F494259
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1478 | 589 | 2956 | 245 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2808606379|2808939683 |
| Length | 288 |
| Sequence | PLNSVGEAVSARQERAKKRSLPALNEHSEPVLNAAMATQVAFQGLHKPCAVIPVYNHEQALAQVVQALRASGWPCVLVDDGSHPGCARVIEQVVAQTASHLLRLPSNQGKGGAVMAGLREAARLGYSHALQVDADGQHDLDNLGDFLAASQAHPQALICGYPRYDASVPKSRLYARYLTHVWVWINSLSLHIRDSMCGFRIYPLTPTLALLDTVTIGKRMDFDTDILVRLSWRNQPMRWLPVRVHYPADGVSHFRLLEDNLLISRMHARLFFGMLWRAPQLLWRRWRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 82 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 110 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 143 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 153 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 154 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 156 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 157 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 158 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 159 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 162 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 169 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 176 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 178 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 179 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 180 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 181 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 182 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 183 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 184 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 185 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 186 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 187 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 188 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 189 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 190 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 191 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 192 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 193 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 194 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 195 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 196 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 197 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 198 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 199 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 200 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 201 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 202 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 203 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 204 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 205 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 206 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 207 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 208 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 209 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 210 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 211 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 212 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 213 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 214 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 215 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 216 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 217 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 218 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 219 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 306 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 307 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 308 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 309 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 310 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 311 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 312 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 313 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 314 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 315 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 316 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 339 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 345 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 346 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 347 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 348 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 349 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 350 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 351 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 352 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 353 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 354 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 355 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 357 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 360 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 361 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 362 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 363 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 364 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 365 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 366 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 367 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 368 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 369 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 370 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 371 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 372 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 373 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 374 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 375 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 376 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 377 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 378 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 379 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 380 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 381 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 382 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 383 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 384 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 385 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 386 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 387 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 388 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 389 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 390 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 391 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 392 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 393 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 394 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 395 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 396 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 397 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 398 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 399 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 400 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 401 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 402 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 403 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 404 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 405 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 406 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 407 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 408 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 409 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 410 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 411 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 412 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 413 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 414 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 415 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 416 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 417 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 418 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 419 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 420 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 421 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 422 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 423 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 424 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 425 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 426 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 427 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 428 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 429 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 430 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 431 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 432 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 433 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 434 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 435 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 436 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 437 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 438 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 439 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 440 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 441 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 442 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 443 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 444 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 445 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 446 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 447 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 448 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 449 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 450 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 451 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 452 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 453 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 454 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 455 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 456 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 457 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 458 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 459 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 460 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 461 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 462 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 463 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 464 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 465 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 466 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 467 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 468 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 469 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 470 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 471 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 472 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 473 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 474 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 475 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 476 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 477 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 478 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 479 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 480 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 481 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 482 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 483 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 484 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 485 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 486 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 487 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 488 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 489 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 490 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 491 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 492 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 493 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 494 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 495 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 496 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 497 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 498 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 499 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 500 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 501 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 502 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 503 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 504 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 505 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 506 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 507 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 508 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 509 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 510 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 511 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 512 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 513 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 514 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 515 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 516 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 517 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 518 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 519 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 520 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 521 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 522 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 523 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 524 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 525 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 526 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 527 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 528 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 529 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 530 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 531 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 532 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 533 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 534 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 535 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 536 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 537 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 538 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 539 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 540 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 541 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 542 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 543 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 544 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 545 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 546 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 547 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 548 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 549 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 550 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 551 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 552 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 553 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 554 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 555 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 556 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 557 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 558 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 559 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 560 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 561 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 562 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 563 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 564 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 565 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 566 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 567 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 568 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 569 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 570 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 571 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 572 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 573 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 574 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 575 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 576 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 577 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 578 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 579 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 580 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 581 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 582 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 583 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 584 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 585 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 586 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 587 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 588 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 589 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.44 |
| Metatranscriptomes | 0 |
| Isolates | 15.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.14 |
| Bulb | 0 |
| Endosphere | 5.55 |
| Nodule | 1.56 |
| Rhizoplane | 5.01 |
| Rhizosphere | 78.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_10320 | 2124908027 | Bacteria | 1437 |
| 2 | MRS2a_Contig_66 | 2124908027 | Bacteria | 22945 |
| 3 | SwRhRL2b_contig_1197704 | 2162886007 | Bacteria | 1199 |
| 4 | JGI24741J21665_1006033 | 3300001915 | Bacteria | 2470 |
| 5 | JGI25162J39368_1000140 | 3300002737 | Bacteria | 78251 |
| 6 | JGI25162J39368_1000181 | 3300002737 | Bacteria | 67817 |
| 7 | JGI25154J39366_1003720 | 3300002738 | Bacteria | 3050 |
| 8 | JGI25163J39215_1000195 | 3300002771 | Bacteria | 23525 |
| 9 | JGI25163J39215_1000288 | 3300002771 | Bacteria | 17349 |
| 10 | JGI25164J39214_1000110 | 3300002772 | Bacteria | 78251 |
| 11 | JGI25164J39214_1000146 | 3300002772 | Bacteria | 67817 |
| 12 | JGI25406J46586_10003703 | 3300003203 | Bacteria | 7163 |
| 13 | JGI25165J46597_1000228 | 3300003214 | Bacteria | 78251 |
| 14 | JGI25165J46597_1000267 | 3300003214 | Bacteria | 67817 |
| 15 | rootH1_10143248 | 3300003323 | Bacteria | 2492 |
| 16 | Ga0055538_1000037 | 3300003751 | Bacteria | 190238 |
| 17 | Ga0055539_1000048 | 3300003752 | Bacteria | 190238 |
| 18 | Ga0055533_1000059 | 3300003756 | Bacteria | 190238 |
| 19 | Ga0055532_1000105 | 3300003758 | Bacteria | 91428 |
| 20 | Ga0055525_1000057 | 3300003759 | Bacteria | 211185 |
| 21 | Ga0055525_1000128 | 3300003759 | Bacteria | 113553 |
| 22 | Ga0055535_1006635 | 3300003761 | Bacteria | 2315 |
| 23 | Ga0055526_1000962 | 3300003771 | Bacteria | 21277 |
| 24 | Ga0055536_1000328 | 3300003781 | Bacteria | 35005 |
| 25 | Ga0055536_1000392 | 3300003781 | Bacteria | 31780 |
| 26 | Ga0055536_1000624 | 3300003781 | Bacteria | 24057 |
| 27 | Ga0055536_1039737 | 3300003781 | Bacteria | 1127 |
| 28 | Ga0055530_10000098 | 3300003791 | Bacteria | 73644 |
| 29 | Ga0055530_10000333 | 3300003791 | Bacteria | 42485 |
| 30 | Ga0055530_10002459 | 3300003791 | Bacteria | 11881 |
| 31 | Ga0055540_1000138 | 3300003792 | Bacteria | 73170 |
| 32 | Ga0055540_1000279 | 3300003792 | Bacteria | 45880 |
| 33 | Ga0055540_1000586 | 3300003792 | Bacteria | 26511 |
| 34 | Ga0055531_10000321 | 3300003794 | Bacteria | 47157 |
| 35 | Ga0055541_1000035 | 3300003841 | Bacteria | 190238 |
| 36 | Ga0065714_10002325 | 3300005288 | Bacteria | 36328 |
| 37 | Ga0065714_10065492 | 3300005288 | Bacteria | 9763 |
| 38 | Ga0065714_10072189 | 3300005288 | Bacteria | 3411 |
| 39 | Ga0065714_10103225 | 3300005288 | Bacteria | 1607 |
| 40 | Ga0065714_10165111 | 3300005288 | Bacteria | 1031 |
| 41 | Ga0065704_10013597 | 3300005289 | Bacteria | 1490 |
| 42 | Ga0065704_10038164 | 3300005289 | Bacteria | 1110 |
| 43 | Ga0065704_10078436 | 3300005289 | Bacteria | 4426 |
| 44 | Ga0065715_10109483 | 3300005293 | Bacteria | 2666 |
| 45 | Ga0070676_10046631 | 3300005328 | Bacteria | 2528 |
| 46 | Ga0070690_100003509 | 3300005330 | Bacteria | 8582 |
| 47 | Ga0070670_100002909 | 3300005331 | Bacteria | 14174 |
| 48 | Ga0070670_100020308 | 3300005331 | Bacteria | 5708 |
| 49 | Ga0070670_100069743 | 3300005331 | Bacteria | 3018 |
| 50 | Ga0068868_100596275 | 3300005338 | Bacteria | 978 |
| 51 | Ga0070689_100001983 | 3300005340 | Bacteria | 13250 |
| 52 | Ga0070689_100070459 | 3300005340 | Bacteria | 2730 |
| 53 | Ga0070661_100000078 | 3300005344 | Bacteria | 77449 |
| 54 | Ga0070669_100000221 | 3300005353 | Bacteria | 47408 |
| 55 | Ga0070675_100107876 | 3300005354 | Bacteria | 2352 |
| 56 | Ga0070674_100178907 | 3300005356 | Bacteria | 1623 |
| 57 | Ga0070674_100677088 | 3300005356 | Bacteria | 879 |
| 58 | Ga0070688_100009229 | 3300005365 | Bacteria | 5384 |
| 59 | Ga0070688_100050324 | 3300005365 | Bacteria | 2595 |
| 60 | Ga0070701_10009191 | 3300005438 | Bacteria | 4320 |
| 61 | Ga0070705_100006396 | 3300005440 | Bacteria | 5774 |
| 62 | Ga0070700_100057629 | 3300005441 | Bacteria | 2438 |
| 63 | Ga0070662_100000095 | 3300005457 | Bacteria | 48526 |
| 64 | Ga0070662_100010823 | 3300005457 | Bacteria | 6005 |
| 65 | Ga0070685_10127159 | 3300005466 | Bacteria | 1589 |
| 66 | Ga0070698_100061858 | 3300005471 | Bacteria | 3778 |
| 67 | Ga0068853_100000089 | 3300005539 | Bacteria | 62291 |
| 68 | Ga0070672_100092797 | 3300005543 | Bacteria | 2438 |
| 69 | Ga0070672_100109191 | 3300005543 | Bacteria | 2253 |
| 70 | Ga0070672_100311912 | 3300005543 | Bacteria | 1336 |
| 71 | Ga0070686_100014835 | 3300005544 | Bacteria | 4498 |
| 72 | Ga0070696_100166990 | 3300005546 | Bacteria | 1625 |
| 73 | Ga0070693_100098972 | 3300005547 | Bacteria | 1773 |
| 74 | Ga0070665_100002013 | 3300005548 | Bacteria | 22856 |
| 75 | Ga0070665_100006705 | 3300005548 | Bacteria | 11705 |
| 76 | Ga0070704_100058517 | 3300005549 | Bacteria | 2746 |
| 77 | Ga0068855_100667255 | 3300005563 | Bacteria | 1115 |
| 78 | Ga0070664_100000391 | 3300005564 | Bacteria | 32645 |
| 79 | Ga0070664_100052654 | 3300005564 | Bacteria | 3448 |
| 80 | Ga0068854_100001775 | 3300005578 | Bacteria | 13130 |
| 81 | Ga0070702_100001974 | 3300005615 | Bacteria | 8636 |
| 82 | Ga0068859_100013045 | 3300005617 | Bacteria | 8351 |
| 83 | Ga0068859_100080101 | 3300005617 | Bacteria | 3306 |
| 84 | Ga0068859_100131788 | 3300005617 | Bacteria | 2572 |
| 85 | Ga0068861_100002242 | 3300005719 | Bacteria | 12547 |
| 86 | Ga0068861_100069542 | 3300005719 | Bacteria | 2724 |
| 87 | Ga0068861_100071415 | 3300005719 | Bacteria | 2691 |
| 88 | Ga0068861_100278312 | 3300005719 | Bacteria | 1440 |
| 89 | Ga0068861_100558330 | 3300005719 | Bacteria | 1044 |
| 90 | Ga0068851_10000024 | 3300005834 | Bacteria | 125917 |
| 91 | Ga0068870_10245072 | 3300005840 | Bacteria | 1108 |
| 92 | Ga0068863_100277144 | 3300005841 | Bacteria | 1624 |
| 93 | Ga0068863_100321199 | 3300005841 | Bacteria | 1504 |
| 94 | Ga0068858_100012305 | 3300005842 | Bacteria | 8069 |
| 95 | Ga0068860_100026372 | 3300005843 | Bacteria | 5602 |
| 96 | Ga0068862_100009441 | 3300005844 | Bacteria | 8070 |
| 97 | Ga0068862_100045897 | 3300005844 | Bacteria | 3729 |
| 98 | Ga0068862_100094782 | 3300005844 | Bacteria | 2603 |
| 99 | Ga0081455_10000032 | 3300005937 | Bacteria | 146266 |
| 100 | Ga0081539_10000007 | 3300005985 | Bacteria | 532790 |
| 101 | Ga0075364_10100175 | 3300006051 | Bacteria | 1929 |
| 102 | Ga0075364_10116716 | 3300006051 | Bacteria | 1785 |
| 103 | Ga0075364_10272890 | 3300006051 | Bacteria | 1150 |
| 104 | Ga0075432_10000629 | 3300006058 | Bacteria | 10741 |
| 105 | Ga0075432_10013530 | 3300006058 | Bacteria | 2772 |
| 106 | Ga0075432_10029736 | 3300006058 | Bacteria | 1887 |
| 107 | Ga0075432_10040005 | 3300006058 | Bacteria | 1636 |
| 108 | Ga0075432_10048055 | 3300006058 | Bacteria | 1500 |
| 109 | Ga0075432_10065001 | 3300006058 | Bacteria | 1303 |
| 110 | Ga0097621_100109048 | 3300006237 | Bacteria | 2338 |
| 111 | Ga0097621_100186931 | 3300006237 | Bacteria | 1792 |
| 112 | Ga0068871_100053807 | 3300006358 | Bacteria | 3264 |
| 113 | Ga0068871_100229118 | 3300006358 | Bacteria | 1612 |
| 114 | Ga0068871_100284365 | 3300006358 | Bacteria | 1448 |
| 115 | Ga0068871_100656965 | 3300006358 | Bacteria | 958 |
| 116 | Ga0075428_100429130 | 3300006844 | Bacteria | 1416 |
| 117 | Ga0075436_100116729 | 3300006914 | Bacteria | 1865 |
| 118 | Ga0075436_100152520 | 3300006914 | Bacteria | 1626 |
| 119 | Ga0097620_100013045 | 3300006931 | Bacteria | 8351 |
| 120 | Ga0097620_100080104 | 3300006931 | Bacteria | 3306 |
| 121 | Ga0097620_100131790 | 3300006931 | Bacteria | 2572 |
| 122 | Ga0079104_1000229 | 3300006946 | Bacteria | 75907 |
| 123 | Ga0079104_1000296 | 3300006946 | Bacteria | 63123 |
| 124 | Ga0079104_1014254 | 3300006946 | Bacteria | 2405 |
| 125 | Ga0105251_10000113 | 3300009011 | Bacteria | 80570 |
| 126 | Ga0105251_10000303 | 3300009011 | Bacteria | 49448 |
| 127 | Ga0105251_10000361 | 3300009011 | Bacteria | 44718 |
| 128 | Ga0105251_10001591 | 3300009011 | Bacteria | 19391 |
| 129 | Ga0105251_10005307 | 3300009011 | Bacteria | 8476 |
| 130 | Ga0105251_10007332 | 3300009011 | Bacteria | 6821 |
| 131 | Ga0105251_10011289 | 3300009011 | Bacteria | 5111 |
| 132 | Ga0105251_10014426 | 3300009011 | Bacteria | 4367 |
| 133 | Ga0105251_10017751 | 3300009011 | Bacteria | 3804 |
| 134 | Ga0105251_10081785 | 3300009011 | Bacteria | 1492 |
| 135 | Ga0105244_10000982 | 3300009036 | Bacteria | 23922 |
| 136 | Ga0105244_10001234 | 3300009036 | Bacteria | 20974 |
| 137 | Ga0105244_10005115 | 3300009036 | Bacteria | 8803 |
| 138 | Ga0105244_10006072 | 3300009036 | Bacteria | 7902 |
| 139 | Ga0105244_10007513 | 3300009036 | Bacteria | 6920 |
| 140 | Ga0105244_10008576 | 3300009036 | Bacteria | 6375 |
| 141 | Ga0105244_10046052 | 3300009036 | Bacteria | 2242 |
| 142 | Ga0105244_10112754 | 3300009036 | Bacteria | 1321 |
| 143 | Ga0105244_10148006 | 3300009036 | Bacteria | 1126 |
| 144 | Ga0105250_10000189 | 3300009092 | Bacteria | 52791 |
| 145 | Ga0105250_10000211 | 3300009092 | Bacteria | 48658 |
| 146 | Ga0105250_10002092 | 3300009092 | Bacteria | 10238 |
| 147 | Ga0105250_10009368 | 3300009092 | Bacteria | 4127 |
| 148 | Ga0105250_10029541 | 3300009092 | Bacteria | 2205 |
| 149 | Ga0105250_10034565 | 3300009092 | Bacteria | 2028 |
| 150 | Ga0105250_10049723 | 3300009092 | Bacteria | 1682 |
| 151 | Ga0111539_10084056 | 3300009094 | Bacteria | 3743 |
| 152 | Ga0105243_10000370 | 3300009148 | Bacteria | 48223 |
| 153 | Ga0105243_10000595 | 3300009148 | Bacteria | 36195 |
| 154 | Ga0105243_10008730 | 3300009148 | Bacteria | 7767 |
| 155 | Ga0105243_10009526 | 3300009148 | Bacteria | 7394 |
| 156 | Ga0105243_10047309 | 3300009148 | Bacteria | 3386 |
| 157 | Ga0105243_10093187 | 3300009148 | Bacteria | 2485 |
| 158 | Ga0105243_10116421 | 3300009148 | Bacteria | 2245 |
| 159 | Ga0105242_10000136 | 3300009176 | Bacteria | 53348 |
| 160 | Ga0105242_10093581 | 3300009176 | Bacteria | 2534 |
| 161 | Ga0105248_10004445 | 3300009177 | Bacteria | 15525 |
| 162 | Ga0105248_10626155 | 3300009177 | Bacteria | 1214 |
| 163 | Ga0105237_10000939 | 3300009545 | Bacteria | 39181 |
| 164 | Ga0105249_10539819 | 3300009553 | Bacteria | 1216 |
| 165 | Ga0105249_10715742 | 3300009553 | Bacteria | 1062 |
| 166 | Ga0105246_10000042 | 3300011119 | Bacteria | 48091 |
| 167 | Ga0105246_10002498 | 3300011119 | Bacteria | 11121 |
| 168 | Ga0105246_10068492 | 3300011119 | Bacteria | 2489 |
| 169 | Ga0157336_1001109 | 3300012477 | Bacteria | 1345 |
| 170 | Ga0157345_1000068 | 3300012498 | Bacteria | 21372 |
| 171 | Ga0157373_10000993 | 3300013100 | Bacteria | 21947 |
| 172 | Ga0157373_10005678 | 3300013100 | Bacteria | 9347 |
| 173 | Ga0157373_10016864 | 3300013100 | Bacteria | 5326 |
| 174 | Ga0157373_10024956 | 3300013100 | Bacteria | 4328 |
| 175 | Ga0157373_10052818 | 3300013100 | Bacteria | 2890 |
| 176 | Ga0157373_10074581 | 3300013100 | Bacteria | 2393 |
| 177 | Ga0157373_10113151 | 3300013100 | Bacteria | 1907 |
| 178 | Ga0157373_10195597 | 3300013100 | Bacteria | 1425 |
| 179 | Ga0157371_10000811 | 3300013102 | Bacteria | 35895 |
| 180 | Ga0157371_10001369 | 3300013102 | Bacteria | 25570 |
| 181 | Ga0157371_10011701 | 3300013102 | Bacteria | 6742 |
| 182 | Ga0157371_10034037 | 3300013102 | Bacteria | 3658 |
| 183 | Ga0157370_10000150 | 3300013104 | Bacteria | 85732 |
| 184 | Ga0157370_10011272 | 3300013104 | Bacteria | 9372 |
| 185 | Ga0157370_10016274 | 3300013104 | Bacteria | 7535 |
| 186 | Ga0157370_10050485 | 3300013104 | Bacteria | 3976 |
| 187 | Ga0157370_10068628 | 3300013104 | Bacteria | 3350 |
| 188 | Ga0157370_10078398 | 3300013104 | Bacteria | 3111 |
| 189 | Ga0157370_10129827 | 3300013104 | Bacteria | 2351 |
| 190 | Ga0157370_10308096 | 3300013104 | Bacteria | 1461 |
| 191 | Ga0157370_10379630 | 3300013104 | Bacteria | 1302 |
| 192 | Ga0157369_10001261 | 3300013105 | Bacteria | 31458 |
| 193 | Ga0157369_10001555 | 3300013105 | Bacteria | 28080 |
| 194 | Ga0157369_10015276 | 3300013105 | Bacteria | 8658 |
| 195 | Ga0157369_10038743 | 3300013105 | Bacteria | 5211 |
| 196 | Ga0157369_10411589 | 3300013105 | Bacteria | 1402 |
| 197 | Ga0163162_10071200 | 3300013306 | Bacteria | 3530 |
| 198 | Ga0157372_10001525 | 3300013307 | Bacteria | 25180 |
| 199 | Ga0157372_10008414 | 3300013307 | Bacteria | 10959 |
| 200 | Ga0157372_10712478 | 3300013307 | Bacteria | 1168 |
| 201 | Ga0157375_10001875 | 3300013308 | Bacteria | 18102 |
| 202 | Ga0157375_10008094 | 3300013308 | Bacteria | 9196 |
| 203 | Ga0157375_10087456 | 3300013308 | Bacteria | 3169 |
| 204 | Ga0157375_10255579 | 3300013308 | Bacteria | 1913 |
| 205 | Ga0157380_10008871 | 3300014326 | Bacteria | 7184 |
| 206 | Ga0182008_10001166 | 3300014497 | Bacteria | 18127 |
| 207 | Ga0182008_10002891 | 3300014497 | Bacteria | 10628 |
| 208 | Ga0182008_10003251 | 3300014497 | Bacteria | 9914 |
| 209 | Ga0182008_10004481 | 3300014497 | Bacteria | 8162 |
| 210 | Ga0182008_10013634 | 3300014497 | Bacteria | 4271 |
| 211 | Ga0182008_10014614 | 3300014497 | Bacteria | 4106 |
| 212 | Ga0182008_10019620 | 3300014497 | Bacteria | 3488 |
| 213 | Ga0182008_10027535 | 3300014497 | Bacteria | 2878 |
| 214 | Ga0182008_10034067 | 3300014497 | Bacteria | 2554 |
| 215 | Ga0157376_10560650 | 3300014969 | Unclassified | 1132 |
| 216 | Ga0157376_10953193 | 3300014969 | Bacteria | 879 |
| 217 | Ga0182006_1000380 | 3300015261 | Bacteria | 36760 |
| 218 | Ga0182006_1000786 | 3300015261 | Bacteria | 21399 |
| 219 | Ga0182006_1005806 | 3300015261 | Bacteria | 5818 |
| 220 | Ga0182006_1034120 | 3300015261 | Bacteria | 2037 |
| 221 | Ga0182006_1056815 | 3300015261 | Bacteria | 1489 |
| 222 | Ga0182007_10000194 | 3300015262 | Bacteria | 40895 |
| 223 | Ga0182007_10012110 | 3300015262 | Bacteria | 3329 |
| 224 | Ga0182005_1000459 | 3300015265 | Bacteria | 21396 |
| 225 | Ga0182005_1001444 | 3300015265 | Bacteria | 9571 |
| 226 | Ga0182005_1018415 | 3300015265 | Bacteria | 1930 |
| 227 | Ga0182005_1019329 | 3300015265 | Bacteria | 1878 |
| 228 | Ga0182005_1028515 | 3300015265 | Bacteria | 1522 |
| 229 | Ga0163161_10000719 | 3300017792 | Bacteria | 26142 |
| 230 | Ga0163161_10001156 | 3300017792 | Bacteria | 19877 |
| 231 | Ga0163161_10007778 | 3300017792 | Bacteria | 7414 |
| 232 | Ga0163161_10021521 | 3300017792 | Bacteria | 4531 |
| 233 | Ga0163161_10043618 | 3300017792 | Bacteria | 3230 |
| 234 | Ga0163161_10073199 | 3300017792 | Bacteria | 2510 |
| 235 | Ga0163161_10077387 | 3300017792 | Bacteria | 2443 |
| 236 | Ga0163161_10111594 | 3300017792 | Bacteria | 2044 |
| 237 | Ga0163161_10235862 | 3300017792 | Bacteria | 1421 |
| 238 | Ga0163161_10244225 | 3300017792 | Bacteria | 1397 |
| 239 | Ga0209435_101197 | 3300025206 | Bacteria | 3493 |
| 240 | Ga0209760_100037 | 3300025207 | Bacteria | 129761 |
| 241 | Ga0209760_100128 | 3300025207 | Bacteria | 50562 |
| 242 | Ga0209784_100028 | 3300025224 | Bacteria | 357464 |
| 243 | Ga0209566_100028 | 3300025225 | Bacteria | 357464 |
| 244 | Ga0209674_100047 | 3300025226 | Bacteria | 357464 |
| 245 | Ga0209147_100031 | 3300025229 | Bacteria | 357464 |
| 246 | Ga0209563_100014 | 3300025230 | Bacteria | 940582 |
| 247 | Ga0209563_100050 | 3300025230 | Bacteria | 357464 |
| 248 | Ga0209563_103308 | 3300025230 | Bacteria | 3369 |
| 249 | Ga0207427_100014 | 3300025231 | Bacteria | 561361 |
| 250 | Ga0207427_100016 | 3300025231 | Bacteria | 538697 |
| 251 | Ga0209437_100011 | 3300025233 | Bacteria | 818520 |
| 252 | Ga0209437_100016 | 3300025233 | Bacteria | 710118 |
| 253 | Ga0209258_100150 | 3300025242 | Bacteria | 161813 |
| 254 | Ga0209646_1000183 | 3300025246 | Bacteria | 79021 |
| 255 | Ga0209677_100029 | 3300025253 | Bacteria | 357464 |
| 256 | Ga0209759_1004821 | 3300025256 | Bacteria | 4907 |
| 257 | Ga0209233_1000019 | 3300025261 | Bacteria | 818520 |
| 258 | Ga0209233_1000036 | 3300025261 | Bacteria | 561361 |
| 259 | Ga0209565_1007315 | 3300025263 | Bacteria | 2991 |
| 260 | Ga0209675_1002235 | 3300025291 | Bacteria | 10113 |
| 261 | Ga0209676_1000025 | 3300025292 | Bacteria | 577569 |
| 262 | Ga0209676_1000032 | 3300025292 | Bacteria | 469558 |
| 263 | Ga0209676_1000318 | 3300025292 | Bacteria | 94045 |
| 264 | Ga0209676_1005098 | 3300025292 | Bacteria | 7010 |
| 265 | Ga0209676_1008035 | 3300025292 | Bacteria | 4800 |
| 266 | Ga0209025_1006155 | 3300025294 | Bacteria | 9439 |
| 267 | Ga0209564_1000404 | 3300025295 | Bacteria | 76827 |
| 268 | Ga0209050_1000025 | 3300025298 | Bacteria | 528225 |
| 269 | Ga0209050_1000028 | 3300025298 | Bacteria | 477133 |
| 270 | Ga0209050_1000520 | 3300025298 | Bacteria | 64262 |
| 271 | Ga0209051_1000026 | 3300025303 | Bacteria | 413311 |
| 272 | Ga0209051_1000080 | 3300025303 | Bacteria | 199694 |
| 273 | Ga0209051_1000334 | 3300025303 | Bacteria | 70713 |
| 274 | Ga0209051_1005483 | 3300025303 | Bacteria | 7402 |
| 275 | Ga0209257_1000034 | 3300025304 | Bacteria | 662719 |
| 276 | Ga0207656_10000007 | 3300025321 | Bacteria | 289154 |
| 277 | Ga0207696_1000020 | 3300025711 | Bacteria | 434998 |
| 278 | Ga0207696_1000057 | 3300025711 | Bacteria | 249404 |
| 279 | Ga0207696_1000084 | 3300025711 | Bacteria | 196086 |
| 280 | Ga0207696_1001201 | 3300025711 | Bacteria | 14759 |
| 281 | Ga0207696_1002125 | 3300025711 | Bacteria | 9949 |
| 282 | Ga0207696_1003512 | 3300025711 | Bacteria | 7091 |
| 283 | Ga0207696_1009400 | 3300025711 | Bacteria | 3648 |
| 284 | Ga0207696_1017377 | 3300025711 | Bacteria | 2383 |
| 285 | Ga0207696_1051295 | 3300025711 | Bacteria | 1179 |
| 286 | Ga0207655_1000014 | 3300025728 | Bacteria | 607124 |
| 287 | Ga0207655_1000326 | 3300025728 | Bacteria | 70089 |
| 288 | Ga0207655_1000405 | 3300025728 | Bacteria | 59516 |
| 289 | Ga0207655_1000935 | 3300025728 | Bacteria | 30300 |
| 290 | Ga0207655_1001697 | 3300025728 | Bacteria | 19386 |
| 291 | Ga0207655_1002391 | 3300025728 | Bacteria | 15301 |
| 292 | Ga0207655_1002603 | 3300025728 | Bacteria | 14351 |
| 293 | Ga0207655_1011916 | 3300025728 | Bacteria | 5130 |
| 294 | Ga0207655_1012601 | 3300025728 | Bacteria | 4927 |
| 295 | Ga0207655_1014811 | 3300025728 | Bacteria | 4378 |
| 296 | Ga0207655_1014841 | 3300025728 | Bacteria | 4372 |
| 297 | Ga0207655_1015764 | 3300025728 | Bacteria | 4179 |
| 298 | Ga0207655_1028886 | 3300025728 | Bacteria | 2607 |
| 299 | Ga0207655_1057498 | 3300025728 | Bacteria | 1527 |
| 300 | Ga0207713_1000031 | 3300025735 | Bacteria | 283971 |
| 301 | Ga0207713_1000114 | 3300025735 | Bacteria | 132170 |
| 302 | Ga0207713_1000331 | 3300025735 | Bacteria | 53100 |
| 303 | Ga0207713_1000434 | 3300025735 | Bacteria | 44039 |
| 304 | Ga0207713_1000632 | 3300025735 | Bacteria | 34264 |
| 305 | Ga0207713_1002064 | 3300025735 | Bacteria | 15016 |
| 306 | Ga0207713_1002309 | 3300025735 | Bacteria | 14016 |
| 307 | Ga0207713_1006008 | 3300025735 | Bacteria | 7485 |
| 308 | Ga0207713_1006316 | 3300025735 | Bacteria | 7234 |
| 309 | Ga0207713_1007038 | 3300025735 | Bacteria | 6739 |
| 310 | Ga0207713_1012006 | 3300025735 | Bacteria | 4663 |
| 311 | Ga0207713_1030078 | 3300025735 | Bacteria | 2421 |
| 312 | Ga0207713_1033592 | 3300025735 | Bacteria | 2239 |
| 313 | Ga0207713_1074606 | 3300025735 | Bacteria | 1240 |
| 314 | Ga0207713_1103890 | 3300025735 | Bacteria | 976 |
| 315 | Ga0207671_10000015 | 3300025914 | Bacteria | 439607 |
| 316 | Ga0207662_10104786 | 3300025918 | Bacteria | 1757 |
| 317 | Ga0207649_10000001 | 3300025920 | Bacteria | 537851 |
| 318 | Ga0207681_10000236 | 3300025923 | Bacteria | 42706 |
| 319 | Ga0207681_10001050 | 3300025923 | Bacteria | 17915 |
| 320 | Ga0207681_10525981 | 3300025923 | Bacteria | 971 |
| 321 | Ga0207681_10677290 | 3300025923 | Bacteria | 856 |
| 322 | Ga0207650_10000273 | 3300025925 | Bacteria | 54321 |
| 323 | Ga0207650_10000449 | 3300025925 | Bacteria | 35040 |
| 324 | Ga0207659_10104894 | 3300025926 | Bacteria | 2138 |
| 325 | Ga0207706_10000069 | 3300025933 | Bacteria | 105541 |
| 326 | Ga0207706_10013926 | 3300025933 | Bacteria | 7293 |
| 327 | Ga0207706_10410594 | 3300025933 | Bacteria | 1173 |
| 328 | Ga0207709_10000022 | 3300025935 | Bacteria | 383573 |
| 329 | Ga0207709_10000164 | 3300025935 | Bacteria | 91154 |
| 330 | Ga0207709_10010709 | 3300025935 | Bacteria | 5051 |
| 331 | Ga0207709_10077411 | 3300025935 | Bacteria | 2132 |
| 332 | Ga0207709_10078174 | 3300025935 | Bacteria | 2123 |
| 333 | Ga0207670_10010276 | 3300025936 | Bacteria | 5383 |
| 334 | Ga0207669_10147465 | 3300025937 | Bacteria | 1643 |
| 335 | Ga0207691_10026578 | 3300025940 | Bacteria | 5431 |
| 336 | Ga0207691_10128220 | 3300025940 | Bacteria | 2243 |
| 337 | Ga0207691_10623484 | 3300025940 | Bacteria | 912 |
| 338 | Ga0207711_10014431 | 3300025941 | Bacteria | 6563 |
| 339 | Ga0207679_10000011 | 3300025945 | Bacteria | 346112 |
| 340 | Ga0207703_10011669 | 3300026035 | Bacteria | 6834 |
| 341 | Ga0207639_10023432 | 3300026041 | Bacteria | 4458 |
| 342 | Ga0207708_10034391 | 3300026075 | Bacteria | 3855 |
| 343 | Ga0207708_10057759 | 3300026075 | Bacteria | 2961 |
| 344 | Ga0207708_10102846 | 3300026075 | Bacteria | 2212 |
| 345 | Ga0207641_10119088 | 3300026088 | Bacteria | 2353 |
| 346 | Ga0207641_10406824 | 3300026088 | Bacteria | 1308 |
| 347 | Ga0207674_10413057 | 3300026116 | Bacteria | 1304 |
| 348 | Ga0207675_100004771 | 3300026118 | Bacteria | 13062 |
| 349 | Ga0207675_100007621 | 3300026118 | Bacteria | 10227 |
| 350 | Ga0207675_100023697 | 3300026118 | Bacteria | 5710 |
| 351 | Ga0207675_100029914 | 3300026118 | Bacteria | 5070 |
| 352 | Ga0207675_100244202 | 3300026118 | Bacteria | 1736 |
| 353 | Ga0209281_1000026 | 3300027111 | Bacteria | 465877 |
| 354 | Ga0209281_1000033 | 3300027111 | Bacteria | 383539 |
| 355 | Ga0209281_1009328 | 3300027111 | Bacteria | 2311 |
| 356 | Ga0209371_1000032 | 3300027312 | Bacteria | 392355 |
| 357 | Ga0209981_1011805 | 3300027378 | Bacteria | 1206 |
| 358 | Ga0209996_1002457 | 3300027395 | Bacteria | 2295 |
| 359 | Ga0209983_1003440 | 3300027665 | Bacteria | 3384 |
| 360 | Ga0209974_10007010 | 3300027876 | Bacteria | 3901 |
| 361 | Ga0207428_10007376 | 3300027907 | Bacteria | 10027 |
| 362 | Ga0207428_10041406 | 3300027907 | Bacteria | 3730 |
| 363 | Ga0207428_10065960 | 3300027907 | Bacteria | 2853 |
| 364 | Ga0207428_10069517 | 3300027907 | Bacteria | 2769 |
| 365 | Ga0207428_10084031 | 3300027907 | Bacteria | 2482 |
| 366 | Ga0207428_10108265 | 3300027907 | Bacteria | 2141 |
| 367 | Ga0207428_10352605 | 3300027907 | Bacteria | 1082 |
| 368 | Ga0207428_10389380 | 3300027907 | Bacteria | 1022 |
| 369 | Ga0268266_10008655 | 3300028379 | Bacteria | 9035 |
| 370 | Ga0268266_10016958 | 3300028379 | Bacteria | 6222 |
| 371 | Ga0268266_10075777 | 3300028379 | Bacteria | 2922 |
| 372 | Ga0268265_10009890 | 3300028380 | Bacteria | 6444 |
| 373 | Ga0268265_10206842 | 3300028380 | Bacteria | 1707 |
| 374 | Ga0268265_10245341 | 3300028380 | Bacteria | 1583 |
| 375 | Ga0268264_10141180 | 3300028381 | Bacteria | 2148 |
| 376 | Ga0307517_10133349 | 3300028786 | Bacteria | 1777 |
| 377 | Ga0307515_10016964 | 3300028794 | Bacteria | 13306 |
| 378 | Ga0268256_1000050 | 3300030500 | Bacteria | 300675 |
| 379 | Ga0307511_10014728 | 3300030521 | Bacteria | 7603 |
| 380 | Ga0316178_1048724 | 3300030735 | Bacteria | 10017 |
| 381 | Ga0316183_1029617 | 3300030742 | Bacteria | 6544 |
| 382 | Ga0316183_1184413 | 3300030742 | Bacteria | 1082 |
| 383 | Ga0316181_1024278 | 3300030744 | Bacteria | 4987 |
| 384 | Ga0265327_10001649 | 3300031251 | Bacteria | 26951 |
| 385 | Ga0265316_10148182 | 3300031344 | Bacteria | 1759 |
| 386 | Ga0307513_10053426 | 3300031456 | Bacteria | 4343 |
| 387 | Ga0307509_10222467 | 3300031507 | Bacteria | 1699 |
| 388 | Ga0307509_10272830 | 3300031507 | Unclassified | 1458 |
| 389 | Ga0307408_100014933 | 3300031548 | Bacteria | 5167 |
| 390 | Ga0307408_100021630 | 3300031548 | Bacteria | 4356 |
| 391 | Ga0307408_100034758 | 3300031548 | Bacteria | 3532 |
| 392 | Ga0307408_100034944 | 3300031548 | Bacteria | 3524 |
| 393 | Ga0307408_100073881 | 3300031548 | Bacteria | 2528 |
| 394 | Ga0307408_100075564 | 3300031548 | Bacteria | 2503 |
| 395 | Ga0307516_10105266 | 3300031730 | Bacteria | 2633 |
| 396 | Ga0307516_10179454 | 3300031730 | Bacteria | 1852 |
| 397 | Ga0307516_10291965 | 3300031730 | Bacteria | 1309 |
| 398 | Ga0307405_10007090 | 3300031731 | Bacteria | 5572 |
| 399 | Ga0307405_10010676 | 3300031731 | Bacteria | 4775 |
| 400 | Ga0307405_10011939 | 3300031731 | Bacteria | 4575 |
| 401 | Ga0307405_10029697 | 3300031731 | Bacteria | 3197 |
| 402 | Ga0307405_10349092 | 3300031731 | Bacteria | 1140 |
| 403 | Ga0307413_10009019 | 3300031824 | Bacteria | 4748 |
| 404 | Ga0307413_10019490 | 3300031824 | Bacteria | 3586 |
| 405 | Ga0307410_10013906 | 3300031852 | Bacteria | 4714 |
| 406 | Ga0307406_10008889 | 3300031901 | Bacteria | 5614 |
| 407 | Ga0307406_10009078 | 3300031901 | Bacteria | 5563 |
| 408 | Ga0307406_10193333 | 3300031901 | Bacteria | 1491 |
| 409 | Ga0307407_10002874 | 3300031903 | Bacteria | 6881 |
| 410 | Ga0307407_10029144 | 3300031903 | Bacteria | 2961 |
| 411 | Ga0307407_10165174 | 3300031903 | Bacteria | 1452 |
| 412 | Ga0307412_10010789 | 3300031911 | Bacteria | 5272 |
| 413 | Ga0307412_10017244 | 3300031911 | Bacteria | 4319 |
| 414 | Ga0307412_10023342 | 3300031911 | Bacteria | 3804 |
| 415 | Ga0307412_10024787 | 3300031911 | Bacteria | 3706 |
| 416 | Ga0307412_10025054 | 3300031911 | Bacteria | 3689 |
| 417 | Ga0307412_10052050 | 3300031911 | Bacteria | 2709 |
| 418 | Ga0307412_10111954 | 3300031911 | Bacteria | 1950 |
| 419 | Ga0307412_10134546 | 3300031911 | Bacteria | 1801 |
| 420 | Ga0307412_10606942 | 3300031911 | Bacteria | 927 |
| 421 | Ga0307409_100019513 | 3300031995 | Bacteria | 4593 |
| 422 | Ga0307409_100032810 | 3300031995 | Bacteria | 3771 |
| 423 | Ga0307409_100054467 | 3300031995 | Bacteria | 3081 |
| 424 | Ga0307409_100056815 | 3300031995 | Bacteria | 3028 |
| 425 | Ga0307409_100244804 | 3300031995 | Unclassified | 1635 |
| 426 | Ga0307416_100076005 | 3300032002 | Bacteria | 2813 |
| 427 | Ga0307416_100085446 | 3300032002 | Bacteria | 2685 |
| 428 | Ga0307416_100316403 | 3300032002 | Bacteria | 1560 |
| 429 | Ga0307416_100450157 | 3300032002 | Bacteria | 1340 |
| 430 | Ga0307414_10133960 | 3300032004 | Bacteria | 1928 |
| 431 | Ga0307414_10140282 | 3300032004 | Bacteria | 1891 |
| 432 | Ga0307411_10010859 | 3300032005 | Bacteria | 4880 |
| 433 | Ga0307411_10074591 | 3300032005 | Bacteria | 2312 |
| 434 | Ga0307411_10137126 | 3300032005 | Bacteria | 1798 |
| 435 | Ga0307411_10667955 | 3300032005 | Bacteria | 901 |
| 436 | Ga0307510_10001604 | 3300033180 | Bacteria | 25008 |
| 437 | Ga0373923_0183272 | 3300035111 | Bacteria | 963 |
| 438 | Ga0237819_04383 | 3300038705 | Bacteria | 2329 |
| 439 | Ga0436363_0203368 | 3300039450 | Bacteria | 1581 |
| 440 | Ga0439438_001683 | 3300041405 | Bacteria | 9722 |
| 441 | Ga0439438_005049 | 3300041405 | Bacteria | 4921 |
| 442 | Ga0439438_005227 | 3300041405 | Bacteria | 4814 |
| 443 | Ga0439438_005882 | 3300041405 | Bacteria | 4437 |
| 444 | Ga0439438_005955 | 3300041405 | Bacteria | 4401 |
| 445 | Ga0439438_014519 | 3300041405 | Bacteria | 2342 |
| 446 | Ga0439438_015502 | 3300041405 | Bacteria | 2241 |
| 447 | Ga0439447_000222 | 3300041407 | Bacteria | 20061 |
| 448 | Ga0439447_001542 | 3300041407 | Bacteria | 8416 |
| 449 | Ga0439447_003263 | 3300041407 | Bacteria | 5769 |
| 450 | Ga0439447_003378 | 3300041407 | Bacteria | 5675 |
| 451 | Ga0439447_003431 | 3300041407 | Bacteria | 5637 |
| 452 | Ga0439447_011142 | 3300041407 | Bacteria | 2637 |
| 453 | Ga0439447_018200 | 3300041407 | Bacteria | 1899 |
| 454 | Ga0439466_0000445 | 3300041411 | Bacteria | 15779 |
| 455 | Ga0439466_0000766 | 3300041411 | Bacteria | 12159 |
| 456 | Ga0439466_0008181 | 3300041411 | Bacteria | 3942 |
| 457 | Ga0439466_0009972 | 3300041411 | Bacteria | 3534 |
| 458 | Ga0439466_0011547 | 3300041411 | Bacteria | 3265 |
| 459 | Ga0439466_0013302 | 3300041411 | Bacteria | 3012 |
| 460 | Ga0439466_0018228 | 3300041411 | Bacteria | 2520 |
| 461 | Ga0439466_0021229 | 3300041411 | Bacteria | 2305 |
| 462 | Ga0439465_0013323 | 3300041413 | Bacteria | 2566 |
| 463 | Ga0439465_0100107 | 3300041413 | Bacteria | 1000 |
| 464 | Ga0451853_3896997 | 3300041512 | Bacteria | 1200 |
| 465 | Ga0439431_0020609 | 3300041997 | Bacteria | 1576 |
| 466 | Ga0439445_0054975 | 3300042004 | Bacteria | 1080 |
| 467 | Ga0439432_000366 | 3300042006 | Bacteria | 16615 |
| 468 | Ga0439432_001336 | 3300042006 | Bacteria | 9343 |
| 469 | Ga0439432_010223 | 3300042006 | Bacteria | 3255 |
| 470 | Ga0439432_012452 | 3300042006 | Bacteria | 2910 |
| 471 | Ga0439451_006406 | 3300042009 | Bacteria | 2407 |
| 472 | Ga0439451_011242 | 3300042009 | Bacteria | 1805 |
| 473 | Ga0439451_015805 | 3300042009 | Bacteria | 1521 |
| 474 | Ga0439451_018930 | 3300042009 | Bacteria | 1389 |
| 475 | Ga0439451_022004 | 3300042009 | Bacteria | 1285 |
| 476 | Ga0439451_030594 | 3300042009 | Bacteria | 1082 |
| 477 | Ga0439451_032477 | 3300042009 | Bacteria | 1050 |
| 478 | Ga0439452_000231 | 3300042010 | Bacteria | 38808 |
| 479 | Ga0439452_000245 | 3300042010 | Bacteria | 37540 |
| 480 | Ga0439452_000971 | 3300042010 | Bacteria | 12881 |
| 481 | Ga0439452_002718 | 3300042010 | Bacteria | 6415 |
| 482 | Ga0439452_004643 | 3300042010 | Bacteria | 4559 |
| 483 | Ga0439452_004857 | 3300042010 | Bacteria | 4414 |
| 484 | Ga0439452_006314 | 3300042010 | Bacteria | 3721 |
| 485 | Ga0439452_010184 | 3300042010 | Bacteria | 2745 |
| 486 | Ga0439452_015932 | 3300042010 | Bacteria | 2051 |
| 487 | Ga0439452_052643 | 3300042010 | Bacteria | 928 |
| 488 | Ga0439456_000187 | 3300042013 | Bacteria | 17986 |
| 489 | Ga0439456_000508 | 3300042013 | Bacteria | 8359 |
| 490 | Ga0439456_003564 | 3300042013 | Bacteria | 3156 |
| 491 | Ga0439456_008809 | 3300042013 | Bacteria | 2085 |
| 492 | Ga0439456_011230 | 3300042013 | Bacteria | 1850 |
| 493 | Ga0439456_023882 | 3300042013 | Bacteria | 1296 |
| 494 | Ga0439456_055448 | 3300042013 | Bacteria | 868 |
| 495 | Ga0439463_001159 | 3300042016 | Bacteria | 7049 |
| 496 | Ga0439463_002336 | 3300042016 | Bacteria | 4837 |
| 497 | Ga0439463_006378 | 3300042016 | Bacteria | 2928 |
| 498 | Ga0439463_047433 | 3300042016 | Bacteria | 1094 |
| 499 | Ga0439463_084866 | 3300042016 | Bacteria | 815 |
| 500 | Ga0450911_000018 | 3300042115 | Bacteria | 104759 |
| 501 | Ga0450911_000158 | 3300042115 | Bacteria | 27057 |
| 502 | Ga0450911_002529 | 3300042115 | Bacteria | 3555 |
| 503 | Ga0450911_007040 | 3300042115 | Bacteria | 1649 |
| 504 | Ga0450911_012285 | 3300042115 | Bacteria | 1159 |
| 505 | Ga0450919_002444 | 3300042121 | Bacteria | 2405 |
| 506 | Ga0450919_004450 | 3300042121 | Bacteria | 1713 |
| 507 | Ga0450922_000113 | 3300042124 | Bacteria | 7891 |
| 508 | Ga0450922_001038 | 3300042124 | Bacteria | 2790 |
| 509 | Ga0450922_001749 | 3300042124 | Bacteria | 2106 |
| 510 | Ga0450890_000475 | 3300042127 | Bacteria | 5889 |
| 511 | Ga0450891_006614 | 3300042129 | Bacteria | 1066 |
| 512 | Ga0450892_003838 | 3300042130 | Bacteria | 1230 |
| 513 | Ga0450900_000295 | 3300042136 | Bacteria | 3572 |
| 514 | Ga0450902_000139 | 3300042137 | Bacteria | 7985 |
| 515 | Ga0450902_008053 | 3300042137 | Bacteria | 1639 |
| 516 | Ga0450903_002643 | 3300042138 | Bacteria | 3157 |
| 517 | Ga0450903_002724 | 3300042138 | Bacteria | 3109 |
| 518 | Ga0450903_004552 | 3300042138 | Bacteria | 2358 |
| 519 | Ga0450904_000008 | 3300042139 | Bacteria | 47688 |
| 520 | Ga0450904_001608 | 3300042139 | Bacteria | 3064 |
| 521 | Ga0450905_000046 | 3300042142 | Bacteria | 10661 |
| 522 | Ga0450905_002730 | 3300042142 | Bacteria | 2286 |
| 523 | Ga0450889_002305 | 3300042144 | Bacteria | 1911 |
| 524 | Ga0450906_001941 | 3300042145 | Bacteria | 4522 |
| 525 | Ga0450906_011941 | 3300042145 | Bacteria | 1615 |
| 526 | Ga0450907_000206 | 3300042146 | Bacteria | 21277 |
| 527 | Ga0450907_000510 | 3300042146 | Bacteria | 10666 |
| 528 | Ga0450907_001218 | 3300042146 | Bacteria | 5817 |
| 529 | Ga0450910_000234 | 3300042147 | Bacteria | 6325 |
| 530 | Ga0450910_000702 | 3300042147 | Bacteria | 4012 |
| 531 | Ga0439446_0000057 | 3300042156 | Bacteria | 17480 |
| 532 | Ga0439446_0000824 | 3300042156 | Bacteria | 6611 |
| 533 | Ga0439446_0000915 | 3300042156 | Bacteria | 6364 |
| 534 | Ga0439446_0033009 | 3300042156 | Bacteria | 1503 |
| 535 | Ga0450908_011824 | 3300042184 | Bacteria | 1591 |
| 536 | Ga0450909_000100 | 3300042185 | Bacteria | 8467 |
| 537 | Ga0450909_000593 | 3300042185 | Bacteria | 4761 |
| 538 | Ga0439434_0000122 | 3300042435 | Bacteria | 20574 |
| 539 | Ga0439464_0017338 | 3300042439 | Bacteria | 1952 |
| 540 | Ga0439464_0026938 | 3300042439 | Bacteria | 1596 |
| 541 | Ga0439464_0027223 | 3300042439 | Bacteria | 1589 |
| 542 | Ga0439460_0003104 | 3300042461 | Bacteria | 4015 |
| 543 | Ga0450916_009068 | 3300042530 | Bacteria | 1223 |
| 544 | Ga0450918_001531 | 3300042531 | Bacteria | 4561 |
| 545 | Ga0450893_0028869 | 3300042532 | Bacteria | 982 |
| 546 | Ga0450901_001194 | 3300042533 | Bacteria | 3012 |
| 547 | Ga0451577_0000162 | 3300042876 | Bacteria | 145994 |
| 548 | Ga0439440_0002123 | 3300042993 | Bacteria | 3704 |
| 549 | Ga0439440_0008434 | 3300042993 | Bacteria | 2115 |
| 550 | Ga0439440_0014881 | 3300042993 | Bacteria | 1685 |
| 551 | Ga0439440_0054445 | 3300042993 | Bacteria | 1008 |
| 552 | Ga0466972_0021404 | 3300044658 | Bacteria | 3223 |
| 553 | Ga0453684_0000524 | 3300044712 | Bacteria | 146655 |
| 554 | Ga0453684_0050801 | 3300044712 | Bacteria | 5447 |
| 555 | Ga0451576_0147329 | 3300045051 | Bacteria | 2455 |
| 556 | Ga0495617_000311 | 3300046452 | Bacteria | 27369 |
| 557 | Ga0495617_000760 | 3300046452 | Bacteria | 15772 |
| 558 | Ga0495617_007185 | 3300046452 | Bacteria | 3877 |
| 559 | Ga0495617_009067 | 3300046452 | Bacteria | 3420 |
| 560 | Ga0495617_016180 | 3300046452 | Bacteria | 2522 |
| 561 | Ga0495617_028194 | 3300046452 | Bacteria | 1887 |
| 562 | Ga0495617_034124 | 3300046452 | Bacteria | 1707 |
| 563 | Ga0495617_129684 | 3300046452 | Bacteria | 809 |
| 564 | Ga0495627_000023 | 3300046453 | Bacteria | 251113 |
| 565 | Ga0495627_000535 | 3300046453 | Bacteria | 31404 |
| 566 | Ga0495627_000700 | 3300046453 | Bacteria | 25589 |
| 567 | Ga0495627_001188 | 3300046453 | Bacteria | 16475 |
| 568 | Ga0495627_005424 | 3300046453 | Bacteria | 5142 |
| 569 | Ga0495627_014062 | 3300046453 | Bacteria | 2804 |
| 570 | Ga0495627_016249 | 3300046453 | Bacteria | 2552 |
| 571 | Ga0495627_069507 | 3300046453 | Bacteria | 1030 |
| 572 | Ga0495627_082340 | 3300046453 | Bacteria | 931 |
| 573 | Ga0495603_0002971 | 3300046455 | Bacteria | 10026 |
| 574 | Ga0495603_0029255 | 3300046455 | Bacteria | 3322 |
| 575 | Ga0495603_0365115 | 3300046455 | Bacteria | 828 |
| 576 | Ga0495590_0001147 | 3300046457 | Bacteria | 11586 |
| 577 | Ga0495590_0004906 | 3300046457 | Bacteria | 5347 |
| 578 | Ga0495590_0011769 | 3300046457 | Bacteria | 3262 |
| 579 | Ga0495590_0041213 | 3300046457 | Bacteria | 1609 |
| 580 | Ga0495590_0041675 | 3300046457 | Bacteria | 1601 |
| 581 | Ga0495590_0052602 | 3300046457 | Bacteria | 1422 |
| 582 | Ga0495591_000025 | 3300046458 | Bacteria | 189897 |
| 583 | Ga0495591_000244 | 3300046458 | Bacteria | 52389 |
| 584 | Ga0495591_001000 | 3300046458 | Bacteria | 19227 |
| 585 | Ga0495591_001158 | 3300046458 | Bacteria | 17285 |
| 586 | Ga0495591_003990 | 3300046458 | Bacteria | 7394 |
| 587 | Ga0495591_007521 | 3300046458 | Bacteria | 4617 |
| 588 | Ga0495591_008190 | 3300046458 | Bacteria | 4308 |
| 589 | Ga0495591_008676 | 3300046458 | Bacteria | 4134 |
| 590 | Ga0495591_009244 | 3300046458 | Bacteria | 3937 |
| 591 | Ga0495591_010450 | 3300046458 | Bacteria | 3598 |
| 592 | Ga0495591_010873 | 3300046458 | Bacteria | 3486 |
| 593 | Ga0495591_012410 | 3300046458 | Bacteria | 3174 |
| 594 | Ga0495591_013066 | 3300046458 | Bacteria | 3059 |
| 595 | Ga0495591_013211 | 3300046458 | Bacteria | 3034 |
| 596 | Ga0495591_014014 | 3300046458 | Bacteria | 2902 |
| 597 | Ga0495591_014644 | 3300046458 | Bacteria | 2807 |
| 598 | Ga0495591_016439 | 3300046458 | Bacteria | 2575 |
| 599 | Ga0495629_0012392 | 3300046459 | Bacteria | 6174 |
| 600 | Ga0495638_0003177 | 3300046460 | Bacteria | 12989 |
| 601 | Ga0495638_0013861 | 3300046460 | Bacteria | 5469 |
| 602 | Ga0495638_0018877 | 3300046460 | Bacteria | 4570 |
| 603 | Ga0495638_0027553 | 3300046460 | Bacteria | 3677 |
| 604 | Ga0495638_0035891 | 3300046460 | Bacteria | 3158 |
| 605 | Ga0495638_0040073 | 3300046460 | Bacteria | 2969 |
| 606 | Ga0495638_0040296 | 3300046460 | Bacteria | 2960 |
| 607 | Ga0495638_0040541 | 3300046460 | Bacteria | 2950 |
| 608 | Ga0495638_0054021 | 3300046460 | Bacteria | 2498 |
| 609 | Ga0495638_0074309 | 3300046460 | Bacteria | 2073 |
| 610 | Ga0495638_0126508 | 3300046460 | Bacteria | 1505 |
| 611 | Ga0495638_0206822 | 3300046460 | Bacteria | 1104 |
| 612 | Ga0495638_0262452 | 3300046460 | Bacteria | 946 |
| 613 | Ga0495653_0000549 | 3300046463 | Bacteria | 28717 |
| 614 | Ga0495653_0004108 | 3300046463 | Bacteria | 11772 |
| 615 | Ga0495653_0004448 | 3300046463 | Bacteria | 11318 |
| 616 | Ga0495653_0015276 | 3300046463 | Bacteria | 6257 |
| 617 | Ga0495653_0117752 | 3300046463 | Bacteria | 1897 |
| 618 | Ga0495650_0002476 | 3300046471 | Bacteria | 14863 |
| 619 | Ga0495650_0003286 | 3300046471 | Bacteria | 11955 |
| 620 | Ga0495650_0009444 | 3300046471 | Bacteria | 5545 |
| 621 | Ga0495650_0010158 | 3300046471 | Bacteria | 5278 |
| 622 | Ga0495650_0013860 | 3300046471 | Bacteria | 4236 |
| 623 | Ga0495650_0018671 | 3300046471 | Bacteria | 3439 |
| 624 | Ga0495650_0019017 | 3300046471 | Bacteria | 3396 |
| 625 | Ga0495650_0020043 | 3300046471 | Bacteria | 3272 |
| 626 | Ga0495650_0023131 | 3300046471 | Bacteria | 2964 |
| 627 | Ga0495582_0010897 | 3300046473 | Bacteria | 5004 |
| 628 | Ga0495605_0000095 | 3300046474 | Bacteria | 112622 |
| 629 | Ga0495605_0000311 | 3300046474 | Bacteria | 50989 |
| 630 | Ga0495605_0000328 | 3300046474 | Bacteria | 48074 |
| 631 | Ga0495605_0000673 | 3300046474 | Bacteria | 25763 |
| 632 | Ga0495605_0000878 | 3300046474 | Bacteria | 20810 |
| 633 | Ga0495605_0007893 | 3300046474 | Bacteria | 6027 |
| 634 | Ga0495605_0021899 | 3300046474 | Bacteria | 3380 |
| 635 | Ga0495605_0022174 | 3300046474 | Bacteria | 3356 |
| 636 | Ga0495605_0025515 | 3300046474 | Bacteria | 3079 |
| 637 | Ga0495605_0025781 | 3300046474 | Bacteria | 3061 |
| 638 | Ga0495605_0027744 | 3300046474 | Bacteria | 2930 |
| 639 | Ga0495605_0034292 | 3300046474 | Bacteria | 2570 |
| 640 | Ga0495605_0040001 | 3300046474 | Bacteria | 2345 |
| 641 | Ga0495605_0081534 | 3300046474 | Bacteria | 1513 |
| 642 | Ga0495639_0000238 | 3300046475 | Bacteria | 27395 |
| 643 | Ga0495584_0000695 | 3300046491 | Bacteria | 22284 |
| 644 | Ga0495584_0006560 | 3300046491 | Bacteria | 6081 |
| 645 | Ga0495584_0012343 | 3300046491 | Bacteria | 4360 |
| 646 | Ga0495584_0017637 | 3300046491 | Bacteria | 3632 |
| 647 | Ga0495584_0019778 | 3300046491 | Bacteria | 3420 |
| 648 | Ga0495584_0021080 | 3300046491 | Bacteria | 3309 |
| 649 | Ga0495584_0026726 | 3300046491 | Bacteria | 2924 |
| 650 | Ga0495584_0026880 | 3300046491 | Bacteria | 2916 |
| 651 | Ga0495584_0079689 | 3300046491 | Bacteria | 1647 |
| 652 | Ga0495584_0162024 | 3300046491 | Bacteria | 1137 |
| 653 | Ga0495585_0000279 | 3300046492 | Bacteria | 51082 |
| 654 | Ga0495585_0000790 | 3300046492 | Bacteria | 27867 |
| 655 | Ga0495585_0015485 | 3300046492 | Bacteria | 4432 |
| 656 | Ga0495585_0017325 | 3300046492 | Bacteria | 4163 |
| 657 | Ga0495585_0020619 | 3300046492 | Bacteria | 3789 |
| 658 | Ga0495585_0024730 | 3300046492 | Bacteria | 3442 |
| 659 | Ga0495585_0028586 | 3300046492 | Bacteria | 3179 |
| 660 | Ga0495585_0039605 | 3300046492 | Bacteria | 2648 |
| 661 | Ga0495585_0041367 | 3300046492 | Bacteria | 2584 |
| 662 | Ga0495585_0156740 | 3300046492 | Bacteria | 1184 |
| 663 | Ga0495594_0001648 | 3300046499 | Bacteria | 11609 |
| 664 | Ga0495594_0165561 | 3300046499 | Bacteria | 1257 |
| 665 | Ga0495596_0000273 | 3300046500 | Bacteria | 34263 |
| 666 | Ga0495596_0001654 | 3300046500 | Bacteria | 12664 |
| 667 | Ga0495596_0106960 | 3300046500 | Bacteria | 1086 |
| 668 | Ga0495607_0000298 | 3300046501 | Bacteria | 51955 |
| 669 | Ga0495607_0000347 | 3300046501 | Bacteria | 47969 |
| 670 | Ga0495607_0000776 | 3300046501 | Bacteria | 30570 |
| 671 | Ga0495607_0000926 | 3300046501 | Bacteria | 27382 |
| 672 | Ga0495607_0003337 | 3300046501 | Bacteria | 12321 |
| 673 | Ga0495607_0009192 | 3300046501 | Bacteria | 6715 |
| 674 | Ga0495607_0014199 | 3300046501 | Bacteria | 5194 |
| 675 | Ga0495607_0015965 | 3300046501 | Bacteria | 4854 |
| 676 | Ga0495607_0023469 | 3300046501 | Bacteria | 3861 |
| 677 | Ga0495607_0026083 | 3300046501 | Bacteria | 3627 |
| 678 | Ga0495607_0027199 | 3300046501 | Bacteria | 3540 |
| 679 | Ga0495607_0030508 | 3300046501 | Bacteria | 3309 |
| 680 | Ga0495607_0031519 | 3300046501 | Bacteria | 3245 |
| 681 | Ga0495607_0035276 | 3300046501 | Bacteria | 3027 |
| 682 | Ga0495607_0038582 | 3300046501 | Bacteria | 2860 |
| 683 | Ga0495607_0095932 | 3300046501 | Bacteria | 1598 |
| 684 | Ga0495607_0151695 | 3300046501 | Bacteria | 1185 |
| 685 | Ga0495607_0173334 | 3300046501 | Bacteria | 1087 |
| 686 | Ga0495607_0214045 | 3300046501 | Bacteria | 946 |
| 687 | Ga0495583_0000015 | 3300046506 | Bacteria | 316392 |
| 688 | Ga0495583_0000756 | 3300046506 | Bacteria | 41068 |
| 689 | Ga0495583_0001231 | 3300046506 | Bacteria | 27233 |
| 690 | Ga0495583_0001865 | 3300046506 | Bacteria | 19601 |
| 691 | Ga0495583_0002457 | 3300046506 | Bacteria | 15823 |
| 692 | Ga0495583_0007128 | 3300046506 | Bacteria | 7121 |
| 693 | Ga0495583_0034596 | 3300046506 | Bacteria | 2418 |
| 694 | Ga0495583_0035663 | 3300046506 | Bacteria | 2372 |
| 695 | Ga0495606_0000177 | 3300046507 | Bacteria | 112843 |
| 696 | Ga0495606_0000214 | 3300046507 | Bacteria | 103149 |
| 697 | Ga0495606_0001468 | 3300046507 | Bacteria | 31498 |
| 698 | Ga0495606_0003165 | 3300046507 | Bacteria | 17806 |
| 699 | Ga0495606_0004043 | 3300046507 | Bacteria | 14953 |
| 700 | Ga0495606_0023244 | 3300046507 | Bacteria | 4497 |
| 701 | Ga0495606_0028733 | 3300046507 | Bacteria | 3916 |
| 702 | Ga0495606_0047242 | 3300046507 | Bacteria | 2838 |
| 703 | Ga0495606_0061283 | 3300046507 | Bacteria | 2407 |
| 704 | Ga0495606_0073664 | 3300046507 | Bacteria | 2142 |
| 705 | Ga0495606_0165576 | 3300046507 | Bacteria | 1286 |
| 706 | Ga0495610_0001476 | 3300046512 | Bacteria | 20720 |
| 707 | Ga0495610_0001656 | 3300046512 | Bacteria | 19581 |
| 708 | Ga0495610_0002687 | 3300046512 | Bacteria | 14660 |
| 709 | Ga0495610_0002713 | 3300046512 | Bacteria | 14573 |
| 710 | Ga0495610_0014482 | 3300046512 | Bacteria | 4629 |
| 711 | Ga0495610_0019649 | 3300046512 | Bacteria | 3772 |
| 712 | Ga0495610_0020743 | 3300046512 | Bacteria | 3639 |
| 713 | Ga0495610_0021118 | 3300046512 | Bacteria | 3588 |
| 714 | Ga0495610_0021713 | 3300046512 | Bacteria | 3524 |
| 715 | Ga0495610_0025419 | 3300046512 | Bacteria | 3178 |
| 716 | Ga0495610_0039121 | 3300046512 | Bacteria | 2401 |
| 717 | Ga0495610_0046191 | 3300046512 | Bacteria | 2150 |
| 718 | Ga0495610_0055928 | 3300046512 | Bacteria | 1899 |
| 719 | Ga0495616_0002792 | 3300046513 | Bacteria | 11404 |
| 720 | Ga0495616_0003688 | 3300046513 | Bacteria | 9783 |
| 721 | Ga0495616_0016363 | 3300046513 | Bacteria | 4106 |
| 722 | Ga0495616_0017474 | 3300046513 | Bacteria | 3956 |
| 723 | Ga0495616_0022881 | 3300046513 | Bacteria | 3368 |
| 724 | Ga0495616_0024171 | 3300046513 | Bacteria | 3261 |
| 725 | Ga0495616_0029868 | 3300046513 | Bacteria | 2871 |
| 726 | Ga0495616_0035822 | 3300046513 | Bacteria | 2565 |
| 727 | Ga0495616_0038964 | 3300046513 | Bacteria | 2437 |
| 728 | Ga0495616_0077485 | 3300046513 | Bacteria | 1595 |
| 729 | Ga0495620_0000042 | 3300046515 | Bacteria | 112107 |
| 730 | Ga0495620_0000456 | 3300046515 | Bacteria | 26967 |
| 731 | Ga0495620_0009865 | 3300046515 | Bacteria | 5058 |
| 732 | Ga0495620_0015816 | 3300046515 | Bacteria | 3800 |
| 733 | Ga0495620_0017423 | 3300046515 | Bacteria | 3581 |
| 734 | Ga0495620_0019562 | 3300046515 | Bacteria | 3326 |
| 735 | Ga0495620_0024333 | 3300046515 | Bacteria | 2881 |
| 736 | Ga0495620_0028670 | 3300046515 | Bacteria | 2585 |
| 737 | Ga0495620_0038055 | 3300046515 | Bacteria | 2137 |
| 738 | Ga0495628_0052974 | 3300046516 | Bacteria | 3204 |
| 739 | Ga0495630_0031773 | 3300046517 | Bacteria | 3932 |
| 740 | Ga0495630_0042381 | 3300046517 | Bacteria | 3399 |
| 741 | Ga0495630_0045547 | 3300046517 | Bacteria | 3278 |
| 742 | Ga0495630_0148290 | 3300046517 | Bacteria | 1784 |
| 743 | Ga0495631_0000722 | 3300046518 | Bacteria | 21214 |
| 744 | Ga0495631_0001940 | 3300046518 | Bacteria | 12135 |
| 745 | Ga0495631_0004156 | 3300046518 | Bacteria | 7760 |
| 746 | Ga0495631_0007549 | 3300046518 | Bacteria | 5528 |
| 747 | Ga0495631_0010776 | 3300046518 | Bacteria | 4518 |
| 748 | Ga0495631_0018255 | 3300046518 | Bacteria | 3305 |
| 749 | Ga0495631_0024723 | 3300046518 | Bacteria | 2772 |
| 750 | Ga0495631_0030012 | 3300046518 | Bacteria | 2469 |
| 751 | Ga0495631_0056166 | 3300046518 | Bacteria | 1714 |
| 752 | Ga0495631_0213472 | 3300046518 | Bacteria | 824 |
| 753 | Ga0495632_0000573 | 3300046519 | Bacteria | 34214 |
| 754 | Ga0495632_0001250 | 3300046519 | Bacteria | 21567 |
| 755 | Ga0495632_0001298 | 3300046519 | Bacteria | 21142 |
| 756 | Ga0495632_0001313 | 3300046519 | Bacteria | 21015 |
| 757 | Ga0495632_0018098 | 3300046519 | Bacteria | 3873 |
| 758 | Ga0495632_0021657 | 3300046519 | Bacteria | 3460 |
| 759 | Ga0495632_0021918 | 3300046519 | Bacteria | 3433 |
| 760 | Ga0495632_0023580 | 3300046519 | Bacteria | 3284 |
| 761 | Ga0495632_0026352 | 3300046519 | Bacteria | 3061 |
| 762 | Ga0495632_0029999 | 3300046519 | Bacteria | 2826 |
| 763 | Ga0495632_0032225 | 3300046519 | Bacteria | 2702 |
| 764 | Ga0495632_0035243 | 3300046519 | Bacteria | 2555 |
| 765 | Ga0495632_0039242 | 3300046519 | Bacteria | 2391 |
| 766 | Ga0495632_0041983 | 3300046519 | Bacteria | 2294 |
| 767 | Ga0495632_0061777 | 3300046519 | Bacteria | 1817 |
| 768 | Ga0495632_0126065 | 3300046519 | Bacteria | 1193 |
| 769 | Ga0495632_0164963 | 3300046519 | Bacteria | 1019 |
| 770 | Ga0495637_0000020 | 3300046520 | Bacteria | 181611 |
| 771 | Ga0495637_0000260 | 3300046520 | Bacteria | 41743 |
| 772 | Ga0495637_0002002 | 3300046520 | Bacteria | 11492 |
| 773 | Ga0495637_0002683 | 3300046520 | Bacteria | 9712 |
| 774 | Ga0495637_0003016 | 3300046520 | Bacteria | 9028 |
| 775 | Ga0495637_0003062 | 3300046520 | Bacteria | 8932 |
| 776 | Ga0495637_0003107 | 3300046520 | Bacteria | 8864 |
| 777 | Ga0495637_0007488 | 3300046520 | Bacteria | 5405 |
| 778 | Ga0495637_0009364 | 3300046520 | Bacteria | 4778 |
| 779 | Ga0495637_0009737 | 3300046520 | Bacteria | 4677 |
| 780 | Ga0495637_0015922 | 3300046520 | Bacteria | 3520 |
| 781 | Ga0495637_0021249 | 3300046520 | Bacteria | 2978 |
| 782 | Ga0495637_0025903 | 3300046520 | Bacteria | 2639 |
| 783 | Ga0495637_0036258 | 3300046520 | Bacteria | 2149 |
| 784 | Ga0495637_0044510 | 3300046520 | Bacteria | 1889 |
| 785 | Ga0495637_0146523 | 3300046520 | Bacteria | 893 |
| 786 | Ga0495643_0001642 | 3300046522 | Bacteria | 19726 |
| 787 | Ga0495643_0005156 | 3300046522 | Bacteria | 8925 |
| 788 | Ga0495643_0015742 | 3300046522 | Bacteria | 4460 |
| 789 | Ga0495643_0029307 | 3300046522 | Bacteria | 3080 |
| 790 | Ga0495643_0030123 | 3300046522 | Bacteria | 3031 |
| 791 | Ga0495643_0051295 | 3300046522 | Bacteria | 2219 |
| 792 | Ga0495643_0113684 | 3300046522 | Bacteria | 1374 |
| 793 | Ga0495643_0186427 | 3300046522 | Bacteria | 1004 |
| 794 | Ga0495644_0005182 | 3300046523 | Bacteria | 5099 |
| 795 | Ga0495644_0014572 | 3300046523 | Bacteria | 3010 |
| 796 | Ga0495644_0018081 | 3300046523 | Bacteria | 2691 |
| 797 | Ga0495644_0023262 | 3300046523 | Bacteria | 2359 |
| 798 | Ga0495644_0034029 | 3300046523 | Bacteria | 1923 |
| 799 | Ga0495644_0054046 | 3300046523 | Bacteria | 1508 |
| 800 | Ga0495644_0063295 | 3300046523 | Bacteria | 1390 |
| 801 | Ga0495648_0002580 | 3300046524 | Bacteria | 16591 |
| 802 | Ga0495648_0003045 | 3300046524 | Bacteria | 15001 |
| 803 | Ga0495648_0006167 | 3300046524 | Bacteria | 9825 |
| 804 | Ga0495648_0010821 | 3300046524 | Bacteria | 6928 |
| 805 | Ga0495648_0023095 | 3300046524 | Bacteria | 4266 |
| 806 | Ga0495648_0030337 | 3300046524 | Bacteria | 3576 |
| 807 | Ga0495648_0030901 | 3300046524 | Bacteria | 3534 |
| 808 | Ga0495648_0035313 | 3300046524 | Bacteria | 3241 |
| 809 | Ga0495648_0035908 | 3300046524 | Bacteria | 3207 |
| 810 | Ga0495648_0036080 | 3300046524 | Bacteria | 3196 |
| 811 | Ga0495648_0073855 | 3300046524 | Bacteria | 1967 |
| 812 | Ga0495648_0082529 | 3300046524 | Bacteria | 1824 |
| 813 | Ga0495648_0109453 | 3300046524 | Bacteria | 1506 |
| 814 | Ga0495648_0217211 | 3300046524 | Bacteria | 945 |
| 815 | Ga0495666_0016903 | 3300046526 | Bacteria | 3632 |
| 816 | Ga0495666_0022639 | 3300046526 | Bacteria | 3111 |
| 817 | Ga0495666_0042367 | 3300046526 | Bacteria | 2201 |
| 818 | Ga0495642_0000088 | 3300046528 | Bacteria | 53831 |
| 819 | Ga0495642_0000463 | 3300046528 | Bacteria | 21321 |
| 820 | Ga0495642_0009974 | 3300046528 | Bacteria | 3638 |
| 821 | Ga0495654_0000891 | 3300046530 | Bacteria | 22358 |
| 822 | Ga0495654_0000985 | 3300046530 | Bacteria | 20933 |
| 823 | Ga0495654_0000992 | 3300046530 | Bacteria | 20889 |
| 824 | Ga0495654_0001624 | 3300046530 | Bacteria | 15239 |
| 825 | Ga0495654_0001635 | 3300046530 | Bacteria | 15181 |
| 826 | Ga0495654_0002244 | 3300046530 | Bacteria | 12516 |
| 827 | Ga0495654_0003414 | 3300046530 | Bacteria | 9753 |
| 828 | Ga0495654_0003637 | 3300046530 | Bacteria | 9367 |
| 829 | Ga0495654_0008879 | 3300046530 | Bacteria | 5526 |
| 830 | Ga0495654_0012750 | 3300046530 | Bacteria | 4511 |
| 831 | Ga0495654_0014227 | 3300046530 | Bacteria | 4239 |
| 832 | Ga0495654_0021323 | 3300046530 | Bacteria | 3371 |
| 833 | Ga0495654_0026130 | 3300046530 | Bacteria | 3004 |
| 834 | Ga0495654_0037251 | 3300046530 | Bacteria | 2440 |
| 835 | Ga0495654_0039902 | 3300046530 | Bacteria | 2341 |
| 836 | Ga0495654_0053155 | 3300046530 | Bacteria | 1970 |
| 837 | Ga0495654_0111809 | 3300046530 | Bacteria | 1245 |
| 838 | Ga0495586_0012298 | 3300046535 | Bacteria | 4542 |
| 839 | Ga0495587_0005901 | 3300046536 | Bacteria | 7982 |
| 840 | Ga0495587_0009517 | 3300046536 | Bacteria | 6223 |
| 841 | Ga0495587_0084874 | 3300046536 | Bacteria | 1834 |
| 842 | Ga0495609_0000102 | 3300046538 | Bacteria | 100762 |
| 843 | Ga0495609_0000685 | 3300046538 | Bacteria | 26127 |
| 844 | Ga0495609_0002004 | 3300046538 | Bacteria | 12870 |
| 845 | Ga0495609_0003388 | 3300046538 | Bacteria | 9158 |
| 846 | Ga0495609_0020583 | 3300046538 | Bacteria | 3047 |
| 847 | Ga0495609_0092172 | 3300046538 | Bacteria | 1317 |
| 848 | Ga0495597_0000186 | 3300046542 | Bacteria | 55973 |
| 849 | Ga0495597_0003248 | 3300046542 | Bacteria | 9645 |
| 850 | Ga0495597_0005301 | 3300046542 | Bacteria | 6842 |
| 851 | Ga0495597_0011052 | 3300046542 | Bacteria | 4386 |
| 852 | Ga0495597_0017828 | 3300046542 | Bacteria | 3336 |
| 853 | Ga0495597_0018327 | 3300046542 | Bacteria | 3285 |
| 854 | Ga0495597_0019376 | 3300046542 | Bacteria | 3185 |
| 855 | Ga0495597_0020769 | 3300046542 | Bacteria | 3055 |
| 856 | Ga0495597_0021836 | 3300046542 | Bacteria | 2973 |
| 857 | Ga0495597_0023587 | 3300046542 | Bacteria | 2845 |
| 858 | Ga0495597_0050214 | 3300046542 | Bacteria | 1842 |
| 859 | Ga0495597_0148372 | 3300046542 | Bacteria | 963 |
| 860 | Ga0495645_0043946 | 3300046543 | Bacteria | 3259 |
| 861 | Ga0495622_0000584 | 3300046557 | Bacteria | 21528 |
| 862 | Ga0495622_0000824 | 3300046557 | Bacteria | 17176 |
| 863 | Ga0495622_0013536 | 3300046557 | Bacteria | 3783 |
| 864 | Ga0495622_0016065 | 3300046557 | Bacteria | 3482 |
| 865 | Ga0495622_0036615 | 3300046557 | Bacteria | 2287 |
| 866 | Ga0495622_0065658 | 3300046557 | Bacteria | 1677 |
| 867 | Ga0495622_0076467 | 3300046557 | Bacteria | 1542 |
| 868 | Ga0495633_0000366 | 3300046558 | Bacteria | 48617 |
| 869 | Ga0495633_0016251 | 3300046558 | Bacteria | 3843 |
| 870 | Ga0495633_0023594 | 3300046558 | Bacteria | 3046 |
| 871 | Ga0495656_0135872 | 3300046615 | Bacteria | 1174 |
| 872 | Ga0495668_0000866 | 3300046616 | Bacteria | 34104 |
| 873 | Ga0495668_0006331 | 3300046616 | Bacteria | 7777 |
| 874 | Ga0495668_0015395 | 3300046616 | Bacteria | 4467 |
| 875 | Ga0495668_0016456 | 3300046616 | Bacteria | 4298 |
| 876 | Ga0495668_0028055 | 3300046616 | Bacteria | 3185 |
| 877 | Ga0495668_0029231 | 3300046616 | Bacteria | 3114 |
| 878 | Ga0495668_0090101 | 3300046616 | Bacteria | 1680 |
| 879 | Ga0495634_0001452 | 3300046642 | Bacteria | 21049 |
| 880 | Ga0495634_0036339 | 3300046642 | Bacteria | 3369 |
| 881 | Ga0495611_0000193 | 3300046648 | Bacteria | 43575 |
| 882 | Ga0495611_0000386 | 3300046648 | Bacteria | 28151 |
| 883 | Ga0495611_0013534 | 3300046648 | Bacteria | 3475 |
| 884 | Ga0495611_0029148 | 3300046648 | Bacteria | 2419 |
| 885 | Ga0495625_0000086 | 3300046660 | Bacteria | 151735 |
| 886 | Ga0495625_0003090 | 3300046660 | Bacteria | 17005 |
| 887 | Ga0495625_0004759 | 3300046660 | Bacteria | 12699 |
| 888 | Ga0495625_0014227 | 3300046660 | Bacteria | 6361 |
| 889 | Ga0495625_0018709 | 3300046660 | Bacteria | 5396 |
| 890 | Ga0495625_0040156 | 3300046660 | Bacteria | 3415 |
| 891 | Ga0495625_0043424 | 3300046660 | Bacteria | 3259 |
| 892 | Ga0495625_0074575 | 3300046660 | Bacteria | 2376 |
| 893 | Ga0495625_0270653 | 3300046660 | Bacteria | 1096 |
| 894 | Ga0495625_0320783 | 3300046660 | Bacteria | 986 |
| 895 | Ga0495635_0001499 | 3300046663 | Bacteria | 15653 |
| 896 | Ga0495635_0011073 | 3300046663 | Bacteria | 6324 |
| 897 | Ga0495659_0000084 | 3300046664 | Bacteria | 40750 |
| 898 | Ga0495659_0060613 | 3300046664 | Bacteria | 1396 |
| 899 | Ga0495661_0000048 | 3300046665 | Bacteria | 144678 |
| 900 | Ga0495661_0000058 | 3300046665 | Bacteria | 133316 |
| 901 | Ga0495661_0000131 | 3300046665 | Bacteria | 90795 |
| 902 | Ga0495661_0000171 | 3300046665 | Bacteria | 76610 |
| 903 | Ga0495661_0003151 | 3300046665 | Bacteria | 12359 |
| 904 | Ga0495661_0003488 | 3300046665 | Bacteria | 11593 |
| 905 | Ga0495661_0021482 | 3300046665 | Bacteria | 4208 |
| 906 | Ga0495661_0031618 | 3300046665 | Bacteria | 3356 |
| 907 | Ga0495661_0032642 | 3300046665 | Bacteria | 3290 |
| 908 | Ga0495661_0039629 | 3300046665 | Bacteria | 2926 |
| 909 | Ga0495661_0040731 | 3300046665 | Bacteria | 2878 |
| 910 | Ga0495661_0045970 | 3300046665 | Bacteria | 2667 |
| 911 | Ga0495661_0060653 | 3300046665 | Bacteria | 2246 |
| 912 | Ga0495661_0062033 | 3300046665 | Bacteria | 2216 |
| 913 | Ga0495588_0030035 | 3300046674 | Bacteria | 2730 |
| 914 | Ga0495588_0222789 | 3300046674 | Bacteria | 995 |
| 915 | Ga0495657_0045138 | 3300046675 | Bacteria | 2992 |
| 916 | Ga0495623_0077213 | 3300046679 | Bacteria | 2065 |
| 917 | Ga0495646_0002514 | 3300046680 | Bacteria | 11265 |
| 918 | Ga0495669_0071894 | 3300046684 | Bacteria | 1578 |
| 919 | Ga0495613_0018639 | 3300046689 | Bacteria | 5175 |
| 920 | Ga0495624_0003730 | 3300046690 | Bacteria | 11262 |
| 921 | Ga0495670_0000302 | 3300046691 | Bacteria | 23271 |
| 922 | Ga0495670_0001543 | 3300046691 | Bacteria | 11267 |
| 923 | Ga0495670_0001965 | 3300046691 | Bacteria | 10098 |
| 924 | Ga0495670_0006959 | 3300046691 | Bacteria | 5571 |
| 925 | Ga0495670_0025900 | 3300046691 | Bacteria | 2903 |
| 926 | Ga0495670_0059985 | 3300046691 | Bacteria | 1910 |
| 927 | Ga0495670_0087318 | 3300046691 | Bacteria | 1593 |
| 928 | Ga0495670_0235322 | 3300046691 | Bacteria | 974 |
| 929 | Ga0495670_0294296 | 3300046691 | Bacteria | 869 |
| 930 | Ga0495671_0000157 | 3300046692 | Bacteria | 59803 |
| 931 | Ga0495671_0001631 | 3300046692 | Bacteria | 14731 |
| 932 | Ga0495671_0014239 | 3300046692 | Bacteria | 4285 |
| 933 | Ga0495671_0027653 | 3300046692 | Bacteria | 2926 |
| 934 | Ga0495671_0032379 | 3300046692 | Bacteria | 2669 |
| 935 | Ga0495671_0032655 | 3300046692 | Bacteria | 2656 |
| 936 | Ga0495671_0046879 | 3300046692 | Bacteria | 2160 |
| 937 | Ga0495671_0071974 | 3300046692 | Bacteria | 1697 |
| 938 | Ga0495671_0085061 | 3300046692 | Bacteria | 1550 |
| 939 | Ga0495671_0096830 | 3300046692 | Bacteria | 1443 |
| 940 | Ga0495671_0122494 | 3300046692 | Bacteria | 1268 |
| 941 | Ga0495671_0227001 | 3300046692 | Bacteria | 903 |
| 942 | Ga0495649_0000782 | 3300046694 | Bacteria | 25561 |
| 943 | Ga0495649_0000965 | 3300046694 | Bacteria | 22681 |
| 944 | Ga0495649_0003415 | 3300046694 | Bacteria | 10734 |
| 945 | Ga0495649_0006929 | 3300046694 | Bacteria | 7002 |
| 946 | Ga0495649_0016636 | 3300046694 | Bacteria | 4166 |
| 947 | Ga0495649_0021290 | 3300046694 | Bacteria | 3633 |
| 948 | Ga0495649_0023174 | 3300046694 | Bacteria | 3468 |
| 949 | Ga0495649_0023224 | 3300046694 | Bacteria | 3465 |
| 950 | Ga0495649_0023339 | 3300046694 | Bacteria | 3457 |
| 951 | Ga0495649_0024230 | 3300046694 | Bacteria | 3384 |
| 952 | Ga0495649_0029107 | 3300046694 | Bacteria | 3059 |
| 953 | Ga0495649_0031594 | 3300046694 | Bacteria | 2919 |
| 954 | Ga0495649_0037264 | 3300046694 | Bacteria | 2669 |
| 955 | Ga0495649_0040130 | 3300046694 | Bacteria | 2564 |
| 956 | Ga0495649_0054920 | 3300046694 | Bacteria | 2153 |
| 957 | Ga0495649_0075663 | 3300046694 | Bacteria | 1802 |
| 958 | Ga0495649_0101197 | 3300046694 | Bacteria | 1531 |
| 959 | Ga0495649_0155195 | 3300046694 | Bacteria | 1201 |
| 960 | Ga0495649_0160496 | 3300046694 | Bacteria | 1178 |
| 961 | Ga0495589_0000647 | 3300046794 | Bacteria | 22840 |
| 962 | Ga0495589_0000866 | 3300046794 | Bacteria | 18894 |
| 963 | Ga0495589_0001416 | 3300046794 | Bacteria | 13904 |
| 964 | Ga0495589_0010462 | 3300046794 | Bacteria | 4821 |
| 965 | Ga0495589_0012387 | 3300046794 | Bacteria | 4417 |
| 966 | Ga0495589_0014178 | 3300046794 | Bacteria | 4107 |
| 967 | Ga0495589_0017131 | 3300046794 | Bacteria | 3720 |
| 968 | Ga0495589_0025324 | 3300046794 | Bacteria | 3011 |
| 969 | Ga0495589_0048724 | 3300046794 | Bacteria | 2097 |
| 970 | Ga0495589_0056841 | 3300046794 | Bacteria | 1925 |
| 971 | Ga0495589_0060883 | 3300046794 | Bacteria | 1853 |
| 972 | Ga0495600_0012548 | 3300046809 | Bacteria | 5301 |
| 973 | Ga0495600_0024810 | 3300046809 | Bacteria | 3860 |
| 974 | Ga0495600_0040754 | 3300046809 | Bacteria | 3025 |
| 975 | Ga0495660_0000608 | 3300046810 | Bacteria | 28251 |
| 976 | Ga0495660_0002259 | 3300046810 | Bacteria | 12393 |
| 977 | Ga0495660_0003303 | 3300046810 | Bacteria | 10011 |
| 978 | Ga0495660_0009505 | 3300046810 | Bacteria | 5668 |
| 979 | Ga0495660_0015879 | 3300046810 | Bacteria | 4345 |
| 980 | Ga0495660_0025139 | 3300046810 | Bacteria | 3384 |
| 981 | Ga0495660_0027881 | 3300046810 | Bacteria | 3193 |
| 982 | Ga0495660_0032244 | 3300046810 | Bacteria | 2942 |
| 983 | Ga0495660_0033188 | 3300046810 | Bacteria | 2895 |
| 984 | Ga0495660_0034505 | 3300046810 | Bacteria | 2831 |
| 985 | Ga0495660_0039127 | 3300046810 | Bacteria | 2634 |
| 986 | Ga0495660_0046476 | 3300046810 | Bacteria | 2380 |
| 987 | Ga0495660_0059766 | 3300046810 | Bacteria | 2049 |
| 988 | Ga0495660_0077036 | 3300046810 | Bacteria | 1755 |
| 989 | Ga0495660_0102607 | 3300046810 | Bacteria | 1470 |
| 990 | Ga0495660_0144202 | 3300046810 | Bacteria | 1181 |
| 991 | Ga0495660_0192389 | 3300046810 | Bacteria | 979 |
| 992 | Ga0495581_0030841 | 3300047315 | Bacteria | 3105 |
| 993 | Ga0495604_0002392 | 3300047317 | Bacteria | 15037 |
| 994 | Ga0495604_0004861 | 3300047317 | Bacteria | 10645 |
| 995 | Ga0495604_0189999 | 3300047317 | Bacteria | 1431 |
| 996 | Ga0495604_0235501 | 3300047317 | Bacteria | 1254 |
| 997 | Ga0495636_0101348 | 3300047318 | Bacteria | 1259 |
| 998 | Ga0495674_0002066 | 3300047319 | Bacteria | 19692 |
| 999 | Ga0495672_0001137 | 3300047320 | Bacteria | 26897 |
| 1000 | Ga0495672_0001472 | 3300047320 | Bacteria | 23111 |
| 1001 | Ga0495672_0001678 | 3300047320 | Bacteria | 21460 |
| 1002 | Ga0495672_0002315 | 3300047320 | Bacteria | 17677 |
| 1003 | Ga0495672_0002439 | 3300047320 | Bacteria | 17116 |
| 1004 | Ga0495672_0006904 | 3300047320 | Bacteria | 8654 |
| 1005 | Ga0495672_0009451 | 3300047320 | Bacteria | 7063 |
| 1006 | Ga0495672_0013935 | 3300047320 | Bacteria | 5526 |
| 1007 | Ga0495672_0019324 | 3300047320 | Bacteria | 4496 |
| 1008 | Ga0495672_0027020 | 3300047320 | Bacteria | 3653 |
| 1009 | Ga0495672_0027981 | 3300047320 | Bacteria | 3574 |
| 1010 | Ga0495672_0029335 | 3300047320 | Bacteria | 3466 |
| 1011 | Ga0495672_0035841 | 3300047320 | Bacteria | 3052 |
| 1012 | Ga0495672_0036952 | 3300047320 | Bacteria | 2993 |
| 1013 | Ga0495672_0055497 | 3300047320 | Bacteria | 2312 |
| 1014 | Ga0495672_0059881 | 3300047320 | Bacteria | 2201 |
| 1015 | Ga0495672_0155514 | 3300047320 | Bacteria | 1181 |
| 1016 | Ga0495672_0176448 | 3300047320 | Bacteria | 1085 |
| 1017 | Ga0495672_0237074 | 3300047320 | Bacteria | 892 |
| 1018 | Ga0495676_0000022 | 3300047321 | Bacteria | 163719 |
| 1019 | Ga0495676_0028987 | 3300047321 | Bacteria | 4718 |
| 1020 | Ga0495680_0001940 | 3300047322 | Bacteria | 21762 |
| 1021 | Ga0495680_0013153 | 3300047322 | Bacteria | 7232 |
| 1022 | Ga0495680_0053910 | 3300047322 | Bacteria | 3125 |
| 1023 | Ga0495683_0000030 | 3300047323 | Bacteria | 150551 |
| 1024 | Ga0495683_0000927 | 3300047323 | Bacteria | 20673 |
| 1025 | Ga0495683_0015733 | 3300047323 | Bacteria | 3928 |
| 1026 | Ga0495683_0015950 | 3300047323 | Bacteria | 3902 |
| 1027 | Ga0495683_0027477 | 3300047323 | Bacteria | 2909 |
| 1028 | Ga0495683_0032163 | 3300047323 | Bacteria | 2672 |
| 1029 | Ga0495683_0049716 | 3300047323 | Bacteria | 2099 |
| 1030 | Ga0495683_0052556 | 3300047323 | Bacteria | 2033 |
| 1031 | Ga0495683_0071033 | 3300047323 | Bacteria | 1708 |
| 1032 | Ga0495683_0076886 | 3300047323 | Bacteria | 1632 |
| 1033 | Ga0495683_0099647 | 3300047323 | Bacteria | 1398 |
| 1034 | Ga0495683_0164105 | 3300047323 | Bacteria | 1025 |
| 1035 | Ga0495687_002395 | 3300047443 | Bacteria | 15125 |
| 1036 | Ga0495687_002578 | 3300047443 | Bacteria | 14291 |
| 1037 | Ga0495687_016372 | 3300047443 | Bacteria | 3730 |
| 1038 | Ga0495675_0002663 | 3300047444 | Bacteria | 10696 |
| 1039 | Ga0495675_0094999 | 3300047444 | Bacteria | 1869 |
| 1040 | Ga0495675_0135571 | 3300047444 | Bacteria | 1528 |
| 1041 | Ga0495677_0004992 | 3300047445 | Bacteria | 5060 |
| 1042 | Ga0495679_000218 | 3300047446 | Bacteria | 48725 |
| 1043 | Ga0495679_008161 | 3300047446 | Bacteria | 4284 |
| 1044 | Ga0495679_009961 | 3300047446 | Bacteria | 3764 |
| 1045 | Ga0495679_010442 | 3300047446 | Bacteria | 3646 |
| 1046 | Ga0495679_011633 | 3300047446 | Bacteria | 3383 |
| 1047 | Ga0495679_013241 | 3300047446 | Bacteria | 3105 |
| 1048 | Ga0495679_015319 | 3300047446 | Bacteria | 2807 |
| 1049 | Ga0495679_015486 | 3300047446 | Bacteria | 2787 |
| 1050 | Ga0495673_0000544 | 3300047469 | Bacteria | 38535 |
| 1051 | Ga0495673_0001080 | 3300047469 | Bacteria | 23910 |
| 1052 | Ga0495673_0001326 | 3300047469 | Bacteria | 20085 |
| 1053 | Ga0495673_0002696 | 3300047469 | Bacteria | 12217 |
| 1054 | Ga0495673_0004063 | 3300047469 | Bacteria | 9316 |
| 1055 | Ga0495673_0004098 | 3300047469 | Bacteria | 9251 |
| 1056 | Ga0495673_0005947 | 3300047469 | Bacteria | 7269 |
| 1057 | Ga0495673_0009951 | 3300047469 | Bacteria | 5211 |
| 1058 | Ga0495673_0010178 | 3300047469 | Bacteria | 5137 |
| 1059 | Ga0495673_0015583 | 3300047469 | Bacteria | 3912 |
| 1060 | Ga0495673_0016719 | 3300047469 | Bacteria | 3744 |
| 1061 | Ga0495673_0018155 | 3300047469 | Bacteria | 3554 |
| 1062 | Ga0495673_0023012 | 3300047469 | Bacteria | 3041 |
| 1063 | Ga0495673_0023895 | 3300047469 | Bacteria | 2963 |
| 1064 | Ga0495673_0023945 | 3300047469 | Bacteria | 2959 |
| 1065 | Ga0495673_0037941 | 3300047469 | Bacteria | 2196 |
| 1066 | Ga0495673_0069614 | 3300047469 | Bacteria | 1483 |
| 1067 | Ga0495673_0070626 | 3300047469 | Bacteria | 1469 |
| 1068 | Ga0495681_0000351 | 3300047470 | Bacteria | 36044 |
| 1069 | Ga0495681_0000411 | 3300047470 | Bacteria | 33097 |
| 1070 | Ga0495681_0000534 | 3300047470 | Bacteria | 29137 |
| 1071 | Ga0495681_0001655 | 3300047470 | Bacteria | 16511 |
| 1072 | Ga0495681_0004365 | 3300047470 | Bacteria | 9668 |
| 1073 | Ga0495681_0005015 | 3300047470 | Bacteria | 8924 |
| 1074 | Ga0495681_0005274 | 3300047470 | Bacteria | 8676 |
| 1075 | Ga0495681_0014124 | 3300047470 | Bacteria | 4598 |
| 1076 | Ga0495681_0015029 | 3300047470 | Bacteria | 4399 |
| 1077 | Ga0495681_0015298 | 3300047470 | Bacteria | 4347 |
| 1078 | Ga0495681_0015554 | 3300047470 | Bacteria | 4298 |
| 1079 | Ga0495681_0017979 | 3300047470 | Bacteria | 3910 |
| 1080 | Ga0495681_0018900 | 3300047470 | Bacteria | 3782 |
| 1081 | Ga0495681_0023727 | 3300047470 | Bacteria | 3250 |
| 1082 | Ga0495681_0028697 | 3300047470 | Bacteria | 2858 |
| 1083 | Ga0495681_0035618 | 3300047470 | Bacteria | 2469 |
| 1084 | Ga0495681_0040112 | 3300047470 | Bacteria | 2281 |
| 1085 | Ga0495681_0103202 | 3300047470 | Bacteria | 1244 |
| 1086 | Ga0495684_0272349 | 3300047471 | Bacteria | 1224 |
| 1087 | Ga0495686_0028405 | 3300047472 | Bacteria | 3643 |
| 1088 | Ga0495686_0030068 | 3300047472 | Bacteria | 3530 |
| 1089 | Ga0495686_0033029 | 3300047472 | Bacteria | 3343 |
| 1090 | Ga0495686_0040042 | 3300047472 | Bacteria | 2990 |
| 1091 | Ga0495686_0049419 | 3300047472 | Bacteria | 2646 |
| 1092 | Ga0495686_0075733 | 3300047472 | Bacteria | 2062 |
| 1093 | Ga0495593_0010377 | 3300047673 | Bacteria | 5385 |
| 1094 | Ga0495593_0020211 | 3300047673 | Bacteria | 3729 |
| 1095 | Ga0495593_0050812 | 3300047673 | Bacteria | 2195 |
| 1096 | Ga0495602_0058196 | 3300048088 | Bacteria | 3385 |
| 1097 | Ga0495602_0579484 | 3300048088 | Bacteria | 774 |
| 1098 | Ga0495626_0000039 | 3300048091 | Bacteria | 175454 |
| 1099 | Ga0495626_0000391 | 3300048091 | Bacteria | 45354 |
| 1100 | Ga0495626_0000562 | 3300048091 | Bacteria | 36865 |
| 1101 | Ga0495626_0000876 | 3300048091 | Bacteria | 26763 |
| 1102 | Ga0495626_0001660 | 3300048091 | Bacteria | 17183 |
| 1103 | Ga0495626_0001894 | 3300048091 | Bacteria | 15625 |
| 1104 | Ga0495626_0017787 | 3300048091 | Bacteria | 3583 |
| 1105 | Ga0495626_0029164 | 3300048091 | Bacteria | 2672 |
| 1106 | Ga0495626_0050757 | 3300048091 | Bacteria | 1915 |
| 1107 | Ga0495626_0051000 | 3300048091 | Bacteria | 1910 |
| 1108 | Ga0496102_0001161 | 3300048905 | Bacteria | 24071 |
| 1109 | Ga0496102_0102955 | 3300048905 | Bacteria | 2655 |
| 1110 | Ga0496102_0205491 | 3300048905 | Bacteria | 1857 |
| 1111 | Ga0496103_0022118 | 3300048906 | Bacteria | 3828 |
| 1112 | Ga0496110_0051109 | 3300048913 | Bacteria | 3632 |
| 1113 | Ga0496110_0230231 | 3300048913 | Bacteria | 1685 |
| 1114 | Ga0496110_0569748 | 3300048913 | Bacteria | 1028 |
| 1115 | Ga0496112_0094767 | 3300048915 | Bacteria | 2956 |
| 1116 | Ga0496114_0015310 | 3300048917 | Bacteria | 6166 |
| 1117 | Ga0496116_0000376 | 3300048919 | Bacteria | 66696 |
| 1118 | Ga0496116_0001403 | 3300048919 | Bacteria | 27112 |
| 1119 | Ga0496116_0004841 | 3300048919 | Bacteria | 12698 |
| 1120 | Ga0496116_0037495 | 3300048919 | Bacteria | 3379 |
| 1121 | Ga0496116_0043304 | 3300048919 | Bacteria | 3068 |
| 1122 | Ga0496116_0056128 | 3300048919 | Bacteria | 2583 |
| 1123 | Ga0496117_0001205 | 3300048920 | Bacteria | 38844 |
| 1124 | Ga0496117_0004904 | 3300048920 | Bacteria | 14392 |
| 1125 | Ga0496117_0039140 | 3300048920 | Bacteria | 3503 |
| 1126 | Ga0496117_0041751 | 3300048920 | Bacteria | 3356 |
| 1127 | Ga0496117_0043992 | 3300048920 | Bacteria | 3238 |
| 1128 | Ga0496117_0148103 | 3300048920 | Bacteria | 1394 |
| 1129 | Ga0496118_0030684 | 3300048921 | Bacteria | 4477 |
| 1130 | Ga0496118_0040717 | 3300048921 | Bacteria | 3690 |
| 1131 | Ga0496118_0047610 | 3300048921 | Bacteria | 3321 |
| 1132 | Ga0496118_0086828 | 3300048921 | Bacteria | 2172 |
| 1133 | Ga0496118_0132446 | 3300048921 | Bacteria | 1598 |
| 1134 | Ga0496118_0132605 | 3300048921 | Bacteria | 1596 |
| 1135 | Ga0496119_0000082 | 3300048922 | Bacteria | 138565 |
| 1136 | Ga0496119_0148135 | 3300048922 | Bacteria | 1260 |
| 1137 | Ga0496120_0000873 | 3300048923 | Bacteria | 42650 |
| 1138 | Ga0496120_0017629 | 3300048923 | Bacteria | 4620 |
| 1139 | Ga0496120_0071677 | 3300048923 | Bacteria | 1901 |
| 1140 | Ga0496121_0001119 | 3300048924 | Bacteria | 47137 |
| 1141 | Ga0496121_0001386 | 3300048924 | Bacteria | 41013 |
| 1142 | Ga0496121_0033948 | 3300048924 | Bacteria | 4603 |
| 1143 | Ga0496121_0056141 | 3300048924 | Bacteria | 3273 |
| 1144 | Ga0496121_0080167 | 3300048924 | Bacteria | 2589 |
| 1145 | Ga0496121_0129808 | 3300048924 | Bacteria | 1888 |
| 1146 | Ga0496122_0003673 | 3300048925 | Bacteria | 19907 |
| 1147 | Ga0496122_0012580 | 3300048925 | Bacteria | 8401 |
| 1148 | Ga0496122_0027078 | 3300048925 | Bacteria | 4914 |
| 1149 | Ga0496122_0078088 | 3300048925 | Bacteria | 2321 |
| 1150 | Ga0496122_0090502 | 3300048925 | Bacteria | 2087 |
| 1151 | Ga0496122_0130565 | 3300048925 | Bacteria | 1597 |
| 1152 | Ga0496123_0002626 | 3300048926 | Bacteria | 21790 |
| 1153 | Ga0496123_0044086 | 3300048926 | Bacteria | 3053 |
| 1154 | Ga0496123_0047650 | 3300048926 | Bacteria | 2892 |
| 1155 | Ga0496123_0070988 | 3300048926 | Bacteria | 2175 |
| 1156 | Ga0496123_0081009 | 3300048926 | Bacteria | 1975 |
| 1157 | Ga0496124_0000120 | 3300048927 | Bacteria | 163899 |
| 1158 | Ga0496124_0014469 | 3300048927 | Bacteria | 7628 |
| 1159 | Ga0496124_0023214 | 3300048927 | Bacteria | 5668 |
| 1160 | Ga0496124_0024564 | 3300048927 | Bacteria | 5474 |
| 1161 | Ga0496124_0030509 | 3300048927 | Bacteria | 4784 |
| 1162 | Ga0496124_0039994 | 3300048927 | Bacteria | 4059 |
| 1163 | Ga0496124_0050285 | 3300048927 | Bacteria | 3553 |
| 1164 | Ga0496124_0062371 | 3300048927 | Bacteria | 3119 |
| 1165 | Ga0496124_0078549 | 3300048927 | Bacteria | 2719 |
| 1166 | Ga0496124_0272504 | 3300048927 | Bacteria | 1238 |
| 1167 | Ga0496125_0000799 | 3300048928 | Bacteria | 51395 |
| 1168 | Ga0496125_0006647 | 3300048928 | Bacteria | 12444 |
| 1169 | Ga0496125_0027012 | 3300048928 | Bacteria | 5212 |
| 1170 | Ga0496125_0060412 | 3300048928 | Bacteria | 3046 |
| 1171 | Ga0496125_0163594 | 3300048928 | Bacteria | 1507 |
| 1172 | Ga0495678_000017 | 3300049459 | Bacteria | 282592 |
| 1173 | Ga0495678_000693 | 3300049459 | Bacteria | 30734 |
| 1174 | Ga0495678_011031 | 3300049459 | Bacteria | 4346 |
| 1175 | Ga0495678_011218 | 3300049459 | Bacteria | 4303 |
| 1176 | Ga0495678_013930 | 3300049459 | Bacteria | 3756 |
| 1177 | Ga0495678_015310 | 3300049459 | Bacteria | 3534 |
| 1178 | Ga0495678_015877 | 3300049459 | Bacteria | 3456 |
| 1179 | Ga0495678_016010 | 3300049459 | Bacteria | 3441 |
| 1180 | Ga0495678_019562 | 3300049459 | Bacteria | 3016 |
| 1181 | Ga0495678_022757 | 3300049459 | Bacteria | 2735 |
| 1182 | Ga0495678_024466 | 3300049459 | Bacteria | 2607 |
| 1183 | Ga0495678_058860 | 3300049459 | Bacteria | 1450 |
| 1184 | Ga0495682_0000182 | 3300049460 | Bacteria | 51816 |
| 1185 | Ga0495682_0003288 | 3300049460 | Bacteria | 7227 |
| 1186 | Ga0495682_0007762 | 3300049460 | Bacteria | 4251 |
| 1187 | Ga0495682_0014543 | 3300049460 | Bacteria | 2983 |
| 1188 | Ga0495682_0034520 | 3300049460 | Bacteria | 1864 |
| 1189 | Ga0495682_0048640 | 3300049460 | Bacteria | 1545 |
| 1190 | Ga0495682_0056984 | 3300049460 | Bacteria | 1415 |
| 1191 | Ga0495682_0147905 | 3300049460 | Bacteria | 838 |
| 1192 | Ga0501038_0045138 | 3300049574 | Bacteria | 3826 |
| 1193 | Ga0501039_0501836 | 3300049575 | Bacteria | 953 |
| 1194 | Ga0501040_0344442 | 3300049576 | Bacteria | 1067 |
| 1195 | Ga0501042_0108652 | 3300049578 | Unclassified | 1997 |
| 1196 | Ga0501043_0011788 | 3300049579 | Bacteria | 6847 |
| 1197 | Ga0501046_0196489 | 3300049580 | Unclassified | 1502 |
| 1198 | Ga0501047_0004948 | 3300049581 | Bacteria | 12512 |
| 1199 | Ga0501047_0133524 | 3300049581 | Bacteria | 2362 |
| 1200 | Ga0501067_0004678 | 3300049583 | Bacteria | 7576 |
| 1201 | Ga0501067_0118484 | 3300049583 | Bacteria | 1473 |
| 1202 | Ga0501068_0004775 | 3300049584 | Bacteria | 7375 |
| 1203 | Ga0501070_0049378 | 3300049586 | Bacteria | 3494 |
| 1204 | Ga0501071_0038675 | 3300049587 | Bacteria | 3409 |
| 1205 | Ga0501071_0183209 | 3300049587 | Unclassified | 1569 |
| 1206 | Ga0501072_0111218 | 3300049588 | Bacteria | 2180 |
| 1207 | Ga0501073_0000405 | 3300049589 | Bacteria | 29429 |
| 1208 | Ga0501073_0010478 | 3300049589 | Bacteria | 6795 |
| 1209 | Ga0501073_0234756 | 3300049589 | Unclassified | 1267 |
| 1210 | Ga0501075_0005105 | 3300049591 | Bacteria | 8970 |
| 1211 | Ga0501076_0014020 | 3300049592 | Bacteria | 6024 |
| 1212 | Ga0501076_0021177 | 3300049592 | Bacteria | 4984 |
| 1213 | Ga0501077_0020106 | 3300049593 | Bacteria | 4225 |
| 1214 | Ga0501077_0302071 | 3300049593 | Unclassified | 1020 |
| 1215 | Ga0501079_0011299 | 3300049741 | Bacteria | 6810 |
| 1216 | Ga0501080_0001172 | 3300049742 | Bacteria | 21702 |
| 1217 | Ga0501080_0146927 | 3300049742 | Unclassified | 2179 |
| 1218 | Ga0501080_0147183 | 3300049742 | Bacteria | 2177 |
| 1219 | Ga0501081_0007493 | 3300049743 | Bacteria | 7077 |
| 1220 | Ga0501081_0122715 | 3300049743 | Bacteria | 1852 |
| 1221 | Ga0501083_0029801 | 3300049744 | Bacteria | 3750 |
| 1222 | Ga0501241_000354 | 3300049758 | Bacteria | 10079 |
| 1223 | Ga0501044_0248569 | 3300049823 | Bacteria | 1720 |
| 1224 | nmdc:mga00v17_210902_c1 | 3300050491 | Bacteria | 1257 |
| 1225 | nmdc:mga00v17_43712_c1 | 3300050491 | Bacteria | 2699 |
| 1226 | nmdc:mga0qj67_438605_c1 | 3300050509 | Bacteria | 1052 |
| 1227 | nmdc:mga08y16_657244_c1 | 3300050511 | Bacteria | 1052 |
| 1228 | nmdc:mga08x19_332261_c1 | 3300050514 | Bacteria | 1059 |
| 1229 | Ga0500583_0003831 | 3300053092 | Bacteria | 4810 |
| 1230 | Ga0500583_0014754 | 3300053092 | Bacteria | 3070 |
| 1231 | Ga0500651_0183419 | 3300053093 | Bacteria | 1242 |
| 1232 | Ga0500641_0007501 | 3300053096 | Bacteria | 3893 |
| 1233 | Ga0500556_0020665 | 3300053104 | Bacteria | 2110 |
| 1234 | Ga0500569_023472 | 3300053109 | Unclassified | 1658 |
| 1235 | Ga0500572_004875 | 3300053111 | Bacteria | 3038 |
| 1236 | Ga0500593_112169 | 3300053117 | Bacteria | 1119 |
| 1237 | Ga0500595_003422 | 3300053119 | Bacteria | 7420 |
| 1238 | Ga0500573_0047189 | 3300053140 | Bacteria | 2481 |
| 1239 | Ga0500616_0000092 | 3300053153 | Bacteria | 183860 |
| 1240 | Ga0500616_0008351 | 3300053153 | Bacteria | 6444 |
| 1241 | Ga0500622_0002074 | 3300053156 | Bacteria | 14930 |
| 1242 | Ga0500627_0051543 | 3300053158 | Bacteria | 1795 |
| 1243 | Ga0500634_0026210 | 3300053161 | Bacteria | 3174 |
| 1244 | Ga0501084_0040792 | 3300054114 | Bacteria | 3884 |
| 1245 | Ga0501084_0064459 | 3300054114 | Bacteria | 3066 |
| 1246 | Ga0501082_0047472 | 3300060353 | Bacteria | 3700 |
| 1247 | Ga0501082_0922531 | 3300060353 | Bacteria | 764 |
| 1248 | Ga0530510_0032432 | 3300061734 | Bacteria | 3759 |
| 1249 | 2808939683 | 2808606379 | Bacteria | 5022697 |
| 1250 | 2510284315 | 2510065053 | Bacteria | 5005518 |
| 1251 | 2510292996 | 2510065055 | Bacteria | 5037935 |
| 1252 | 2510312502 | 2510065058 | Bacteria | 5005894 |
| 1253 | 2511256400 | 2511231004 | Bacteria | 6669789 |
| 1254 | 2511266106 | 2511231006 | Bacteria | 6794709 |
| 1255 | 2511278978 | 2511231008 | Bacteria | 6624100 |
| 1256 | 2511288784 | 2511231010 | Bacteria | 6373152 |
| 1257 | 2511297349 | 2511231011 | Bacteria | 6149768 |
| 1258 | 2511300350 | 2511231012 | Bacteria | 6738011 |
| 1259 | 2511316714 | 2511231014 | Bacteria | 6462302 |
| 1260 | 2511317628 | 2511231015 | Bacteria | 6598026 |
| 1261 | 2511326023 | 2511231016 | Bacteria | 6704427 |
| 1262 | 2511330985 | 2511231017 | Bacteria | 6503007 |
| 1263 | 2511336320 | 2511231018 | Bacteria | 6436256 |
| 1264 | 2511349116 | 2511231020 | Bacteria | 6115223 |
| 1265 | 2511355992 | 2511231021 | Bacteria | 7302637 |
| 1266 | 2511362595 | 2511231022 | Bacteria | 6719296 |
| 1267 | 2511366827 | 2511231023 | Bacteria | 6808468 |
| 1268 | 2511411317 | 2511231031 | Bacteria | 6558529 |
| 1269 | 2511822457 | 2511231156 | Bacteria | 6845832 |
| 1270 | 2512325958 | 2512047018 | Bacteria | 6663241 |
| 1271 | 2555245724 | 2554235231 | Bacteria | 5215788 |
| 1272 | 2555667420 | 2554235341 | Bacteria | 6867980 |
| 1273 | 2583789802 | 2582580891 | Bacteria | 6800976 |
| 1274 | 2597855664 | 2597489887 | Bacteria | 6666321 |
| 1275 | 2597861664 | 2597489888 | Bacteria | 6179543 |
| 1276 | 2597867389 | 2597489889 | Bacteria | 6297495 |
| 1277 | 2599327422 | 2599185155 | Bacteria | 5827168 |
| 1278 | 2599356643 | 2599185160 | Bacteria | 6844013 |
| 1279 | 2599363327 | 2599185161 | Bacteria | 6960462 |
| 1280 | 2599369721 | 2599185162 | Bacteria | 6957254 |
| 1281 | 2599376436 | 2599185163 | Bacteria | 6995158 |
| 1282 | 2599381748 | 2599185164 | Bacteria | 6841688 |
| 1283 | 2599388108 | 2599185165 | Bacteria | 6843250 |
| 1284 | 2599395368 | 2599185166 | Bacteria | 6959206 |
| 1285 | 2599398849 | 2599185167 | Bacteria | 6353609 |
| 1286 | 2599407133 | 2599185168 | Bacteria | 6997636 |
| 1287 | 2599450904 | 2599185179 | Bacteria | 6611171 |
| 1288 | 2599463476 | 2599185181 | Bacteria | 6844519 |
| 1289 | 2599469174 | 2599185182 | Bacteria | 6883168 |
| 1290 | 2599485566 | 2599185185 | Bacteria | 6652270 |
| 1291 | 2599492493 | 2599185186 | Bacteria | 6831633 |
| 1292 | 2599500108 | 2599185188 | Bacteria | 6164180 |
| 1293 | 2599506430 | 2599185189 | Bacteria | 5862825 |
| 1294 | 2599514150 | 2599185190 | Bacteria | 6285678 |
| 1295 | 2599518751 | 2599185191 | Bacteria | 6297582 |
| 1296 | 2599614592 | 2599185212 | Bacteria | 6765997 |
| 1297 | 2599769413 | 2599185248 | Bacteria | 6696816 |
| 1298 | 2599806695 | 2599185257 | Bacteria | 6492581 |
| 1299 | 2599882666 | 2599185288 | Bacteria | 6666191 |
| 1300 | 2599886833 | 2599185289 | Bacteria | 6778765 |
| 1301 | 2599893515 | 2599185290 | Bacteria | 6289611 |
| 1302 | 2599898162 | 2599185291 | Bacteria | 6775623 |
| 1303 | 2599930895 | 2599185300 | Bacteria | 6062622 |
| 1304 | 2599943599 | 2599185302 | Bacteria | 5954930 |
| 1305 | 2599950757 | 2599185303 | Bacteria | 6512725 |
| 1306 | 2599955910 | 2599185304 | Bacteria | 5951361 |
| 1307 | 2599962039 | 2599185305 | Bacteria | 6748700 |
| 1308 | 2599964551 | 2599185306 | Bacteria | 6637356 |
| 1309 | 2599978908 | 2599185308 | Bacteria | 6621546 |
| 1310 | 2599984603 | 2599185309 | Bacteria | 5969593 |
| 1311 | 2599991244 | 2599185310 | Bacteria | 6014457 |
| 1312 | 2599994850 | 2599185311 | Bacteria | 6354990 |
| 1313 | 2600002225 | 2599185312 | Bacteria | 5912071 |
| 1314 | 2600004864 | 2599185313 | Bacteria | 6658188 |
| 1315 | 2600012868 | 2599185314 | Bacteria | 6621749 |
| 1316 | 2600018973 | 2599185315 | Bacteria | 6771107 |
| 1317 | 2600023969 | 2599185316 | Bacteria | 6320029 |
| 1318 | 2600030994 | 2599185317 | Bacteria | 6435722 |
| 1319 | 2600034670 | 2599185318 | Bacteria | 6961590 |
| 1320 | 2600043463 | 2599185319 | Bacteria | 6637840 |
| 1321 | 2600048055 | 2599185320 | Bacteria | 5963263 |
| 1322 | 2600053326 | 2599185321 | Bacteria | 6764560 |
| 1323 | 2600061328 | 2599185322 | Bacteria | 6763055 |
| 1324 | 2600067616 | 2599185323 | Bacteria | 6688755 |
| 1325 | 2600071793 | 2599185324 | Bacteria | 6590677 |
| 1326 | 2600077662 | 2599185325 | Bacteria | 6324919 |
| 1327 | 2600216105 | 2599185356 | Bacteria | 6843884 |
| 1328 | 2600360885 | 2600254930 | Bacteria | 6431253 |
| 1329 | 2600364881 | 2600254931 | Bacteria | 6734225 |
| 1330 | 2601692349 | 2600255296 | Bacteria | 5784754 |
| 1331 | 2601776272 | 2600255313 | Bacteria | 6842543 |
| 1332 | 2601797836 | 2600255318 | Bacteria | 6383414 |
| 1333 | 2602008645 | 2600255389 | Bacteria | 5275336 |
| 1334 | 2606076681 | 2603880185 | Bacteria | 6379190 |
| 1335 | 2606128905 | 2603880199 | Bacteria | 6377649 |
| 1336 | 2621302176 | 2619619299 | Bacteria | 6649820 |
| 1337 | 2624478225 | 2623620443 | Bacteria | 6427864 |
| 1338 | 2643872617 | 2643221571 | Bacteria | 6228673 |
| 1339 | 2643954899 | 2643221589 | Bacteria | 6250934 |
| 1340 | 2644024539 | 2643221602 | Bacteria | 6249926 |
| 1341 | 2644186125 | 2643221633 | Bacteria | 6733554 |
| 1342 | 2644282073 | 2643221650 | Bacteria | 7029547 |
| 1343 | 2644619650 | 2643221713 | Bacteria | 6554480 |
| 1344 | 2652543419 | 2651869719 | Bacteria | 6047974 |
| 1345 | 2671090799 | 2667528170 | Bacteria | 6786960 |
| 1346 | 2671099967 | 2667528171 | Bacteria | 6900659 |
| 1347 | 2671127338 | 2667528176 | Bacteria | 6724917 |
| 1348 | 2671772346 | 2671180172 | Bacteria | 6495783 |
| 1349 | 2677898952 | 2675903420 | Bacteria | 6247433 |
| 1350 | 2678260990 | 2675903515 | Bacteria | 6580491 |
| 1351 | 2715749210 | 2713897148 | Bacteria | 5883533 |
| 1352 | 2715755480 | 2713897149 | Bacteria | 6506249 |
| 1353 | 2718632162 | 2718217725 | Bacteria | 5758958 |
| 1354 | 2723246562 | 2721755607 | Bacteria | 5841722 |
| 1355 | 2738674089 | 2738541265 | Bacteria | 6594665 |
| 1356 | 2738752482 | 2738541282 | Bacteria | 6593925 |
| 1357 | 2738807905 | 2738541294 | Bacteria | 6925949 |
| 1358 | 2738861523 | 2738541303 | Bacteria | 6591772 |
| 1359 | 2738895265 | 2738541309 | Bacteria | 6926455 |
| 1360 | 2739198030 | 2738543004 | Bacteria | 6381073 |
| 1361 | 2739260294 | 2738543015 | Bacteria | 6750701 |
| 1362 | 2739288589 | 2738543020 | Bacteria | 5718238 |
| 1363 | 2739293901 | 2738543021 | Bacteria | 5718241 |
| 1364 | 2739311284 | 2738543025 | Bacteria | 6600348 |
| 1365 | 2743735081 | 2740892503 | Bacteria | 6855563 |
| 1366 | 2745006302 | 2744054620 | Bacteria | 6551379 |
| 1367 | 2774119557 | 2773857670 | Bacteria | 6407454 |
| 1368 | 2774131495 | 2773857672 | Bacteria | 4993178 |
| 1369 | 2774134740 | 2773857673 | Bacteria | 6513460 |
| 1370 | 2784261043 | 2784132063 | Bacteria | 6262788 |
| 1371 | 2784315968 | 2784132072 | Bacteria | 6596533 |
| 1372 | 2794593981 | 2791355520 | Bacteria | 5948615 |
| 1373 | 2808855941 | 2808606361 | Bacteria | 6136259 |
| 1374 | 2808905431 | 2808606373 | Bacteria | 4423627 |
| 1375 | 2808922744 | 2808606376 | Bacteria | 6248667 |
| 1376 | 2808932179 | 2808606377 | Bacteria | 6646337 |
| 1377 | 2808936021 | 2808606378 | Bacteria | 6177535 |
| 1378 | 2808944431 | 2808606380 | Bacteria | 6248705 |
| 1379 | 2808954220 | 2808606381 | Bacteria | 6646461 |
| 1380 | 2808964482 | 2808606383 | Bacteria | 6138645 |
| 1381 | 2808976658 | 2808606385 | Bacteria | 6711065 |
| 1382 | 2808991904 | 2808606388 | Bacteria | 6706662 |
| 1383 | 2808999370 | 2808606389 | Bacteria | 6138126 |
| 1384 | 2809217980 | 2808606445 | Bacteria | 6057339 |
| 1385 | 2812370181 | 2811994881 | Bacteria | 6298475 |
| 1386 | 2817488414 | 2816332298 | Bacteria | 6852809 |
| 1387 | 2819657234 | 2818991456 | Bacteria | 6123676 |
| 1388 | 2819705217 | 2818991464 | Bacteria | 6907494 |
| 1389 | 2823425500 | 2823421272 | Bacteria | 5372474 |
| 1390 | 2825654264 | 2825651385 | Bacteria | 6715909 |
| 1391 | 2826586874 | 2826581358 | Bacteria | 5963467 |
| 1392 | 2834032209 | 2834028612 | Bacteria | 6354979 |
| 1393 | 2842807109 | 2842805378 | Bacteria | 5385175 |
| 1394 | 2842816692 | 2842815866 | Bacteria | 5947510 |
| 1395 | 2842832087 | 2842826826 | Bacteria | 5974129 |
| 1396 | 2842834162 | 2842832357 | Bacteria | 5959113 |
| 1397 | 2842838637 | 2842837860 | Bacteria | 6066181 |
| 1398 | 2842846361 | 2842843487 | Bacteria | 6004777 |
| 1399 | 2842852260 | 2842849001 | Bacteria | 5924277 |
| 1400 | 2842858724 | 2842854478 | Bacteria | 6143501 |
| 1401 | 2844667900 | 2844665904 | Bacteria | 6817974 |
| 1402 | 2852617078 | 2852612431 | Bacteria | 6885235 |
| 1403 | 2852660449 | 2852657418 | Bacteria | 6472974 |
| 1404 | 2852671933 | 2852667396 | Bacteria | 6885555 |
| 1405 | 2860868438 | 2860867994 | Bacteria | 5645326 |
| 1406 | 2878030168 | 2878029506 | Bacteria | 6418441 |
| 1407 | 2880231115 | 2880230671 | Bacteria | 6140320 |
| 1408 | 2894513819 | 2894510363 | Bacteria | 5121143 |
| 1409 | 2904519574 | 2904518522 | Bacteria | 6068986 |
| 1410 | 2904552156 | 2904550169 | Bacteria | 6221258 |
| 1411 | 2908447031 | 2908446538 | Bacteria | 6829095 |
| 1412 | 2912964087 | 2912963787 | Bacteria | 5646108 |
| 1413 | 2913037288 | 2913036834 | Bacteria | 6704877 |
| 1414 | 2917071171 | 2917070673 | Bacteria | 6868303 |
| 1415 | 2917836379 | 2917832318 | Bacteria | 5346010 |
| 1416 | 2919066150 | 2919063839 | Bacteria | 6302690 |
| 1417 | 2919127488 | 2919125081 | Bacteria | 5385106 |
| 1418 | 2919155786 | 2919155634 | Bacteria | 4860545 |
| 1419 | 2919389774 | 2919385768 | Bacteria | 5897293 |
| 1420 | 2919459987 | 2919456309 | Bacteria | 6586567 |
| 1421 | 2919486893 | 2919481497 | Bacteria | 6907839 |
| 1422 | 2919488701 | 2919487758 | Bacteria | 5929766 |
| 1423 | 2919502235 | 2919501602 | Bacteria | 5286340 |
| 1424 | 2923154076 | 2923153595 | Bacteria | 6870622 |
| 1425 | 2923524272 | 2923519811 | Bacteria | 6298479 |
| 1426 | 2923589788 | 2923586266 | Bacteria | 6565975 |
| 1427 | 2926063908 | 2926063275 | Bacteria | 5285848 |
| 1428 | 2929144819 | 2929144301 | Bacteria | 6622272 |
| 1429 | 2929190303 | 2929189879 | Bacteria | 5930554 |
| 1430 | 2931371845 | 2931369376 | Bacteria | 6847892 |
| 1431 | 2931391382 | 2931390751 | Bacteria | 6273349 |
| 1432 | 2935358999 | 2935353572 | Unclassified | 6955622 |
| 1433 | 2939654979 | 2939651529 | Bacteria | 5895393 |
| 1434 | 2945930164 | 2945928738 | Bacteria | 6053221 |
| 1435 | 2945967592 | 2945961074 | Bacteria | 7342064 |
| 1436 | 2946012511 | 2946006987 | Bacteria | 6705746 |
| 1437 | 2946028646 | 2946027586 | Bacteria | 6049274 |
| 1438 | 2947235173 | 2947233263 | Bacteria | 6439278 |
| 1439 | 2969304961 | 2969304461 | Bacteria | 6601805 |
| 1440 | 2974293347 | 2974289157 | Bacteria | 6080362 |
| 1441 | 2974301735 | 2974298342 | Bacteria | 4840922 |
| 1442 | 2984291983 | 2984286254 | Bacteria | 6702062 |
| 1443 | 2984500696 | 2984499530 | Bacteria | 5020881 |
| 1444 | 2984507219 | 2984504281 | Bacteria | 5262371 |
| 1445 | 2988732208 | 2988728565 | Bacteria | 6124362 |
| 1446 | 2989393230 | 2989392574 | Bacteria | 4554005 |
| 1447 | 2990199578 | 2990196909 | Bacteria | 4054280 |
| 1448 | 2998140464 | 2998139840 | Bacteria | 6073514 |
| 1449 | 3007255370 | 3007252601 | Bacteria | 4559114 |
| 1450 | 3007315824 | 3007315729 | Bacteria | 5076637 |
| 1451 | 3007399627 | 3007395558 | Bacteria | 6755444 |
| 1452 | 3007420026 | 3007419365 | Bacteria | 7026924 |
| 1453 | 3007517909 | 3007511990 | Bacteria | 6481491 |
| 1454 | 3007618652 | 3007614139 | Bacteria | 6053559 |
| 1455 | 3007624986 | 3007619802 | Bacteria | 6411688 |
| 1456 | 3007721225 | 3007718800 | Bacteria | 5971527 |
| 1457 | 3007859704 | 3007855910 | Bacteria | 5637581 |
| 1458 | 3007864323 | 3007861166 | Bacteria | 6045338 |
| 1459 | 3007872019 | 3007866637 | Bacteria | 5899198 |
| 1460 | 637317817 | 637000220 | Bacteria | 7074893 |
| 1461 | 8015688325 | 8015687852 | Bacteria | 6613826 |
| 1462 | 8030000274 | 8029995093 | Bacteria | 5990776 |
| 1463 | 8054291526 | 8054285046 | Bacteria | 6919322 |
| 1464 | 8054350128 | 8054347763 | Bacteria | 5901107 |
| 1465 | 8054503969 | 8054503363 | Bacteria | 6101651 |
| 1466 | 8055771422 | 8055770955 | Bacteria | 6827675 |
| 1467 | 8055818365 | 8055817908 | Bacteria | 6609162 |
| 1468 | 8056126477 | 8056125926 | Bacteria | 6228218 |
| 1469 | 8056132339 | 8056131705 | Bacteria | 6107031 |
| 1470 | 8056143741 | 8056143049 | Bacteria | 6307666 |
| 1471 | 8056152479 | 8056148874 | Bacteria | 6479865 |
| 1472 | 8056158516 | 8056155041 | Bacteria | 6486948 |
| 1473 | 8056164345 | 8056161164 | Bacteria | 6106669 |
| 1474 | 8056170587 | 8056166840 | Bacteria | 5820959 |
| 1475 | 8056176702 | 8056172158 | Bacteria | 6133900 |
| 1476 | 8056183039 | 8056177738 | Bacteria | 6748268 |
| 1477 | 8056572323 | 8056569372 | Bacteria | 5997322 |
| 1478 | 8057802711 | 8057798959 | Bacteria | 6713499 |
| 1479 | MRS2a_Contig_10320 | |||
| 1480 | MRS2a_Contig_66 | |||
| 1481 | SwRhRL2b_contig_1197704 | |||
| 1482 | JGI24741J21665_1006033 | |||
| 1483 | JGI25162J39368_1000140 | |||
| 1484 | JGI25162J39368_1000181 | |||
| 1485 | JGI25154J39366_1003720 | |||
| 1486 | JGI25163J39215_1000195 | |||
| 1487 | JGI25163J39215_1000288 | |||
| 1488 | JGI25164J39214_1000110 | |||
| 1489 | JGI25164J39214_1000146 | |||
| 1490 | JGI25406J46586_10003703 | |||
| 1491 | JGI25165J46597_1000228 | |||
| 1492 | JGI25165J46597_1000267 | |||
| 1493 | rootH1_10143248 | |||
| 1494 | Ga0055538_1000037 | |||
| 1495 | Ga0055539_1000048 | |||
| 1496 | Ga0055533_1000059 | |||
| 1497 | Ga0055532_1000105 | |||
| 1498 | Ga0055525_1000057 | |||
| 1499 | Ga0055525_1000128 | |||
| 1500 | Ga0055535_1006635 | |||
| 1501 | Ga0055526_1000962 | |||
| 1502 | Ga0055536_1000328 | |||
| 1503 | Ga0055536_1000392 | |||
| 1504 | Ga0055536_1000624 | |||
| 1505 | Ga0055536_1039737 | |||
| 1506 | Ga0055530_10000098 | |||
| 1507 | Ga0055530_10000333 | |||
| 1508 | Ga0055530_10002459 | |||
| 1509 | Ga0055540_1000138 | |||
| 1510 | Ga0055540_1000279 | |||
| 1511 | Ga0055540_1000586 | |||
| 1512 | Ga0055531_10000321 | |||
| 1513 | Ga0055541_1000035 | |||
| 1514 | Ga0065714_10002325 | |||
| 1515 | Ga0065714_10065492 | |||
| 1516 | Ga0065714_10072189 | |||
| 1517 | Ga0065714_10103225 | |||
| 1518 | Ga0065714_10165111 | |||
| 1519 | Ga0065704_10013597 | |||
| 1520 | Ga0065704_10038164 | |||
| 1521 | Ga0065704_10078436 | |||
| 1522 | Ga0065715_10109483 | |||
| 1523 | Ga0070676_10046631 | |||
| 1524 | Ga0070690_100003509 | |||
| 1525 | Ga0070670_100002909 | |||
| 1526 | Ga0070670_100020308 | |||
| 1527 | Ga0070670_100069743 | |||
| 1528 | Ga0068868_100596275 | |||
| 1529 | Ga0070689_100001983 | |||
| 1530 | Ga0070689_100070459 | |||
| 1531 | Ga0070661_100000078 | |||
| 1532 | Ga0070669_100000221 | |||
| 1533 | Ga0070675_100107876 | |||
| 1534 | Ga0070674_100178907 | |||
| 1535 | Ga0070674_100677088 | |||
| 1536 | Ga0070688_100009229 | |||
| 1537 | Ga0070688_100050324 | |||
| 1538 | Ga0070701_10009191 | |||
| 1539 | Ga0070705_100006396 | |||
| 1540 | Ga0070700_100057629 | |||
| 1541 | Ga0070662_100000095 | |||
| 1542 | Ga0070662_100010823 | |||
| 1543 | Ga0070685_10127159 | |||
| 1544 | Ga0070698_100061858 | |||
| 1545 | Ga0068853_100000089 | |||
| 1546 | Ga0070672_100092797 | |||
| 1547 | Ga0070672_100109191 | |||
| 1548 | Ga0070672_100311912 | |||
| 1549 | Ga0070686_100014835 | |||
| 1550 | Ga0070696_100166990 | |||
| 1551 | Ga0070693_100098972 | |||
| 1552 | Ga0070665_100002013 | |||
| 1553 | Ga0070665_100006705 | |||
| 1554 | Ga0070704_100058517 | |||
| 1555 | Ga0068855_100667255 | |||
| 1556 | Ga0070664_100000391 | |||
| 1557 | Ga0070664_100052654 | |||
| 1558 | Ga0068854_100001775 | |||
| 1559 | Ga0070702_100001974 | |||
| 1560 | Ga0068859_100013045 | |||
| 1561 | Ga0068859_100080101 | |||
| 1562 | Ga0068859_100131788 | |||
| 1563 | Ga0068861_100002242 | |||
| 1564 | Ga0068861_100069542 | |||
| 1565 | Ga0068861_100071415 | |||
| 1566 | Ga0068861_100278312 | |||
| 1567 | Ga0068861_100558330 | |||
| 1568 | Ga0068851_10000024 | |||
| 1569 | Ga0068870_10245072 | |||
| 1570 | Ga0068863_100277144 | |||
| 1571 | Ga0068863_100321199 | |||
| 1572 | Ga0068858_100012305 | |||
| 1573 | Ga0068860_100026372 | |||
| 1574 | Ga0068862_100009441 | |||
| 1575 | Ga0068862_100045897 | |||
| 1576 | Ga0068862_100094782 | |||
| 1577 | Ga0081455_10000032 | |||
| 1578 | Ga0081539_10000007 | |||
| 1579 | Ga0075364_10100175 | |||
| 1580 | Ga0075364_10116716 | |||
| 1581 | Ga0075364_10272890 | |||
| 1582 | Ga0075432_10000629 | |||
| 1583 | Ga0075432_10013530 | |||
| 1584 | Ga0075432_10029736 | |||
| 1585 | Ga0075432_10040005 | |||
| 1586 | Ga0075432_10048055 | |||
| 1587 | Ga0075432_10065001 | |||
| 1588 | Ga0097621_100109048 | |||
| 1589 | Ga0097621_100186931 | |||
| 1590 | Ga0068871_100053807 | |||
| 1591 | Ga0068871_100229118 | |||
| 1592 | Ga0068871_100284365 | |||
| 1593 | Ga0068871_100656965 | |||
| 1594 | Ga0075428_100429130 | |||
| 1595 | Ga0075436_100116729 | |||
| 1596 | Ga0075436_100152520 | |||
| 1597 | Ga0097620_100013045 | |||
| 1598 | Ga0097620_100080104 | |||
| 1599 | Ga0097620_100131790 | |||
| 1600 | Ga0079104_1000229 | |||
| 1601 | Ga0079104_1000296 | |||
| 1602 | Ga0079104_1014254 | |||
| 1603 | Ga0105251_10000113 | |||
| 1604 | Ga0105251_10000303 | |||
| 1605 | Ga0105251_10000361 | |||
| 1606 | Ga0105251_10001591 | |||
| 1607 | Ga0105251_10005307 | |||
| 1608 | Ga0105251_10007332 | |||
| 1609 | Ga0105251_10011289 | |||
| 1610 | Ga0105251_10014426 | |||
| 1611 | Ga0105251_10017751 | |||
| 1612 | Ga0105251_10081785 | |||
| 1613 | Ga0105244_10000982 | |||
| 1614 | Ga0105244_10001234 | |||
| 1615 | Ga0105244_10005115 | |||
| 1616 | Ga0105244_10006072 | |||
| 1617 | Ga0105244_10007513 | |||
| 1618 | Ga0105244_10008576 | |||
| 1619 | Ga0105244_10046052 | |||
| 1620 | Ga0105244_10112754 | |||
| 1621 | Ga0105244_10148006 | |||
| 1622 | Ga0105250_10000189 | |||
| 1623 | Ga0105250_10000211 | |||
| 1624 | Ga0105250_10002092 | |||
| 1625 | Ga0105250_10009368 | |||
| 1626 | Ga0105250_10029541 | |||
| 1627 | Ga0105250_10034565 | |||
| 1628 | Ga0105250_10049723 | |||
| 1629 | Ga0111539_10084056 | |||
| 1630 | Ga0105243_10000370 | |||
| 1631 | Ga0105243_10000595 | |||
| 1632 | Ga0105243_10008730 | |||
| 1633 | Ga0105243_10009526 | |||
| 1634 | Ga0105243_10047309 | |||
| 1635 | Ga0105243_10093187 | |||
| 1636 | Ga0105243_10116421 | |||
| 1637 | Ga0105242_10000136 | |||
| 1638 | Ga0105242_10093581 | |||
| 1639 | Ga0105248_10004445 | |||
| 1640 | Ga0105248_10626155 | |||
| 1641 | Ga0105237_10000939 | |||
| 1642 | Ga0105249_10539819 | |||
| 1643 | Ga0105249_10715742 | |||
| 1644 | Ga0105246_10000042 | |||
| 1645 | Ga0105246_10002498 | |||
| 1646 | Ga0105246_10068492 | |||
| 1647 | Ga0157336_1001109 | |||
| 1648 | Ga0157345_1000068 | |||
| 1649 | Ga0157373_10000993 | |||
| 1650 | Ga0157373_10005678 | |||
| 1651 | Ga0157373_10016864 | |||
| 1652 | Ga0157373_10024956 | |||
| 1653 | Ga0157373_10052818 | |||
| 1654 | Ga0157373_10074581 | |||
| 1655 | Ga0157373_10113151 | |||
| 1656 | Ga0157373_10195597 | |||
| 1657 | Ga0157371_10000811 | |||
| 1658 | Ga0157371_10001369 | |||
| 1659 | Ga0157371_10011701 | |||
| 1660 | Ga0157371_10034037 | |||
| 1661 | Ga0157370_10000150 | |||
| 1662 | Ga0157370_10011272 | |||
| 1663 | Ga0157370_10016274 | |||
| 1664 | Ga0157370_10050485 | |||
| 1665 | Ga0157370_10068628 | |||
| 1666 | Ga0157370_10078398 | |||
| 1667 | Ga0157370_10129827 | |||
| 1668 | Ga0157370_10308096 | |||
| 1669 | Ga0157370_10379630 | |||
| 1670 | Ga0157369_10001261 | |||
| 1671 | Ga0157369_10001555 | |||
| 1672 | Ga0157369_10015276 | |||
| 1673 | Ga0157369_10038743 | |||
| 1674 | Ga0157369_10411589 | |||
| 1675 | Ga0163162_10071200 | |||
| 1676 | Ga0157372_10001525 | |||
| 1677 | Ga0157372_10008414 | |||
| 1678 | Ga0157372_10712478 | |||
| 1679 | Ga0157375_10001875 | |||
| 1680 | Ga0157375_10008094 | |||
| 1681 | Ga0157375_10087456 | |||
| 1682 | Ga0157375_10255579 | |||
| 1683 | Ga0157380_10008871 | |||
| 1684 | Ga0182008_10001166 | |||
| 1685 | Ga0182008_10002891 | |||
| 1686 | Ga0182008_10003251 | |||
| 1687 | Ga0182008_10004481 | |||
| 1688 | Ga0182008_10013634 | |||
| 1689 | Ga0182008_10014614 | |||
| 1690 | Ga0182008_10019620 | |||
| 1691 | Ga0182008_10027535 | |||
| 1692 | Ga0182008_10034067 | |||
| 1693 | Ga0157376_10560650 | |||
| 1694 | Ga0157376_10953193 | |||
| 1695 | Ga0182006_1000380 | |||
| 1696 | Ga0182006_1000786 | |||
| 1697 | Ga0182006_1005806 | |||
| 1698 | Ga0182006_1034120 | |||
| 1699 | Ga0182006_1056815 | |||
| 1700 | Ga0182007_10000194 | |||
| 1701 | Ga0182007_10012110 | |||
| 1702 | Ga0182005_1000459 | |||
| 1703 | Ga0182005_1001444 | |||
| 1704 | Ga0182005_1018415 | |||
| 1705 | Ga0182005_1019329 | |||
| 1706 | Ga0182005_1028515 | |||
| 1707 | Ga0163161_10000719 | |||
| 1708 | Ga0163161_10001156 | |||
| 1709 | Ga0163161_10007778 | |||
| 1710 | Ga0163161_10021521 | |||
| 1711 | Ga0163161_10043618 | |||
| 1712 | Ga0163161_10073199 | |||
| 1713 | Ga0163161_10077387 | |||
| 1714 | Ga0163161_10111594 | |||
| 1715 | Ga0163161_10235862 | |||
| 1716 | Ga0163161_10244225 | |||
| 1717 | Ga0209435_101197 | |||
| 1718 | Ga0209760_100037 | |||
| 1719 | Ga0209760_100128 | |||
| 1720 | Ga0209784_100028 | |||
| 1721 | Ga0209566_100028 | |||
| 1722 | Ga0209674_100047 | |||
| 1723 | Ga0209147_100031 | |||
| 1724 | Ga0209563_100014 | |||
| 1725 | Ga0209563_100050 | |||
| 1726 | Ga0209563_103308 | |||
| 1727 | Ga0207427_100014 | |||
| 1728 | Ga0207427_100016 | |||
| 1729 | Ga0209437_100011 | |||
| 1730 | Ga0209437_100016 | |||
| 1731 | Ga0209258_100150 | |||
| 1732 | Ga0209646_1000183 | |||
| 1733 | Ga0209677_100029 | |||
| 1734 | Ga0209759_1004821 | |||
| 1735 | Ga0209233_1000019 | |||
| 1736 | Ga0209233_1000036 | |||
| 1737 | Ga0209565_1007315 | |||
| 1738 | Ga0209675_1002235 | |||
| 1739 | Ga0209676_1000025 | |||
| 1740 | Ga0209676_1000032 | |||
| 1741 | Ga0209676_1000318 | |||
| 1742 | Ga0209676_1005098 | |||
| 1743 | Ga0209676_1008035 | |||
| 1744 | Ga0209025_1006155 | |||
| 1745 | Ga0209564_1000404 | |||
| 1746 | Ga0209050_1000025 | |||
| 1747 | Ga0209050_1000028 | |||
| 1748 | Ga0209050_1000520 | |||
| 1749 | Ga0209051_1000026 | |||
| 1750 | Ga0209051_1000080 | |||
| 1751 | Ga0209051_1000334 | |||
| 1752 | Ga0209051_1005483 | |||
| 1753 | Ga0209257_1000034 | |||
| 1754 | Ga0207656_10000007 | |||
| 1755 | Ga0207696_1000020 | |||
| 1756 | Ga0207696_1000057 | |||
| 1757 | Ga0207696_1000084 | |||
| 1758 | Ga0207696_1001201 | |||
| 1759 | Ga0207696_1002125 | |||
| 1760 | Ga0207696_1003512 | |||
| 1761 | Ga0207696_1009400 | |||
| 1762 | Ga0207696_1017377 | |||
| 1763 | Ga0207696_1051295 | |||
| 1764 | Ga0207655_1000014 | |||
| 1765 | Ga0207655_1000326 | |||
| 1766 | Ga0207655_1000405 | |||
| 1767 | Ga0207655_1000935 | |||
| 1768 | Ga0207655_1001697 | |||
| 1769 | Ga0207655_1002391 | |||
| 1770 | Ga0207655_1002603 | |||
| 1771 | Ga0207655_1011916 | |||
| 1772 | Ga0207655_1012601 | |||
| 1773 | Ga0207655_1014811 | |||
| 1774 | Ga0207655_1014841 | |||
| 1775 | Ga0207655_1015764 | |||
| 1776 | Ga0207655_1028886 | |||
| 1777 | Ga0207655_1057498 | |||
| 1778 | Ga0207713_1000031 | |||
| 1779 | Ga0207713_1000114 | |||
| 1780 | Ga0207713_1000331 | |||
| 1781 | Ga0207713_1000434 | |||
| 1782 | Ga0207713_1000632 | |||
| 1783 | Ga0207713_1002064 | |||
| 1784 | Ga0207713_1002309 | |||
| 1785 | Ga0207713_1006008 | |||
| 1786 | Ga0207713_1006316 | |||
| 1787 | Ga0207713_1007038 | |||
| 1788 | Ga0207713_1012006 | |||
| 1789 | Ga0207713_1030078 | |||
| 1790 | Ga0207713_1033592 | |||
| 1791 | Ga0207713_1074606 | |||
| 1792 | Ga0207713_1103890 | |||
| 1793 | Ga0207671_10000015 | |||
| 1794 | Ga0207662_10104786 | |||
| 1795 | Ga0207649_10000001 | |||
| 1796 | Ga0207681_10000236 | |||
| 1797 | Ga0207681_10001050 | |||
| 1798 | Ga0207681_10525981 | |||
| 1799 | Ga0207681_10677290 | |||
| 1800 | Ga0207650_10000273 | |||
| 1801 | Ga0207650_10000449 | |||
| 1802 | Ga0207659_10104894 | |||
| 1803 | Ga0207706_10000069 | |||
| 1804 | Ga0207706_10013926 | |||
| 1805 | Ga0207706_10410594 | |||
| 1806 | Ga0207709_10000022 | |||
| 1807 | Ga0207709_10000164 | |||
| 1808 | Ga0207709_10010709 | |||
| 1809 | Ga0207709_10077411 | |||
| 1810 | Ga0207709_10078174 | |||
| 1811 | Ga0207670_10010276 | |||
| 1812 | Ga0207669_10147465 | |||
| 1813 | Ga0207691_10026578 | |||
| 1814 | Ga0207691_10128220 | |||
| 1815 | Ga0207691_10623484 | |||
| 1816 | Ga0207711_10014431 | |||
| 1817 | Ga0207679_10000011 | |||
| 1818 | Ga0207703_10011669 | |||
| 1819 | Ga0207639_10023432 | |||
| 1820 | Ga0207708_10034391 | |||
| 1821 | Ga0207708_10057759 | |||
| 1822 | Ga0207708_10102846 | |||
| 1823 | Ga0207641_10119088 | |||
| 1824 | Ga0207641_10406824 | |||
| 1825 | Ga0207674_10413057 | |||
| 1826 | Ga0207675_100004771 | |||
| 1827 | Ga0207675_100007621 | |||
| 1828 | Ga0207675_100023697 | |||
| 1829 | Ga0207675_100029914 | |||
| 1830 | Ga0207675_100244202 | |||
| 1831 | Ga0209281_1000026 | |||
| 1832 | Ga0209281_1000033 | |||
| 1833 | Ga0209281_1009328 | |||
| 1834 | Ga0209371_1000032 | |||
| 1835 | Ga0209981_1011805 | |||
| 1836 | Ga0209996_1002457 | |||
| 1837 | Ga0209983_1003440 | |||
| 1838 | Ga0209974_10007010 | |||
| 1839 | Ga0207428_10007376 | |||
| 1840 | Ga0207428_10041406 | |||
| 1841 | Ga0207428_10065960 | |||
| 1842 | Ga0207428_10069517 | |||
| 1843 | Ga0207428_10084031 | |||
| 1844 | Ga0207428_10108265 | |||
| 1845 | Ga0207428_10352605 | |||
| 1846 | Ga0207428_10389380 | |||
| 1847 | Ga0268266_10008655 | |||
| 1848 | Ga0268266_10016958 | |||
| 1849 | Ga0268266_10075777 | |||
| 1850 | Ga0268265_10009890 | |||
| 1851 | Ga0268265_10206842 | |||
| 1852 | Ga0268265_10245341 | |||
| 1853 | Ga0268264_10141180 | |||
| 1854 | Ga0307517_10133349 | |||
| 1855 | Ga0307515_10016964 | |||
| 1856 | Ga0268256_1000050 | |||
| 1857 | Ga0307511_10014728 | |||
| 1858 | Ga0316178_1048724 | |||
| 1859 | Ga0316183_1029617 | |||
| 1860 | Ga0316183_1184413 | |||
| 1861 | Ga0316181_1024278 | |||
| 1862 | Ga0265327_10001649 | |||
| 1863 | Ga0265316_10148182 | |||
| 1864 | Ga0307513_10053426 | |||
| 1865 | Ga0307509_10222467 | |||
| 1866 | Ga0307509_10272830 | |||
| 1867 | Ga0307408_100014933 | |||
| 1868 | Ga0307408_100021630 | |||
| 1869 | Ga0307408_100034758 | |||
| 1870 | Ga0307408_100034944 | |||
| 1871 | Ga0307408_100073881 | |||
| 1872 | Ga0307408_100075564 | |||
| 1873 | Ga0307516_10105266 | |||
| 1874 | Ga0307516_10179454 | |||
| 1875 | Ga0307516_10291965 | |||
| 1876 | Ga0307405_10007090 | |||
| 1877 | Ga0307405_10010676 | |||
| 1878 | Ga0307405_10011939 | |||
| 1879 | Ga0307405_10029697 | |||
| 1880 | Ga0307405_10349092 | |||
| 1881 | Ga0307413_10009019 | |||
| 1882 | Ga0307413_10019490 | |||
| 1883 | Ga0307410_10013906 | |||
| 1884 | Ga0307406_10008889 | |||
| 1885 | Ga0307406_10009078 | |||
| 1886 | Ga0307406_10193333 | |||
| 1887 | Ga0307407_10002874 | |||
| 1888 | Ga0307407_10029144 | |||
| 1889 | Ga0307407_10165174 | |||
| 1890 | Ga0307412_10010789 | |||
| 1891 | Ga0307412_10017244 | |||
| 1892 | Ga0307412_10023342 | |||
| 1893 | Ga0307412_10024787 | |||
| 1894 | Ga0307412_10025054 | |||
| 1895 | Ga0307412_10052050 | |||
| 1896 | Ga0307412_10111954 | |||
| 1897 | Ga0307412_10134546 | |||
| 1898 | Ga0307412_10606942 | |||
| 1899 | Ga0307409_100019513 | |||
| 1900 | Ga0307409_100032810 | |||
| 1901 | Ga0307409_100054467 | |||
| 1902 | Ga0307409_100056815 | |||
| 1903 | Ga0307409_100244804 | |||
| 1904 | Ga0307416_100076005 | |||
| 1905 | Ga0307416_100085446 | |||
| 1906 | Ga0307416_100316403 | |||
| 1907 | Ga0307416_100450157 | |||
| 1908 | Ga0307414_10133960 | |||
| 1909 | Ga0307414_10140282 | |||
| 1910 | Ga0307411_10010859 | |||
| 1911 | Ga0307411_10074591 | |||
| 1912 | Ga0307411_10137126 | |||
| 1913 | Ga0307411_10667955 | |||
| 1914 | Ga0307510_10001604 | |||
| 1915 | Ga0373923_0183272 | |||
| 1916 | Ga0237819_04383 | |||
| 1917 | Ga0436363_0203368 | |||
| 1918 | Ga0439438_001683 | |||
| 1919 | Ga0439438_005049 | |||
| 1920 | Ga0439438_005227 | |||
| 1921 | Ga0439438_005882 | |||
| 1922 | Ga0439438_005955 | |||
| 1923 | Ga0439438_014519 | |||
| 1924 | Ga0439438_015502 | |||
| 1925 | Ga0439447_000222 | |||
| 1926 | Ga0439447_001542 | |||
| 1927 | Ga0439447_003263 | |||
| 1928 | Ga0439447_003378 | |||
| 1929 | Ga0439447_003431 | |||
| 1930 | Ga0439447_011142 | |||
| 1931 | Ga0439447_018200 | |||
| 1932 | Ga0439466_0000445 | |||
| 1933 | Ga0439466_0000766 | |||
| 1934 | Ga0439466_0008181 | |||
| 1935 | Ga0439466_0009972 | |||
| 1936 | Ga0439466_0011547 | |||
| 1937 | Ga0439466_0013302 | |||
| 1938 | Ga0439466_0018228 | |||
| 1939 | Ga0439466_0021229 | |||
| 1940 | Ga0439465_0013323 | |||
| 1941 | Ga0439465_0100107 | |||
| 1942 | Ga0451853_3896997 | |||
| 1943 | Ga0439431_0020609 | |||
| 1944 | Ga0439445_0054975 | |||
| 1945 | Ga0439432_000366 | |||
| 1946 | Ga0439432_001336 | |||
| 1947 | Ga0439432_010223 | |||
| 1948 | Ga0439432_012452 | |||
| 1949 | Ga0439451_006406 | |||
| 1950 | Ga0439451_011242 | |||
| 1951 | Ga0439451_015805 | |||
| 1952 | Ga0439451_018930 | |||
| 1953 | Ga0439451_022004 | |||
| 1954 | Ga0439451_030594 | |||
| 1955 | Ga0439451_032477 | |||
| 1956 | Ga0439452_000231 | |||
| 1957 | Ga0439452_000245 | |||
| 1958 | Ga0439452_000971 | |||
| 1959 | Ga0439452_002718 | |||
| 1960 | Ga0439452_004643 | |||
| 1961 | Ga0439452_004857 | |||
| 1962 | Ga0439452_006314 | |||
| 1963 | Ga0439452_010184 | |||
| 1964 | Ga0439452_015932 | |||
| 1965 | Ga0439452_052643 | |||
| 1966 | Ga0439456_000187 | |||
| 1967 | Ga0439456_000508 | |||
| 1968 | Ga0439456_003564 | |||
| 1969 | Ga0439456_008809 | |||
| 1970 | Ga0439456_011230 | |||
| 1971 | Ga0439456_023882 | |||
| 1972 | Ga0439456_055448 | |||
| 1973 | Ga0439463_001159 | |||
| 1974 | Ga0439463_002336 | |||
| 1975 | Ga0439463_006378 | |||
| 1976 | Ga0439463_047433 | |||
| 1977 | Ga0439463_084866 | |||
| 1978 | Ga0450911_000018 | |||
| 1979 | Ga0450911_000158 | |||
| 1980 | Ga0450911_002529 | |||
| 1981 | Ga0450911_007040 | |||
| 1982 | Ga0450911_012285 | |||
| 1983 | Ga0450919_002444 | |||
| 1984 | Ga0450919_004450 | |||
| 1985 | Ga0450922_000113 | |||
| 1986 | Ga0450922_001038 | |||
| 1987 | Ga0450922_001749 | |||
| 1988 | Ga0450890_000475 | |||
| 1989 | Ga0450891_006614 | |||
| 1990 | Ga0450892_003838 | |||
| 1991 | Ga0450900_000295 | |||
| 1992 | Ga0450902_000139 | |||
| 1993 | Ga0450902_008053 | |||
| 1994 | Ga0450903_002643 | |||
| 1995 | Ga0450903_002724 | |||
| 1996 | Ga0450903_004552 | |||
| 1997 | Ga0450904_000008 | |||
| 1998 | Ga0450904_001608 | |||
| 1999 | Ga0450905_000046 | |||
| 2000 | Ga0450905_002730 | |||
| 2001 | Ga0450889_002305 | |||
| 2002 | Ga0450906_001941 | |||
| 2003 | Ga0450906_011941 | |||
| 2004 | Ga0450907_000206 | |||
| 2005 | Ga0450907_000510 | |||
| 2006 | Ga0450907_001218 | |||
| 2007 | Ga0450910_000234 | |||
| 2008 | Ga0450910_000702 | |||
| 2009 | Ga0439446_0000057 | |||
| 2010 | Ga0439446_0000824 | |||
| 2011 | Ga0439446_0000915 | |||
| 2012 | Ga0439446_0033009 | |||
| 2013 | Ga0450908_011824 | |||
| 2014 | Ga0450909_000100 | |||
| 2015 | Ga0450909_000593 | |||
| 2016 | Ga0439434_0000122 | |||
| 2017 | Ga0439464_0017338 | |||
| 2018 | Ga0439464_0026938 | |||
| 2019 | Ga0439464_0027223 | |||
| 2020 | Ga0439460_0003104 | |||
| 2021 | Ga0450916_009068 | |||
| 2022 | Ga0450918_001531 | |||
| 2023 | Ga0450893_0028869 | |||
| 2024 | Ga0450901_001194 | |||
| 2025 | Ga0451577_0000162 | |||
| 2026 | Ga0439440_0002123 | |||
| 2027 | Ga0439440_0008434 | |||
| 2028 | Ga0439440_0014881 | |||
| 2029 | Ga0439440_0054445 | |||
| 2030 | Ga0466972_0021404 | |||
| 2031 | Ga0453684_0000524 | |||
| 2032 | Ga0453684_0050801 | |||
| 2033 | Ga0451576_0147329 | |||
| 2034 | Ga0495617_000311 | |||
| 2035 | Ga0495617_000760 | |||
| 2036 | Ga0495617_007185 | |||
| 2037 | Ga0495617_009067 | |||
| 2038 | Ga0495617_016180 | |||
| 2039 | Ga0495617_028194 | |||
| 2040 | Ga0495617_034124 | |||
| 2041 | Ga0495617_129684 | |||
| 2042 | Ga0495627_000023 | |||
| 2043 | Ga0495627_000535 | |||
| 2044 | Ga0495627_000700 | |||
| 2045 | Ga0495627_001188 | |||
| 2046 | Ga0495627_005424 | |||
| 2047 | Ga0495627_014062 | |||
| 2048 | Ga0495627_016249 | |||
| 2049 | Ga0495627_069507 | |||
| 2050 | Ga0495627_082340 | |||
| 2051 | Ga0495603_0002971 | |||
| 2052 | Ga0495603_0029255 | |||
| 2053 | Ga0495603_0365115 | |||
| 2054 | Ga0495590_0001147 | |||
| 2055 | Ga0495590_0004906 | |||
| 2056 | Ga0495590_0011769 | |||
| 2057 | Ga0495590_0041213 | |||
| 2058 | Ga0495590_0041675 | |||
| 2059 | Ga0495590_0052602 | |||
| 2060 | Ga0495591_000025 | |||
| 2061 | Ga0495591_000244 | |||
| 2062 | Ga0495591_001000 | |||
| 2063 | Ga0495591_001158 | |||
| 2064 | Ga0495591_003990 | |||
| 2065 | Ga0495591_007521 | |||
| 2066 | Ga0495591_008190 | |||
| 2067 | Ga0495591_008676 | |||
| 2068 | Ga0495591_009244 | |||
| 2069 | Ga0495591_010450 | |||
| 2070 | Ga0495591_010873 | |||
| 2071 | Ga0495591_012410 | |||
| 2072 | Ga0495591_013066 | |||
| 2073 | Ga0495591_013211 | |||
| 2074 | Ga0495591_014014 | |||
| 2075 | Ga0495591_014644 | |||
| 2076 | Ga0495591_016439 | |||
| 2077 | Ga0495629_0012392 | |||
| 2078 | Ga0495638_0003177 | |||
| 2079 | Ga0495638_0013861 | |||
| 2080 | Ga0495638_0018877 | |||
| 2081 | Ga0495638_0027553 | |||
| 2082 | Ga0495638_0035891 | |||
| 2083 | Ga0495638_0040073 | |||
| 2084 | Ga0495638_0040296 | |||
| 2085 | Ga0495638_0040541 | |||
| 2086 | Ga0495638_0054021 | |||
| 2087 | Ga0495638_0074309 | |||
| 2088 | Ga0495638_0126508 | |||
| 2089 | Ga0495638_0206822 | |||
| 2090 | Ga0495638_0262452 | |||
| 2091 | Ga0495653_0000549 | |||
| 2092 | Ga0495653_0004108 | |||
| 2093 | Ga0495653_0004448 | |||
| 2094 | Ga0495653_0015276 | |||
| 2095 | Ga0495653_0117752 | |||
| 2096 | Ga0495650_0002476 | |||
| 2097 | Ga0495650_0003286 | |||
| 2098 | Ga0495650_0009444 | |||
| 2099 | Ga0495650_0010158 | |||
| 2100 | Ga0495650_0013860 | |||
| 2101 | Ga0495650_0018671 | |||
| 2102 | Ga0495650_0019017 | |||
| 2103 | Ga0495650_0020043 | |||
| 2104 | Ga0495650_0023131 | |||
| 2105 | Ga0495582_0010897 | |||
| 2106 | Ga0495605_0000095 | |||
| 2107 | Ga0495605_0000311 | |||
| 2108 | Ga0495605_0000328 | |||
| 2109 | Ga0495605_0000673 | |||
| 2110 | Ga0495605_0000878 | |||
| 2111 | Ga0495605_0007893 | |||
| 2112 | Ga0495605_0021899 | |||
| 2113 | Ga0495605_0022174 | |||
| 2114 | Ga0495605_0025515 | |||
| 2115 | Ga0495605_0025781 | |||
| 2116 | Ga0495605_0027744 | |||
| 2117 | Ga0495605_0034292 | |||
| 2118 | Ga0495605_0040001 | |||
| 2119 | Ga0495605_0081534 | |||
| 2120 | Ga0495639_0000238 | |||
| 2121 | Ga0495584_0000695 | |||
| 2122 | Ga0495584_0006560 | |||
| 2123 | Ga0495584_0012343 | |||
| 2124 | Ga0495584_0017637 | |||
| 2125 | Ga0495584_0019778 | |||
| 2126 | Ga0495584_0021080 | |||
| 2127 | Ga0495584_0026726 | |||
| 2128 | Ga0495584_0026880 | |||
| 2129 | Ga0495584_0079689 | |||
| 2130 | Ga0495584_0162024 | |||
| 2131 | Ga0495585_0000279 | |||
| 2132 | Ga0495585_0000790 | |||
| 2133 | Ga0495585_0015485 | |||
| 2134 | Ga0495585_0017325 | |||
| 2135 | Ga0495585_0020619 | |||
| 2136 | Ga0495585_0024730 | |||
| 2137 | Ga0495585_0028586 | |||
| 2138 | Ga0495585_0039605 | |||
| 2139 | Ga0495585_0041367 | |||
| 2140 | Ga0495585_0156740 | |||
| 2141 | Ga0495594_0001648 | |||
| 2142 | Ga0495594_0165561 | |||
| 2143 | Ga0495596_0000273 | |||
| 2144 | Ga0495596_0001654 | |||
| 2145 | Ga0495596_0106960 | |||
| 2146 | Ga0495607_0000298 | |||
| 2147 | Ga0495607_0000347 | |||
| 2148 | Ga0495607_0000776 | |||
| 2149 | Ga0495607_0000926 | |||
| 2150 | Ga0495607_0003337 | |||
| 2151 | Ga0495607_0009192 | |||
| 2152 | Ga0495607_0014199 | |||
| 2153 | Ga0495607_0015965 | |||
| 2154 | Ga0495607_0023469 | |||
| 2155 | Ga0495607_0026083 | |||
| 2156 | Ga0495607_0027199 | |||
| 2157 | Ga0495607_0030508 | |||
| 2158 | Ga0495607_0031519 | |||
| 2159 | Ga0495607_0035276 | |||
| 2160 | Ga0495607_0038582 | |||
| 2161 | Ga0495607_0095932 | |||
| 2162 | Ga0495607_0151695 | |||
| 2163 | Ga0495607_0173334 | |||
| 2164 | Ga0495607_0214045 | |||
| 2165 | Ga0495583_0000015 | |||
| 2166 | Ga0495583_0000756 | |||
| 2167 | Ga0495583_0001231 | |||
| 2168 | Ga0495583_0001865 | |||
| 2169 | Ga0495583_0002457 | |||
| 2170 | Ga0495583_0007128 | |||
| 2171 | Ga0495583_0034596 | |||
| 2172 | Ga0495583_0035663 | |||
| 2173 | Ga0495606_0000177 | |||
| 2174 | Ga0495606_0000214 | |||
| 2175 | Ga0495606_0001468 | |||
| 2176 | Ga0495606_0003165 | |||
| 2177 | Ga0495606_0004043 | |||
| 2178 | Ga0495606_0023244 | |||
| 2179 | Ga0495606_0028733 | |||
| 2180 | Ga0495606_0047242 | |||
| 2181 | Ga0495606_0061283 | |||
| 2182 | Ga0495606_0073664 | |||
| 2183 | Ga0495606_0165576 | |||
| 2184 | Ga0495610_0001476 | |||
| 2185 | Ga0495610_0001656 | |||
| 2186 | Ga0495610_0002687 | |||
| 2187 | Ga0495610_0002713 | |||
| 2188 | Ga0495610_0014482 | |||
| 2189 | Ga0495610_0019649 | |||
| 2190 | Ga0495610_0020743 | |||
| 2191 | Ga0495610_0021118 | |||
| 2192 | Ga0495610_0021713 | |||
| 2193 | Ga0495610_0025419 | |||
| 2194 | Ga0495610_0039121 | |||
| 2195 | Ga0495610_0046191 | |||
| 2196 | Ga0495610_0055928 | |||
| 2197 | Ga0495616_0002792 | |||
| 2198 | Ga0495616_0003688 | |||
| 2199 | Ga0495616_0016363 | |||
| 2200 | Ga0495616_0017474 | |||
| 2201 | Ga0495616_0022881 | |||
| 2202 | Ga0495616_0024171 | |||
| 2203 | Ga0495616_0029868 | |||
| 2204 | Ga0495616_0035822 | |||
| 2205 | Ga0495616_0038964 | |||
| 2206 | Ga0495616_0077485 | |||
| 2207 | Ga0495620_0000042 | |||
| 2208 | Ga0495620_0000456 | |||
| 2209 | Ga0495620_0009865 | |||
| 2210 | Ga0495620_0015816 | |||
| 2211 | Ga0495620_0017423 | |||
| 2212 | Ga0495620_0019562 | |||
| 2213 | Ga0495620_0024333 | |||
| 2214 | Ga0495620_0028670 | |||
| 2215 | Ga0495620_0038055 | |||
| 2216 | Ga0495628_0052974 | |||
| 2217 | Ga0495630_0031773 | |||
| 2218 | Ga0495630_0042381 | |||
| 2219 | Ga0495630_0045547 | |||
| 2220 | Ga0495630_0148290 | |||
| 2221 | Ga0495631_0000722 | |||
| 2222 | Ga0495631_0001940 | |||
| 2223 | Ga0495631_0004156 | |||
| 2224 | Ga0495631_0007549 | |||
| 2225 | Ga0495631_0010776 | |||
| 2226 | Ga0495631_0018255 | |||
| 2227 | Ga0495631_0024723 | |||
| 2228 | Ga0495631_0030012 | |||
| 2229 | Ga0495631_0056166 | |||
| 2230 | Ga0495631_0213472 | |||
| 2231 | Ga0495632_0000573 | |||
| 2232 | Ga0495632_0001250 | |||
| 2233 | Ga0495632_0001298 | |||
| 2234 | Ga0495632_0001313 | |||
| 2235 | Ga0495632_0018098 | |||
| 2236 | Ga0495632_0021657 | |||
| 2237 | Ga0495632_0021918 | |||
| 2238 | Ga0495632_0023580 | |||
| 2239 | Ga0495632_0026352 | |||
| 2240 | Ga0495632_0029999 | |||
| 2241 | Ga0495632_0032225 | |||
| 2242 | Ga0495632_0035243 | |||
| 2243 | Ga0495632_0039242 | |||
| 2244 | Ga0495632_0041983 | |||
| 2245 | Ga0495632_0061777 | |||
| 2246 | Ga0495632_0126065 | |||
| 2247 | Ga0495632_0164963 | |||
| 2248 | Ga0495637_0000020 | |||
| 2249 | Ga0495637_0000260 | |||
| 2250 | Ga0495637_0002002 | |||
| 2251 | Ga0495637_0002683 | |||
| 2252 | Ga0495637_0003016 | |||
| 2253 | Ga0495637_0003062 | |||
| 2254 | Ga0495637_0003107 | |||
| 2255 | Ga0495637_0007488 | |||
| 2256 | Ga0495637_0009364 | |||
| 2257 | Ga0495637_0009737 | |||
| 2258 | Ga0495637_0015922 | |||
| 2259 | Ga0495637_0021249 | |||
| 2260 | Ga0495637_0025903 | |||
| 2261 | Ga0495637_0036258 | |||
| 2262 | Ga0495637_0044510 | |||
| 2263 | Ga0495637_0146523 | |||
| 2264 | Ga0495643_0001642 | |||
| 2265 | Ga0495643_0005156 | |||
| 2266 | Ga0495643_0015742 | |||
| 2267 | Ga0495643_0029307 | |||
| 2268 | Ga0495643_0030123 | |||
| 2269 | Ga0495643_0051295 | |||
| 2270 | Ga0495643_0113684 | |||
| 2271 | Ga0495643_0186427 | |||
| 2272 | Ga0495644_0005182 | |||
| 2273 | Ga0495644_0014572 | |||
| 2274 | Ga0495644_0018081 | |||
| 2275 | Ga0495644_0023262 | |||
| 2276 | Ga0495644_0034029 | |||
| 2277 | Ga0495644_0054046 | |||
| 2278 | Ga0495644_0063295 | |||
| 2279 | Ga0495648_0002580 | |||
| 2280 | Ga0495648_0003045 | |||
| 2281 | Ga0495648_0006167 | |||
| 2282 | Ga0495648_0010821 | |||
| 2283 | Ga0495648_0023095 | |||
| 2284 | Ga0495648_0030337 | |||
| 2285 | Ga0495648_0030901 | |||
| 2286 | Ga0495648_0035313 | |||
| 2287 | Ga0495648_0035908 | |||
| 2288 | Ga0495648_0036080 | |||
| 2289 | Ga0495648_0073855 | |||
| 2290 | Ga0495648_0082529 | |||
| 2291 | Ga0495648_0109453 | |||
| 2292 | Ga0495648_0217211 | |||
| 2293 | Ga0495666_0016903 | |||
| 2294 | Ga0495666_0022639 | |||
| 2295 | Ga0495666_0042367 | |||
| 2296 | Ga0495642_0000088 | |||
| 2297 | Ga0495642_0000463 | |||
| 2298 | Ga0495642_0009974 | |||
| 2299 | Ga0495654_0000891 | |||
| 2300 | Ga0495654_0000985 | |||
| 2301 | Ga0495654_0000992 | |||
| 2302 | Ga0495654_0001624 | |||
| 2303 | Ga0495654_0001635 | |||
| 2304 | Ga0495654_0002244 | |||
| 2305 | Ga0495654_0003414 | |||
| 2306 | Ga0495654_0003637 | |||
| 2307 | Ga0495654_0008879 | |||
| 2308 | Ga0495654_0012750 | |||
| 2309 | Ga0495654_0014227 | |||
| 2310 | Ga0495654_0021323 | |||
| 2311 | Ga0495654_0026130 | |||
| 2312 | Ga0495654_0037251 | |||
| 2313 | Ga0495654_0039902 | |||
| 2314 | Ga0495654_0053155 | |||
| 2315 | Ga0495654_0111809 | |||
| 2316 | Ga0495586_0012298 | |||
| 2317 | Ga0495587_0005901 | |||
| 2318 | Ga0495587_0009517 | |||
| 2319 | Ga0495587_0084874 | |||
| 2320 | Ga0495609_0000102 | |||
| 2321 | Ga0495609_0000685 | |||
| 2322 | Ga0495609_0002004 | |||
| 2323 | Ga0495609_0003388 | |||
| 2324 | Ga0495609_0020583 | |||
| 2325 | Ga0495609_0092172 | |||
| 2326 | Ga0495597_0000186 | |||
| 2327 | Ga0495597_0003248 | |||
| 2328 | Ga0495597_0005301 | |||
| 2329 | Ga0495597_0011052 | |||
| 2330 | Ga0495597_0017828 | |||
| 2331 | Ga0495597_0018327 | |||
| 2332 | Ga0495597_0019376 | |||
| 2333 | Ga0495597_0020769 | |||
| 2334 | Ga0495597_0021836 | |||
| 2335 | Ga0495597_0023587 | |||
| 2336 | Ga0495597_0050214 | |||
| 2337 | Ga0495597_0148372 | |||
| 2338 | Ga0495645_0043946 | |||
| 2339 | Ga0495622_0000584 | |||
| 2340 | Ga0495622_0000824 | |||
| 2341 | Ga0495622_0013536 | |||
| 2342 | Ga0495622_0016065 | |||
| 2343 | Ga0495622_0036615 | |||
| 2344 | Ga0495622_0065658 | |||
| 2345 | Ga0495622_0076467 | |||
| 2346 | Ga0495633_0000366 | |||
| 2347 | Ga0495633_0016251 | |||
| 2348 | Ga0495633_0023594 | |||
| 2349 | Ga0495656_0135872 | |||
| 2350 | Ga0495668_0000866 | |||
| 2351 | Ga0495668_0006331 | |||
| 2352 | Ga0495668_0015395 | |||
| 2353 | Ga0495668_0016456 | |||
| 2354 | Ga0495668_0028055 | |||
| 2355 | Ga0495668_0029231 | |||
| 2356 | Ga0495668_0090101 | |||
| 2357 | Ga0495634_0001452 | |||
| 2358 | Ga0495634_0036339 | |||
| 2359 | Ga0495611_0000193 | |||
| 2360 | Ga0495611_0000386 | |||
| 2361 | Ga0495611_0013534 | |||
| 2362 | Ga0495611_0029148 | |||
| 2363 | Ga0495625_0000086 | |||
| 2364 | Ga0495625_0003090 | |||
| 2365 | Ga0495625_0004759 | |||
| 2366 | Ga0495625_0014227 | |||
| 2367 | Ga0495625_0018709 | |||
| 2368 | Ga0495625_0040156 | |||
| 2369 | Ga0495625_0043424 | |||
| 2370 | Ga0495625_0074575 | |||
| 2371 | Ga0495625_0270653 | |||
| 2372 | Ga0495625_0320783 | |||
| 2373 | Ga0495635_0001499 | |||
| 2374 | Ga0495635_0011073 | |||
| 2375 | Ga0495659_0000084 | |||
| 2376 | Ga0495659_0060613 | |||
| 2377 | Ga0495661_0000048 | |||
| 2378 | Ga0495661_0000058 | |||
| 2379 | Ga0495661_0000131 | |||
| 2380 | Ga0495661_0000171 | |||
| 2381 | Ga0495661_0003151 | |||
| 2382 | Ga0495661_0003488 | |||
| 2383 | Ga0495661_0021482 | |||
| 2384 | Ga0495661_0031618 | |||
| 2385 | Ga0495661_0032642 | |||
| 2386 | Ga0495661_0039629 | |||
| 2387 | Ga0495661_0040731 | |||
| 2388 | Ga0495661_0045970 | |||
| 2389 | Ga0495661_0060653 | |||
| 2390 | Ga0495661_0062033 | |||
| 2391 | Ga0495588_0030035 | |||
| 2392 | Ga0495588_0222789 | |||
| 2393 | Ga0495657_0045138 | |||
| 2394 | Ga0495623_0077213 | |||
| 2395 | Ga0495646_0002514 | |||
| 2396 | Ga0495669_0071894 | |||
| 2397 | Ga0495613_0018639 | |||
| 2398 | Ga0495624_0003730 | |||
| 2399 | Ga0495670_0000302 | |||
| 2400 | Ga0495670_0001543 | |||
| 2401 | Ga0495670_0001965 | |||
| 2402 | Ga0495670_0006959 | |||
| 2403 | Ga0495670_0025900 | |||
| 2404 | Ga0495670_0059985 | |||
| 2405 | Ga0495670_0087318 | |||
| 2406 | Ga0495670_0235322 | |||
| 2407 | Ga0495670_0294296 | |||
| 2408 | Ga0495671_0000157 | |||
| 2409 | Ga0495671_0001631 | |||
| 2410 | Ga0495671_0014239 | |||
| 2411 | Ga0495671_0027653 | |||
| 2412 | Ga0495671_0032379 | |||
| 2413 | Ga0495671_0032655 | |||
| 2414 | Ga0495671_0046879 | |||
| 2415 | Ga0495671_0071974 | |||
| 2416 | Ga0495671_0085061 | |||
| 2417 | Ga0495671_0096830 | |||
| 2418 | Ga0495671_0122494 | |||
| 2419 | Ga0495671_0227001 | |||
| 2420 | Ga0495649_0000782 | |||
| 2421 | Ga0495649_0000965 | |||
| 2422 | Ga0495649_0003415 | |||
| 2423 | Ga0495649_0006929 | |||
| 2424 | Ga0495649_0016636 | |||
| 2425 | Ga0495649_0021290 | |||
| 2426 | Ga0495649_0023174 | |||
| 2427 | Ga0495649_0023224 | |||
| 2428 | Ga0495649_0023339 | |||
| 2429 | Ga0495649_0024230 | |||
| 2430 | Ga0495649_0029107 | |||
| 2431 | Ga0495649_0031594 | |||
| 2432 | Ga0495649_0037264 | |||
| 2433 | Ga0495649_0040130 | |||
| 2434 | Ga0495649_0054920 | |||
| 2435 | Ga0495649_0075663 | |||
| 2436 | Ga0495649_0101197 | |||
| 2437 | Ga0495649_0155195 | |||
| 2438 | Ga0495649_0160496 | |||
| 2439 | Ga0495589_0000647 | |||
| 2440 | Ga0495589_0000866 | |||
| 2441 | Ga0495589_0001416 | |||
| 2442 | Ga0495589_0010462 | |||
| 2443 | Ga0495589_0012387 | |||
| 2444 | Ga0495589_0014178 | |||
| 2445 | Ga0495589_0017131 | |||
| 2446 | Ga0495589_0025324 | |||
| 2447 | Ga0495589_0048724 | |||
| 2448 | Ga0495589_0056841 | |||
| 2449 | Ga0495589_0060883 | |||
| 2450 | Ga0495600_0012548 | |||
| 2451 | Ga0495600_0024810 | |||
| 2452 | Ga0495600_0040754 | |||
| 2453 | Ga0495660_0000608 | |||
| 2454 | Ga0495660_0002259 | |||
| 2455 | Ga0495660_0003303 | |||
| 2456 | Ga0495660_0009505 | |||
| 2457 | Ga0495660_0015879 | |||
| 2458 | Ga0495660_0025139 | |||
| 2459 | Ga0495660_0027881 | |||
| 2460 | Ga0495660_0032244 | |||
| 2461 | Ga0495660_0033188 | |||
| 2462 | Ga0495660_0034505 | |||
| 2463 | Ga0495660_0039127 | |||
| 2464 | Ga0495660_0046476 | |||
| 2465 | Ga0495660_0059766 | |||
| 2466 | Ga0495660_0077036 | |||
| 2467 | Ga0495660_0102607 | |||
| 2468 | Ga0495660_0144202 | |||
| 2469 | Ga0495660_0192389 | |||
| 2470 | Ga0495581_0030841 | |||
| 2471 | Ga0495604_0002392 | |||
| 2472 | Ga0495604_0004861 | |||
| 2473 | Ga0495604_0189999 | |||
| 2474 | Ga0495604_0235501 | |||
| 2475 | Ga0495636_0101348 | |||
| 2476 | Ga0495674_0002066 | |||
| 2477 | Ga0495672_0001137 | |||
| 2478 | Ga0495672_0001472 | |||
| 2479 | Ga0495672_0001678 | |||
| 2480 | Ga0495672_0002315 | |||
| 2481 | Ga0495672_0002439 | |||
| 2482 | Ga0495672_0006904 | |||
| 2483 | Ga0495672_0009451 | |||
| 2484 | Ga0495672_0013935 | |||
| 2485 | Ga0495672_0019324 | |||
| 2486 | Ga0495672_0027020 | |||
| 2487 | Ga0495672_0027981 | |||
| 2488 | Ga0495672_0029335 | |||
| 2489 | Ga0495672_0035841 | |||
| 2490 | Ga0495672_0036952 | |||
| 2491 | Ga0495672_0055497 | |||
| 2492 | Ga0495672_0059881 | |||
| 2493 | Ga0495672_0155514 | |||
| 2494 | Ga0495672_0176448 | |||
| 2495 | Ga0495672_0237074 | |||
| 2496 | Ga0495676_0000022 | |||
| 2497 | Ga0495676_0028987 | |||
| 2498 | Ga0495680_0001940 | |||
| 2499 | Ga0495680_0013153 | |||
| 2500 | Ga0495680_0053910 | |||
| 2501 | Ga0495683_0000030 | |||
| 2502 | Ga0495683_0000927 | |||
| 2503 | Ga0495683_0015733 | |||
| 2504 | Ga0495683_0015950 | |||
| 2505 | Ga0495683_0027477 | |||
| 2506 | Ga0495683_0032163 | |||
| 2507 | Ga0495683_0049716 | |||
| 2508 | Ga0495683_0052556 | |||
| 2509 | Ga0495683_0071033 | |||
| 2510 | Ga0495683_0076886 | |||
| 2511 | Ga0495683_0099647 | |||
| 2512 | Ga0495683_0164105 | |||
| 2513 | Ga0495687_002395 | |||
| 2514 | Ga0495687_002578 | |||
| 2515 | Ga0495687_016372 | |||
| 2516 | Ga0495675_0002663 | |||
| 2517 | Ga0495675_0094999 | |||
| 2518 | Ga0495675_0135571 | |||
| 2519 | Ga0495677_0004992 | |||
| 2520 | Ga0495679_000218 | |||
| 2521 | Ga0495679_008161 | |||
| 2522 | Ga0495679_009961 | |||
| 2523 | Ga0495679_010442 | |||
| 2524 | Ga0495679_011633 | |||
| 2525 | Ga0495679_013241 | |||
| 2526 | Ga0495679_015319 | |||
| 2527 | Ga0495679_015486 | |||
| 2528 | Ga0495673_0000544 | |||
| 2529 | Ga0495673_0001080 | |||
| 2530 | Ga0495673_0001326 | |||
| 2531 | Ga0495673_0002696 | |||
| 2532 | Ga0495673_0004063 | |||
| 2533 | Ga0495673_0004098 | |||
| 2534 | Ga0495673_0005947 | |||
| 2535 | Ga0495673_0009951 | |||
| 2536 | Ga0495673_0010178 | |||
| 2537 | Ga0495673_0015583 | |||
| 2538 | Ga0495673_0016719 | |||
| 2539 | Ga0495673_0018155 | |||
| 2540 | Ga0495673_0023012 | |||
| 2541 | Ga0495673_0023895 | |||
| 2542 | Ga0495673_0023945 | |||
| 2543 | Ga0495673_0037941 | |||
| 2544 | Ga0495673_0069614 | |||
| 2545 | Ga0495673_0070626 | |||
| 2546 | Ga0495681_0000351 | |||
| 2547 | Ga0495681_0000411 | |||
| 2548 | Ga0495681_0000534 | |||
| 2549 | Ga0495681_0001655 | |||
| 2550 | Ga0495681_0004365 | |||
| 2551 | Ga0495681_0005015 | |||
| 2552 | Ga0495681_0005274 | |||
| 2553 | Ga0495681_0014124 | |||
| 2554 | Ga0495681_0015029 | |||
| 2555 | Ga0495681_0015298 | |||
| 2556 | Ga0495681_0015554 | |||
| 2557 | Ga0495681_0017979 | |||
| 2558 | Ga0495681_0018900 | |||
| 2559 | Ga0495681_0023727 | |||
| 2560 | Ga0495681_0028697 | |||
| 2561 | Ga0495681_0035618 | |||
| 2562 | Ga0495681_0040112 | |||
| 2563 | Ga0495681_0103202 | |||
| 2564 | Ga0495684_0272349 | |||
| 2565 | Ga0495686_0028405 | |||
| 2566 | Ga0495686_0030068 | |||
| 2567 | Ga0495686_0033029 | |||
| 2568 | Ga0495686_0040042 | |||
| 2569 | Ga0495686_0049419 | |||
| 2570 | Ga0495686_0075733 | |||
| 2571 | Ga0495593_0010377 | |||
| 2572 | Ga0495593_0020211 | |||
| 2573 | Ga0495593_0050812 | |||
| 2574 | Ga0495602_0058196 | |||
| 2575 | Ga0495602_0579484 | |||
| 2576 | Ga0495626_0000039 | |||
| 2577 | Ga0495626_0000391 | |||
| 2578 | Ga0495626_0000562 | |||
| 2579 | Ga0495626_0000876 | |||
| 2580 | Ga0495626_0001660 | |||
| 2581 | Ga0495626_0001894 | |||
| 2582 | Ga0495626_0017787 | |||
| 2583 | Ga0495626_0029164 | |||
| 2584 | Ga0495626_0050757 | |||
| 2585 | Ga0495626_0051000 | |||
| 2586 | Ga0496102_0001161 | |||
| 2587 | Ga0496102_0102955 | |||
| 2588 | Ga0496102_0205491 | |||
| 2589 | Ga0496103_0022118 | |||
| 2590 | Ga0496110_0051109 | |||
| 2591 | Ga0496110_0230231 | |||
| 2592 | Ga0496110_0569748 | |||
| 2593 | Ga0496112_0094767 | |||
| 2594 | Ga0496114_0015310 | |||
| 2595 | Ga0496116_0000376 | |||
| 2596 | Ga0496116_0001403 | |||
| 2597 | Ga0496116_0004841 | |||
| 2598 | Ga0496116_0037495 | |||
| 2599 | Ga0496116_0043304 | |||
| 2600 | Ga0496116_0056128 | |||
| 2601 | Ga0496117_0001205 | |||
| 2602 | Ga0496117_0004904 | |||
| 2603 | Ga0496117_0039140 | |||
| 2604 | Ga0496117_0041751 | |||
| 2605 | Ga0496117_0043992 | |||
| 2606 | Ga0496117_0148103 | |||
| 2607 | Ga0496118_0030684 | |||
| 2608 | Ga0496118_0040717 | |||
| 2609 | Ga0496118_0047610 | |||
| 2610 | Ga0496118_0086828 | |||
| 2611 | Ga0496118_0132446 | |||
| 2612 | Ga0496118_0132605 | |||
| 2613 | Ga0496119_0000082 | |||
| 2614 | Ga0496119_0148135 | |||
| 2615 | Ga0496120_0000873 | |||
| 2616 | Ga0496120_0017629 | |||
| 2617 | Ga0496120_0071677 | |||
| 2618 | Ga0496121_0001119 | |||
| 2619 | Ga0496121_0001386 | |||
| 2620 | Ga0496121_0033948 | |||
| 2621 | Ga0496121_0056141 | |||
| 2622 | Ga0496121_0080167 | |||
| 2623 | Ga0496121_0129808 | |||
| 2624 | Ga0496122_0003673 | |||
| 2625 | Ga0496122_0012580 | |||
| 2626 | Ga0496122_0027078 | |||
| 2627 | Ga0496122_0078088 | |||
| 2628 | Ga0496122_0090502 | |||
| 2629 | Ga0496122_0130565 | |||
| 2630 | Ga0496123_0002626 | |||
| 2631 | Ga0496123_0044086 | |||
| 2632 | Ga0496123_0047650 | |||
| 2633 | Ga0496123_0070988 | |||
| 2634 | Ga0496123_0081009 | |||
| 2635 | Ga0496124_0000120 | |||
| 2636 | Ga0496124_0014469 | |||
| 2637 | Ga0496124_0023214 | |||
| 2638 | Ga0496124_0024564 | |||
| 2639 | Ga0496124_0030509 | |||
| 2640 | Ga0496124_0039994 | |||
| 2641 | Ga0496124_0050285 | |||
| 2642 | Ga0496124_0062371 | |||
| 2643 | Ga0496124_0078549 | |||
| 2644 | Ga0496124_0272504 | |||
| 2645 | Ga0496125_0000799 | |||
| 2646 | Ga0496125_0006647 | |||
| 2647 | Ga0496125_0027012 | |||
| 2648 | Ga0496125_0060412 | |||
| 2649 | Ga0496125_0163594 | |||
| 2650 | Ga0495678_000017 | |||
| 2651 | Ga0495678_000693 | |||
| 2652 | Ga0495678_011031 | |||
| 2653 | Ga0495678_011218 | |||
| 2654 | Ga0495678_013930 | |||
| 2655 | Ga0495678_015310 | |||
| 2656 | Ga0495678_015877 | |||
| 2657 | Ga0495678_016010 | |||
| 2658 | Ga0495678_019562 | |||
| 2659 | Ga0495678_022757 | |||
| 2660 | Ga0495678_024466 | |||
| 2661 | Ga0495678_058860 | |||
| 2662 | Ga0495682_0000182 | |||
| 2663 | Ga0495682_0003288 | |||
| 2664 | Ga0495682_0007762 | |||
| 2665 | Ga0495682_0014543 | |||
| 2666 | Ga0495682_0034520 | |||
| 2667 | Ga0495682_0048640 | |||
| 2668 | Ga0495682_0056984 | |||
| 2669 | Ga0495682_0147905 | |||
| 2670 | Ga0501038_0045138 | |||
| 2671 | Ga0501039_0501836 | |||
| 2672 | Ga0501040_0344442 | |||
| 2673 | Ga0501042_0108652 | |||
| 2674 | Ga0501043_0011788 | |||
| 2675 | Ga0501046_0196489 | |||
| 2676 | Ga0501047_0004948 | |||
| 2677 | Ga0501047_0133524 | |||
| 2678 | Ga0501067_0004678 | |||
| 2679 | Ga0501067_0118484 | |||
| 2680 | Ga0501068_0004775 | |||
| 2681 | Ga0501070_0049378 | |||
| 2682 | Ga0501071_0038675 | |||
| 2683 | Ga0501071_0183209 | |||
| 2684 | Ga0501072_0111218 | |||
| 2685 | Ga0501073_0000405 | |||
| 2686 | Ga0501073_0010478 | |||
| 2687 | Ga0501073_0234756 | |||
| 2688 | Ga0501075_0005105 | |||
| 2689 | Ga0501076_0014020 | |||
| 2690 | Ga0501076_0021177 | |||
| 2691 | Ga0501077_0020106 | |||
| 2692 | Ga0501077_0302071 | |||
| 2693 | Ga0501079_0011299 | |||
| 2694 | Ga0501080_0001172 | |||
| 2695 | Ga0501080_0146927 | |||
| 2696 | Ga0501080_0147183 | |||
| 2697 | Ga0501081_0007493 | |||
| 2698 | Ga0501081_0122715 | |||
| 2699 | Ga0501083_0029801 | |||
| 2700 | Ga0501241_000354 | |||
| 2701 | Ga0501044_0248569 | |||
| 2702 | nmdc:mga00v17_210902_c1 | |||
| 2703 | nmdc:mga00v17_43712_c1 | |||
| 2704 | nmdc:mga0qj67_438605_c1 | |||
| 2705 | nmdc:mga08y16_657244_c1 | |||
| 2706 | nmdc:mga08x19_332261_c1 | |||
| 2707 | Ga0500583_0003831 | |||
| 2708 | Ga0500583_0014754 | |||
| 2709 | Ga0500651_0183419 | |||
| 2710 | Ga0500641_0007501 | |||
| 2711 | Ga0500556_0020665 | |||
| 2712 | Ga0500569_023472 | |||
| 2713 | Ga0500572_004875 | |||
| 2714 | Ga0500593_112169 | |||
| 2715 | Ga0500595_003422 | |||
| 2716 | Ga0500573_0047189 | |||
| 2717 | Ga0500616_0000092 | |||
| 2718 | Ga0500616_0008351 | |||
| 2719 | Ga0500622_0002074 | |||
| 2720 | Ga0500627_0051543 | |||
| 2721 | Ga0500634_0026210 | |||
| 2722 | Ga0501084_0040792 | |||
| 2723 | Ga0501084_0064459 | |||
| 2724 | Ga0501082_0047472 | |||
| 2725 | Ga0501082_0922531 | |||
| 2726 | Ga0530510_0032432 | |||
| 2727 | 2808939683 | |||
| 2728 | 2510284315 | |||
| 2729 | 2510292996 | |||
| 2730 | 2510312502 | |||
| 2731 | 2511256400 | |||
| 2732 | 2511266106 | |||
| 2733 | 2511278978 | |||
| 2734 | 2511288784 | |||
| 2735 | 2511297349 | |||
| 2736 | 2511300350 | |||
| 2737 | 2511316714 | |||
| 2738 | 2511317628 | |||
| 2739 | 2511326023 | |||
| 2740 | 2511330985 | |||
| 2741 | 2511336320 | |||
| 2742 | 2511349116 | |||
| 2743 | 2511355992 | |||
| 2744 | 2511362595 | |||
| 2745 | 2511366827 | |||
| 2746 | 2511411317 | |||
| 2747 | 2511822457 | |||
| 2748 | 2512325958 | |||
| 2749 | 2555245724 | |||
| 2750 | 2555667420 | |||
| 2751 | 2583789802 | |||
| 2752 | 2597855664 | |||
| 2753 | 2597861664 | |||
| 2754 | 2597867389 | |||
| 2755 | 2599327422 | |||
| 2756 | 2599356643 | |||
| 2757 | 2599363327 | |||
| 2758 | 2599369721 | |||
| 2759 | 2599376436 | |||
| 2760 | 2599381748 | |||
| 2761 | 2599388108 | |||
| 2762 | 2599395368 | |||
| 2763 | 2599398849 | |||
| 2764 | 2599407133 | |||
| 2765 | 2599450904 | |||
| 2766 | 2599463476 | |||
| 2767 | 2599469174 | |||
| 2768 | 2599485566 | |||
| 2769 | 2599492493 | |||
| 2770 | 2599500108 | |||
| 2771 | 2599506430 | |||
| 2772 | 2599514150 | |||
| 2773 | 2599518751 | |||
| 2774 | 2599614592 | |||
| 2775 | 2599769413 | |||
| 2776 | 2599806695 | |||
| 2777 | 2599882666 | |||
| 2778 | 2599886833 | |||
| 2779 | 2599893515 | |||
| 2780 | 2599898162 | |||
| 2781 | 2599930895 | |||
| 2782 | 2599943599 | |||
| 2783 | 2599950757 | |||
| 2784 | 2599955910 | |||
| 2785 | 2599962039 | |||
| 2786 | 2599964551 | |||
| 2787 | 2599978908 | |||
| 2788 | 2599984603 | |||
| 2789 | 2599991244 | |||
| 2790 | 2599994850 | |||
| 2791 | 2600002225 | |||
| 2792 | 2600004864 | |||
| 2793 | 2600012868 | |||
| 2794 | 2600018973 | |||
| 2795 | 2600023969 | |||
| 2796 | 2600030994 | |||
| 2797 | 2600034670 | |||
| 2798 | 2600043463 | |||
| 2799 | 2600048055 | |||
| 2800 | 2600053326 | |||
| 2801 | 2600061328 | |||
| 2802 | 2600067616 | |||
| 2803 | 2600071793 | |||
| 2804 | 2600077662 | |||
| 2805 | 2600216105 | |||
| 2806 | 2600360885 | |||
| 2807 | 2600364881 | |||
| 2808 | 2601692349 | |||
| 2809 | 2601776272 | |||
| 2810 | 2601797836 | |||
| 2811 | 2602008645 | |||
| 2812 | 2606076681 | |||
| 2813 | 2606128905 | |||
| 2814 | 2621302176 | |||
| 2815 | 2624478225 | |||
| 2816 | 2643872617 | |||
| 2817 | 2643954899 | |||
| 2818 | 2644024539 | |||
| 2819 | 2644186125 | |||
| 2820 | 2644282073 | |||
| 2821 | 2644619650 | |||
| 2822 | 2652543419 | |||
| 2823 | 2671090799 | |||
| 2824 | 2671099967 | |||
| 2825 | 2671127338 | |||
| 2826 | 2671772346 | |||
| 2827 | 2677898952 | |||
| 2828 | 2678260990 | |||
| 2829 | 2715749210 | |||
| 2830 | 2715755480 | |||
| 2831 | 2718632162 | |||
| 2832 | 2723246562 | |||
| 2833 | 2738674089 | |||
| 2834 | 2738752482 | |||
| 2835 | 2738807905 | |||
| 2836 | 2738861523 | |||
| 2837 | 2738895265 | |||
| 2838 | 2739198030 | |||
| 2839 | 2739260294 | |||
| 2840 | 2739288589 | |||
| 2841 | 2739293901 | |||
| 2842 | 2739311284 | |||
| 2843 | 2743735081 | |||
| 2844 | 2745006302 | |||
| 2845 | 2774119557 | |||
| 2846 | 2774131495 | |||
| 2847 | 2774134740 | |||
| 2848 | 2784261043 | |||
| 2849 | 2784315968 | |||
| 2850 | 2794593981 | |||
| 2851 | 2808855941 | |||
| 2852 | 2808905431 | |||
| 2853 | 2808922744 | |||
| 2854 | 2808932179 | |||
| 2855 | 2808936021 | |||
| 2856 | 2808944431 | |||
| 2857 | 2808954220 | |||
| 2858 | 2808964482 | |||
| 2859 | 2808976658 | |||
| 2860 | 2808991904 | |||
| 2861 | 2808999370 | |||
| 2862 | 2809217980 | |||
| 2863 | 2812370181 | |||
| 2864 | 2817488414 | |||
| 2865 | 2819657234 | |||
| 2866 | 2819705217 | |||
| 2867 | 2823425500 | |||
| 2868 | 2825654264 | |||
| 2869 | 2826586874 | |||
| 2870 | 2834032209 | |||
| 2871 | 2842807109 | |||
| 2872 | 2842816692 | |||
| 2873 | 2842832087 | |||
| 2874 | 2842834162 | |||
| 2875 | 2842838637 | |||
| 2876 | 2842846361 | |||
| 2877 | 2842852260 | |||
| 2878 | 2842858724 | |||
| 2879 | 2844667900 | |||
| 2880 | 2852617078 | |||
| 2881 | 2852660449 | |||
| 2882 | 2852671933 | |||
| 2883 | 2860868438 | |||
| 2884 | 2878030168 | |||
| 2885 | 2880231115 | |||
| 2886 | 2894513819 | |||
| 2887 | 2904519574 | |||
| 2888 | 2904552156 | |||
| 2889 | 2908447031 | |||
| 2890 | 2912964087 | |||
| 2891 | 2913037288 | |||
| 2892 | 2917071171 | |||
| 2893 | 2917836379 | |||
| 2894 | 2919066150 | |||
| 2895 | 2919127488 | |||
| 2896 | 2919155786 | |||
| 2897 | 2919389774 | |||
| 2898 | 2919459987 | |||
| 2899 | 2919486893 | |||
| 2900 | 2919488701 | |||
| 2901 | 2919502235 | |||
| 2902 | 2923154076 | |||
| 2903 | 2923524272 | |||
| 2904 | 2923589788 | |||
| 2905 | 2926063908 | |||
| 2906 | 2929144819 | |||
| 2907 | 2929190303 | |||
| 2908 | 2931371845 | |||
| 2909 | 2931391382 | |||
| 2910 | 2935358999 | |||
| 2911 | 2939654979 | |||
| 2912 | 2945930164 | |||
| 2913 | 2945967592 | |||
| 2914 | 2946012511 | |||
| 2915 | 2946028646 | |||
| 2916 | 2947235173 | |||
| 2917 | 2969304961 | |||
| 2918 | 2974293347 | |||
| 2919 | 2974301735 | |||
| 2920 | 2984291983 | |||
| 2921 | 2984500696 | |||
| 2922 | 2984507219 | |||
| 2923 | 2988732208 | |||
| 2924 | 2989393230 | |||
| 2925 | 2990199578 | |||
| 2926 | 2998140464 | |||
| 2927 | 3007255370 | |||
| 2928 | 3007315824 | |||
| 2929 | 3007399627 | |||
| 2930 | 3007420026 | |||
| 2931 | 3007517909 | |||
| 2932 | 3007618652 | |||
| 2933 | 3007624986 | |||
| 2934 | 3007721225 | |||
| 2935 | 3007859704 | |||
| 2936 | 3007864323 | |||
| 2937 | 3007872019 | |||
| 2938 | 637317817 | |||
| 2939 | 8015688325 | |||
| 2940 | 8030000274 | |||
| 2941 | 8054291526 | |||
| 2942 | 8054350128 | |||
| 2943 | 8054503969 | |||
| 2944 | 8055771422 | |||
| 2945 | 8055818365 | |||
| 2946 | 8056126477 | |||
| 2947 | 8056132339 | |||
| 2948 | 8056143741 | |||
| 2949 | 8056152479 | |||
| 2950 | 8056158516 | |||
| 2951 | 8056164345 | |||
| 2952 | 8056170587 | |||
| 2953 | 8056176702 | |||
| 2954 | 8056183039 | |||
| 2955 | 8056572323 | |||
| 2956 | 8057802711 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7msn-assembly1.cif.gz_B | suns glycosin s-glycosyltransferase | 0.7923 | 2 | 118 |
| 2bo7-assembly2.cif.gz_F | dissection of mannosylglycerate synthase: an archetypal mannosyltransferase | 0.7605 | 5 | 204 |
| 7pho-assembly1.cif.gz_B | crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.1 in complex with 4-hydroxybenzaldehyde | 0.7409 | 2 | 203 |
| 7p8g-assembly1.cif.gz_A-2 | crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 - apo form | 0.7318 | 2 | 230 |
| 7pdo-assembly1.cif.gz_A-2 | crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp | 0.7301 | 2 | 230 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53493_586_855_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8775 | 4 | 235 | 3.90.550.10 |
| af_Q58619_2_238_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8674 | 4 | 226 | 3.90.550.10 |
| af_P9WMY1_2_214_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8638 | 3 | 223 | 3.90.550.10 |
| af_P9WMY1_2_214_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8452 | 3 | 223 | 3.90.550.10 |
| af_P40350_49_327_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8354 | 2 | 232 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W5I6R2-F1-model_v4 | deleted | 0.9937 | 3 | 119 |
|
| AF-A0A0D0RUL3-F1-model_v4 | Undecaprenyl-phosphate mannosyltransferase (EC 2.4.1.54) | 0.9908 | 1 | 244 |
GO:0006487
GO:0047267 |
| AF-A0A0R2ZGR6-F1-model_v4 | Glycosyl transferase | 0.9901 | 1 | 244 |
GO:0006487
GO:0016740 |
| AF-A0A560SVF0-F1-model_v4 | Glycosyltransferase involved in cell wall biosynthesis | 0.9898 | 1 | 244 |
GO:0006487
GO:0016740 |
| AF-A0A063BH90-F1-model_v4 | Glycosyl transferase family 2 | 0.9884 | 1 | 240 |
GO:0005886
GO:0006487 GO:0009247 GO:0016746 |