F494259

General Info

Members Datasets Scaffolds Average Seq Length
1478 589 2956 245

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606379|2808939683
Length 288
Sequence PLNSVGEAVSARQERAKKRSLPALNEHSEPVLNAAMATQVAFQGLHKPCAVIPVYNHEQALAQVVQALRASGWPCVLVDDGSHPGCARVIEQVVAQTASHLLRLPSNQGKGGAVMAGLREAARLGYSHALQVDADGQHDLDNLGDFLAASQAHPQALICGYPRYDASVPKSRLYARYLTHVWVWINSLSLHIRDSMCGFRIYPLTPTLALLDTVTIGKRMDFDTDILVRLSWRNQPMRWLPVRVHYPADGVSHFRLLEDNLLISRMHARLFFGMLWRAPQLLWRRWRG

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
82 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
98 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
143 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
155 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
156 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
157 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
158 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
180 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
181 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
185 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
186 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
187 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
188 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
189 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
190 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
191 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
192 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
193 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
194 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
195 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
196 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
197 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
198 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
199 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
200 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
201 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
202 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
203 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
204 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
205 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
206 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
207 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
208 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
209 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
210 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
211 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
212 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
213 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
214 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
215 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
218 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
222 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
225 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
242 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
246 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
247 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
248 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
249 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
250 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
251 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
252 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
253 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
257 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
260 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
261 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
268 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
269 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
276 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
277 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
278 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
279 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
280 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
281 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
282 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
283 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
284 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
285 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
286 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
287 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
288 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
289 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
290 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
291 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
292 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
293 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
294 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
295 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
298 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
299 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
300 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
306 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
307 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
310 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
311 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
312 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
313 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
314 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
315 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
316 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
317 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
318 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
326 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
327 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
328 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
329 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
330 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
331 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
332 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
333 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
337 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
338 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
344 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
345 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
346 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
347 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
348 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
349 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
350 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
351 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
352 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
353 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
354 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
355 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
356 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
357 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
358 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
359 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
360 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
361 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
362 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
363 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
364 2511231004 Pseudomonas sp. GM102 Isolate Nodule
365 2511231006 Pseudomonas sp. GM17 Isolate Nodule
366 2511231008 Pseudomonas sp. GM21 Isolate Nodule
367 2511231010 Pseudomonas sp. GM25 Isolate Nodule
368 2511231011 Pseudomonas sp. GM30 Isolate Nodule
369 2511231012 Pseudomonas sp. GM33 Isolate Nodule
370 2511231014 Pseudomonas sp. GM48 Isolate Nodule
371 2511231015 Pseudomonas sp. GM49 Isolate Nodule
372 2511231016 Pseudomonas sp. GM50 Isolate Nodule
373 2511231017 Pseudomonas sp. GM55 Isolate Nodule
374 2511231018 Pseudomonas sp. GM60 Isolate Nodule
375 2511231020 Pseudomonas sp. GM74 Isolate Nodule
376 2511231021 Pseudomonas sp. GM78 Isolate Nodule
377 2511231022 Pseudomonas sp. GM79 Isolate Nodule
378 2511231023 Pseudomonas sp. GM80 Isolate Nodule
379 2511231031 Pseudomonas sp. GM16 Isolate Nodule
380 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
381 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
382 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
383 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
384 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
385 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
386 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
387 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
388 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
389 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
390 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
391 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
392 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
393 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
394 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
395 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
396 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
397 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
398 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
399 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
400 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
401 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
402 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
403 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
404 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
405 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
406 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
407 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
408 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
409 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
410 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
411 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
412 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
413 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
414 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
415 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
416 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
417 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
418 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
419 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
420 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
421 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
422 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
423 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
424 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
425 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
426 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
427 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
428 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
429 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
430 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
431 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
432 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
433 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
434 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
435 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
436 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
437 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
438 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
439 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
440 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
441 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
442 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
443 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
444 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
445 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
446 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
447 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
448 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
449 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
450 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
451 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
452 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
453 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
454 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
455 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
456 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
457 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
458 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
459 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
460 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
461 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
462 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
463 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
464 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
465 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
466 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
467 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
468 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
469 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
470 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
471 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
472 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
473 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
474 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
475 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
476 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
477 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
478 2773857670 Pseudomonas sp. 478 Isolate Unclassified
479 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
480 2773857673 Pseudomonas sp. 443 Isolate Unclassified
481 2784132063 Pseudomonas sp. 424 Isolate Unclassified
482 2784132072 Pseudomonas sp. 460 Isolate Unclassified
483 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
484 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
485 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
486 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
487 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
488 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
489 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
490 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
491 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
492 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
493 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
494 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
495 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
496 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
497 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
498 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
499 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
500 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
501 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
502 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
503 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
504 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
505 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
506 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
507 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
508 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
509 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
510 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
511 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
512 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
513 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
514 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
515 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
516 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
517 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
518 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
519 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
520 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
521 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
522 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
523 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
524 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
525 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
526 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
527 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
528 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
529 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
530 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
531 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
532 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
533 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
534 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
535 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
536 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
537 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
538 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
539 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
540 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
541 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
542 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
543 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
544 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
545 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
546 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
547 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
548 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
549 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
550 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
551 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
552 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
553 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
554 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
555 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
556 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
557 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
558 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
559 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
560 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
561 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
562 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
563 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
564 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
565 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
566 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
567 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
568 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
569 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
570 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
571 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
572 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
573 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
574 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
575 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
576 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
577 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
578 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
579 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
580 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
581 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
582 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
583 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
584 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
585 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
586 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
587 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
588 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
589 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.44
Metatranscriptomes 0
Isolates 15.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 5.55
Nodule 1.56
Rhizoplane 5.01
Rhizosphere 78.28
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_10320 2124908027 Bacteria 1437
2 MRS2a_Contig_66 2124908027 Bacteria 22945
3 SwRhRL2b_contig_1197704 2162886007 Bacteria 1199
4 JGI24741J21665_1006033 3300001915 Bacteria 2470
5 JGI25162J39368_1000140 3300002737 Bacteria 78251
6 JGI25162J39368_1000181 3300002737 Bacteria 67817
7 JGI25154J39366_1003720 3300002738 Bacteria 3050
8 JGI25163J39215_1000195 3300002771 Bacteria 23525
9 JGI25163J39215_1000288 3300002771 Bacteria 17349
10 JGI25164J39214_1000110 3300002772 Bacteria 78251
11 JGI25164J39214_1000146 3300002772 Bacteria 67817
12 JGI25406J46586_10003703 3300003203 Bacteria 7163
13 JGI25165J46597_1000228 3300003214 Bacteria 78251
14 JGI25165J46597_1000267 3300003214 Bacteria 67817
15 rootH1_10143248 3300003323 Bacteria 2492
16 Ga0055538_1000037 3300003751 Bacteria 190238
17 Ga0055539_1000048 3300003752 Bacteria 190238
18 Ga0055533_1000059 3300003756 Bacteria 190238
19 Ga0055532_1000105 3300003758 Bacteria 91428
20 Ga0055525_1000057 3300003759 Bacteria 211185
21 Ga0055525_1000128 3300003759 Bacteria 113553
22 Ga0055535_1006635 3300003761 Bacteria 2315
23 Ga0055526_1000962 3300003771 Bacteria 21277
24 Ga0055536_1000328 3300003781 Bacteria 35005
25 Ga0055536_1000392 3300003781 Bacteria 31780
26 Ga0055536_1000624 3300003781 Bacteria 24057
27 Ga0055536_1039737 3300003781 Bacteria 1127
28 Ga0055530_10000098 3300003791 Bacteria 73644
29 Ga0055530_10000333 3300003791 Bacteria 42485
30 Ga0055530_10002459 3300003791 Bacteria 11881
31 Ga0055540_1000138 3300003792 Bacteria 73170
32 Ga0055540_1000279 3300003792 Bacteria 45880
33 Ga0055540_1000586 3300003792 Bacteria 26511
34 Ga0055531_10000321 3300003794 Bacteria 47157
35 Ga0055541_1000035 3300003841 Bacteria 190238
36 Ga0065714_10002325 3300005288 Bacteria 36328
37 Ga0065714_10065492 3300005288 Bacteria 9763
38 Ga0065714_10072189 3300005288 Bacteria 3411
39 Ga0065714_10103225 3300005288 Bacteria 1607
40 Ga0065714_10165111 3300005288 Bacteria 1031
41 Ga0065704_10013597 3300005289 Bacteria 1490
42 Ga0065704_10038164 3300005289 Bacteria 1110
43 Ga0065704_10078436 3300005289 Bacteria 4426
44 Ga0065715_10109483 3300005293 Bacteria 2666
45 Ga0070676_10046631 3300005328 Bacteria 2528
46 Ga0070690_100003509 3300005330 Bacteria 8582
47 Ga0070670_100002909 3300005331 Bacteria 14174
48 Ga0070670_100020308 3300005331 Bacteria 5708
49 Ga0070670_100069743 3300005331 Bacteria 3018
50 Ga0068868_100596275 3300005338 Bacteria 978
51 Ga0070689_100001983 3300005340 Bacteria 13250
52 Ga0070689_100070459 3300005340 Bacteria 2730
53 Ga0070661_100000078 3300005344 Bacteria 77449
54 Ga0070669_100000221 3300005353 Bacteria 47408
55 Ga0070675_100107876 3300005354 Bacteria 2352
56 Ga0070674_100178907 3300005356 Bacteria 1623
57 Ga0070674_100677088 3300005356 Bacteria 879
58 Ga0070688_100009229 3300005365 Bacteria 5384
59 Ga0070688_100050324 3300005365 Bacteria 2595
60 Ga0070701_10009191 3300005438 Bacteria 4320
61 Ga0070705_100006396 3300005440 Bacteria 5774
62 Ga0070700_100057629 3300005441 Bacteria 2438
63 Ga0070662_100000095 3300005457 Bacteria 48526
64 Ga0070662_100010823 3300005457 Bacteria 6005
65 Ga0070685_10127159 3300005466 Bacteria 1589
66 Ga0070698_100061858 3300005471 Bacteria 3778
67 Ga0068853_100000089 3300005539 Bacteria 62291
68 Ga0070672_100092797 3300005543 Bacteria 2438
69 Ga0070672_100109191 3300005543 Bacteria 2253
70 Ga0070672_100311912 3300005543 Bacteria 1336
71 Ga0070686_100014835 3300005544 Bacteria 4498
72 Ga0070696_100166990 3300005546 Bacteria 1625
73 Ga0070693_100098972 3300005547 Bacteria 1773
74 Ga0070665_100002013 3300005548 Bacteria 22856
75 Ga0070665_100006705 3300005548 Bacteria 11705
76 Ga0070704_100058517 3300005549 Bacteria 2746
77 Ga0068855_100667255 3300005563 Bacteria 1115
78 Ga0070664_100000391 3300005564 Bacteria 32645
79 Ga0070664_100052654 3300005564 Bacteria 3448
80 Ga0068854_100001775 3300005578 Bacteria 13130
81 Ga0070702_100001974 3300005615 Bacteria 8636
82 Ga0068859_100013045 3300005617 Bacteria 8351
83 Ga0068859_100080101 3300005617 Bacteria 3306
84 Ga0068859_100131788 3300005617 Bacteria 2572
85 Ga0068861_100002242 3300005719 Bacteria 12547
86 Ga0068861_100069542 3300005719 Bacteria 2724
87 Ga0068861_100071415 3300005719 Bacteria 2691
88 Ga0068861_100278312 3300005719 Bacteria 1440
89 Ga0068861_100558330 3300005719 Bacteria 1044
90 Ga0068851_10000024 3300005834 Bacteria 125917
91 Ga0068870_10245072 3300005840 Bacteria 1108
92 Ga0068863_100277144 3300005841 Bacteria 1624
93 Ga0068863_100321199 3300005841 Bacteria 1504
94 Ga0068858_100012305 3300005842 Bacteria 8069
95 Ga0068860_100026372 3300005843 Bacteria 5602
96 Ga0068862_100009441 3300005844 Bacteria 8070
97 Ga0068862_100045897 3300005844 Bacteria 3729
98 Ga0068862_100094782 3300005844 Bacteria 2603
99 Ga0081455_10000032 3300005937 Bacteria 146266
100 Ga0081539_10000007 3300005985 Bacteria 532790
101 Ga0075364_10100175 3300006051 Bacteria 1929
102 Ga0075364_10116716 3300006051 Bacteria 1785
103 Ga0075364_10272890 3300006051 Bacteria 1150
104 Ga0075432_10000629 3300006058 Bacteria 10741
105 Ga0075432_10013530 3300006058 Bacteria 2772
106 Ga0075432_10029736 3300006058 Bacteria 1887
107 Ga0075432_10040005 3300006058 Bacteria 1636
108 Ga0075432_10048055 3300006058 Bacteria 1500
109 Ga0075432_10065001 3300006058 Bacteria 1303
110 Ga0097621_100109048 3300006237 Bacteria 2338
111 Ga0097621_100186931 3300006237 Bacteria 1792
112 Ga0068871_100053807 3300006358 Bacteria 3264
113 Ga0068871_100229118 3300006358 Bacteria 1612
114 Ga0068871_100284365 3300006358 Bacteria 1448
115 Ga0068871_100656965 3300006358 Bacteria 958
116 Ga0075428_100429130 3300006844 Bacteria 1416
117 Ga0075436_100116729 3300006914 Bacteria 1865
118 Ga0075436_100152520 3300006914 Bacteria 1626
119 Ga0097620_100013045 3300006931 Bacteria 8351
120 Ga0097620_100080104 3300006931 Bacteria 3306
121 Ga0097620_100131790 3300006931 Bacteria 2572
122 Ga0079104_1000229 3300006946 Bacteria 75907
123 Ga0079104_1000296 3300006946 Bacteria 63123
124 Ga0079104_1014254 3300006946 Bacteria 2405
125 Ga0105251_10000113 3300009011 Bacteria 80570
126 Ga0105251_10000303 3300009011 Bacteria 49448
127 Ga0105251_10000361 3300009011 Bacteria 44718
128 Ga0105251_10001591 3300009011 Bacteria 19391
129 Ga0105251_10005307 3300009011 Bacteria 8476
130 Ga0105251_10007332 3300009011 Bacteria 6821
131 Ga0105251_10011289 3300009011 Bacteria 5111
132 Ga0105251_10014426 3300009011 Bacteria 4367
133 Ga0105251_10017751 3300009011 Bacteria 3804
134 Ga0105251_10081785 3300009011 Bacteria 1492
135 Ga0105244_10000982 3300009036 Bacteria 23922
136 Ga0105244_10001234 3300009036 Bacteria 20974
137 Ga0105244_10005115 3300009036 Bacteria 8803
138 Ga0105244_10006072 3300009036 Bacteria 7902
139 Ga0105244_10007513 3300009036 Bacteria 6920
140 Ga0105244_10008576 3300009036 Bacteria 6375
141 Ga0105244_10046052 3300009036 Bacteria 2242
142 Ga0105244_10112754 3300009036 Bacteria 1321
143 Ga0105244_10148006 3300009036 Bacteria 1126
144 Ga0105250_10000189 3300009092 Bacteria 52791
145 Ga0105250_10000211 3300009092 Bacteria 48658
146 Ga0105250_10002092 3300009092 Bacteria 10238
147 Ga0105250_10009368 3300009092 Bacteria 4127
148 Ga0105250_10029541 3300009092 Bacteria 2205
149 Ga0105250_10034565 3300009092 Bacteria 2028
150 Ga0105250_10049723 3300009092 Bacteria 1682
151 Ga0111539_10084056 3300009094 Bacteria 3743
152 Ga0105243_10000370 3300009148 Bacteria 48223
153 Ga0105243_10000595 3300009148 Bacteria 36195
154 Ga0105243_10008730 3300009148 Bacteria 7767
155 Ga0105243_10009526 3300009148 Bacteria 7394
156 Ga0105243_10047309 3300009148 Bacteria 3386
157 Ga0105243_10093187 3300009148 Bacteria 2485
158 Ga0105243_10116421 3300009148 Bacteria 2245
159 Ga0105242_10000136 3300009176 Bacteria 53348
160 Ga0105242_10093581 3300009176 Bacteria 2534
161 Ga0105248_10004445 3300009177 Bacteria 15525
162 Ga0105248_10626155 3300009177 Bacteria 1214
163 Ga0105237_10000939 3300009545 Bacteria 39181
164 Ga0105249_10539819 3300009553 Bacteria 1216
165 Ga0105249_10715742 3300009553 Bacteria 1062
166 Ga0105246_10000042 3300011119 Bacteria 48091
167 Ga0105246_10002498 3300011119 Bacteria 11121
168 Ga0105246_10068492 3300011119 Bacteria 2489
169 Ga0157336_1001109 3300012477 Bacteria 1345
170 Ga0157345_1000068 3300012498 Bacteria 21372
171 Ga0157373_10000993 3300013100 Bacteria 21947
172 Ga0157373_10005678 3300013100 Bacteria 9347
173 Ga0157373_10016864 3300013100 Bacteria 5326
174 Ga0157373_10024956 3300013100 Bacteria 4328
175 Ga0157373_10052818 3300013100 Bacteria 2890
176 Ga0157373_10074581 3300013100 Bacteria 2393
177 Ga0157373_10113151 3300013100 Bacteria 1907
178 Ga0157373_10195597 3300013100 Bacteria 1425
179 Ga0157371_10000811 3300013102 Bacteria 35895
180 Ga0157371_10001369 3300013102 Bacteria 25570
181 Ga0157371_10011701 3300013102 Bacteria 6742
182 Ga0157371_10034037 3300013102 Bacteria 3658
183 Ga0157370_10000150 3300013104 Bacteria 85732
184 Ga0157370_10011272 3300013104 Bacteria 9372
185 Ga0157370_10016274 3300013104 Bacteria 7535
186 Ga0157370_10050485 3300013104 Bacteria 3976
187 Ga0157370_10068628 3300013104 Bacteria 3350
188 Ga0157370_10078398 3300013104 Bacteria 3111
189 Ga0157370_10129827 3300013104 Bacteria 2351
190 Ga0157370_10308096 3300013104 Bacteria 1461
191 Ga0157370_10379630 3300013104 Bacteria 1302
192 Ga0157369_10001261 3300013105 Bacteria 31458
193 Ga0157369_10001555 3300013105 Bacteria 28080
194 Ga0157369_10015276 3300013105 Bacteria 8658
195 Ga0157369_10038743 3300013105 Bacteria 5211
196 Ga0157369_10411589 3300013105 Bacteria 1402
197 Ga0163162_10071200 3300013306 Bacteria 3530
198 Ga0157372_10001525 3300013307 Bacteria 25180
199 Ga0157372_10008414 3300013307 Bacteria 10959
200 Ga0157372_10712478 3300013307 Bacteria 1168
201 Ga0157375_10001875 3300013308 Bacteria 18102
202 Ga0157375_10008094 3300013308 Bacteria 9196
203 Ga0157375_10087456 3300013308 Bacteria 3169
204 Ga0157375_10255579 3300013308 Bacteria 1913
205 Ga0157380_10008871 3300014326 Bacteria 7184
206 Ga0182008_10001166 3300014497 Bacteria 18127
207 Ga0182008_10002891 3300014497 Bacteria 10628
208 Ga0182008_10003251 3300014497 Bacteria 9914
209 Ga0182008_10004481 3300014497 Bacteria 8162
210 Ga0182008_10013634 3300014497 Bacteria 4271
211 Ga0182008_10014614 3300014497 Bacteria 4106
212 Ga0182008_10019620 3300014497 Bacteria 3488
213 Ga0182008_10027535 3300014497 Bacteria 2878
214 Ga0182008_10034067 3300014497 Bacteria 2554
215 Ga0157376_10560650 3300014969 Unclassified 1132
216 Ga0157376_10953193 3300014969 Bacteria 879
217 Ga0182006_1000380 3300015261 Bacteria 36760
218 Ga0182006_1000786 3300015261 Bacteria 21399
219 Ga0182006_1005806 3300015261 Bacteria 5818
220 Ga0182006_1034120 3300015261 Bacteria 2037
221 Ga0182006_1056815 3300015261 Bacteria 1489
222 Ga0182007_10000194 3300015262 Bacteria 40895
223 Ga0182007_10012110 3300015262 Bacteria 3329
224 Ga0182005_1000459 3300015265 Bacteria 21396
225 Ga0182005_1001444 3300015265 Bacteria 9571
226 Ga0182005_1018415 3300015265 Bacteria 1930
227 Ga0182005_1019329 3300015265 Bacteria 1878
228 Ga0182005_1028515 3300015265 Bacteria 1522
229 Ga0163161_10000719 3300017792 Bacteria 26142
230 Ga0163161_10001156 3300017792 Bacteria 19877
231 Ga0163161_10007778 3300017792 Bacteria 7414
232 Ga0163161_10021521 3300017792 Bacteria 4531
233 Ga0163161_10043618 3300017792 Bacteria 3230
234 Ga0163161_10073199 3300017792 Bacteria 2510
235 Ga0163161_10077387 3300017792 Bacteria 2443
236 Ga0163161_10111594 3300017792 Bacteria 2044
237 Ga0163161_10235862 3300017792 Bacteria 1421
238 Ga0163161_10244225 3300017792 Bacteria 1397
239 Ga0209435_101197 3300025206 Bacteria 3493
240 Ga0209760_100037 3300025207 Bacteria 129761
241 Ga0209760_100128 3300025207 Bacteria 50562
242 Ga0209784_100028 3300025224 Bacteria 357464
243 Ga0209566_100028 3300025225 Bacteria 357464
244 Ga0209674_100047 3300025226 Bacteria 357464
245 Ga0209147_100031 3300025229 Bacteria 357464
246 Ga0209563_100014 3300025230 Bacteria 940582
247 Ga0209563_100050 3300025230 Bacteria 357464
248 Ga0209563_103308 3300025230 Bacteria 3369
249 Ga0207427_100014 3300025231 Bacteria 561361
250 Ga0207427_100016 3300025231 Bacteria 538697
251 Ga0209437_100011 3300025233 Bacteria 818520
252 Ga0209437_100016 3300025233 Bacteria 710118
253 Ga0209258_100150 3300025242 Bacteria 161813
254 Ga0209646_1000183 3300025246 Bacteria 79021
255 Ga0209677_100029 3300025253 Bacteria 357464
256 Ga0209759_1004821 3300025256 Bacteria 4907
257 Ga0209233_1000019 3300025261 Bacteria 818520
258 Ga0209233_1000036 3300025261 Bacteria 561361
259 Ga0209565_1007315 3300025263 Bacteria 2991
260 Ga0209675_1002235 3300025291 Bacteria 10113
261 Ga0209676_1000025 3300025292 Bacteria 577569
262 Ga0209676_1000032 3300025292 Bacteria 469558
263 Ga0209676_1000318 3300025292 Bacteria 94045
264 Ga0209676_1005098 3300025292 Bacteria 7010
265 Ga0209676_1008035 3300025292 Bacteria 4800
266 Ga0209025_1006155 3300025294 Bacteria 9439
267 Ga0209564_1000404 3300025295 Bacteria 76827
268 Ga0209050_1000025 3300025298 Bacteria 528225
269 Ga0209050_1000028 3300025298 Bacteria 477133
270 Ga0209050_1000520 3300025298 Bacteria 64262
271 Ga0209051_1000026 3300025303 Bacteria 413311
272 Ga0209051_1000080 3300025303 Bacteria 199694
273 Ga0209051_1000334 3300025303 Bacteria 70713
274 Ga0209051_1005483 3300025303 Bacteria 7402
275 Ga0209257_1000034 3300025304 Bacteria 662719
276 Ga0207656_10000007 3300025321 Bacteria 289154
277 Ga0207696_1000020 3300025711 Bacteria 434998
278 Ga0207696_1000057 3300025711 Bacteria 249404
279 Ga0207696_1000084 3300025711 Bacteria 196086
280 Ga0207696_1001201 3300025711 Bacteria 14759
281 Ga0207696_1002125 3300025711 Bacteria 9949
282 Ga0207696_1003512 3300025711 Bacteria 7091
283 Ga0207696_1009400 3300025711 Bacteria 3648
284 Ga0207696_1017377 3300025711 Bacteria 2383
285 Ga0207696_1051295 3300025711 Bacteria 1179
286 Ga0207655_1000014 3300025728 Bacteria 607124
287 Ga0207655_1000326 3300025728 Bacteria 70089
288 Ga0207655_1000405 3300025728 Bacteria 59516
289 Ga0207655_1000935 3300025728 Bacteria 30300
290 Ga0207655_1001697 3300025728 Bacteria 19386
291 Ga0207655_1002391 3300025728 Bacteria 15301
292 Ga0207655_1002603 3300025728 Bacteria 14351
293 Ga0207655_1011916 3300025728 Bacteria 5130
294 Ga0207655_1012601 3300025728 Bacteria 4927
295 Ga0207655_1014811 3300025728 Bacteria 4378
296 Ga0207655_1014841 3300025728 Bacteria 4372
297 Ga0207655_1015764 3300025728 Bacteria 4179
298 Ga0207655_1028886 3300025728 Bacteria 2607
299 Ga0207655_1057498 3300025728 Bacteria 1527
300 Ga0207713_1000031 3300025735 Bacteria 283971
301 Ga0207713_1000114 3300025735 Bacteria 132170
302 Ga0207713_1000331 3300025735 Bacteria 53100
303 Ga0207713_1000434 3300025735 Bacteria 44039
304 Ga0207713_1000632 3300025735 Bacteria 34264
305 Ga0207713_1002064 3300025735 Bacteria 15016
306 Ga0207713_1002309 3300025735 Bacteria 14016
307 Ga0207713_1006008 3300025735 Bacteria 7485
308 Ga0207713_1006316 3300025735 Bacteria 7234
309 Ga0207713_1007038 3300025735 Bacteria 6739
310 Ga0207713_1012006 3300025735 Bacteria 4663
311 Ga0207713_1030078 3300025735 Bacteria 2421
312 Ga0207713_1033592 3300025735 Bacteria 2239
313 Ga0207713_1074606 3300025735 Bacteria 1240
314 Ga0207713_1103890 3300025735 Bacteria 976
315 Ga0207671_10000015 3300025914 Bacteria 439607
316 Ga0207662_10104786 3300025918 Bacteria 1757
317 Ga0207649_10000001 3300025920 Bacteria 537851
318 Ga0207681_10000236 3300025923 Bacteria 42706
319 Ga0207681_10001050 3300025923 Bacteria 17915
320 Ga0207681_10525981 3300025923 Bacteria 971
321 Ga0207681_10677290 3300025923 Bacteria 856
322 Ga0207650_10000273 3300025925 Bacteria 54321
323 Ga0207650_10000449 3300025925 Bacteria 35040
324 Ga0207659_10104894 3300025926 Bacteria 2138
325 Ga0207706_10000069 3300025933 Bacteria 105541
326 Ga0207706_10013926 3300025933 Bacteria 7293
327 Ga0207706_10410594 3300025933 Bacteria 1173
328 Ga0207709_10000022 3300025935 Bacteria 383573
329 Ga0207709_10000164 3300025935 Bacteria 91154
330 Ga0207709_10010709 3300025935 Bacteria 5051
331 Ga0207709_10077411 3300025935 Bacteria 2132
332 Ga0207709_10078174 3300025935 Bacteria 2123
333 Ga0207670_10010276 3300025936 Bacteria 5383
334 Ga0207669_10147465 3300025937 Bacteria 1643
335 Ga0207691_10026578 3300025940 Bacteria 5431
336 Ga0207691_10128220 3300025940 Bacteria 2243
337 Ga0207691_10623484 3300025940 Bacteria 912
338 Ga0207711_10014431 3300025941 Bacteria 6563
339 Ga0207679_10000011 3300025945 Bacteria 346112
340 Ga0207703_10011669 3300026035 Bacteria 6834
341 Ga0207639_10023432 3300026041 Bacteria 4458
342 Ga0207708_10034391 3300026075 Bacteria 3855
343 Ga0207708_10057759 3300026075 Bacteria 2961
344 Ga0207708_10102846 3300026075 Bacteria 2212
345 Ga0207641_10119088 3300026088 Bacteria 2353
346 Ga0207641_10406824 3300026088 Bacteria 1308
347 Ga0207674_10413057 3300026116 Bacteria 1304
348 Ga0207675_100004771 3300026118 Bacteria 13062
349 Ga0207675_100007621 3300026118 Bacteria 10227
350 Ga0207675_100023697 3300026118 Bacteria 5710
351 Ga0207675_100029914 3300026118 Bacteria 5070
352 Ga0207675_100244202 3300026118 Bacteria 1736
353 Ga0209281_1000026 3300027111 Bacteria 465877
354 Ga0209281_1000033 3300027111 Bacteria 383539
355 Ga0209281_1009328 3300027111 Bacteria 2311
356 Ga0209371_1000032 3300027312 Bacteria 392355
357 Ga0209981_1011805 3300027378 Bacteria 1206
358 Ga0209996_1002457 3300027395 Bacteria 2295
359 Ga0209983_1003440 3300027665 Bacteria 3384
360 Ga0209974_10007010 3300027876 Bacteria 3901
361 Ga0207428_10007376 3300027907 Bacteria 10027
362 Ga0207428_10041406 3300027907 Bacteria 3730
363 Ga0207428_10065960 3300027907 Bacteria 2853
364 Ga0207428_10069517 3300027907 Bacteria 2769
365 Ga0207428_10084031 3300027907 Bacteria 2482
366 Ga0207428_10108265 3300027907 Bacteria 2141
367 Ga0207428_10352605 3300027907 Bacteria 1082
368 Ga0207428_10389380 3300027907 Bacteria 1022
369 Ga0268266_10008655 3300028379 Bacteria 9035
370 Ga0268266_10016958 3300028379 Bacteria 6222
371 Ga0268266_10075777 3300028379 Bacteria 2922
372 Ga0268265_10009890 3300028380 Bacteria 6444
373 Ga0268265_10206842 3300028380 Bacteria 1707
374 Ga0268265_10245341 3300028380 Bacteria 1583
375 Ga0268264_10141180 3300028381 Bacteria 2148
376 Ga0307517_10133349 3300028786 Bacteria 1777
377 Ga0307515_10016964 3300028794 Bacteria 13306
378 Ga0268256_1000050 3300030500 Bacteria 300675
379 Ga0307511_10014728 3300030521 Bacteria 7603
380 Ga0316178_1048724 3300030735 Bacteria 10017
381 Ga0316183_1029617 3300030742 Bacteria 6544
382 Ga0316183_1184413 3300030742 Bacteria 1082
383 Ga0316181_1024278 3300030744 Bacteria 4987
384 Ga0265327_10001649 3300031251 Bacteria 26951
385 Ga0265316_10148182 3300031344 Bacteria 1759
386 Ga0307513_10053426 3300031456 Bacteria 4343
387 Ga0307509_10222467 3300031507 Bacteria 1699
388 Ga0307509_10272830 3300031507 Unclassified 1458
389 Ga0307408_100014933 3300031548 Bacteria 5167
390 Ga0307408_100021630 3300031548 Bacteria 4356
391 Ga0307408_100034758 3300031548 Bacteria 3532
392 Ga0307408_100034944 3300031548 Bacteria 3524
393 Ga0307408_100073881 3300031548 Bacteria 2528
394 Ga0307408_100075564 3300031548 Bacteria 2503
395 Ga0307516_10105266 3300031730 Bacteria 2633
396 Ga0307516_10179454 3300031730 Bacteria 1852
397 Ga0307516_10291965 3300031730 Bacteria 1309
398 Ga0307405_10007090 3300031731 Bacteria 5572
399 Ga0307405_10010676 3300031731 Bacteria 4775
400 Ga0307405_10011939 3300031731 Bacteria 4575
401 Ga0307405_10029697 3300031731 Bacteria 3197
402 Ga0307405_10349092 3300031731 Bacteria 1140
403 Ga0307413_10009019 3300031824 Bacteria 4748
404 Ga0307413_10019490 3300031824 Bacteria 3586
405 Ga0307410_10013906 3300031852 Bacteria 4714
406 Ga0307406_10008889 3300031901 Bacteria 5614
407 Ga0307406_10009078 3300031901 Bacteria 5563
408 Ga0307406_10193333 3300031901 Bacteria 1491
409 Ga0307407_10002874 3300031903 Bacteria 6881
410 Ga0307407_10029144 3300031903 Bacteria 2961
411 Ga0307407_10165174 3300031903 Bacteria 1452
412 Ga0307412_10010789 3300031911 Bacteria 5272
413 Ga0307412_10017244 3300031911 Bacteria 4319
414 Ga0307412_10023342 3300031911 Bacteria 3804
415 Ga0307412_10024787 3300031911 Bacteria 3706
416 Ga0307412_10025054 3300031911 Bacteria 3689
417 Ga0307412_10052050 3300031911 Bacteria 2709
418 Ga0307412_10111954 3300031911 Bacteria 1950
419 Ga0307412_10134546 3300031911 Bacteria 1801
420 Ga0307412_10606942 3300031911 Bacteria 927
421 Ga0307409_100019513 3300031995 Bacteria 4593
422 Ga0307409_100032810 3300031995 Bacteria 3771
423 Ga0307409_100054467 3300031995 Bacteria 3081
424 Ga0307409_100056815 3300031995 Bacteria 3028
425 Ga0307409_100244804 3300031995 Unclassified 1635
426 Ga0307416_100076005 3300032002 Bacteria 2813
427 Ga0307416_100085446 3300032002 Bacteria 2685
428 Ga0307416_100316403 3300032002 Bacteria 1560
429 Ga0307416_100450157 3300032002 Bacteria 1340
430 Ga0307414_10133960 3300032004 Bacteria 1928
431 Ga0307414_10140282 3300032004 Bacteria 1891
432 Ga0307411_10010859 3300032005 Bacteria 4880
433 Ga0307411_10074591 3300032005 Bacteria 2312
434 Ga0307411_10137126 3300032005 Bacteria 1798
435 Ga0307411_10667955 3300032005 Bacteria 901
436 Ga0307510_10001604 3300033180 Bacteria 25008
437 Ga0373923_0183272 3300035111 Bacteria 963
438 Ga0237819_04383 3300038705 Bacteria 2329
439 Ga0436363_0203368 3300039450 Bacteria 1581
440 Ga0439438_001683 3300041405 Bacteria 9722
441 Ga0439438_005049 3300041405 Bacteria 4921
442 Ga0439438_005227 3300041405 Bacteria 4814
443 Ga0439438_005882 3300041405 Bacteria 4437
444 Ga0439438_005955 3300041405 Bacteria 4401
445 Ga0439438_014519 3300041405 Bacteria 2342
446 Ga0439438_015502 3300041405 Bacteria 2241
447 Ga0439447_000222 3300041407 Bacteria 20061
448 Ga0439447_001542 3300041407 Bacteria 8416
449 Ga0439447_003263 3300041407 Bacteria 5769
450 Ga0439447_003378 3300041407 Bacteria 5675
451 Ga0439447_003431 3300041407 Bacteria 5637
452 Ga0439447_011142 3300041407 Bacteria 2637
453 Ga0439447_018200 3300041407 Bacteria 1899
454 Ga0439466_0000445 3300041411 Bacteria 15779
455 Ga0439466_0000766 3300041411 Bacteria 12159
456 Ga0439466_0008181 3300041411 Bacteria 3942
457 Ga0439466_0009972 3300041411 Bacteria 3534
458 Ga0439466_0011547 3300041411 Bacteria 3265
459 Ga0439466_0013302 3300041411 Bacteria 3012
460 Ga0439466_0018228 3300041411 Bacteria 2520
461 Ga0439466_0021229 3300041411 Bacteria 2305
462 Ga0439465_0013323 3300041413 Bacteria 2566
463 Ga0439465_0100107 3300041413 Bacteria 1000
464 Ga0451853_3896997 3300041512 Bacteria 1200
465 Ga0439431_0020609 3300041997 Bacteria 1576
466 Ga0439445_0054975 3300042004 Bacteria 1080
467 Ga0439432_000366 3300042006 Bacteria 16615
468 Ga0439432_001336 3300042006 Bacteria 9343
469 Ga0439432_010223 3300042006 Bacteria 3255
470 Ga0439432_012452 3300042006 Bacteria 2910
471 Ga0439451_006406 3300042009 Bacteria 2407
472 Ga0439451_011242 3300042009 Bacteria 1805
473 Ga0439451_015805 3300042009 Bacteria 1521
474 Ga0439451_018930 3300042009 Bacteria 1389
475 Ga0439451_022004 3300042009 Bacteria 1285
476 Ga0439451_030594 3300042009 Bacteria 1082
477 Ga0439451_032477 3300042009 Bacteria 1050
478 Ga0439452_000231 3300042010 Bacteria 38808
479 Ga0439452_000245 3300042010 Bacteria 37540
480 Ga0439452_000971 3300042010 Bacteria 12881
481 Ga0439452_002718 3300042010 Bacteria 6415
482 Ga0439452_004643 3300042010 Bacteria 4559
483 Ga0439452_004857 3300042010 Bacteria 4414
484 Ga0439452_006314 3300042010 Bacteria 3721
485 Ga0439452_010184 3300042010 Bacteria 2745
486 Ga0439452_015932 3300042010 Bacteria 2051
487 Ga0439452_052643 3300042010 Bacteria 928
488 Ga0439456_000187 3300042013 Bacteria 17986
489 Ga0439456_000508 3300042013 Bacteria 8359
490 Ga0439456_003564 3300042013 Bacteria 3156
491 Ga0439456_008809 3300042013 Bacteria 2085
492 Ga0439456_011230 3300042013 Bacteria 1850
493 Ga0439456_023882 3300042013 Bacteria 1296
494 Ga0439456_055448 3300042013 Bacteria 868
495 Ga0439463_001159 3300042016 Bacteria 7049
496 Ga0439463_002336 3300042016 Bacteria 4837
497 Ga0439463_006378 3300042016 Bacteria 2928
498 Ga0439463_047433 3300042016 Bacteria 1094
499 Ga0439463_084866 3300042016 Bacteria 815
500 Ga0450911_000018 3300042115 Bacteria 104759
501 Ga0450911_000158 3300042115 Bacteria 27057
502 Ga0450911_002529 3300042115 Bacteria 3555
503 Ga0450911_007040 3300042115 Bacteria 1649
504 Ga0450911_012285 3300042115 Bacteria 1159
505 Ga0450919_002444 3300042121 Bacteria 2405
506 Ga0450919_004450 3300042121 Bacteria 1713
507 Ga0450922_000113 3300042124 Bacteria 7891
508 Ga0450922_001038 3300042124 Bacteria 2790
509 Ga0450922_001749 3300042124 Bacteria 2106
510 Ga0450890_000475 3300042127 Bacteria 5889
511 Ga0450891_006614 3300042129 Bacteria 1066
512 Ga0450892_003838 3300042130 Bacteria 1230
513 Ga0450900_000295 3300042136 Bacteria 3572
514 Ga0450902_000139 3300042137 Bacteria 7985
515 Ga0450902_008053 3300042137 Bacteria 1639
516 Ga0450903_002643 3300042138 Bacteria 3157
517 Ga0450903_002724 3300042138 Bacteria 3109
518 Ga0450903_004552 3300042138 Bacteria 2358
519 Ga0450904_000008 3300042139 Bacteria 47688
520 Ga0450904_001608 3300042139 Bacteria 3064
521 Ga0450905_000046 3300042142 Bacteria 10661
522 Ga0450905_002730 3300042142 Bacteria 2286
523 Ga0450889_002305 3300042144 Bacteria 1911
524 Ga0450906_001941 3300042145 Bacteria 4522
525 Ga0450906_011941 3300042145 Bacteria 1615
526 Ga0450907_000206 3300042146 Bacteria 21277
527 Ga0450907_000510 3300042146 Bacteria 10666
528 Ga0450907_001218 3300042146 Bacteria 5817
529 Ga0450910_000234 3300042147 Bacteria 6325
530 Ga0450910_000702 3300042147 Bacteria 4012
531 Ga0439446_0000057 3300042156 Bacteria 17480
532 Ga0439446_0000824 3300042156 Bacteria 6611
533 Ga0439446_0000915 3300042156 Bacteria 6364
534 Ga0439446_0033009 3300042156 Bacteria 1503
535 Ga0450908_011824 3300042184 Bacteria 1591
536 Ga0450909_000100 3300042185 Bacteria 8467
537 Ga0450909_000593 3300042185 Bacteria 4761
538 Ga0439434_0000122 3300042435 Bacteria 20574
539 Ga0439464_0017338 3300042439 Bacteria 1952
540 Ga0439464_0026938 3300042439 Bacteria 1596
541 Ga0439464_0027223 3300042439 Bacteria 1589
542 Ga0439460_0003104 3300042461 Bacteria 4015
543 Ga0450916_009068 3300042530 Bacteria 1223
544 Ga0450918_001531 3300042531 Bacteria 4561
545 Ga0450893_0028869 3300042532 Bacteria 982
546 Ga0450901_001194 3300042533 Bacteria 3012
547 Ga0451577_0000162 3300042876 Bacteria 145994
548 Ga0439440_0002123 3300042993 Bacteria 3704
549 Ga0439440_0008434 3300042993 Bacteria 2115
550 Ga0439440_0014881 3300042993 Bacteria 1685
551 Ga0439440_0054445 3300042993 Bacteria 1008
552 Ga0466972_0021404 3300044658 Bacteria 3223
553 Ga0453684_0000524 3300044712 Bacteria 146655
554 Ga0453684_0050801 3300044712 Bacteria 5447
555 Ga0451576_0147329 3300045051 Bacteria 2455
556 Ga0495617_000311 3300046452 Bacteria 27369
557 Ga0495617_000760 3300046452 Bacteria 15772
558 Ga0495617_007185 3300046452 Bacteria 3877
559 Ga0495617_009067 3300046452 Bacteria 3420
560 Ga0495617_016180 3300046452 Bacteria 2522
561 Ga0495617_028194 3300046452 Bacteria 1887
562 Ga0495617_034124 3300046452 Bacteria 1707
563 Ga0495617_129684 3300046452 Bacteria 809
564 Ga0495627_000023 3300046453 Bacteria 251113
565 Ga0495627_000535 3300046453 Bacteria 31404
566 Ga0495627_000700 3300046453 Bacteria 25589
567 Ga0495627_001188 3300046453 Bacteria 16475
568 Ga0495627_005424 3300046453 Bacteria 5142
569 Ga0495627_014062 3300046453 Bacteria 2804
570 Ga0495627_016249 3300046453 Bacteria 2552
571 Ga0495627_069507 3300046453 Bacteria 1030
572 Ga0495627_082340 3300046453 Bacteria 931
573 Ga0495603_0002971 3300046455 Bacteria 10026
574 Ga0495603_0029255 3300046455 Bacteria 3322
575 Ga0495603_0365115 3300046455 Bacteria 828
576 Ga0495590_0001147 3300046457 Bacteria 11586
577 Ga0495590_0004906 3300046457 Bacteria 5347
578 Ga0495590_0011769 3300046457 Bacteria 3262
579 Ga0495590_0041213 3300046457 Bacteria 1609
580 Ga0495590_0041675 3300046457 Bacteria 1601
581 Ga0495590_0052602 3300046457 Bacteria 1422
582 Ga0495591_000025 3300046458 Bacteria 189897
583 Ga0495591_000244 3300046458 Bacteria 52389
584 Ga0495591_001000 3300046458 Bacteria 19227
585 Ga0495591_001158 3300046458 Bacteria 17285
586 Ga0495591_003990 3300046458 Bacteria 7394
587 Ga0495591_007521 3300046458 Bacteria 4617
588 Ga0495591_008190 3300046458 Bacteria 4308
589 Ga0495591_008676 3300046458 Bacteria 4134
590 Ga0495591_009244 3300046458 Bacteria 3937
591 Ga0495591_010450 3300046458 Bacteria 3598
592 Ga0495591_010873 3300046458 Bacteria 3486
593 Ga0495591_012410 3300046458 Bacteria 3174
594 Ga0495591_013066 3300046458 Bacteria 3059
595 Ga0495591_013211 3300046458 Bacteria 3034
596 Ga0495591_014014 3300046458 Bacteria 2902
597 Ga0495591_014644 3300046458 Bacteria 2807
598 Ga0495591_016439 3300046458 Bacteria 2575
599 Ga0495629_0012392 3300046459 Bacteria 6174
600 Ga0495638_0003177 3300046460 Bacteria 12989
601 Ga0495638_0013861 3300046460 Bacteria 5469
602 Ga0495638_0018877 3300046460 Bacteria 4570
603 Ga0495638_0027553 3300046460 Bacteria 3677
604 Ga0495638_0035891 3300046460 Bacteria 3158
605 Ga0495638_0040073 3300046460 Bacteria 2969
606 Ga0495638_0040296 3300046460 Bacteria 2960
607 Ga0495638_0040541 3300046460 Bacteria 2950
608 Ga0495638_0054021 3300046460 Bacteria 2498
609 Ga0495638_0074309 3300046460 Bacteria 2073
610 Ga0495638_0126508 3300046460 Bacteria 1505
611 Ga0495638_0206822 3300046460 Bacteria 1104
612 Ga0495638_0262452 3300046460 Bacteria 946
613 Ga0495653_0000549 3300046463 Bacteria 28717
614 Ga0495653_0004108 3300046463 Bacteria 11772
615 Ga0495653_0004448 3300046463 Bacteria 11318
616 Ga0495653_0015276 3300046463 Bacteria 6257
617 Ga0495653_0117752 3300046463 Bacteria 1897
618 Ga0495650_0002476 3300046471 Bacteria 14863
619 Ga0495650_0003286 3300046471 Bacteria 11955
620 Ga0495650_0009444 3300046471 Bacteria 5545
621 Ga0495650_0010158 3300046471 Bacteria 5278
622 Ga0495650_0013860 3300046471 Bacteria 4236
623 Ga0495650_0018671 3300046471 Bacteria 3439
624 Ga0495650_0019017 3300046471 Bacteria 3396
625 Ga0495650_0020043 3300046471 Bacteria 3272
626 Ga0495650_0023131 3300046471 Bacteria 2964
627 Ga0495582_0010897 3300046473 Bacteria 5004
628 Ga0495605_0000095 3300046474 Bacteria 112622
629 Ga0495605_0000311 3300046474 Bacteria 50989
630 Ga0495605_0000328 3300046474 Bacteria 48074
631 Ga0495605_0000673 3300046474 Bacteria 25763
632 Ga0495605_0000878 3300046474 Bacteria 20810
633 Ga0495605_0007893 3300046474 Bacteria 6027
634 Ga0495605_0021899 3300046474 Bacteria 3380
635 Ga0495605_0022174 3300046474 Bacteria 3356
636 Ga0495605_0025515 3300046474 Bacteria 3079
637 Ga0495605_0025781 3300046474 Bacteria 3061
638 Ga0495605_0027744 3300046474 Bacteria 2930
639 Ga0495605_0034292 3300046474 Bacteria 2570
640 Ga0495605_0040001 3300046474 Bacteria 2345
641 Ga0495605_0081534 3300046474 Bacteria 1513
642 Ga0495639_0000238 3300046475 Bacteria 27395
643 Ga0495584_0000695 3300046491 Bacteria 22284
644 Ga0495584_0006560 3300046491 Bacteria 6081
645 Ga0495584_0012343 3300046491 Bacteria 4360
646 Ga0495584_0017637 3300046491 Bacteria 3632
647 Ga0495584_0019778 3300046491 Bacteria 3420
648 Ga0495584_0021080 3300046491 Bacteria 3309
649 Ga0495584_0026726 3300046491 Bacteria 2924
650 Ga0495584_0026880 3300046491 Bacteria 2916
651 Ga0495584_0079689 3300046491 Bacteria 1647
652 Ga0495584_0162024 3300046491 Bacteria 1137
653 Ga0495585_0000279 3300046492 Bacteria 51082
654 Ga0495585_0000790 3300046492 Bacteria 27867
655 Ga0495585_0015485 3300046492 Bacteria 4432
656 Ga0495585_0017325 3300046492 Bacteria 4163
657 Ga0495585_0020619 3300046492 Bacteria 3789
658 Ga0495585_0024730 3300046492 Bacteria 3442
659 Ga0495585_0028586 3300046492 Bacteria 3179
660 Ga0495585_0039605 3300046492 Bacteria 2648
661 Ga0495585_0041367 3300046492 Bacteria 2584
662 Ga0495585_0156740 3300046492 Bacteria 1184
663 Ga0495594_0001648 3300046499 Bacteria 11609
664 Ga0495594_0165561 3300046499 Bacteria 1257
665 Ga0495596_0000273 3300046500 Bacteria 34263
666 Ga0495596_0001654 3300046500 Bacteria 12664
667 Ga0495596_0106960 3300046500 Bacteria 1086
668 Ga0495607_0000298 3300046501 Bacteria 51955
669 Ga0495607_0000347 3300046501 Bacteria 47969
670 Ga0495607_0000776 3300046501 Bacteria 30570
671 Ga0495607_0000926 3300046501 Bacteria 27382
672 Ga0495607_0003337 3300046501 Bacteria 12321
673 Ga0495607_0009192 3300046501 Bacteria 6715
674 Ga0495607_0014199 3300046501 Bacteria 5194
675 Ga0495607_0015965 3300046501 Bacteria 4854
676 Ga0495607_0023469 3300046501 Bacteria 3861
677 Ga0495607_0026083 3300046501 Bacteria 3627
678 Ga0495607_0027199 3300046501 Bacteria 3540
679 Ga0495607_0030508 3300046501 Bacteria 3309
680 Ga0495607_0031519 3300046501 Bacteria 3245
681 Ga0495607_0035276 3300046501 Bacteria 3027
682 Ga0495607_0038582 3300046501 Bacteria 2860
683 Ga0495607_0095932 3300046501 Bacteria 1598
684 Ga0495607_0151695 3300046501 Bacteria 1185
685 Ga0495607_0173334 3300046501 Bacteria 1087
686 Ga0495607_0214045 3300046501 Bacteria 946
687 Ga0495583_0000015 3300046506 Bacteria 316392
688 Ga0495583_0000756 3300046506 Bacteria 41068
689 Ga0495583_0001231 3300046506 Bacteria 27233
690 Ga0495583_0001865 3300046506 Bacteria 19601
691 Ga0495583_0002457 3300046506 Bacteria 15823
692 Ga0495583_0007128 3300046506 Bacteria 7121
693 Ga0495583_0034596 3300046506 Bacteria 2418
694 Ga0495583_0035663 3300046506 Bacteria 2372
695 Ga0495606_0000177 3300046507 Bacteria 112843
696 Ga0495606_0000214 3300046507 Bacteria 103149
697 Ga0495606_0001468 3300046507 Bacteria 31498
698 Ga0495606_0003165 3300046507 Bacteria 17806
699 Ga0495606_0004043 3300046507 Bacteria 14953
700 Ga0495606_0023244 3300046507 Bacteria 4497
701 Ga0495606_0028733 3300046507 Bacteria 3916
702 Ga0495606_0047242 3300046507 Bacteria 2838
703 Ga0495606_0061283 3300046507 Bacteria 2407
704 Ga0495606_0073664 3300046507 Bacteria 2142
705 Ga0495606_0165576 3300046507 Bacteria 1286
706 Ga0495610_0001476 3300046512 Bacteria 20720
707 Ga0495610_0001656 3300046512 Bacteria 19581
708 Ga0495610_0002687 3300046512 Bacteria 14660
709 Ga0495610_0002713 3300046512 Bacteria 14573
710 Ga0495610_0014482 3300046512 Bacteria 4629
711 Ga0495610_0019649 3300046512 Bacteria 3772
712 Ga0495610_0020743 3300046512 Bacteria 3639
713 Ga0495610_0021118 3300046512 Bacteria 3588
714 Ga0495610_0021713 3300046512 Bacteria 3524
715 Ga0495610_0025419 3300046512 Bacteria 3178
716 Ga0495610_0039121 3300046512 Bacteria 2401
717 Ga0495610_0046191 3300046512 Bacteria 2150
718 Ga0495610_0055928 3300046512 Bacteria 1899
719 Ga0495616_0002792 3300046513 Bacteria 11404
720 Ga0495616_0003688 3300046513 Bacteria 9783
721 Ga0495616_0016363 3300046513 Bacteria 4106
722 Ga0495616_0017474 3300046513 Bacteria 3956
723 Ga0495616_0022881 3300046513 Bacteria 3368
724 Ga0495616_0024171 3300046513 Bacteria 3261
725 Ga0495616_0029868 3300046513 Bacteria 2871
726 Ga0495616_0035822 3300046513 Bacteria 2565
727 Ga0495616_0038964 3300046513 Bacteria 2437
728 Ga0495616_0077485 3300046513 Bacteria 1595
729 Ga0495620_0000042 3300046515 Bacteria 112107
730 Ga0495620_0000456 3300046515 Bacteria 26967
731 Ga0495620_0009865 3300046515 Bacteria 5058
732 Ga0495620_0015816 3300046515 Bacteria 3800
733 Ga0495620_0017423 3300046515 Bacteria 3581
734 Ga0495620_0019562 3300046515 Bacteria 3326
735 Ga0495620_0024333 3300046515 Bacteria 2881
736 Ga0495620_0028670 3300046515 Bacteria 2585
737 Ga0495620_0038055 3300046515 Bacteria 2137
738 Ga0495628_0052974 3300046516 Bacteria 3204
739 Ga0495630_0031773 3300046517 Bacteria 3932
740 Ga0495630_0042381 3300046517 Bacteria 3399
741 Ga0495630_0045547 3300046517 Bacteria 3278
742 Ga0495630_0148290 3300046517 Bacteria 1784
743 Ga0495631_0000722 3300046518 Bacteria 21214
744 Ga0495631_0001940 3300046518 Bacteria 12135
745 Ga0495631_0004156 3300046518 Bacteria 7760
746 Ga0495631_0007549 3300046518 Bacteria 5528
747 Ga0495631_0010776 3300046518 Bacteria 4518
748 Ga0495631_0018255 3300046518 Bacteria 3305
749 Ga0495631_0024723 3300046518 Bacteria 2772
750 Ga0495631_0030012 3300046518 Bacteria 2469
751 Ga0495631_0056166 3300046518 Bacteria 1714
752 Ga0495631_0213472 3300046518 Bacteria 824
753 Ga0495632_0000573 3300046519 Bacteria 34214
754 Ga0495632_0001250 3300046519 Bacteria 21567
755 Ga0495632_0001298 3300046519 Bacteria 21142
756 Ga0495632_0001313 3300046519 Bacteria 21015
757 Ga0495632_0018098 3300046519 Bacteria 3873
758 Ga0495632_0021657 3300046519 Bacteria 3460
759 Ga0495632_0021918 3300046519 Bacteria 3433
760 Ga0495632_0023580 3300046519 Bacteria 3284
761 Ga0495632_0026352 3300046519 Bacteria 3061
762 Ga0495632_0029999 3300046519 Bacteria 2826
763 Ga0495632_0032225 3300046519 Bacteria 2702
764 Ga0495632_0035243 3300046519 Bacteria 2555
765 Ga0495632_0039242 3300046519 Bacteria 2391
766 Ga0495632_0041983 3300046519 Bacteria 2294
767 Ga0495632_0061777 3300046519 Bacteria 1817
768 Ga0495632_0126065 3300046519 Bacteria 1193
769 Ga0495632_0164963 3300046519 Bacteria 1019
770 Ga0495637_0000020 3300046520 Bacteria 181611
771 Ga0495637_0000260 3300046520 Bacteria 41743
772 Ga0495637_0002002 3300046520 Bacteria 11492
773 Ga0495637_0002683 3300046520 Bacteria 9712
774 Ga0495637_0003016 3300046520 Bacteria 9028
775 Ga0495637_0003062 3300046520 Bacteria 8932
776 Ga0495637_0003107 3300046520 Bacteria 8864
777 Ga0495637_0007488 3300046520 Bacteria 5405
778 Ga0495637_0009364 3300046520 Bacteria 4778
779 Ga0495637_0009737 3300046520 Bacteria 4677
780 Ga0495637_0015922 3300046520 Bacteria 3520
781 Ga0495637_0021249 3300046520 Bacteria 2978
782 Ga0495637_0025903 3300046520 Bacteria 2639
783 Ga0495637_0036258 3300046520 Bacteria 2149
784 Ga0495637_0044510 3300046520 Bacteria 1889
785 Ga0495637_0146523 3300046520 Bacteria 893
786 Ga0495643_0001642 3300046522 Bacteria 19726
787 Ga0495643_0005156 3300046522 Bacteria 8925
788 Ga0495643_0015742 3300046522 Bacteria 4460
789 Ga0495643_0029307 3300046522 Bacteria 3080
790 Ga0495643_0030123 3300046522 Bacteria 3031
791 Ga0495643_0051295 3300046522 Bacteria 2219
792 Ga0495643_0113684 3300046522 Bacteria 1374
793 Ga0495643_0186427 3300046522 Bacteria 1004
794 Ga0495644_0005182 3300046523 Bacteria 5099
795 Ga0495644_0014572 3300046523 Bacteria 3010
796 Ga0495644_0018081 3300046523 Bacteria 2691
797 Ga0495644_0023262 3300046523 Bacteria 2359
798 Ga0495644_0034029 3300046523 Bacteria 1923
799 Ga0495644_0054046 3300046523 Bacteria 1508
800 Ga0495644_0063295 3300046523 Bacteria 1390
801 Ga0495648_0002580 3300046524 Bacteria 16591
802 Ga0495648_0003045 3300046524 Bacteria 15001
803 Ga0495648_0006167 3300046524 Bacteria 9825
804 Ga0495648_0010821 3300046524 Bacteria 6928
805 Ga0495648_0023095 3300046524 Bacteria 4266
806 Ga0495648_0030337 3300046524 Bacteria 3576
807 Ga0495648_0030901 3300046524 Bacteria 3534
808 Ga0495648_0035313 3300046524 Bacteria 3241
809 Ga0495648_0035908 3300046524 Bacteria 3207
810 Ga0495648_0036080 3300046524 Bacteria 3196
811 Ga0495648_0073855 3300046524 Bacteria 1967
812 Ga0495648_0082529 3300046524 Bacteria 1824
813 Ga0495648_0109453 3300046524 Bacteria 1506
814 Ga0495648_0217211 3300046524 Bacteria 945
815 Ga0495666_0016903 3300046526 Bacteria 3632
816 Ga0495666_0022639 3300046526 Bacteria 3111
817 Ga0495666_0042367 3300046526 Bacteria 2201
818 Ga0495642_0000088 3300046528 Bacteria 53831
819 Ga0495642_0000463 3300046528 Bacteria 21321
820 Ga0495642_0009974 3300046528 Bacteria 3638
821 Ga0495654_0000891 3300046530 Bacteria 22358
822 Ga0495654_0000985 3300046530 Bacteria 20933
823 Ga0495654_0000992 3300046530 Bacteria 20889
824 Ga0495654_0001624 3300046530 Bacteria 15239
825 Ga0495654_0001635 3300046530 Bacteria 15181
826 Ga0495654_0002244 3300046530 Bacteria 12516
827 Ga0495654_0003414 3300046530 Bacteria 9753
828 Ga0495654_0003637 3300046530 Bacteria 9367
829 Ga0495654_0008879 3300046530 Bacteria 5526
830 Ga0495654_0012750 3300046530 Bacteria 4511
831 Ga0495654_0014227 3300046530 Bacteria 4239
832 Ga0495654_0021323 3300046530 Bacteria 3371
833 Ga0495654_0026130 3300046530 Bacteria 3004
834 Ga0495654_0037251 3300046530 Bacteria 2440
835 Ga0495654_0039902 3300046530 Bacteria 2341
836 Ga0495654_0053155 3300046530 Bacteria 1970
837 Ga0495654_0111809 3300046530 Bacteria 1245
838 Ga0495586_0012298 3300046535 Bacteria 4542
839 Ga0495587_0005901 3300046536 Bacteria 7982
840 Ga0495587_0009517 3300046536 Bacteria 6223
841 Ga0495587_0084874 3300046536 Bacteria 1834
842 Ga0495609_0000102 3300046538 Bacteria 100762
843 Ga0495609_0000685 3300046538 Bacteria 26127
844 Ga0495609_0002004 3300046538 Bacteria 12870
845 Ga0495609_0003388 3300046538 Bacteria 9158
846 Ga0495609_0020583 3300046538 Bacteria 3047
847 Ga0495609_0092172 3300046538 Bacteria 1317
848 Ga0495597_0000186 3300046542 Bacteria 55973
849 Ga0495597_0003248 3300046542 Bacteria 9645
850 Ga0495597_0005301 3300046542 Bacteria 6842
851 Ga0495597_0011052 3300046542 Bacteria 4386
852 Ga0495597_0017828 3300046542 Bacteria 3336
853 Ga0495597_0018327 3300046542 Bacteria 3285
854 Ga0495597_0019376 3300046542 Bacteria 3185
855 Ga0495597_0020769 3300046542 Bacteria 3055
856 Ga0495597_0021836 3300046542 Bacteria 2973
857 Ga0495597_0023587 3300046542 Bacteria 2845
858 Ga0495597_0050214 3300046542 Bacteria 1842
859 Ga0495597_0148372 3300046542 Bacteria 963
860 Ga0495645_0043946 3300046543 Bacteria 3259
861 Ga0495622_0000584 3300046557 Bacteria 21528
862 Ga0495622_0000824 3300046557 Bacteria 17176
863 Ga0495622_0013536 3300046557 Bacteria 3783
864 Ga0495622_0016065 3300046557 Bacteria 3482
865 Ga0495622_0036615 3300046557 Bacteria 2287
866 Ga0495622_0065658 3300046557 Bacteria 1677
867 Ga0495622_0076467 3300046557 Bacteria 1542
868 Ga0495633_0000366 3300046558 Bacteria 48617
869 Ga0495633_0016251 3300046558 Bacteria 3843
870 Ga0495633_0023594 3300046558 Bacteria 3046
871 Ga0495656_0135872 3300046615 Bacteria 1174
872 Ga0495668_0000866 3300046616 Bacteria 34104
873 Ga0495668_0006331 3300046616 Bacteria 7777
874 Ga0495668_0015395 3300046616 Bacteria 4467
875 Ga0495668_0016456 3300046616 Bacteria 4298
876 Ga0495668_0028055 3300046616 Bacteria 3185
877 Ga0495668_0029231 3300046616 Bacteria 3114
878 Ga0495668_0090101 3300046616 Bacteria 1680
879 Ga0495634_0001452 3300046642 Bacteria 21049
880 Ga0495634_0036339 3300046642 Bacteria 3369
881 Ga0495611_0000193 3300046648 Bacteria 43575
882 Ga0495611_0000386 3300046648 Bacteria 28151
883 Ga0495611_0013534 3300046648 Bacteria 3475
884 Ga0495611_0029148 3300046648 Bacteria 2419
885 Ga0495625_0000086 3300046660 Bacteria 151735
886 Ga0495625_0003090 3300046660 Bacteria 17005
887 Ga0495625_0004759 3300046660 Bacteria 12699
888 Ga0495625_0014227 3300046660 Bacteria 6361
889 Ga0495625_0018709 3300046660 Bacteria 5396
890 Ga0495625_0040156 3300046660 Bacteria 3415
891 Ga0495625_0043424 3300046660 Bacteria 3259
892 Ga0495625_0074575 3300046660 Bacteria 2376
893 Ga0495625_0270653 3300046660 Bacteria 1096
894 Ga0495625_0320783 3300046660 Bacteria 986
895 Ga0495635_0001499 3300046663 Bacteria 15653
896 Ga0495635_0011073 3300046663 Bacteria 6324
897 Ga0495659_0000084 3300046664 Bacteria 40750
898 Ga0495659_0060613 3300046664 Bacteria 1396
899 Ga0495661_0000048 3300046665 Bacteria 144678
900 Ga0495661_0000058 3300046665 Bacteria 133316
901 Ga0495661_0000131 3300046665 Bacteria 90795
902 Ga0495661_0000171 3300046665 Bacteria 76610
903 Ga0495661_0003151 3300046665 Bacteria 12359
904 Ga0495661_0003488 3300046665 Bacteria 11593
905 Ga0495661_0021482 3300046665 Bacteria 4208
906 Ga0495661_0031618 3300046665 Bacteria 3356
907 Ga0495661_0032642 3300046665 Bacteria 3290
908 Ga0495661_0039629 3300046665 Bacteria 2926
909 Ga0495661_0040731 3300046665 Bacteria 2878
910 Ga0495661_0045970 3300046665 Bacteria 2667
911 Ga0495661_0060653 3300046665 Bacteria 2246
912 Ga0495661_0062033 3300046665 Bacteria 2216
913 Ga0495588_0030035 3300046674 Bacteria 2730
914 Ga0495588_0222789 3300046674 Bacteria 995
915 Ga0495657_0045138 3300046675 Bacteria 2992
916 Ga0495623_0077213 3300046679 Bacteria 2065
917 Ga0495646_0002514 3300046680 Bacteria 11265
918 Ga0495669_0071894 3300046684 Bacteria 1578
919 Ga0495613_0018639 3300046689 Bacteria 5175
920 Ga0495624_0003730 3300046690 Bacteria 11262
921 Ga0495670_0000302 3300046691 Bacteria 23271
922 Ga0495670_0001543 3300046691 Bacteria 11267
923 Ga0495670_0001965 3300046691 Bacteria 10098
924 Ga0495670_0006959 3300046691 Bacteria 5571
925 Ga0495670_0025900 3300046691 Bacteria 2903
926 Ga0495670_0059985 3300046691 Bacteria 1910
927 Ga0495670_0087318 3300046691 Bacteria 1593
928 Ga0495670_0235322 3300046691 Bacteria 974
929 Ga0495670_0294296 3300046691 Bacteria 869
930 Ga0495671_0000157 3300046692 Bacteria 59803
931 Ga0495671_0001631 3300046692 Bacteria 14731
932 Ga0495671_0014239 3300046692 Bacteria 4285
933 Ga0495671_0027653 3300046692 Bacteria 2926
934 Ga0495671_0032379 3300046692 Bacteria 2669
935 Ga0495671_0032655 3300046692 Bacteria 2656
936 Ga0495671_0046879 3300046692 Bacteria 2160
937 Ga0495671_0071974 3300046692 Bacteria 1697
938 Ga0495671_0085061 3300046692 Bacteria 1550
939 Ga0495671_0096830 3300046692 Bacteria 1443
940 Ga0495671_0122494 3300046692 Bacteria 1268
941 Ga0495671_0227001 3300046692 Bacteria 903
942 Ga0495649_0000782 3300046694 Bacteria 25561
943 Ga0495649_0000965 3300046694 Bacteria 22681
944 Ga0495649_0003415 3300046694 Bacteria 10734
945 Ga0495649_0006929 3300046694 Bacteria 7002
946 Ga0495649_0016636 3300046694 Bacteria 4166
947 Ga0495649_0021290 3300046694 Bacteria 3633
948 Ga0495649_0023174 3300046694 Bacteria 3468
949 Ga0495649_0023224 3300046694 Bacteria 3465
950 Ga0495649_0023339 3300046694 Bacteria 3457
951 Ga0495649_0024230 3300046694 Bacteria 3384
952 Ga0495649_0029107 3300046694 Bacteria 3059
953 Ga0495649_0031594 3300046694 Bacteria 2919
954 Ga0495649_0037264 3300046694 Bacteria 2669
955 Ga0495649_0040130 3300046694 Bacteria 2564
956 Ga0495649_0054920 3300046694 Bacteria 2153
957 Ga0495649_0075663 3300046694 Bacteria 1802
958 Ga0495649_0101197 3300046694 Bacteria 1531
959 Ga0495649_0155195 3300046694 Bacteria 1201
960 Ga0495649_0160496 3300046694 Bacteria 1178
961 Ga0495589_0000647 3300046794 Bacteria 22840
962 Ga0495589_0000866 3300046794 Bacteria 18894
963 Ga0495589_0001416 3300046794 Bacteria 13904
964 Ga0495589_0010462 3300046794 Bacteria 4821
965 Ga0495589_0012387 3300046794 Bacteria 4417
966 Ga0495589_0014178 3300046794 Bacteria 4107
967 Ga0495589_0017131 3300046794 Bacteria 3720
968 Ga0495589_0025324 3300046794 Bacteria 3011
969 Ga0495589_0048724 3300046794 Bacteria 2097
970 Ga0495589_0056841 3300046794 Bacteria 1925
971 Ga0495589_0060883 3300046794 Bacteria 1853
972 Ga0495600_0012548 3300046809 Bacteria 5301
973 Ga0495600_0024810 3300046809 Bacteria 3860
974 Ga0495600_0040754 3300046809 Bacteria 3025
975 Ga0495660_0000608 3300046810 Bacteria 28251
976 Ga0495660_0002259 3300046810 Bacteria 12393
977 Ga0495660_0003303 3300046810 Bacteria 10011
978 Ga0495660_0009505 3300046810 Bacteria 5668
979 Ga0495660_0015879 3300046810 Bacteria 4345
980 Ga0495660_0025139 3300046810 Bacteria 3384
981 Ga0495660_0027881 3300046810 Bacteria 3193
982 Ga0495660_0032244 3300046810 Bacteria 2942
983 Ga0495660_0033188 3300046810 Bacteria 2895
984 Ga0495660_0034505 3300046810 Bacteria 2831
985 Ga0495660_0039127 3300046810 Bacteria 2634
986 Ga0495660_0046476 3300046810 Bacteria 2380
987 Ga0495660_0059766 3300046810 Bacteria 2049
988 Ga0495660_0077036 3300046810 Bacteria 1755
989 Ga0495660_0102607 3300046810 Bacteria 1470
990 Ga0495660_0144202 3300046810 Bacteria 1181
991 Ga0495660_0192389 3300046810 Bacteria 979
992 Ga0495581_0030841 3300047315 Bacteria 3105
993 Ga0495604_0002392 3300047317 Bacteria 15037
994 Ga0495604_0004861 3300047317 Bacteria 10645
995 Ga0495604_0189999 3300047317 Bacteria 1431
996 Ga0495604_0235501 3300047317 Bacteria 1254
997 Ga0495636_0101348 3300047318 Bacteria 1259
998 Ga0495674_0002066 3300047319 Bacteria 19692
999 Ga0495672_0001137 3300047320 Bacteria 26897
1000 Ga0495672_0001472 3300047320 Bacteria 23111
1001 Ga0495672_0001678 3300047320 Bacteria 21460
1002 Ga0495672_0002315 3300047320 Bacteria 17677
1003 Ga0495672_0002439 3300047320 Bacteria 17116
1004 Ga0495672_0006904 3300047320 Bacteria 8654
1005 Ga0495672_0009451 3300047320 Bacteria 7063
1006 Ga0495672_0013935 3300047320 Bacteria 5526
1007 Ga0495672_0019324 3300047320 Bacteria 4496
1008 Ga0495672_0027020 3300047320 Bacteria 3653
1009 Ga0495672_0027981 3300047320 Bacteria 3574
1010 Ga0495672_0029335 3300047320 Bacteria 3466
1011 Ga0495672_0035841 3300047320 Bacteria 3052
1012 Ga0495672_0036952 3300047320 Bacteria 2993
1013 Ga0495672_0055497 3300047320 Bacteria 2312
1014 Ga0495672_0059881 3300047320 Bacteria 2201
1015 Ga0495672_0155514 3300047320 Bacteria 1181
1016 Ga0495672_0176448 3300047320 Bacteria 1085
1017 Ga0495672_0237074 3300047320 Bacteria 892
1018 Ga0495676_0000022 3300047321 Bacteria 163719
1019 Ga0495676_0028987 3300047321 Bacteria 4718
1020 Ga0495680_0001940 3300047322 Bacteria 21762
1021 Ga0495680_0013153 3300047322 Bacteria 7232
1022 Ga0495680_0053910 3300047322 Bacteria 3125
1023 Ga0495683_0000030 3300047323 Bacteria 150551
1024 Ga0495683_0000927 3300047323 Bacteria 20673
1025 Ga0495683_0015733 3300047323 Bacteria 3928
1026 Ga0495683_0015950 3300047323 Bacteria 3902
1027 Ga0495683_0027477 3300047323 Bacteria 2909
1028 Ga0495683_0032163 3300047323 Bacteria 2672
1029 Ga0495683_0049716 3300047323 Bacteria 2099
1030 Ga0495683_0052556 3300047323 Bacteria 2033
1031 Ga0495683_0071033 3300047323 Bacteria 1708
1032 Ga0495683_0076886 3300047323 Bacteria 1632
1033 Ga0495683_0099647 3300047323 Bacteria 1398
1034 Ga0495683_0164105 3300047323 Bacteria 1025
1035 Ga0495687_002395 3300047443 Bacteria 15125
1036 Ga0495687_002578 3300047443 Bacteria 14291
1037 Ga0495687_016372 3300047443 Bacteria 3730
1038 Ga0495675_0002663 3300047444 Bacteria 10696
1039 Ga0495675_0094999 3300047444 Bacteria 1869
1040 Ga0495675_0135571 3300047444 Bacteria 1528
1041 Ga0495677_0004992 3300047445 Bacteria 5060
1042 Ga0495679_000218 3300047446 Bacteria 48725
1043 Ga0495679_008161 3300047446 Bacteria 4284
1044 Ga0495679_009961 3300047446 Bacteria 3764
1045 Ga0495679_010442 3300047446 Bacteria 3646
1046 Ga0495679_011633 3300047446 Bacteria 3383
1047 Ga0495679_013241 3300047446 Bacteria 3105
1048 Ga0495679_015319 3300047446 Bacteria 2807
1049 Ga0495679_015486 3300047446 Bacteria 2787
1050 Ga0495673_0000544 3300047469 Bacteria 38535
1051 Ga0495673_0001080 3300047469 Bacteria 23910
1052 Ga0495673_0001326 3300047469 Bacteria 20085
1053 Ga0495673_0002696 3300047469 Bacteria 12217
1054 Ga0495673_0004063 3300047469 Bacteria 9316
1055 Ga0495673_0004098 3300047469 Bacteria 9251
1056 Ga0495673_0005947 3300047469 Bacteria 7269
1057 Ga0495673_0009951 3300047469 Bacteria 5211
1058 Ga0495673_0010178 3300047469 Bacteria 5137
1059 Ga0495673_0015583 3300047469 Bacteria 3912
1060 Ga0495673_0016719 3300047469 Bacteria 3744
1061 Ga0495673_0018155 3300047469 Bacteria 3554
1062 Ga0495673_0023012 3300047469 Bacteria 3041
1063 Ga0495673_0023895 3300047469 Bacteria 2963
1064 Ga0495673_0023945 3300047469 Bacteria 2959
1065 Ga0495673_0037941 3300047469 Bacteria 2196
1066 Ga0495673_0069614 3300047469 Bacteria 1483
1067 Ga0495673_0070626 3300047469 Bacteria 1469
1068 Ga0495681_0000351 3300047470 Bacteria 36044
1069 Ga0495681_0000411 3300047470 Bacteria 33097
1070 Ga0495681_0000534 3300047470 Bacteria 29137
1071 Ga0495681_0001655 3300047470 Bacteria 16511
1072 Ga0495681_0004365 3300047470 Bacteria 9668
1073 Ga0495681_0005015 3300047470 Bacteria 8924
1074 Ga0495681_0005274 3300047470 Bacteria 8676
1075 Ga0495681_0014124 3300047470 Bacteria 4598
1076 Ga0495681_0015029 3300047470 Bacteria 4399
1077 Ga0495681_0015298 3300047470 Bacteria 4347
1078 Ga0495681_0015554 3300047470 Bacteria 4298
1079 Ga0495681_0017979 3300047470 Bacteria 3910
1080 Ga0495681_0018900 3300047470 Bacteria 3782
1081 Ga0495681_0023727 3300047470 Bacteria 3250
1082 Ga0495681_0028697 3300047470 Bacteria 2858
1083 Ga0495681_0035618 3300047470 Bacteria 2469
1084 Ga0495681_0040112 3300047470 Bacteria 2281
1085 Ga0495681_0103202 3300047470 Bacteria 1244
1086 Ga0495684_0272349 3300047471 Bacteria 1224
1087 Ga0495686_0028405 3300047472 Bacteria 3643
1088 Ga0495686_0030068 3300047472 Bacteria 3530
1089 Ga0495686_0033029 3300047472 Bacteria 3343
1090 Ga0495686_0040042 3300047472 Bacteria 2990
1091 Ga0495686_0049419 3300047472 Bacteria 2646
1092 Ga0495686_0075733 3300047472 Bacteria 2062
1093 Ga0495593_0010377 3300047673 Bacteria 5385
1094 Ga0495593_0020211 3300047673 Bacteria 3729
1095 Ga0495593_0050812 3300047673 Bacteria 2195
1096 Ga0495602_0058196 3300048088 Bacteria 3385
1097 Ga0495602_0579484 3300048088 Bacteria 774
1098 Ga0495626_0000039 3300048091 Bacteria 175454
1099 Ga0495626_0000391 3300048091 Bacteria 45354
1100 Ga0495626_0000562 3300048091 Bacteria 36865
1101 Ga0495626_0000876 3300048091 Bacteria 26763
1102 Ga0495626_0001660 3300048091 Bacteria 17183
1103 Ga0495626_0001894 3300048091 Bacteria 15625
1104 Ga0495626_0017787 3300048091 Bacteria 3583
1105 Ga0495626_0029164 3300048091 Bacteria 2672
1106 Ga0495626_0050757 3300048091 Bacteria 1915
1107 Ga0495626_0051000 3300048091 Bacteria 1910
1108 Ga0496102_0001161 3300048905 Bacteria 24071
1109 Ga0496102_0102955 3300048905 Bacteria 2655
1110 Ga0496102_0205491 3300048905 Bacteria 1857
1111 Ga0496103_0022118 3300048906 Bacteria 3828
1112 Ga0496110_0051109 3300048913 Bacteria 3632
1113 Ga0496110_0230231 3300048913 Bacteria 1685
1114 Ga0496110_0569748 3300048913 Bacteria 1028
1115 Ga0496112_0094767 3300048915 Bacteria 2956
1116 Ga0496114_0015310 3300048917 Bacteria 6166
1117 Ga0496116_0000376 3300048919 Bacteria 66696
1118 Ga0496116_0001403 3300048919 Bacteria 27112
1119 Ga0496116_0004841 3300048919 Bacteria 12698
1120 Ga0496116_0037495 3300048919 Bacteria 3379
1121 Ga0496116_0043304 3300048919 Bacteria 3068
1122 Ga0496116_0056128 3300048919 Bacteria 2583
1123 Ga0496117_0001205 3300048920 Bacteria 38844
1124 Ga0496117_0004904 3300048920 Bacteria 14392
1125 Ga0496117_0039140 3300048920 Bacteria 3503
1126 Ga0496117_0041751 3300048920 Bacteria 3356
1127 Ga0496117_0043992 3300048920 Bacteria 3238
1128 Ga0496117_0148103 3300048920 Bacteria 1394
1129 Ga0496118_0030684 3300048921 Bacteria 4477
1130 Ga0496118_0040717 3300048921 Bacteria 3690
1131 Ga0496118_0047610 3300048921 Bacteria 3321
1132 Ga0496118_0086828 3300048921 Bacteria 2172
1133 Ga0496118_0132446 3300048921 Bacteria 1598
1134 Ga0496118_0132605 3300048921 Bacteria 1596
1135 Ga0496119_0000082 3300048922 Bacteria 138565
1136 Ga0496119_0148135 3300048922 Bacteria 1260
1137 Ga0496120_0000873 3300048923 Bacteria 42650
1138 Ga0496120_0017629 3300048923 Bacteria 4620
1139 Ga0496120_0071677 3300048923 Bacteria 1901
1140 Ga0496121_0001119 3300048924 Bacteria 47137
1141 Ga0496121_0001386 3300048924 Bacteria 41013
1142 Ga0496121_0033948 3300048924 Bacteria 4603
1143 Ga0496121_0056141 3300048924 Bacteria 3273
1144 Ga0496121_0080167 3300048924 Bacteria 2589
1145 Ga0496121_0129808 3300048924 Bacteria 1888
1146 Ga0496122_0003673 3300048925 Bacteria 19907
1147 Ga0496122_0012580 3300048925 Bacteria 8401
1148 Ga0496122_0027078 3300048925 Bacteria 4914
1149 Ga0496122_0078088 3300048925 Bacteria 2321
1150 Ga0496122_0090502 3300048925 Bacteria 2087
1151 Ga0496122_0130565 3300048925 Bacteria 1597
1152 Ga0496123_0002626 3300048926 Bacteria 21790
1153 Ga0496123_0044086 3300048926 Bacteria 3053
1154 Ga0496123_0047650 3300048926 Bacteria 2892
1155 Ga0496123_0070988 3300048926 Bacteria 2175
1156 Ga0496123_0081009 3300048926 Bacteria 1975
1157 Ga0496124_0000120 3300048927 Bacteria 163899
1158 Ga0496124_0014469 3300048927 Bacteria 7628
1159 Ga0496124_0023214 3300048927 Bacteria 5668
1160 Ga0496124_0024564 3300048927 Bacteria 5474
1161 Ga0496124_0030509 3300048927 Bacteria 4784
1162 Ga0496124_0039994 3300048927 Bacteria 4059
1163 Ga0496124_0050285 3300048927 Bacteria 3553
1164 Ga0496124_0062371 3300048927 Bacteria 3119
1165 Ga0496124_0078549 3300048927 Bacteria 2719
1166 Ga0496124_0272504 3300048927 Bacteria 1238
1167 Ga0496125_0000799 3300048928 Bacteria 51395
1168 Ga0496125_0006647 3300048928 Bacteria 12444
1169 Ga0496125_0027012 3300048928 Bacteria 5212
1170 Ga0496125_0060412 3300048928 Bacteria 3046
1171 Ga0496125_0163594 3300048928 Bacteria 1507
1172 Ga0495678_000017 3300049459 Bacteria 282592
1173 Ga0495678_000693 3300049459 Bacteria 30734
1174 Ga0495678_011031 3300049459 Bacteria 4346
1175 Ga0495678_011218 3300049459 Bacteria 4303
1176 Ga0495678_013930 3300049459 Bacteria 3756
1177 Ga0495678_015310 3300049459 Bacteria 3534
1178 Ga0495678_015877 3300049459 Bacteria 3456
1179 Ga0495678_016010 3300049459 Bacteria 3441
1180 Ga0495678_019562 3300049459 Bacteria 3016
1181 Ga0495678_022757 3300049459 Bacteria 2735
1182 Ga0495678_024466 3300049459 Bacteria 2607
1183 Ga0495678_058860 3300049459 Bacteria 1450
1184 Ga0495682_0000182 3300049460 Bacteria 51816
1185 Ga0495682_0003288 3300049460 Bacteria 7227
1186 Ga0495682_0007762 3300049460 Bacteria 4251
1187 Ga0495682_0014543 3300049460 Bacteria 2983
1188 Ga0495682_0034520 3300049460 Bacteria 1864
1189 Ga0495682_0048640 3300049460 Bacteria 1545
1190 Ga0495682_0056984 3300049460 Bacteria 1415
1191 Ga0495682_0147905 3300049460 Bacteria 838
1192 Ga0501038_0045138 3300049574 Bacteria 3826
1193 Ga0501039_0501836 3300049575 Bacteria 953
1194 Ga0501040_0344442 3300049576 Bacteria 1067
1195 Ga0501042_0108652 3300049578 Unclassified 1997
1196 Ga0501043_0011788 3300049579 Bacteria 6847
1197 Ga0501046_0196489 3300049580 Unclassified 1502
1198 Ga0501047_0004948 3300049581 Bacteria 12512
1199 Ga0501047_0133524 3300049581 Bacteria 2362
1200 Ga0501067_0004678 3300049583 Bacteria 7576
1201 Ga0501067_0118484 3300049583 Bacteria 1473
1202 Ga0501068_0004775 3300049584 Bacteria 7375
1203 Ga0501070_0049378 3300049586 Bacteria 3494
1204 Ga0501071_0038675 3300049587 Bacteria 3409
1205 Ga0501071_0183209 3300049587 Unclassified 1569
1206 Ga0501072_0111218 3300049588 Bacteria 2180
1207 Ga0501073_0000405 3300049589 Bacteria 29429
1208 Ga0501073_0010478 3300049589 Bacteria 6795
1209 Ga0501073_0234756 3300049589 Unclassified 1267
1210 Ga0501075_0005105 3300049591 Bacteria 8970
1211 Ga0501076_0014020 3300049592 Bacteria 6024
1212 Ga0501076_0021177 3300049592 Bacteria 4984
1213 Ga0501077_0020106 3300049593 Bacteria 4225
1214 Ga0501077_0302071 3300049593 Unclassified 1020
1215 Ga0501079_0011299 3300049741 Bacteria 6810
1216 Ga0501080_0001172 3300049742 Bacteria 21702
1217 Ga0501080_0146927 3300049742 Unclassified 2179
1218 Ga0501080_0147183 3300049742 Bacteria 2177
1219 Ga0501081_0007493 3300049743 Bacteria 7077
1220 Ga0501081_0122715 3300049743 Bacteria 1852
1221 Ga0501083_0029801 3300049744 Bacteria 3750
1222 Ga0501241_000354 3300049758 Bacteria 10079
1223 Ga0501044_0248569 3300049823 Bacteria 1720
1224 nmdc:mga00v17_210902_c1 3300050491 Bacteria 1257
1225 nmdc:mga00v17_43712_c1 3300050491 Bacteria 2699
1226 nmdc:mga0qj67_438605_c1 3300050509 Bacteria 1052
1227 nmdc:mga08y16_657244_c1 3300050511 Bacteria 1052
1228 nmdc:mga08x19_332261_c1 3300050514 Bacteria 1059
1229 Ga0500583_0003831 3300053092 Bacteria 4810
1230 Ga0500583_0014754 3300053092 Bacteria 3070
1231 Ga0500651_0183419 3300053093 Bacteria 1242
1232 Ga0500641_0007501 3300053096 Bacteria 3893
1233 Ga0500556_0020665 3300053104 Bacteria 2110
1234 Ga0500569_023472 3300053109 Unclassified 1658
1235 Ga0500572_004875 3300053111 Bacteria 3038
1236 Ga0500593_112169 3300053117 Bacteria 1119
1237 Ga0500595_003422 3300053119 Bacteria 7420
1238 Ga0500573_0047189 3300053140 Bacteria 2481
1239 Ga0500616_0000092 3300053153 Bacteria 183860
1240 Ga0500616_0008351 3300053153 Bacteria 6444
1241 Ga0500622_0002074 3300053156 Bacteria 14930
1242 Ga0500627_0051543 3300053158 Bacteria 1795
1243 Ga0500634_0026210 3300053161 Bacteria 3174
1244 Ga0501084_0040792 3300054114 Bacteria 3884
1245 Ga0501084_0064459 3300054114 Bacteria 3066
1246 Ga0501082_0047472 3300060353 Bacteria 3700
1247 Ga0501082_0922531 3300060353 Bacteria 764
1248 Ga0530510_0032432 3300061734 Bacteria 3759
1249 2808939683 2808606379 Bacteria 5022697
1250 2510284315 2510065053 Bacteria 5005518
1251 2510292996 2510065055 Bacteria 5037935
1252 2510312502 2510065058 Bacteria 5005894
1253 2511256400 2511231004 Bacteria 6669789
1254 2511266106 2511231006 Bacteria 6794709
1255 2511278978 2511231008 Bacteria 6624100
1256 2511288784 2511231010 Bacteria 6373152
1257 2511297349 2511231011 Bacteria 6149768
1258 2511300350 2511231012 Bacteria 6738011
1259 2511316714 2511231014 Bacteria 6462302
1260 2511317628 2511231015 Bacteria 6598026
1261 2511326023 2511231016 Bacteria 6704427
1262 2511330985 2511231017 Bacteria 6503007
1263 2511336320 2511231018 Bacteria 6436256
1264 2511349116 2511231020 Bacteria 6115223
1265 2511355992 2511231021 Bacteria 7302637
1266 2511362595 2511231022 Bacteria 6719296
1267 2511366827 2511231023 Bacteria 6808468
1268 2511411317 2511231031 Bacteria 6558529
1269 2511822457 2511231156 Bacteria 6845832
1270 2512325958 2512047018 Bacteria 6663241
1271 2555245724 2554235231 Bacteria 5215788
1272 2555667420 2554235341 Bacteria 6867980
1273 2583789802 2582580891 Bacteria 6800976
1274 2597855664 2597489887 Bacteria 6666321
1275 2597861664 2597489888 Bacteria 6179543
1276 2597867389 2597489889 Bacteria 6297495
1277 2599327422 2599185155 Bacteria 5827168
1278 2599356643 2599185160 Bacteria 6844013
1279 2599363327 2599185161 Bacteria 6960462
1280 2599369721 2599185162 Bacteria 6957254
1281 2599376436 2599185163 Bacteria 6995158
1282 2599381748 2599185164 Bacteria 6841688
1283 2599388108 2599185165 Bacteria 6843250
1284 2599395368 2599185166 Bacteria 6959206
1285 2599398849 2599185167 Bacteria 6353609
1286 2599407133 2599185168 Bacteria 6997636
1287 2599450904 2599185179 Bacteria 6611171
1288 2599463476 2599185181 Bacteria 6844519
1289 2599469174 2599185182 Bacteria 6883168
1290 2599485566 2599185185 Bacteria 6652270
1291 2599492493 2599185186 Bacteria 6831633
1292 2599500108 2599185188 Bacteria 6164180
1293 2599506430 2599185189 Bacteria 5862825
1294 2599514150 2599185190 Bacteria 6285678
1295 2599518751 2599185191 Bacteria 6297582
1296 2599614592 2599185212 Bacteria 6765997
1297 2599769413 2599185248 Bacteria 6696816
1298 2599806695 2599185257 Bacteria 6492581
1299 2599882666 2599185288 Bacteria 6666191
1300 2599886833 2599185289 Bacteria 6778765
1301 2599893515 2599185290 Bacteria 6289611
1302 2599898162 2599185291 Bacteria 6775623
1303 2599930895 2599185300 Bacteria 6062622
1304 2599943599 2599185302 Bacteria 5954930
1305 2599950757 2599185303 Bacteria 6512725
1306 2599955910 2599185304 Bacteria 5951361
1307 2599962039 2599185305 Bacteria 6748700
1308 2599964551 2599185306 Bacteria 6637356
1309 2599978908 2599185308 Bacteria 6621546
1310 2599984603 2599185309 Bacteria 5969593
1311 2599991244 2599185310 Bacteria 6014457
1312 2599994850 2599185311 Bacteria 6354990
1313 2600002225 2599185312 Bacteria 5912071
1314 2600004864 2599185313 Bacteria 6658188
1315 2600012868 2599185314 Bacteria 6621749
1316 2600018973 2599185315 Bacteria 6771107
1317 2600023969 2599185316 Bacteria 6320029
1318 2600030994 2599185317 Bacteria 6435722
1319 2600034670 2599185318 Bacteria 6961590
1320 2600043463 2599185319 Bacteria 6637840
1321 2600048055 2599185320 Bacteria 5963263
1322 2600053326 2599185321 Bacteria 6764560
1323 2600061328 2599185322 Bacteria 6763055
1324 2600067616 2599185323 Bacteria 6688755
1325 2600071793 2599185324 Bacteria 6590677
1326 2600077662 2599185325 Bacteria 6324919
1327 2600216105 2599185356 Bacteria 6843884
1328 2600360885 2600254930 Bacteria 6431253
1329 2600364881 2600254931 Bacteria 6734225
1330 2601692349 2600255296 Bacteria 5784754
1331 2601776272 2600255313 Bacteria 6842543
1332 2601797836 2600255318 Bacteria 6383414
1333 2602008645 2600255389 Bacteria 5275336
1334 2606076681 2603880185 Bacteria 6379190
1335 2606128905 2603880199 Bacteria 6377649
1336 2621302176 2619619299 Bacteria 6649820
1337 2624478225 2623620443 Bacteria 6427864
1338 2643872617 2643221571 Bacteria 6228673
1339 2643954899 2643221589 Bacteria 6250934
1340 2644024539 2643221602 Bacteria 6249926
1341 2644186125 2643221633 Bacteria 6733554
1342 2644282073 2643221650 Bacteria 7029547
1343 2644619650 2643221713 Bacteria 6554480
1344 2652543419 2651869719 Bacteria 6047974
1345 2671090799 2667528170 Bacteria 6786960
1346 2671099967 2667528171 Bacteria 6900659
1347 2671127338 2667528176 Bacteria 6724917
1348 2671772346 2671180172 Bacteria 6495783
1349 2677898952 2675903420 Bacteria 6247433
1350 2678260990 2675903515 Bacteria 6580491
1351 2715749210 2713897148 Bacteria 5883533
1352 2715755480 2713897149 Bacteria 6506249
1353 2718632162 2718217725 Bacteria 5758958
1354 2723246562 2721755607 Bacteria 5841722
1355 2738674089 2738541265 Bacteria 6594665
1356 2738752482 2738541282 Bacteria 6593925
1357 2738807905 2738541294 Bacteria 6925949
1358 2738861523 2738541303 Bacteria 6591772
1359 2738895265 2738541309 Bacteria 6926455
1360 2739198030 2738543004 Bacteria 6381073
1361 2739260294 2738543015 Bacteria 6750701
1362 2739288589 2738543020 Bacteria 5718238
1363 2739293901 2738543021 Bacteria 5718241
1364 2739311284 2738543025 Bacteria 6600348
1365 2743735081 2740892503 Bacteria 6855563
1366 2745006302 2744054620 Bacteria 6551379
1367 2774119557 2773857670 Bacteria 6407454
1368 2774131495 2773857672 Bacteria 4993178
1369 2774134740 2773857673 Bacteria 6513460
1370 2784261043 2784132063 Bacteria 6262788
1371 2784315968 2784132072 Bacteria 6596533
1372 2794593981 2791355520 Bacteria 5948615
1373 2808855941 2808606361 Bacteria 6136259
1374 2808905431 2808606373 Bacteria 4423627
1375 2808922744 2808606376 Bacteria 6248667
1376 2808932179 2808606377 Bacteria 6646337
1377 2808936021 2808606378 Bacteria 6177535
1378 2808944431 2808606380 Bacteria 6248705
1379 2808954220 2808606381 Bacteria 6646461
1380 2808964482 2808606383 Bacteria 6138645
1381 2808976658 2808606385 Bacteria 6711065
1382 2808991904 2808606388 Bacteria 6706662
1383 2808999370 2808606389 Bacteria 6138126
1384 2809217980 2808606445 Bacteria 6057339
1385 2812370181 2811994881 Bacteria 6298475
1386 2817488414 2816332298 Bacteria 6852809
1387 2819657234 2818991456 Bacteria 6123676
1388 2819705217 2818991464 Bacteria 6907494
1389 2823425500 2823421272 Bacteria 5372474
1390 2825654264 2825651385 Bacteria 6715909
1391 2826586874 2826581358 Bacteria 5963467
1392 2834032209 2834028612 Bacteria 6354979
1393 2842807109 2842805378 Bacteria 5385175
1394 2842816692 2842815866 Bacteria 5947510
1395 2842832087 2842826826 Bacteria 5974129
1396 2842834162 2842832357 Bacteria 5959113
1397 2842838637 2842837860 Bacteria 6066181
1398 2842846361 2842843487 Bacteria 6004777
1399 2842852260 2842849001 Bacteria 5924277
1400 2842858724 2842854478 Bacteria 6143501
1401 2844667900 2844665904 Bacteria 6817974
1402 2852617078 2852612431 Bacteria 6885235
1403 2852660449 2852657418 Bacteria 6472974
1404 2852671933 2852667396 Bacteria 6885555
1405 2860868438 2860867994 Bacteria 5645326
1406 2878030168 2878029506 Bacteria 6418441
1407 2880231115 2880230671 Bacteria 6140320
1408 2894513819 2894510363 Bacteria 5121143
1409 2904519574 2904518522 Bacteria 6068986
1410 2904552156 2904550169 Bacteria 6221258
1411 2908447031 2908446538 Bacteria 6829095
1412 2912964087 2912963787 Bacteria 5646108
1413 2913037288 2913036834 Bacteria 6704877
1414 2917071171 2917070673 Bacteria 6868303
1415 2917836379 2917832318 Bacteria 5346010
1416 2919066150 2919063839 Bacteria 6302690
1417 2919127488 2919125081 Bacteria 5385106
1418 2919155786 2919155634 Bacteria 4860545
1419 2919389774 2919385768 Bacteria 5897293
1420 2919459987 2919456309 Bacteria 6586567
1421 2919486893 2919481497 Bacteria 6907839
1422 2919488701 2919487758 Bacteria 5929766
1423 2919502235 2919501602 Bacteria 5286340
1424 2923154076 2923153595 Bacteria 6870622
1425 2923524272 2923519811 Bacteria 6298479
1426 2923589788 2923586266 Bacteria 6565975
1427 2926063908 2926063275 Bacteria 5285848
1428 2929144819 2929144301 Bacteria 6622272
1429 2929190303 2929189879 Bacteria 5930554
1430 2931371845 2931369376 Bacteria 6847892
1431 2931391382 2931390751 Bacteria 6273349
1432 2935358999 2935353572 Unclassified 6955622
1433 2939654979 2939651529 Bacteria 5895393
1434 2945930164 2945928738 Bacteria 6053221
1435 2945967592 2945961074 Bacteria 7342064
1436 2946012511 2946006987 Bacteria 6705746
1437 2946028646 2946027586 Bacteria 6049274
1438 2947235173 2947233263 Bacteria 6439278
1439 2969304961 2969304461 Bacteria 6601805
1440 2974293347 2974289157 Bacteria 6080362
1441 2974301735 2974298342 Bacteria 4840922
1442 2984291983 2984286254 Bacteria 6702062
1443 2984500696 2984499530 Bacteria 5020881
1444 2984507219 2984504281 Bacteria 5262371
1445 2988732208 2988728565 Bacteria 6124362
1446 2989393230 2989392574 Bacteria 4554005
1447 2990199578 2990196909 Bacteria 4054280
1448 2998140464 2998139840 Bacteria 6073514
1449 3007255370 3007252601 Bacteria 4559114
1450 3007315824 3007315729 Bacteria 5076637
1451 3007399627 3007395558 Bacteria 6755444
1452 3007420026 3007419365 Bacteria 7026924
1453 3007517909 3007511990 Bacteria 6481491
1454 3007618652 3007614139 Bacteria 6053559
1455 3007624986 3007619802 Bacteria 6411688
1456 3007721225 3007718800 Bacteria 5971527
1457 3007859704 3007855910 Bacteria 5637581
1458 3007864323 3007861166 Bacteria 6045338
1459 3007872019 3007866637 Bacteria 5899198
1460 637317817 637000220 Bacteria 7074893
1461 8015688325 8015687852 Bacteria 6613826
1462 8030000274 8029995093 Bacteria 5990776
1463 8054291526 8054285046 Bacteria 6919322
1464 8054350128 8054347763 Bacteria 5901107
1465 8054503969 8054503363 Bacteria 6101651
1466 8055771422 8055770955 Bacteria 6827675
1467 8055818365 8055817908 Bacteria 6609162
1468 8056126477 8056125926 Bacteria 6228218
1469 8056132339 8056131705 Bacteria 6107031
1470 8056143741 8056143049 Bacteria 6307666
1471 8056152479 8056148874 Bacteria 6479865
1472 8056158516 8056155041 Bacteria 6486948
1473 8056164345 8056161164 Bacteria 6106669
1474 8056170587 8056166840 Bacteria 5820959
1475 8056176702 8056172158 Bacteria 6133900
1476 8056183039 8056177738 Bacteria 6748268
1477 8056572323 8056569372 Bacteria 5997322
1478 8057802711 8057798959 Bacteria 6713499
1479 MRS2a_Contig_10320
1480 MRS2a_Contig_66
1481 SwRhRL2b_contig_1197704
1482 JGI24741J21665_1006033
1483 JGI25162J39368_1000140
1484 JGI25162J39368_1000181
1485 JGI25154J39366_1003720
1486 JGI25163J39215_1000195
1487 JGI25163J39215_1000288
1488 JGI25164J39214_1000110
1489 JGI25164J39214_1000146
1490 JGI25406J46586_10003703
1491 JGI25165J46597_1000228
1492 JGI25165J46597_1000267
1493 rootH1_10143248
1494 Ga0055538_1000037
1495 Ga0055539_1000048
1496 Ga0055533_1000059
1497 Ga0055532_1000105
1498 Ga0055525_1000057
1499 Ga0055525_1000128
1500 Ga0055535_1006635
1501 Ga0055526_1000962
1502 Ga0055536_1000328
1503 Ga0055536_1000392
1504 Ga0055536_1000624
1505 Ga0055536_1039737
1506 Ga0055530_10000098
1507 Ga0055530_10000333
1508 Ga0055530_10002459
1509 Ga0055540_1000138
1510 Ga0055540_1000279
1511 Ga0055540_1000586
1512 Ga0055531_10000321
1513 Ga0055541_1000035
1514 Ga0065714_10002325
1515 Ga0065714_10065492
1516 Ga0065714_10072189
1517 Ga0065714_10103225
1518 Ga0065714_10165111
1519 Ga0065704_10013597
1520 Ga0065704_10038164
1521 Ga0065704_10078436
1522 Ga0065715_10109483
1523 Ga0070676_10046631
1524 Ga0070690_100003509
1525 Ga0070670_100002909
1526 Ga0070670_100020308
1527 Ga0070670_100069743
1528 Ga0068868_100596275
1529 Ga0070689_100001983
1530 Ga0070689_100070459
1531 Ga0070661_100000078
1532 Ga0070669_100000221
1533 Ga0070675_100107876
1534 Ga0070674_100178907
1535 Ga0070674_100677088
1536 Ga0070688_100009229
1537 Ga0070688_100050324
1538 Ga0070701_10009191
1539 Ga0070705_100006396
1540 Ga0070700_100057629
1541 Ga0070662_100000095
1542 Ga0070662_100010823
1543 Ga0070685_10127159
1544 Ga0070698_100061858
1545 Ga0068853_100000089
1546 Ga0070672_100092797
1547 Ga0070672_100109191
1548 Ga0070672_100311912
1549 Ga0070686_100014835
1550 Ga0070696_100166990
1551 Ga0070693_100098972
1552 Ga0070665_100002013
1553 Ga0070665_100006705
1554 Ga0070704_100058517
1555 Ga0068855_100667255
1556 Ga0070664_100000391
1557 Ga0070664_100052654
1558 Ga0068854_100001775
1559 Ga0070702_100001974
1560 Ga0068859_100013045
1561 Ga0068859_100080101
1562 Ga0068859_100131788
1563 Ga0068861_100002242
1564 Ga0068861_100069542
1565 Ga0068861_100071415
1566 Ga0068861_100278312
1567 Ga0068861_100558330
1568 Ga0068851_10000024
1569 Ga0068870_10245072
1570 Ga0068863_100277144
1571 Ga0068863_100321199
1572 Ga0068858_100012305
1573 Ga0068860_100026372
1574 Ga0068862_100009441
1575 Ga0068862_100045897
1576 Ga0068862_100094782
1577 Ga0081455_10000032
1578 Ga0081539_10000007
1579 Ga0075364_10100175
1580 Ga0075364_10116716
1581 Ga0075364_10272890
1582 Ga0075432_10000629
1583 Ga0075432_10013530
1584 Ga0075432_10029736
1585 Ga0075432_10040005
1586 Ga0075432_10048055
1587 Ga0075432_10065001
1588 Ga0097621_100109048
1589 Ga0097621_100186931
1590 Ga0068871_100053807
1591 Ga0068871_100229118
1592 Ga0068871_100284365
1593 Ga0068871_100656965
1594 Ga0075428_100429130
1595 Ga0075436_100116729
1596 Ga0075436_100152520
1597 Ga0097620_100013045
1598 Ga0097620_100080104
1599 Ga0097620_100131790
1600 Ga0079104_1000229
1601 Ga0079104_1000296
1602 Ga0079104_1014254
1603 Ga0105251_10000113
1604 Ga0105251_10000303
1605 Ga0105251_10000361
1606 Ga0105251_10001591
1607 Ga0105251_10005307
1608 Ga0105251_10007332
1609 Ga0105251_10011289
1610 Ga0105251_10014426
1611 Ga0105251_10017751
1612 Ga0105251_10081785
1613 Ga0105244_10000982
1614 Ga0105244_10001234
1615 Ga0105244_10005115
1616 Ga0105244_10006072
1617 Ga0105244_10007513
1618 Ga0105244_10008576
1619 Ga0105244_10046052
1620 Ga0105244_10112754
1621 Ga0105244_10148006
1622 Ga0105250_10000189
1623 Ga0105250_10000211
1624 Ga0105250_10002092
1625 Ga0105250_10009368
1626 Ga0105250_10029541
1627 Ga0105250_10034565
1628 Ga0105250_10049723
1629 Ga0111539_10084056
1630 Ga0105243_10000370
1631 Ga0105243_10000595
1632 Ga0105243_10008730
1633 Ga0105243_10009526
1634 Ga0105243_10047309
1635 Ga0105243_10093187
1636 Ga0105243_10116421
1637 Ga0105242_10000136
1638 Ga0105242_10093581
1639 Ga0105248_10004445
1640 Ga0105248_10626155
1641 Ga0105237_10000939
1642 Ga0105249_10539819
1643 Ga0105249_10715742
1644 Ga0105246_10000042
1645 Ga0105246_10002498
1646 Ga0105246_10068492
1647 Ga0157336_1001109
1648 Ga0157345_1000068
1649 Ga0157373_10000993
1650 Ga0157373_10005678
1651 Ga0157373_10016864
1652 Ga0157373_10024956
1653 Ga0157373_10052818
1654 Ga0157373_10074581
1655 Ga0157373_10113151
1656 Ga0157373_10195597
1657 Ga0157371_10000811
1658 Ga0157371_10001369
1659 Ga0157371_10011701
1660 Ga0157371_10034037
1661 Ga0157370_10000150
1662 Ga0157370_10011272
1663 Ga0157370_10016274
1664 Ga0157370_10050485
1665 Ga0157370_10068628
1666 Ga0157370_10078398
1667 Ga0157370_10129827
1668 Ga0157370_10308096
1669 Ga0157370_10379630
1670 Ga0157369_10001261
1671 Ga0157369_10001555
1672 Ga0157369_10015276
1673 Ga0157369_10038743
1674 Ga0157369_10411589
1675 Ga0163162_10071200
1676 Ga0157372_10001525
1677 Ga0157372_10008414
1678 Ga0157372_10712478
1679 Ga0157375_10001875
1680 Ga0157375_10008094
1681 Ga0157375_10087456
1682 Ga0157375_10255579
1683 Ga0157380_10008871
1684 Ga0182008_10001166
1685 Ga0182008_10002891
1686 Ga0182008_10003251
1687 Ga0182008_10004481
1688 Ga0182008_10013634
1689 Ga0182008_10014614
1690 Ga0182008_10019620
1691 Ga0182008_10027535
1692 Ga0182008_10034067
1693 Ga0157376_10560650
1694 Ga0157376_10953193
1695 Ga0182006_1000380
1696 Ga0182006_1000786
1697 Ga0182006_1005806
1698 Ga0182006_1034120
1699 Ga0182006_1056815
1700 Ga0182007_10000194
1701 Ga0182007_10012110
1702 Ga0182005_1000459
1703 Ga0182005_1001444
1704 Ga0182005_1018415
1705 Ga0182005_1019329
1706 Ga0182005_1028515
1707 Ga0163161_10000719
1708 Ga0163161_10001156
1709 Ga0163161_10007778
1710 Ga0163161_10021521
1711 Ga0163161_10043618
1712 Ga0163161_10073199
1713 Ga0163161_10077387
1714 Ga0163161_10111594
1715 Ga0163161_10235862
1716 Ga0163161_10244225
1717 Ga0209435_101197
1718 Ga0209760_100037
1719 Ga0209760_100128
1720 Ga0209784_100028
1721 Ga0209566_100028
1722 Ga0209674_100047
1723 Ga0209147_100031
1724 Ga0209563_100014
1725 Ga0209563_100050
1726 Ga0209563_103308
1727 Ga0207427_100014
1728 Ga0207427_100016
1729 Ga0209437_100011
1730 Ga0209437_100016
1731 Ga0209258_100150
1732 Ga0209646_1000183
1733 Ga0209677_100029
1734 Ga0209759_1004821
1735 Ga0209233_1000019
1736 Ga0209233_1000036
1737 Ga0209565_1007315
1738 Ga0209675_1002235
1739 Ga0209676_1000025
1740 Ga0209676_1000032
1741 Ga0209676_1000318
1742 Ga0209676_1005098
1743 Ga0209676_1008035
1744 Ga0209025_1006155
1745 Ga0209564_1000404
1746 Ga0209050_1000025
1747 Ga0209050_1000028
1748 Ga0209050_1000520
1749 Ga0209051_1000026
1750 Ga0209051_1000080
1751 Ga0209051_1000334
1752 Ga0209051_1005483
1753 Ga0209257_1000034
1754 Ga0207656_10000007
1755 Ga0207696_1000020
1756 Ga0207696_1000057
1757 Ga0207696_1000084
1758 Ga0207696_1001201
1759 Ga0207696_1002125
1760 Ga0207696_1003512
1761 Ga0207696_1009400
1762 Ga0207696_1017377
1763 Ga0207696_1051295
1764 Ga0207655_1000014
1765 Ga0207655_1000326
1766 Ga0207655_1000405
1767 Ga0207655_1000935
1768 Ga0207655_1001697
1769 Ga0207655_1002391
1770 Ga0207655_1002603
1771 Ga0207655_1011916
1772 Ga0207655_1012601
1773 Ga0207655_1014811
1774 Ga0207655_1014841
1775 Ga0207655_1015764
1776 Ga0207655_1028886
1777 Ga0207655_1057498
1778 Ga0207713_1000031
1779 Ga0207713_1000114
1780 Ga0207713_1000331
1781 Ga0207713_1000434
1782 Ga0207713_1000632
1783 Ga0207713_1002064
1784 Ga0207713_1002309
1785 Ga0207713_1006008
1786 Ga0207713_1006316
1787 Ga0207713_1007038
1788 Ga0207713_1012006
1789 Ga0207713_1030078
1790 Ga0207713_1033592
1791 Ga0207713_1074606
1792 Ga0207713_1103890
1793 Ga0207671_10000015
1794 Ga0207662_10104786
1795 Ga0207649_10000001
1796 Ga0207681_10000236
1797 Ga0207681_10001050
1798 Ga0207681_10525981
1799 Ga0207681_10677290
1800 Ga0207650_10000273
1801 Ga0207650_10000449
1802 Ga0207659_10104894
1803 Ga0207706_10000069
1804 Ga0207706_10013926
1805 Ga0207706_10410594
1806 Ga0207709_10000022
1807 Ga0207709_10000164
1808 Ga0207709_10010709
1809 Ga0207709_10077411
1810 Ga0207709_10078174
1811 Ga0207670_10010276
1812 Ga0207669_10147465
1813 Ga0207691_10026578
1814 Ga0207691_10128220
1815 Ga0207691_10623484
1816 Ga0207711_10014431
1817 Ga0207679_10000011
1818 Ga0207703_10011669
1819 Ga0207639_10023432
1820 Ga0207708_10034391
1821 Ga0207708_10057759
1822 Ga0207708_10102846
1823 Ga0207641_10119088
1824 Ga0207641_10406824
1825 Ga0207674_10413057
1826 Ga0207675_100004771
1827 Ga0207675_100007621
1828 Ga0207675_100023697
1829 Ga0207675_100029914
1830 Ga0207675_100244202
1831 Ga0209281_1000026
1832 Ga0209281_1000033
1833 Ga0209281_1009328
1834 Ga0209371_1000032
1835 Ga0209981_1011805
1836 Ga0209996_1002457
1837 Ga0209983_1003440
1838 Ga0209974_10007010
1839 Ga0207428_10007376
1840 Ga0207428_10041406
1841 Ga0207428_10065960
1842 Ga0207428_10069517
1843 Ga0207428_10084031
1844 Ga0207428_10108265
1845 Ga0207428_10352605
1846 Ga0207428_10389380
1847 Ga0268266_10008655
1848 Ga0268266_10016958
1849 Ga0268266_10075777
1850 Ga0268265_10009890
1851 Ga0268265_10206842
1852 Ga0268265_10245341
1853 Ga0268264_10141180
1854 Ga0307517_10133349
1855 Ga0307515_10016964
1856 Ga0268256_1000050
1857 Ga0307511_10014728
1858 Ga0316178_1048724
1859 Ga0316183_1029617
1860 Ga0316183_1184413
1861 Ga0316181_1024278
1862 Ga0265327_10001649
1863 Ga0265316_10148182
1864 Ga0307513_10053426
1865 Ga0307509_10222467
1866 Ga0307509_10272830
1867 Ga0307408_100014933
1868 Ga0307408_100021630
1869 Ga0307408_100034758
1870 Ga0307408_100034944
1871 Ga0307408_100073881
1872 Ga0307408_100075564
1873 Ga0307516_10105266
1874 Ga0307516_10179454
1875 Ga0307516_10291965
1876 Ga0307405_10007090
1877 Ga0307405_10010676
1878 Ga0307405_10011939
1879 Ga0307405_10029697
1880 Ga0307405_10349092
1881 Ga0307413_10009019
1882 Ga0307413_10019490
1883 Ga0307410_10013906
1884 Ga0307406_10008889
1885 Ga0307406_10009078
1886 Ga0307406_10193333
1887 Ga0307407_10002874
1888 Ga0307407_10029144
1889 Ga0307407_10165174
1890 Ga0307412_10010789
1891 Ga0307412_10017244
1892 Ga0307412_10023342
1893 Ga0307412_10024787
1894 Ga0307412_10025054
1895 Ga0307412_10052050
1896 Ga0307412_10111954
1897 Ga0307412_10134546
1898 Ga0307412_10606942
1899 Ga0307409_100019513
1900 Ga0307409_100032810
1901 Ga0307409_100054467
1902 Ga0307409_100056815
1903 Ga0307409_100244804
1904 Ga0307416_100076005
1905 Ga0307416_100085446
1906 Ga0307416_100316403
1907 Ga0307416_100450157
1908 Ga0307414_10133960
1909 Ga0307414_10140282
1910 Ga0307411_10010859
1911 Ga0307411_10074591
1912 Ga0307411_10137126
1913 Ga0307411_10667955
1914 Ga0307510_10001604
1915 Ga0373923_0183272
1916 Ga0237819_04383
1917 Ga0436363_0203368
1918 Ga0439438_001683
1919 Ga0439438_005049
1920 Ga0439438_005227
1921 Ga0439438_005882
1922 Ga0439438_005955
1923 Ga0439438_014519
1924 Ga0439438_015502
1925 Ga0439447_000222
1926 Ga0439447_001542
1927 Ga0439447_003263
1928 Ga0439447_003378
1929 Ga0439447_003431
1930 Ga0439447_011142
1931 Ga0439447_018200
1932 Ga0439466_0000445
1933 Ga0439466_0000766
1934 Ga0439466_0008181
1935 Ga0439466_0009972
1936 Ga0439466_0011547
1937 Ga0439466_0013302
1938 Ga0439466_0018228
1939 Ga0439466_0021229
1940 Ga0439465_0013323
1941 Ga0439465_0100107
1942 Ga0451853_3896997
1943 Ga0439431_0020609
1944 Ga0439445_0054975
1945 Ga0439432_000366
1946 Ga0439432_001336
1947 Ga0439432_010223
1948 Ga0439432_012452
1949 Ga0439451_006406
1950 Ga0439451_011242
1951 Ga0439451_015805
1952 Ga0439451_018930
1953 Ga0439451_022004
1954 Ga0439451_030594
1955 Ga0439451_032477
1956 Ga0439452_000231
1957 Ga0439452_000245
1958 Ga0439452_000971
1959 Ga0439452_002718
1960 Ga0439452_004643
1961 Ga0439452_004857
1962 Ga0439452_006314
1963 Ga0439452_010184
1964 Ga0439452_015932
1965 Ga0439452_052643
1966 Ga0439456_000187
1967 Ga0439456_000508
1968 Ga0439456_003564
1969 Ga0439456_008809
1970 Ga0439456_011230
1971 Ga0439456_023882
1972 Ga0439456_055448
1973 Ga0439463_001159
1974 Ga0439463_002336
1975 Ga0439463_006378
1976 Ga0439463_047433
1977 Ga0439463_084866
1978 Ga0450911_000018
1979 Ga0450911_000158
1980 Ga0450911_002529
1981 Ga0450911_007040
1982 Ga0450911_012285
1983 Ga0450919_002444
1984 Ga0450919_004450
1985 Ga0450922_000113
1986 Ga0450922_001038
1987 Ga0450922_001749
1988 Ga0450890_000475
1989 Ga0450891_006614
1990 Ga0450892_003838
1991 Ga0450900_000295
1992 Ga0450902_000139
1993 Ga0450902_008053
1994 Ga0450903_002643
1995 Ga0450903_002724
1996 Ga0450903_004552
1997 Ga0450904_000008
1998 Ga0450904_001608
1999 Ga0450905_000046
2000 Ga0450905_002730
2001 Ga0450889_002305
2002 Ga0450906_001941
2003 Ga0450906_011941
2004 Ga0450907_000206
2005 Ga0450907_000510
2006 Ga0450907_001218
2007 Ga0450910_000234
2008 Ga0450910_000702
2009 Ga0439446_0000057
2010 Ga0439446_0000824
2011 Ga0439446_0000915
2012 Ga0439446_0033009
2013 Ga0450908_011824
2014 Ga0450909_000100
2015 Ga0450909_000593
2016 Ga0439434_0000122
2017 Ga0439464_0017338
2018 Ga0439464_0026938
2019 Ga0439464_0027223
2020 Ga0439460_0003104
2021 Ga0450916_009068
2022 Ga0450918_001531
2023 Ga0450893_0028869
2024 Ga0450901_001194
2025 Ga0451577_0000162
2026 Ga0439440_0002123
2027 Ga0439440_0008434
2028 Ga0439440_0014881
2029 Ga0439440_0054445
2030 Ga0466972_0021404
2031 Ga0453684_0000524
2032 Ga0453684_0050801
2033 Ga0451576_0147329
2034 Ga0495617_000311
2035 Ga0495617_000760
2036 Ga0495617_007185
2037 Ga0495617_009067
2038 Ga0495617_016180
2039 Ga0495617_028194
2040 Ga0495617_034124
2041 Ga0495617_129684
2042 Ga0495627_000023
2043 Ga0495627_000535
2044 Ga0495627_000700
2045 Ga0495627_001188
2046 Ga0495627_005424
2047 Ga0495627_014062
2048 Ga0495627_016249
2049 Ga0495627_069507
2050 Ga0495627_082340
2051 Ga0495603_0002971
2052 Ga0495603_0029255
2053 Ga0495603_0365115
2054 Ga0495590_0001147
2055 Ga0495590_0004906
2056 Ga0495590_0011769
2057 Ga0495590_0041213
2058 Ga0495590_0041675
2059 Ga0495590_0052602
2060 Ga0495591_000025
2061 Ga0495591_000244
2062 Ga0495591_001000
2063 Ga0495591_001158
2064 Ga0495591_003990
2065 Ga0495591_007521
2066 Ga0495591_008190
2067 Ga0495591_008676
2068 Ga0495591_009244
2069 Ga0495591_010450
2070 Ga0495591_010873
2071 Ga0495591_012410
2072 Ga0495591_013066
2073 Ga0495591_013211
2074 Ga0495591_014014
2075 Ga0495591_014644
2076 Ga0495591_016439
2077 Ga0495629_0012392
2078 Ga0495638_0003177
2079 Ga0495638_0013861
2080 Ga0495638_0018877
2081 Ga0495638_0027553
2082 Ga0495638_0035891
2083 Ga0495638_0040073
2084 Ga0495638_0040296
2085 Ga0495638_0040541
2086 Ga0495638_0054021
2087 Ga0495638_0074309
2088 Ga0495638_0126508
2089 Ga0495638_0206822
2090 Ga0495638_0262452
2091 Ga0495653_0000549
2092 Ga0495653_0004108
2093 Ga0495653_0004448
2094 Ga0495653_0015276
2095 Ga0495653_0117752
2096 Ga0495650_0002476
2097 Ga0495650_0003286
2098 Ga0495650_0009444
2099 Ga0495650_0010158
2100 Ga0495650_0013860
2101 Ga0495650_0018671
2102 Ga0495650_0019017
2103 Ga0495650_0020043
2104 Ga0495650_0023131
2105 Ga0495582_0010897
2106 Ga0495605_0000095
2107 Ga0495605_0000311
2108 Ga0495605_0000328
2109 Ga0495605_0000673
2110 Ga0495605_0000878
2111 Ga0495605_0007893
2112 Ga0495605_0021899
2113 Ga0495605_0022174
2114 Ga0495605_0025515
2115 Ga0495605_0025781
2116 Ga0495605_0027744
2117 Ga0495605_0034292
2118 Ga0495605_0040001
2119 Ga0495605_0081534
2120 Ga0495639_0000238
2121 Ga0495584_0000695
2122 Ga0495584_0006560
2123 Ga0495584_0012343
2124 Ga0495584_0017637
2125 Ga0495584_0019778
2126 Ga0495584_0021080
2127 Ga0495584_0026726
2128 Ga0495584_0026880
2129 Ga0495584_0079689
2130 Ga0495584_0162024
2131 Ga0495585_0000279
2132 Ga0495585_0000790
2133 Ga0495585_0015485
2134 Ga0495585_0017325
2135 Ga0495585_0020619
2136 Ga0495585_0024730
2137 Ga0495585_0028586
2138 Ga0495585_0039605
2139 Ga0495585_0041367
2140 Ga0495585_0156740
2141 Ga0495594_0001648
2142 Ga0495594_0165561
2143 Ga0495596_0000273
2144 Ga0495596_0001654
2145 Ga0495596_0106960
2146 Ga0495607_0000298
2147 Ga0495607_0000347
2148 Ga0495607_0000776
2149 Ga0495607_0000926
2150 Ga0495607_0003337
2151 Ga0495607_0009192
2152 Ga0495607_0014199
2153 Ga0495607_0015965
2154 Ga0495607_0023469
2155 Ga0495607_0026083
2156 Ga0495607_0027199
2157 Ga0495607_0030508
2158 Ga0495607_0031519
2159 Ga0495607_0035276
2160 Ga0495607_0038582
2161 Ga0495607_0095932
2162 Ga0495607_0151695
2163 Ga0495607_0173334
2164 Ga0495607_0214045
2165 Ga0495583_0000015
2166 Ga0495583_0000756
2167 Ga0495583_0001231
2168 Ga0495583_0001865
2169 Ga0495583_0002457
2170 Ga0495583_0007128
2171 Ga0495583_0034596
2172 Ga0495583_0035663
2173 Ga0495606_0000177
2174 Ga0495606_0000214
2175 Ga0495606_0001468
2176 Ga0495606_0003165
2177 Ga0495606_0004043
2178 Ga0495606_0023244
2179 Ga0495606_0028733
2180 Ga0495606_0047242
2181 Ga0495606_0061283
2182 Ga0495606_0073664
2183 Ga0495606_0165576
2184 Ga0495610_0001476
2185 Ga0495610_0001656
2186 Ga0495610_0002687
2187 Ga0495610_0002713
2188 Ga0495610_0014482
2189 Ga0495610_0019649
2190 Ga0495610_0020743
2191 Ga0495610_0021118
2192 Ga0495610_0021713
2193 Ga0495610_0025419
2194 Ga0495610_0039121
2195 Ga0495610_0046191
2196 Ga0495610_0055928
2197 Ga0495616_0002792
2198 Ga0495616_0003688
2199 Ga0495616_0016363
2200 Ga0495616_0017474
2201 Ga0495616_0022881
2202 Ga0495616_0024171
2203 Ga0495616_0029868
2204 Ga0495616_0035822
2205 Ga0495616_0038964
2206 Ga0495616_0077485
2207 Ga0495620_0000042
2208 Ga0495620_0000456
2209 Ga0495620_0009865
2210 Ga0495620_0015816
2211 Ga0495620_0017423
2212 Ga0495620_0019562
2213 Ga0495620_0024333
2214 Ga0495620_0028670
2215 Ga0495620_0038055
2216 Ga0495628_0052974
2217 Ga0495630_0031773
2218 Ga0495630_0042381
2219 Ga0495630_0045547
2220 Ga0495630_0148290
2221 Ga0495631_0000722
2222 Ga0495631_0001940
2223 Ga0495631_0004156
2224 Ga0495631_0007549
2225 Ga0495631_0010776
2226 Ga0495631_0018255
2227 Ga0495631_0024723
2228 Ga0495631_0030012
2229 Ga0495631_0056166
2230 Ga0495631_0213472
2231 Ga0495632_0000573
2232 Ga0495632_0001250
2233 Ga0495632_0001298
2234 Ga0495632_0001313
2235 Ga0495632_0018098
2236 Ga0495632_0021657
2237 Ga0495632_0021918
2238 Ga0495632_0023580
2239 Ga0495632_0026352
2240 Ga0495632_0029999
2241 Ga0495632_0032225
2242 Ga0495632_0035243
2243 Ga0495632_0039242
2244 Ga0495632_0041983
2245 Ga0495632_0061777
2246 Ga0495632_0126065
2247 Ga0495632_0164963
2248 Ga0495637_0000020
2249 Ga0495637_0000260
2250 Ga0495637_0002002
2251 Ga0495637_0002683
2252 Ga0495637_0003016
2253 Ga0495637_0003062
2254 Ga0495637_0003107
2255 Ga0495637_0007488
2256 Ga0495637_0009364
2257 Ga0495637_0009737
2258 Ga0495637_0015922
2259 Ga0495637_0021249
2260 Ga0495637_0025903
2261 Ga0495637_0036258
2262 Ga0495637_0044510
2263 Ga0495637_0146523
2264 Ga0495643_0001642
2265 Ga0495643_0005156
2266 Ga0495643_0015742
2267 Ga0495643_0029307
2268 Ga0495643_0030123
2269 Ga0495643_0051295
2270 Ga0495643_0113684
2271 Ga0495643_0186427
2272 Ga0495644_0005182
2273 Ga0495644_0014572
2274 Ga0495644_0018081
2275 Ga0495644_0023262
2276 Ga0495644_0034029
2277 Ga0495644_0054046
2278 Ga0495644_0063295
2279 Ga0495648_0002580
2280 Ga0495648_0003045
2281 Ga0495648_0006167
2282 Ga0495648_0010821
2283 Ga0495648_0023095
2284 Ga0495648_0030337
2285 Ga0495648_0030901
2286 Ga0495648_0035313
2287 Ga0495648_0035908
2288 Ga0495648_0036080
2289 Ga0495648_0073855
2290 Ga0495648_0082529
2291 Ga0495648_0109453
2292 Ga0495648_0217211
2293 Ga0495666_0016903
2294 Ga0495666_0022639
2295 Ga0495666_0042367
2296 Ga0495642_0000088
2297 Ga0495642_0000463
2298 Ga0495642_0009974
2299 Ga0495654_0000891
2300 Ga0495654_0000985
2301 Ga0495654_0000992
2302 Ga0495654_0001624
2303 Ga0495654_0001635
2304 Ga0495654_0002244
2305 Ga0495654_0003414
2306 Ga0495654_0003637
2307 Ga0495654_0008879
2308 Ga0495654_0012750
2309 Ga0495654_0014227
2310 Ga0495654_0021323
2311 Ga0495654_0026130
2312 Ga0495654_0037251
2313 Ga0495654_0039902
2314 Ga0495654_0053155
2315 Ga0495654_0111809
2316 Ga0495586_0012298
2317 Ga0495587_0005901
2318 Ga0495587_0009517
2319 Ga0495587_0084874
2320 Ga0495609_0000102
2321 Ga0495609_0000685
2322 Ga0495609_0002004
2323 Ga0495609_0003388
2324 Ga0495609_0020583
2325 Ga0495609_0092172
2326 Ga0495597_0000186
2327 Ga0495597_0003248
2328 Ga0495597_0005301
2329 Ga0495597_0011052
2330 Ga0495597_0017828
2331 Ga0495597_0018327
2332 Ga0495597_0019376
2333 Ga0495597_0020769
2334 Ga0495597_0021836
2335 Ga0495597_0023587
2336 Ga0495597_0050214
2337 Ga0495597_0148372
2338 Ga0495645_0043946
2339 Ga0495622_0000584
2340 Ga0495622_0000824
2341 Ga0495622_0013536
2342 Ga0495622_0016065
2343 Ga0495622_0036615
2344 Ga0495622_0065658
2345 Ga0495622_0076467
2346 Ga0495633_0000366
2347 Ga0495633_0016251
2348 Ga0495633_0023594
2349 Ga0495656_0135872
2350 Ga0495668_0000866
2351 Ga0495668_0006331
2352 Ga0495668_0015395
2353 Ga0495668_0016456
2354 Ga0495668_0028055
2355 Ga0495668_0029231
2356 Ga0495668_0090101
2357 Ga0495634_0001452
2358 Ga0495634_0036339
2359 Ga0495611_0000193
2360 Ga0495611_0000386
2361 Ga0495611_0013534
2362 Ga0495611_0029148
2363 Ga0495625_0000086
2364 Ga0495625_0003090
2365 Ga0495625_0004759
2366 Ga0495625_0014227
2367 Ga0495625_0018709
2368 Ga0495625_0040156
2369 Ga0495625_0043424
2370 Ga0495625_0074575
2371 Ga0495625_0270653
2372 Ga0495625_0320783
2373 Ga0495635_0001499
2374 Ga0495635_0011073
2375 Ga0495659_0000084
2376 Ga0495659_0060613
2377 Ga0495661_0000048
2378 Ga0495661_0000058
2379 Ga0495661_0000131
2380 Ga0495661_0000171
2381 Ga0495661_0003151
2382 Ga0495661_0003488
2383 Ga0495661_0021482
2384 Ga0495661_0031618
2385 Ga0495661_0032642
2386 Ga0495661_0039629
2387 Ga0495661_0040731
2388 Ga0495661_0045970
2389 Ga0495661_0060653
2390 Ga0495661_0062033
2391 Ga0495588_0030035
2392 Ga0495588_0222789
2393 Ga0495657_0045138
2394 Ga0495623_0077213
2395 Ga0495646_0002514
2396 Ga0495669_0071894
2397 Ga0495613_0018639
2398 Ga0495624_0003730
2399 Ga0495670_0000302
2400 Ga0495670_0001543
2401 Ga0495670_0001965
2402 Ga0495670_0006959
2403 Ga0495670_0025900
2404 Ga0495670_0059985
2405 Ga0495670_0087318
2406 Ga0495670_0235322
2407 Ga0495670_0294296
2408 Ga0495671_0000157
2409 Ga0495671_0001631
2410 Ga0495671_0014239
2411 Ga0495671_0027653
2412 Ga0495671_0032379
2413 Ga0495671_0032655
2414 Ga0495671_0046879
2415 Ga0495671_0071974
2416 Ga0495671_0085061
2417 Ga0495671_0096830
2418 Ga0495671_0122494
2419 Ga0495671_0227001
2420 Ga0495649_0000782
2421 Ga0495649_0000965
2422 Ga0495649_0003415
2423 Ga0495649_0006929
2424 Ga0495649_0016636
2425 Ga0495649_0021290
2426 Ga0495649_0023174
2427 Ga0495649_0023224
2428 Ga0495649_0023339
2429 Ga0495649_0024230
2430 Ga0495649_0029107
2431 Ga0495649_0031594
2432 Ga0495649_0037264
2433 Ga0495649_0040130
2434 Ga0495649_0054920
2435 Ga0495649_0075663
2436 Ga0495649_0101197
2437 Ga0495649_0155195
2438 Ga0495649_0160496
2439 Ga0495589_0000647
2440 Ga0495589_0000866
2441 Ga0495589_0001416
2442 Ga0495589_0010462
2443 Ga0495589_0012387
2444 Ga0495589_0014178
2445 Ga0495589_0017131
2446 Ga0495589_0025324
2447 Ga0495589_0048724
2448 Ga0495589_0056841
2449 Ga0495589_0060883
2450 Ga0495600_0012548
2451 Ga0495600_0024810
2452 Ga0495600_0040754
2453 Ga0495660_0000608
2454 Ga0495660_0002259
2455 Ga0495660_0003303
2456 Ga0495660_0009505
2457 Ga0495660_0015879
2458 Ga0495660_0025139
2459 Ga0495660_0027881
2460 Ga0495660_0032244
2461 Ga0495660_0033188
2462 Ga0495660_0034505
2463 Ga0495660_0039127
2464 Ga0495660_0046476
2465 Ga0495660_0059766
2466 Ga0495660_0077036
2467 Ga0495660_0102607
2468 Ga0495660_0144202
2469 Ga0495660_0192389
2470 Ga0495581_0030841
2471 Ga0495604_0002392
2472 Ga0495604_0004861
2473 Ga0495604_0189999
2474 Ga0495604_0235501
2475 Ga0495636_0101348
2476 Ga0495674_0002066
2477 Ga0495672_0001137
2478 Ga0495672_0001472
2479 Ga0495672_0001678
2480 Ga0495672_0002315
2481 Ga0495672_0002439
2482 Ga0495672_0006904
2483 Ga0495672_0009451
2484 Ga0495672_0013935
2485 Ga0495672_0019324
2486 Ga0495672_0027020
2487 Ga0495672_0027981
2488 Ga0495672_0029335
2489 Ga0495672_0035841
2490 Ga0495672_0036952
2491 Ga0495672_0055497
2492 Ga0495672_0059881
2493 Ga0495672_0155514
2494 Ga0495672_0176448
2495 Ga0495672_0237074
2496 Ga0495676_0000022
2497 Ga0495676_0028987
2498 Ga0495680_0001940
2499 Ga0495680_0013153
2500 Ga0495680_0053910
2501 Ga0495683_0000030
2502 Ga0495683_0000927
2503 Ga0495683_0015733
2504 Ga0495683_0015950
2505 Ga0495683_0027477
2506 Ga0495683_0032163
2507 Ga0495683_0049716
2508 Ga0495683_0052556
2509 Ga0495683_0071033
2510 Ga0495683_0076886
2511 Ga0495683_0099647
2512 Ga0495683_0164105
2513 Ga0495687_002395
2514 Ga0495687_002578
2515 Ga0495687_016372
2516 Ga0495675_0002663
2517 Ga0495675_0094999
2518 Ga0495675_0135571
2519 Ga0495677_0004992
2520 Ga0495679_000218
2521 Ga0495679_008161
2522 Ga0495679_009961
2523 Ga0495679_010442
2524 Ga0495679_011633
2525 Ga0495679_013241
2526 Ga0495679_015319
2527 Ga0495679_015486
2528 Ga0495673_0000544
2529 Ga0495673_0001080
2530 Ga0495673_0001326
2531 Ga0495673_0002696
2532 Ga0495673_0004063
2533 Ga0495673_0004098
2534 Ga0495673_0005947
2535 Ga0495673_0009951
2536 Ga0495673_0010178
2537 Ga0495673_0015583
2538 Ga0495673_0016719
2539 Ga0495673_0018155
2540 Ga0495673_0023012
2541 Ga0495673_0023895
2542 Ga0495673_0023945
2543 Ga0495673_0037941
2544 Ga0495673_0069614
2545 Ga0495673_0070626
2546 Ga0495681_0000351
2547 Ga0495681_0000411
2548 Ga0495681_0000534
2549 Ga0495681_0001655
2550 Ga0495681_0004365
2551 Ga0495681_0005015
2552 Ga0495681_0005274
2553 Ga0495681_0014124
2554 Ga0495681_0015029
2555 Ga0495681_0015298
2556 Ga0495681_0015554
2557 Ga0495681_0017979
2558 Ga0495681_0018900
2559 Ga0495681_0023727
2560 Ga0495681_0028697
2561 Ga0495681_0035618
2562 Ga0495681_0040112
2563 Ga0495681_0103202
2564 Ga0495684_0272349
2565 Ga0495686_0028405
2566 Ga0495686_0030068
2567 Ga0495686_0033029
2568 Ga0495686_0040042
2569 Ga0495686_0049419
2570 Ga0495686_0075733
2571 Ga0495593_0010377
2572 Ga0495593_0020211
2573 Ga0495593_0050812
2574 Ga0495602_0058196
2575 Ga0495602_0579484
2576 Ga0495626_0000039
2577 Ga0495626_0000391
2578 Ga0495626_0000562
2579 Ga0495626_0000876
2580 Ga0495626_0001660
2581 Ga0495626_0001894
2582 Ga0495626_0017787
2583 Ga0495626_0029164
2584 Ga0495626_0050757
2585 Ga0495626_0051000
2586 Ga0496102_0001161
2587 Ga0496102_0102955
2588 Ga0496102_0205491
2589 Ga0496103_0022118
2590 Ga0496110_0051109
2591 Ga0496110_0230231
2592 Ga0496110_0569748
2593 Ga0496112_0094767
2594 Ga0496114_0015310
2595 Ga0496116_0000376
2596 Ga0496116_0001403
2597 Ga0496116_0004841
2598 Ga0496116_0037495
2599 Ga0496116_0043304
2600 Ga0496116_0056128
2601 Ga0496117_0001205
2602 Ga0496117_0004904
2603 Ga0496117_0039140
2604 Ga0496117_0041751
2605 Ga0496117_0043992
2606 Ga0496117_0148103
2607 Ga0496118_0030684
2608 Ga0496118_0040717
2609 Ga0496118_0047610
2610 Ga0496118_0086828
2611 Ga0496118_0132446
2612 Ga0496118_0132605
2613 Ga0496119_0000082
2614 Ga0496119_0148135
2615 Ga0496120_0000873
2616 Ga0496120_0017629
2617 Ga0496120_0071677
2618 Ga0496121_0001119
2619 Ga0496121_0001386
2620 Ga0496121_0033948
2621 Ga0496121_0056141
2622 Ga0496121_0080167
2623 Ga0496121_0129808
2624 Ga0496122_0003673
2625 Ga0496122_0012580
2626 Ga0496122_0027078
2627 Ga0496122_0078088
2628 Ga0496122_0090502
2629 Ga0496122_0130565
2630 Ga0496123_0002626
2631 Ga0496123_0044086
2632 Ga0496123_0047650
2633 Ga0496123_0070988
2634 Ga0496123_0081009
2635 Ga0496124_0000120
2636 Ga0496124_0014469
2637 Ga0496124_0023214
2638 Ga0496124_0024564
2639 Ga0496124_0030509
2640 Ga0496124_0039994
2641 Ga0496124_0050285
2642 Ga0496124_0062371
2643 Ga0496124_0078549
2644 Ga0496124_0272504
2645 Ga0496125_0000799
2646 Ga0496125_0006647
2647 Ga0496125_0027012
2648 Ga0496125_0060412
2649 Ga0496125_0163594
2650 Ga0495678_000017
2651 Ga0495678_000693
2652 Ga0495678_011031
2653 Ga0495678_011218
2654 Ga0495678_013930
2655 Ga0495678_015310
2656 Ga0495678_015877
2657 Ga0495678_016010
2658 Ga0495678_019562
2659 Ga0495678_022757
2660 Ga0495678_024466
2661 Ga0495678_058860
2662 Ga0495682_0000182
2663 Ga0495682_0003288
2664 Ga0495682_0007762
2665 Ga0495682_0014543
2666 Ga0495682_0034520
2667 Ga0495682_0048640
2668 Ga0495682_0056984
2669 Ga0495682_0147905
2670 Ga0501038_0045138
2671 Ga0501039_0501836
2672 Ga0501040_0344442
2673 Ga0501042_0108652
2674 Ga0501043_0011788
2675 Ga0501046_0196489
2676 Ga0501047_0004948
2677 Ga0501047_0133524
2678 Ga0501067_0004678
2679 Ga0501067_0118484
2680 Ga0501068_0004775
2681 Ga0501070_0049378
2682 Ga0501071_0038675
2683 Ga0501071_0183209
2684 Ga0501072_0111218
2685 Ga0501073_0000405
2686 Ga0501073_0010478
2687 Ga0501073_0234756
2688 Ga0501075_0005105
2689 Ga0501076_0014020
2690 Ga0501076_0021177
2691 Ga0501077_0020106
2692 Ga0501077_0302071
2693 Ga0501079_0011299
2694 Ga0501080_0001172
2695 Ga0501080_0146927
2696 Ga0501080_0147183
2697 Ga0501081_0007493
2698 Ga0501081_0122715
2699 Ga0501083_0029801
2700 Ga0501241_000354
2701 Ga0501044_0248569
2702 nmdc:mga00v17_210902_c1
2703 nmdc:mga00v17_43712_c1
2704 nmdc:mga0qj67_438605_c1
2705 nmdc:mga08y16_657244_c1
2706 nmdc:mga08x19_332261_c1
2707 Ga0500583_0003831
2708 Ga0500583_0014754
2709 Ga0500651_0183419
2710 Ga0500641_0007501
2711 Ga0500556_0020665
2712 Ga0500569_023472
2713 Ga0500572_004875
2714 Ga0500593_112169
2715 Ga0500595_003422
2716 Ga0500573_0047189
2717 Ga0500616_0000092
2718 Ga0500616_0008351
2719 Ga0500622_0002074
2720 Ga0500627_0051543
2721 Ga0500634_0026210
2722 Ga0501084_0040792
2723 Ga0501084_0064459
2724 Ga0501082_0047472
2725 Ga0501082_0922531
2726 Ga0530510_0032432
2727 2808939683
2728 2510284315
2729 2510292996
2730 2510312502
2731 2511256400
2732 2511266106
2733 2511278978
2734 2511288784
2735 2511297349
2736 2511300350
2737 2511316714
2738 2511317628
2739 2511326023
2740 2511330985
2741 2511336320
2742 2511349116
2743 2511355992
2744 2511362595
2745 2511366827
2746 2511411317
2747 2511822457
2748 2512325958
2749 2555245724
2750 2555667420
2751 2583789802
2752 2597855664
2753 2597861664
2754 2597867389
2755 2599327422
2756 2599356643
2757 2599363327
2758 2599369721
2759 2599376436
2760 2599381748
2761 2599388108
2762 2599395368
2763 2599398849
2764 2599407133
2765 2599450904
2766 2599463476
2767 2599469174
2768 2599485566
2769 2599492493
2770 2599500108
2771 2599506430
2772 2599514150
2773 2599518751
2774 2599614592
2775 2599769413
2776 2599806695
2777 2599882666
2778 2599886833
2779 2599893515
2780 2599898162
2781 2599930895
2782 2599943599
2783 2599950757
2784 2599955910
2785 2599962039
2786 2599964551
2787 2599978908
2788 2599984603
2789 2599991244
2790 2599994850
2791 2600002225
2792 2600004864
2793 2600012868
2794 2600018973
2795 2600023969
2796 2600030994
2797 2600034670
2798 2600043463
2799 2600048055
2800 2600053326
2801 2600061328
2802 2600067616
2803 2600071793
2804 2600077662
2805 2600216105
2806 2600360885
2807 2600364881
2808 2601692349
2809 2601776272
2810 2601797836
2811 2602008645
2812 2606076681
2813 2606128905
2814 2621302176
2815 2624478225
2816 2643872617
2817 2643954899
2818 2644024539
2819 2644186125
2820 2644282073
2821 2644619650
2822 2652543419
2823 2671090799
2824 2671099967
2825 2671127338
2826 2671772346
2827 2677898952
2828 2678260990
2829 2715749210
2830 2715755480
2831 2718632162
2832 2723246562
2833 2738674089
2834 2738752482
2835 2738807905
2836 2738861523
2837 2738895265
2838 2739198030
2839 2739260294
2840 2739288589
2841 2739293901
2842 2739311284
2843 2743735081
2844 2745006302
2845 2774119557
2846 2774131495
2847 2774134740
2848 2784261043
2849 2784315968
2850 2794593981
2851 2808855941
2852 2808905431
2853 2808922744
2854 2808932179
2855 2808936021
2856 2808944431
2857 2808954220
2858 2808964482
2859 2808976658
2860 2808991904
2861 2808999370
2862 2809217980
2863 2812370181
2864 2817488414
2865 2819657234
2866 2819705217
2867 2823425500
2868 2825654264
2869 2826586874
2870 2834032209
2871 2842807109
2872 2842816692
2873 2842832087
2874 2842834162
2875 2842838637
2876 2842846361
2877 2842852260
2878 2842858724
2879 2844667900
2880 2852617078
2881 2852660449
2882 2852671933
2883 2860868438
2884 2878030168
2885 2880231115
2886 2894513819
2887 2904519574
2888 2904552156
2889 2908447031
2890 2912964087
2891 2913037288
2892 2917071171
2893 2917836379
2894 2919066150
2895 2919127488
2896 2919155786
2897 2919389774
2898 2919459987
2899 2919486893
2900 2919488701
2901 2919502235
2902 2923154076
2903 2923524272
2904 2923589788
2905 2926063908
2906 2929144819
2907 2929190303
2908 2931371845
2909 2931391382
2910 2935358999
2911 2939654979
2912 2945930164
2913 2945967592
2914 2946012511
2915 2946028646
2916 2947235173
2917 2969304961
2918 2974293347
2919 2974301735
2920 2984291983
2921 2984500696
2922 2984507219
2923 2988732208
2924 2989393230
2925 2990199578
2926 2998140464
2927 3007255370
2928 3007315824
2929 3007399627
2930 3007420026
2931 3007517909
2932 3007618652
2933 3007624986
2934 3007721225
2935 3007859704
2936 3007864323
2937 3007872019
2938 637317817
2939 8015688325
2940 8030000274
2941 8054291526
2942 8054350128
2943 8054503969
2944 8055771422
2945 8055818365
2946 8056126477
2947 8056132339
2948 8056143741
2949 8056152479
2950 8056158516
2951 8056164345
2952 8056170587
2953 8056176702
2954 8056183039
2955 8056572323
2956 8057802711

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

49

213

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7msn-assembly1.cif.gz_B suns glycosin s-glycosyltransferase 0.7923 2 118
2bo7-assembly2.cif.gz_F dissection of mannosylglycerate synthase: an archetypal mannosyltransferase 0.7605 5 204
7pho-assembly1.cif.gz_B crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.1 in complex with 4-hydroxybenzaldehyde 0.7409 2 203
7p8g-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 - apo form 0.7318 2 230
7pdo-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp 0.7301 2 230
ID Description Score Start End Superfamily
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8775 4 235 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8674 4 226 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8638 3 223 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8452 3 223 3.90.550.10
af_P40350_49_327_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8354 2 232 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2W5I6R2-F1-model_v4 deleted 0.9937 3 119
AF-A0A0D0RUL3-F1-model_v4 Undecaprenyl-phosphate mannosyltransferase (EC 2.4.1.54) 0.9908 1 244 GO:0006487
GO:0047267
AF-A0A0R2ZGR6-F1-model_v4 Glycosyl transferase 0.9901 1 244 GO:0006487
GO:0016740
AF-A0A560SVF0-F1-model_v4 Glycosyltransferase involved in cell wall biosynthesis 0.9898 1 244 GO:0006487
GO:0016740
AF-A0A063BH90-F1-model_v4 Glycosyl transferase family 2 0.9884 1 240 GO:0005886
GO:0006487
GO:0009247
GO:0016746

Map