F494266
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1480 | 694 | 2960 | 173 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100261863|Ga0068856_1002618632 |
| Length | 193 |
| Sequence | MERNDPDGRHCAPEIKSMMRRLLQPFWVLLAIVFLIEAWLWDHLEPIVARIVALIPLRAFKQWLADRVDALSPAMTLIVFAVPVIPLFPLKLVGLWLLANEYWVSAAIVIVLGKFVGLGVTAFIFDVTRSKLMQMAWFKKVYEFIMAMRAKAAELVQPIKQRIKEVLHGGGDGWSSRTLRLIQRFRKSVHEAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 11 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 94 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 131 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 203 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 204 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 214 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 217 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 220 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 221 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 223 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 225 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 226 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 227 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 228 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 229 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 230 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 231 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 232 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 233 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 235 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 236 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 237 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 238 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 239 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 240 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 241 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 251 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 260 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 261 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 262 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 265 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 266 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 267 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 271 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 277 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 278 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 279 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 280 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 281 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 282 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 283 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 284 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 285 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 286 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 287 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 288 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 289 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 290 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 291 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 292 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 293 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 294 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 391 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 392 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 393 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 394 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 395 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 396 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 397 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 398 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 401 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 402 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 403 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 404 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 405 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 406 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 407 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 408 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 409 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 410 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 411 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 412 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 413 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 414 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 415 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 416 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 422 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 423 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 424 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 425 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 426 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 427 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 428 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 429 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 434 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 437 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 441 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 442 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 443 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 444 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 445 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 446 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 447 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 448 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 449 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 450 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 451 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 452 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 453 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 454 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 455 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 456 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 457 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 458 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 459 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 460 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 461 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 462 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 463 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 464 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 465 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 466 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 467 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 468 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 469 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 470 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 471 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 472 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 473 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 474 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 475 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 476 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 477 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 478 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 479 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 480 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 481 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 482 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 483 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 484 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 485 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 486 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 487 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 488 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 489 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 490 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 491 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 492 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 493 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 494 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 495 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 496 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 497 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 498 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 499 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 500 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 501 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 502 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 503 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 504 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 505 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 506 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 507 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 508 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 509 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 510 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 511 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 512 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 513 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 514 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 515 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 516 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 517 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 518 | 2791355199 | |||
| 519 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 520 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 521 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 522 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 523 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 524 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 525 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 526 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 527 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 528 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 529 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 530 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 531 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 532 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 533 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 534 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 535 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 536 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 537 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 538 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 539 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 540 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 541 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 542 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 543 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 544 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 545 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 546 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 547 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 548 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 549 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 550 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 551 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 552 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 553 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 554 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 555 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 556 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 557 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 558 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 559 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 560 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 561 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 562 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 563 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 564 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 565 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 566 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 567 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 568 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 569 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 570 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 571 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 572 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 573 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 574 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 575 | 2904699407 | |||
| 576 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 577 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 578 | 2906610324 | |||
| 579 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 580 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 581 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 582 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 583 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 584 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 585 | 2922368715 | |||
| 586 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 587 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 588 | 2922425934 | |||
| 589 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 590 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 591 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 592 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 593 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 594 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 595 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 596 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 597 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 598 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 599 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 600 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 601 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 602 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 603 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 604 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 605 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 606 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 607 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 608 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 609 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 610 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 611 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 612 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 613 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 614 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 615 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 616 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 617 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 618 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 619 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 620 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 621 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 622 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 623 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 624 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 625 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 626 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 627 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 628 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 629 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 630 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 631 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 632 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 633 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 634 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 635 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 636 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 637 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 638 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 639 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 640 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 641 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 642 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 643 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 644 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 645 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 646 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 647 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 648 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 649 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 650 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 651 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 652 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 653 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 654 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 655 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 656 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 657 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 658 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 659 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 660 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 661 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 662 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 663 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 664 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 665 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 666 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 667 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 668 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 669 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 670 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 671 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 672 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 673 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 674 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 675 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 676 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 677 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 678 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 679 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 680 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 681 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 682 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 683 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 684 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 685 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 686 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 687 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 688 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 689 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 690 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 691 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 692 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 693 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 694 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.64 |
| Metatranscriptomes | 0.14 |
| Isolates | 13.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15 |
| Nodule | 10.54 |
| Rhizoplane | 5.27 |
| Rhizosphere | 58.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068856_100261863 | 3300005614 | Bacteria | 1745 |
| 2 | JGI24736J21556_1009058 | 3300001904 | Bacteria | 1648 |
| 3 | JGI24737J22298_10067448 | 3300001990 | Bacteria | 1071 |
| 4 | JGI24744J21845_10006651 | 3300002077 | Bacteria | 2393 |
| 5 | JGI25406J46586_10009349 | 3300003203 | Bacteria | 4391 |
| 6 | JGI25406J46586_10154205 | 3300003203 | Bacteria | 670 |
| 7 | JGI25165J46597_1005291 | 3300003214 | Bacteria | 2526 |
| 8 | JGI25153J46596_10005387 | 3300003215 | Bacteria | 6720 |
| 9 | JGI25153J46596_10006271 | 3300003215 | Bacteria | 6074 |
| 10 | JGI25153J46596_10006385 | 3300003215 | Bacteria | 5976 |
| 11 | JGI25153J46596_10014578 | 3300003215 | Bacteria | 3256 |
| 12 | JGI25153J46596_10042166 | 3300003215 | Bacteria | 1395 |
| 13 | rootL2_10223649 | 3300003322 | Bacteria | 2054 |
| 14 | JGI25160J50197_1002041 | 3300003354 | Bacteria | 9623 |
| 15 | JGI25160J50197_1004384 | 3300003354 | Bacteria | 6116 |
| 16 | JGI25160J50197_1005378 | 3300003354 | Bacteria | 5340 |
| 17 | JGI25161J50226_1018010 | 3300003374 | Bacteria | 736 |
| 18 | JGI25404J52841_10000873 | 3300003659 | Bacteria | 4879 |
| 19 | JGI25404J52841_10013024 | 3300003659 | Bacteria | 1804 |
| 20 | JGI25404J52841_10067389 | 3300003659 | Bacteria | 749 |
| 21 | JGI25404J52841_10106369 | 3300003659 | Bacteria | 589 |
| 22 | Ga0055531_10004632 | 3300003794 | Bacteria | 8262 |
| 23 | Ga0055531_10027490 | 3300003794 | Bacteria | 1995 |
| 24 | Ga0055543_1007172 | 3300004625 | Bacteria | 2604 |
| 25 | Ga0055543_1026148 | 3300004625 | Bacteria | 1039 |
| 26 | Ga0065165_1003775 | 3300005262 | Bacteria | 10150 |
| 27 | Ga0065165_1003886 | 3300005262 | Bacteria | 9897 |
| 28 | Ga0065165_1019062 | 3300005262 | Bacteria | 2463 |
| 29 | Ga0070658_10291913 | 3300005327 | Bacteria | 1389 |
| 30 | Ga0070676_10547942 | 3300005328 | Bacteria | 827 |
| 31 | Ga0070690_100099015 | 3300005330 | Bacteria | 1930 |
| 32 | Ga0070670_100525653 | 3300005331 | Bacteria | 1054 |
| 33 | Ga0068869_100031930 | 3300005334 | Bacteria | 3708 |
| 34 | Ga0068869_100401449 | 3300005334 | Bacteria | 1127 |
| 35 | Ga0068869_100433628 | 3300005334 | Bacteria | 1086 |
| 36 | Ga0070666_10322709 | 3300005335 | Bacteria | 1102 |
| 37 | Ga0070666_10664934 | 3300005335 | Bacteria | 762 |
| 38 | Ga0070680_100277401 | 3300005336 | Bacteria | 1420 |
| 39 | Ga0070682_100240415 | 3300005337 | Bacteria | 1299 |
| 40 | Ga0068868_100162758 | 3300005338 | Bacteria | 1844 |
| 41 | Ga0068868_100435601 | 3300005338 | Bacteria | 1137 |
| 42 | Ga0068868_100614006 | 3300005338 | Bacteria | 965 |
| 43 | Ga0068868_100981123 | 3300005338 | Bacteria | 772 |
| 44 | Ga0068868_101352447 | 3300005338 | Bacteria | 663 |
| 45 | Ga0070660_100505443 | 3300005339 | Bacteria | 1006 |
| 46 | Ga0070689_100143600 | 3300005340 | Bacteria | 1921 |
| 47 | Ga0070687_100653555 | 3300005343 | Bacteria | 729 |
| 48 | Ga0070661_100268021 | 3300005344 | Bacteria | 1322 |
| 49 | Ga0070668_100052173 | 3300005347 | Bacteria | 3152 |
| 50 | Ga0070668_100080823 | 3300005347 | Bacteria | 2547 |
| 51 | Ga0070668_100092406 | 3300005347 | Bacteria | 2386 |
| 52 | Ga0070668_100093376 | 3300005347 | Bacteria | 2374 |
| 53 | Ga0070668_100146930 | 3300005347 | Bacteria | 1903 |
| 54 | Ga0070668_100226037 | 3300005347 | Bacteria | 1546 |
| 55 | Ga0070668_100461726 | 3300005347 | Bacteria | 1093 |
| 56 | Ga0070669_100196111 | 3300005353 | Bacteria | 1586 |
| 57 | Ga0070675_100174031 | 3300005354 | Bacteria | 1858 |
| 58 | Ga0070675_101051968 | 3300005354 | Bacteria | 748 |
| 59 | Ga0070671_100457252 | 3300005355 | Bacteria | 1096 |
| 60 | Ga0070671_100577311 | 3300005355 | Bacteria | 971 |
| 61 | Ga0070674_100286693 | 3300005356 | Bacteria | 1307 |
| 62 | Ga0070674_100476657 | 3300005356 | Bacteria | 1035 |
| 63 | Ga0070674_101173489 | 3300005356 | Bacteria | 681 |
| 64 | Ga0070673_100288838 | 3300005364 | Bacteria | 1441 |
| 65 | Ga0070673_100459906 | 3300005364 | Bacteria | 1146 |
| 66 | Ga0070673_101509513 | 3300005364 | Bacteria | 634 |
| 67 | Ga0070688_100937311 | 3300005365 | Bacteria | 685 |
| 68 | Ga0070659_100129249 | 3300005366 | Bacteria | 2050 |
| 69 | Ga0070659_101040940 | 3300005366 | Bacteria | 720 |
| 70 | Ga0070667_100184393 | 3300005367 | Bacteria | 1847 |
| 71 | Ga0070709_10000164 | 3300005434 | Bacteria | 42124 |
| 72 | Ga0070709_10184937 | 3300005434 | Bacteria | 1466 |
| 73 | Ga0070714_100047913 | 3300005435 | Bacteria | 3633 |
| 74 | Ga0070714_100116517 | 3300005435 | Bacteria | 2372 |
| 75 | Ga0070713_100004014 | 3300005436 | Bacteria | 9799 |
| 76 | Ga0070713_100094561 | 3300005436 | Bacteria | 2577 |
| 77 | Ga0070713_100196055 | 3300005436 | Bacteria | 1822 |
| 78 | Ga0070713_100906911 | 3300005436 | Bacteria | 848 |
| 79 | Ga0070710_10000283 | 3300005437 | Bacteria | 24031 |
| 80 | Ga0070710_10153524 | 3300005437 | Bacteria | 1422 |
| 81 | Ga0070701_10438818 | 3300005438 | Bacteria | 835 |
| 82 | Ga0070711_100005189 | 3300005439 | Bacteria | 7768 |
| 83 | Ga0070711_100015539 | 3300005439 | Bacteria | 4818 |
| 84 | Ga0070663_100040755 | 3300005455 | Bacteria | 3253 |
| 85 | Ga0070663_100048472 | 3300005455 | Bacteria | 3012 |
| 86 | Ga0070663_100124021 | 3300005455 | Bacteria | 1954 |
| 87 | Ga0070663_100124757 | 3300005455 | Bacteria | 1949 |
| 88 | Ga0070663_100126633 | 3300005455 | Bacteria | 1935 |
| 89 | Ga0070663_100206905 | 3300005455 | Bacteria | 1534 |
| 90 | Ga0070663_100455756 | 3300005455 | Bacteria | 1055 |
| 91 | Ga0070663_100586840 | 3300005455 | Bacteria | 936 |
| 92 | Ga0070663_100617546 | 3300005455 | Bacteria | 913 |
| 93 | Ga0070663_100845157 | 3300005455 | Bacteria | 787 |
| 94 | Ga0070678_100031271 | 3300005456 | Bacteria | 3669 |
| 95 | Ga0070678_100298265 | 3300005456 | Bacteria | 1369 |
| 96 | Ga0070678_100376863 | 3300005456 | Bacteria | 1227 |
| 97 | Ga0070678_100435374 | 3300005456 | Bacteria | 1146 |
| 98 | Ga0070662_100249738 | 3300005457 | Bacteria | 1426 |
| 99 | Ga0070662_100412757 | 3300005457 | Bacteria | 1116 |
| 100 | Ga0070681_10099168 | 3300005458 | Bacteria | 2859 |
| 101 | Ga0070706_100375313 | 3300005467 | Bacteria | 1325 |
| 102 | Ga0070707_100137959 | 3300005468 | Bacteria | 2373 |
| 103 | Ga0070679_100177508 | 3300005530 | Bacteria | 2103 |
| 104 | Ga0070697_100073538 | 3300005536 | Bacteria | 2807 |
| 105 | Ga0068853_100272640 | 3300005539 | Bacteria | 1558 |
| 106 | Ga0068853_100330786 | 3300005539 | Bacteria | 1414 |
| 107 | Ga0068853_100366307 | 3300005539 | Bacteria | 1344 |
| 108 | Ga0068853_100504203 | 3300005539 | Bacteria | 1143 |
| 109 | Ga0068853_100588946 | 3300005539 | Bacteria | 1056 |
| 110 | Ga0070672_100133626 | 3300005543 | Bacteria | 2041 |
| 111 | Ga0070672_100209828 | 3300005543 | Bacteria | 1631 |
| 112 | Ga0070686_100300815 | 3300005544 | Bacteria | 1190 |
| 113 | Ga0070693_100054359 | 3300005547 | Bacteria | 2302 |
| 114 | Ga0070693_100334448 | 3300005547 | Bacteria | 1032 |
| 115 | Ga0070665_100024388 | 3300005548 | Bacteria | 6091 |
| 116 | Ga0070665_100113273 | 3300005548 | Bacteria | 2715 |
| 117 | Ga0070665_100232557 | 3300005548 | Bacteria | 1843 |
| 118 | Ga0070665_100263835 | 3300005548 | Bacteria | 1723 |
| 119 | Ga0070665_100423701 | 3300005548 | Bacteria | 1340 |
| 120 | Ga0070665_100666282 | 3300005548 | Bacteria | 1054 |
| 121 | Ga0070665_101829538 | 3300005548 | Bacteria | 614 |
| 122 | Ga0068855_100205366 | 3300005563 | Bacteria | 2217 |
| 123 | Ga0070664_100114656 | 3300005564 | Bacteria | 2355 |
| 124 | Ga0068857_100276126 | 3300005577 | Bacteria | 1545 |
| 125 | Ga0068857_100480307 | 3300005577 | Bacteria | 1164 |
| 126 | Ga0068857_100538843 | 3300005577 | Bacteria | 1099 |
| 127 | Ga0068857_100574455 | 3300005577 | Bacteria | 1064 |
| 128 | Ga0068854_100037985 | 3300005578 | Bacteria | 3384 |
| 129 | Ga0068854_100350862 | 3300005578 | Bacteria | 1207 |
| 130 | Ga0068856_100101992 | 3300005614 | Bacteria | 2863 |
| 131 | Ga0068856_100151979 | 3300005614 | Bacteria | 2324 |
| 132 | Ga0068856_100762197 | 3300005614 | Bacteria | 988 |
| 133 | Ga0068856_100892822 | 3300005614 | Bacteria | 908 |
| 134 | Ga0070702_100034991 | 3300005615 | Bacteria | 2773 |
| 135 | Ga0070702_100176664 | 3300005615 | Bacteria | 1394 |
| 136 | Ga0068852_100164356 | 3300005616 | Bacteria | 2075 |
| 137 | Ga0068852_100340850 | 3300005616 | Bacteria | 1461 |
| 138 | Ga0068852_100695221 | 3300005616 | Bacteria | 1027 |
| 139 | Ga0068852_100819838 | 3300005616 | Bacteria | 945 |
| 140 | Ga0068859_100320351 | 3300005617 | Bacteria | 1644 |
| 141 | Ga0068859_100404153 | 3300005617 | Bacteria | 1462 |
| 142 | Ga0068859_100673693 | 3300005617 | Bacteria | 1126 |
| 143 | Ga0068859_100930930 | 3300005617 | Bacteria | 953 |
| 144 | Ga0068864_100076165 | 3300005618 | Bacteria | 2930 |
| 145 | Ga0068866_10064783 | 3300005718 | Bacteria | 1909 |
| 146 | Ga0068866_10154652 | 3300005718 | Bacteria | 1332 |
| 147 | Ga0068861_100362861 | 3300005719 | Bacteria | 1274 |
| 148 | Ga0068861_100401389 | 3300005719 | Bacteria | 1216 |
| 149 | Ga0068861_100672704 | 3300005719 | Bacteria | 959 |
| 150 | Ga0068870_10362037 | 3300005840 | Bacteria | 934 |
| 151 | Ga0068863_100572227 | 3300005841 | Bacteria | 1117 |
| 152 | Ga0068863_100585417 | 3300005841 | Bacteria | 1104 |
| 153 | Ga0068863_100687203 | 3300005841 | Bacteria | 1017 |
| 154 | Ga0068863_100792837 | 3300005841 | Bacteria | 945 |
| 155 | Ga0068863_101031747 | 3300005841 | Bacteria | 826 |
| 156 | Ga0068858_100241443 | 3300005842 | Bacteria | 1714 |
| 157 | Ga0068858_100292276 | 3300005842 | Bacteria | 1553 |
| 158 | Ga0068858_100326385 | 3300005842 | Bacteria | 1467 |
| 159 | Ga0068858_100414739 | 3300005842 | Bacteria | 1295 |
| 160 | Ga0068858_100504965 | 3300005842 | Bacteria | 1168 |
| 161 | Ga0068858_100514563 | 3300005842 | Bacteria | 1157 |
| 162 | Ga0068860_100017741 | 3300005843 | Bacteria | 6934 |
| 163 | Ga0068860_100253173 | 3300005843 | Bacteria | 1715 |
| 164 | Ga0068860_100443083 | 3300005843 | Bacteria | 1290 |
| 165 | Ga0068862_100086095 | 3300005844 | Bacteria | 2731 |
| 166 | Ga0081455_10016293 | 3300005937 | Bacteria | 7181 |
| 167 | Ga0081455_10027264 | 3300005937 | Bacteria | 5236 |
| 168 | Ga0081455_10169663 | 3300005937 | Bacteria | 1664 |
| 169 | Ga0081455_10196830 | 3300005937 | Bacteria | 1513 |
| 170 | Ga0081455_10205630 | 3300005937 | Bacteria | 1471 |
| 171 | Ga0081455_10209159 | 3300005937 | Bacteria | 1455 |
| 172 | Ga0081455_10400114 | 3300005937 | Bacteria | 953 |
| 173 | Ga0081540_1002717 | 3300005983 | Bacteria | 14394 |
| 174 | Ga0081540_1004243 | 3300005983 | Bacteria | 11008 |
| 175 | Ga0081540_1004583 | 3300005983 | Bacteria | 10468 |
| 176 | Ga0081540_1006735 | 3300005983 | Bacteria | 8310 |
| 177 | Ga0081540_1014469 | 3300005983 | Bacteria | 5053 |
| 178 | Ga0081540_1018204 | 3300005983 | Bacteria | 4319 |
| 179 | Ga0081540_1036177 | 3300005983 | Bacteria | 2637 |
| 180 | Ga0081540_1049325 | 3300005983 | Bacteria | 2101 |
| 181 | Ga0081540_1080078 | 3300005983 | Bacteria | 1474 |
| 182 | Ga0081539_10000371 | 3300005985 | Bacteria | 98455 |
| 183 | Ga0081539_10018231 | 3300005985 | Bacteria | 4882 |
| 184 | Ga0081539_10078005 | 3300005985 | Bacteria | 1750 |
| 185 | Ga0081539_10143754 | 3300005985 | Bacteria | 1156 |
| 186 | Ga0070717_10038762 | 3300006028 | Bacteria | 3874 |
| 187 | Ga0070717_10616045 | 3300006028 | Bacteria | 985 |
| 188 | Ga0070717_11219148 | 3300006028 | Bacteria | 685 |
| 189 | Ga0075365_10007177 | 3300006038 | Bacteria | 6219 |
| 190 | Ga0075365_10007995 | 3300006038 | Bacteria | 5968 |
| 191 | Ga0075365_10044897 | 3300006038 | Bacteria | 2897 |
| 192 | Ga0075365_10117749 | 3300006038 | Bacteria | 1830 |
| 193 | Ga0075365_10171744 | 3300006038 | Bacteria | 1513 |
| 194 | Ga0075365_10196786 | 3300006038 | Bacteria | 1411 |
| 195 | Ga0075365_10264509 | 3300006038 | Bacteria | 1209 |
| 196 | Ga0075365_10337125 | 3300006038 | Bacteria | 1062 |
| 197 | Ga0075368_10014493 | 3300006042 | Bacteria | 2913 |
| 198 | Ga0075363_100000382 | 3300006048 | Bacteria | 13428 |
| 199 | Ga0075363_100009480 | 3300006048 | Bacteria | 4577 |
| 200 | Ga0075363_100171579 | 3300006048 | Bacteria | 1231 |
| 201 | Ga0075364_10072888 | 3300006051 | Bacteria | 2263 |
| 202 | Ga0075364_10096242 | 3300006051 | Bacteria | 1968 |
| 203 | Ga0075364_10114904 | 3300006051 | Bacteria | 1799 |
| 204 | Ga0075364_10170040 | 3300006051 | Bacteria | 1473 |
| 205 | Ga0075364_10415813 | 3300006051 | Bacteria | 918 |
| 206 | Ga0070715_10086905 | 3300006163 | Bacteria | 1431 |
| 207 | Ga0070715_10161682 | 3300006163 | Bacteria | 1107 |
| 208 | Ga0070715_10304498 | 3300006163 | Bacteria | 854 |
| 209 | Ga0070716_100168012 | 3300006173 | Bacteria | 1429 |
| 210 | Ga0070716_100307856 | 3300006173 | Bacteria | 1105 |
| 211 | Ga0070712_100014272 | 3300006175 | Bacteria | 5101 |
| 212 | Ga0070712_100026701 | 3300006175 | Bacteria | 3850 |
| 213 | Ga0070712_100248984 | 3300006175 | Bacteria | 1419 |
| 214 | Ga0075362_10001063 | 3300006177 | Bacteria | 8485 |
| 215 | Ga0075362_10093881 | 3300006177 | Bacteria | 1395 |
| 216 | Ga0075367_10026606 | 3300006178 | Bacteria | 3283 |
| 217 | Ga0075367_10066229 | 3300006178 | Bacteria | 2164 |
| 218 | Ga0075367_10084792 | 3300006178 | Bacteria | 1922 |
| 219 | Ga0075367_10122497 | 3300006178 | Bacteria | 1603 |
| 220 | Ga0075367_10128287 | 3300006178 | Bacteria | 1566 |
| 221 | Ga0075367_10259502 | 3300006178 | Bacteria | 1091 |
| 222 | Ga0075367_10376682 | 3300006178 | Bacteria | 897 |
| 223 | Ga0075369_10184077 | 3300006186 | Bacteria | 961 |
| 224 | Ga0075369_10205841 | 3300006186 | Bacteria | 909 |
| 225 | Ga0075369_10424051 | 3300006186 | Bacteria | 628 |
| 226 | Ga0075366_10043941 | 3300006195 | Bacteria | 2647 |
| 227 | Ga0075366_10065380 | 3300006195 | Bacteria | 2163 |
| 228 | Ga0075366_10086496 | 3300006195 | Bacteria | 1875 |
| 229 | Ga0075366_10106390 | 3300006195 | Bacteria | 1686 |
| 230 | Ga0075366_10186447 | 3300006195 | Bacteria | 1260 |
| 231 | Ga0075366_10231164 | 3300006195 | Bacteria | 1127 |
| 232 | Ga0075366_10383996 | 3300006195 | Bacteria | 864 |
| 233 | Ga0075366_10455285 | 3300006195 | Bacteria | 790 |
| 234 | Ga0075366_10495048 | 3300006195 | Bacteria | 755 |
| 235 | Ga0097621_100892052 | 3300006237 | Bacteria | 828 |
| 236 | Ga0097621_100951034 | 3300006237 | Bacteria | 802 |
| 237 | Ga0075370_10029240 | 3300006353 | Bacteria | 3068 |
| 238 | Ga0075370_10112638 | 3300006353 | Bacteria | 1581 |
| 239 | Ga0075370_10144561 | 3300006353 | Bacteria | 1391 |
| 240 | Ga0075370_10202053 | 3300006353 | Bacteria | 1172 |
| 241 | Ga0068871_100360992 | 3300006358 | Bacteria | 1287 |
| 242 | Ga0068871_101296814 | 3300006358 | Bacteria | 685 |
| 243 | Ga0075428_100221744 | 3300006844 | Bacteria | 2042 |
| 244 | Ga0068865_100128766 | 3300006881 | Bacteria | 1893 |
| 245 | Ga0068865_100323303 | 3300006881 | Bacteria | 1242 |
| 246 | Ga0075436_100497088 | 3300006914 | Bacteria | 892 |
| 247 | Ga0097620_100320365 | 3300006931 | Bacteria | 1644 |
| 248 | Ga0097620_100404141 | 3300006931 | Bacteria | 1462 |
| 249 | Ga0097620_100673723 | 3300006931 | Bacteria | 1126 |
| 250 | Ga0097620_100930904 | 3300006931 | Bacteria | 953 |
| 251 | Ga0099824_1015237 | 3300006942 | Bacteria | 7359 |
| 252 | Ga0099822_1035053 | 3300006943 | Bacteria | 3285 |
| 253 | Ga0075435_100168984 | 3300007076 | Bacteria | 1844 |
| 254 | Ga0099794_10421978 | 3300007265 | Bacteria | 698 |
| 255 | Ga0099795_10029851 | 3300007788 | Bacteria | 1866 |
| 256 | Ga0099795_10119526 | 3300007788 | Bacteria | 1052 |
| 257 | Ga0105251_10189061 | 3300009011 | Bacteria | 927 |
| 258 | Ga0105250_10186222 | 3300009092 | Bacteria | 872 |
| 259 | Ga0105250_10401323 | 3300009092 | Bacteria | 608 |
| 260 | Ga0105240_10178027 | 3300009093 | Bacteria | 2512 |
| 261 | Ga0105240_10226073 | 3300009093 | Bacteria | 2177 |
| 262 | Ga0105240_10642954 | 3300009093 | Bacteria | 1163 |
| 263 | Ga0105240_10758931 | 3300009093 | Bacteria | 1054 |
| 264 | Ga0111539_10417181 | 3300009094 | Bacteria | 1563 |
| 265 | Ga0105245_10306632 | 3300009098 | Bacteria | 1560 |
| 266 | Ga0105245_10504544 | 3300009098 | Bacteria | 1226 |
| 267 | Ga0105245_11323201 | 3300009098 | Bacteria | 770 |
| 268 | Ga0105247_10023886 | 3300009101 | Bacteria | 3683 |
| 269 | Ga0105247_10131208 | 3300009101 | Bacteria | 1633 |
| 270 | Ga0105247_10142907 | 3300009101 | Bacteria | 1570 |
| 271 | Ga0105247_10167541 | 3300009101 | Bacteria | 1459 |
| 272 | Ga0105247_10275874 | 3300009101 | Bacteria | 1158 |
| 273 | Ga0105247_10413079 | 3300009101 | Bacteria | 964 |
| 274 | Ga0114129_11026378 | 3300009147 | Bacteria | 1037 |
| 275 | Ga0105243_10121232 | 3300009148 | Bacteria | 2205 |
| 276 | Ga0105243_11260329 | 3300009148 | Bacteria | 755 |
| 277 | Ga0105241_10127058 | 3300009174 | Bacteria | 2060 |
| 278 | Ga0105241_11041033 | 3300009174 | Bacteria | 768 |
| 279 | Ga0105241_11076802 | 3300009174 | Bacteria | 756 |
| 280 | Ga0105242_10129766 | 3300009176 | Bacteria | 2174 |
| 281 | Ga0105242_10215683 | 3300009176 | Bacteria | 1712 |
| 282 | Ga0105242_11013291 | 3300009176 | Bacteria | 839 |
| 283 | Ga0105242_11025958 | 3300009176 | Bacteria | 834 |
| 284 | Ga0105248_10041030 | 3300009177 | Bacteria | 5189 |
| 285 | Ga0105248_10220918 | 3300009177 | Bacteria | 2133 |
| 286 | Ga0105248_10342081 | 3300009177 | Bacteria | 1684 |
| 287 | Ga0105248_10392667 | 3300009177 | Bacteria | 1562 |
| 288 | Ga0105248_11057603 | 3300009177 | Bacteria | 917 |
| 289 | Ga0105237_10069275 | 3300009545 | Bacteria | 3523 |
| 290 | Ga0105237_10142859 | 3300009545 | Bacteria | 2388 |
| 291 | Ga0105237_10400005 | 3300009545 | Bacteria | 1378 |
| 292 | Ga0105237_10443980 | 3300009545 | Bacteria | 1303 |
| 293 | Ga0105237_10531032 | 3300009545 | Bacteria | 1183 |
| 294 | Ga0105237_10907925 | 3300009545 | Bacteria | 888 |
| 295 | Ga0105237_10970004 | 3300009545 | Bacteria | 857 |
| 296 | Ga0105237_11191088 | 3300009545 | Bacteria | 768 |
| 297 | Ga0105238_10194243 | 3300009551 | Bacteria | 2005 |
| 298 | Ga0105238_10215852 | 3300009551 | Bacteria | 1894 |
| 299 | Ga0105238_10538750 | 3300009551 | Bacteria | 1171 |
| 300 | Ga0105238_10563306 | 3300009551 | Bacteria | 1145 |
| 301 | Ga0105238_10583601 | 3300009551 | Bacteria | 1124 |
| 302 | Ga0105238_11456335 | 3300009551 | Bacteria | 713 |
| 303 | Ga0105249_10059548 | 3300009553 | Bacteria | 3502 |
| 304 | Ga0105249_10149581 | 3300009553 | Bacteria | 2247 |
| 305 | Ga0105249_10432199 | 3300009553 | Bacteria | 1352 |
| 306 | Ga0105249_11609445 | 3300009553 | Bacteria | 722 |
| 307 | Ga0099796_10006414 | 3300010159 | Bacteria | 3008 |
| 308 | Ga0099796_10015670 | 3300010159 | Bacteria | 2220 |
| 309 | Ga0099796_10141877 | 3300010159 | Bacteria | 939 |
| 310 | Ga0105239_10066302 | 3300010375 | Bacteria | 3966 |
| 311 | Ga0105239_10246790 | 3300010375 | Bacteria | 2005 |
| 312 | Ga0105239_10280959 | 3300010375 | Bacteria | 1874 |
| 313 | Ga0105239_10343708 | 3300010375 | Bacteria | 1684 |
| 314 | Ga0105239_10495695 | 3300010375 | Bacteria | 1389 |
| 315 | Ga0105239_10509286 | 3300010375 | Bacteria | 1369 |
| 316 | Ga0105239_10572339 | 3300010375 | Bacteria | 1287 |
| 317 | Ga0105239_10996996 | 3300010375 | Bacteria | 963 |
| 318 | Ga0105246_10040758 | 3300011119 | Bacteria | 3136 |
| 319 | Ga0105246_10239352 | 3300011119 | Bacteria | 1434 |
| 320 | Ga0105246_10374335 | 3300011119 | Bacteria | 1175 |
| 321 | Ga0157370_10074997 | 3300013104 | Bacteria | 3190 |
| 322 | Ga0157370_10222534 | 3300013104 | Bacteria | 1748 |
| 323 | Ga0157369_10030438 | 3300013105 | Bacteria | 5952 |
| 324 | Ga0157374_10255525 | 3300013296 | Bacteria | 1725 |
| 325 | Ga0157374_10270162 | 3300013296 | Bacteria | 1676 |
| 326 | Ga0157374_10838057 | 3300013296 | Bacteria | 936 |
| 327 | Ga0157378_10020915 | 3300013297 | Bacteria | 5757 |
| 328 | Ga0157378_10070174 | 3300013297 | Bacteria | 3145 |
| 329 | Ga0157378_10233186 | 3300013297 | Bacteria | 1755 |
| 330 | Ga0157378_10444310 | 3300013297 | Bacteria | 1286 |
| 331 | Ga0157378_10466163 | 3300013297 | Bacteria | 1256 |
| 332 | Ga0157378_10714024 | 3300013297 | Bacteria | 1023 |
| 333 | Ga0163162_10211259 | 3300013306 | Bacteria | 2070 |
| 334 | Ga0163162_10413485 | 3300013306 | Bacteria | 1481 |
| 335 | Ga0163162_10413874 | 3300013306 | Bacteria | 1480 |
| 336 | Ga0163162_10743862 | 3300013306 | Bacteria | 1100 |
| 337 | Ga0163162_10824995 | 3300013306 | Bacteria | 1044 |
| 338 | Ga0157372_10718860 | 3300013307 | Bacteria | 1162 |
| 339 | Ga0157375_10217414 | 3300013308 | Bacteria | 2069 |
| 340 | Ga0157375_10783766 | 3300013308 | Bacteria | 1103 |
| 341 | Ga0157375_11007278 | 3300013308 | Bacteria | 973 |
| 342 | Ga0157375_11227028 | 3300013308 | Bacteria | 880 |
| 343 | Ga0163163_10028423 | 3300014325 | Bacteria | 5369 |
| 344 | Ga0163163_10133712 | 3300014325 | Bacteria | 2521 |
| 345 | Ga0163163_10690854 | 3300014325 | Bacteria | 1084 |
| 346 | Ga0163163_10899950 | 3300014325 | Bacteria | 948 |
| 347 | Ga0163163_11046276 | 3300014325 | Bacteria | 879 |
| 348 | Ga0157380_10114201 | 3300014326 | Bacteria | 2275 |
| 349 | Ga0157380_10239624 | 3300014326 | Bacteria | 1634 |
| 350 | Ga0157380_10873498 | 3300014326 | Bacteria | 923 |
| 351 | Ga0157380_11253403 | 3300014326 | Bacteria | 787 |
| 352 | Ga0157377_10207455 | 3300014745 | Bacteria | 1248 |
| 353 | Ga0157377_10295538 | 3300014745 | Bacteria | 1067 |
| 354 | Ga0157379_10289247 | 3300014968 | Bacteria | 1492 |
| 355 | Ga0157379_10381779 | 3300014968 | Bacteria | 1293 |
| 356 | Ga0157379_10707919 | 3300014968 | Bacteria | 946 |
| 357 | Ga0157376_10163532 | 3300014969 | Bacteria | 2020 |
| 358 | Ga0157376_10166023 | 3300014969 | Bacteria | 2006 |
| 359 | Ga0157376_11292722 | 3300014969 | Bacteria | 759 |
| 360 | Ga0163161_10072163 | 3300017792 | Bacteria | 2528 |
| 361 | Ga0163161_10265581 | 3300017792 | Bacteria | 1342 |
| 362 | Ga0206353_11400766 | 3300020082 | Bacteria | 1120 |
| 363 | Ga0213876_10249333 | 3300021384 | Bacteria | 943 |
| 364 | Ga0213875_10243397 | 3300021388 | Bacteria | 848 |
| 365 | Ga0213875_10395076 | 3300021388 | Bacteria | 659 |
| 366 | Ga0209563_105793 | 3300025230 | Bacteria | 2196 |
| 367 | Ga0209677_105710 | 3300025253 | Bacteria | 3168 |
| 368 | Ga0209148_1000295 | 3300025254 | Bacteria | 73660 |
| 369 | Ga0209233_1003058 | 3300025261 | Bacteria | 5951 |
| 370 | Ga0209233_1055178 | 3300025261 | Bacteria | 790 |
| 371 | Ga0209233_1060958 | 3300025261 | Bacteria | 728 |
| 372 | Ga0209455_1008110 | 3300025272 | Bacteria | 2887 |
| 373 | Ga0209455_1021718 | 3300025272 | Bacteria | 1239 |
| 374 | Ga0209673_1032099 | 3300025273 | Bacteria | 1622 |
| 375 | Ga0209564_1007238 | 3300025295 | Bacteria | 5772 |
| 376 | Ga0209564_1015758 | 3300025295 | Bacteria | 3055 |
| 377 | Ga0209758_1000069 | 3300025297 | Bacteria | 286161 |
| 378 | Ga0209758_1001816 | 3300025297 | Bacteria | 23562 |
| 379 | Ga0209758_1002809 | 3300025297 | Bacteria | 16970 |
| 380 | Ga0209758_1003717 | 3300025297 | Bacteria | 13525 |
| 381 | Ga0209758_1006696 | 3300025297 | Bacteria | 8127 |
| 382 | Ga0209758_1007298 | 3300025297 | Bacteria | 7579 |
| 383 | Ga0209758_1039944 | 3300025297 | Bacteria | 1776 |
| 384 | Ga0209758_1041471 | 3300025297 | Bacteria | 1720 |
| 385 | Ga0209758_1053011 | 3300025297 | Bacteria | 1397 |
| 386 | Ga0209758_1057118 | 3300025297 | Bacteria | 1314 |
| 387 | Ga0209758_1102552 | 3300025297 | Bacteria | 810 |
| 388 | Ga0209758_1119004 | 3300025297 | Bacteria | 716 |
| 389 | Ga0209050_1074670 | 3300025298 | Bacteria | 743 |
| 390 | Ga0209256_1005844 | 3300025299 | Bacteria | 6836 |
| 391 | Ga0209256_1016629 | 3300025299 | Bacteria | 2494 |
| 392 | Ga0209256_1034701 | 3300025299 | Bacteria | 1339 |
| 393 | Ga0209256_1056171 | 3300025299 | Bacteria | 932 |
| 394 | Ga0207426_1001802 | 3300025302 | Bacteria | 15949 |
| 395 | Ga0207426_1004864 | 3300025302 | Bacteria | 6361 |
| 396 | Ga0207426_1027673 | 3300025302 | Bacteria | 1886 |
| 397 | Ga0209257_1004375 | 3300025304 | Bacteria | 10990 |
| 398 | Ga0209257_1020602 | 3300025304 | Bacteria | 2429 |
| 399 | Ga0207697_10087462 | 3300025315 | Bacteria | 1318 |
| 400 | Ga0207697_10474344 | 3300025315 | Bacteria | 554 |
| 401 | Ga0207656_10081557 | 3300025321 | Bacteria | 1455 |
| 402 | Ga0207692_10000528 | 3300025898 | Bacteria | 13562 |
| 403 | Ga0207692_10142642 | 3300025898 | Bacteria | 1364 |
| 404 | Ga0207642_10336808 | 3300025899 | Bacteria | 886 |
| 405 | Ga0207710_10062593 | 3300025900 | Bacteria | 1691 |
| 406 | Ga0207710_10077845 | 3300025900 | Bacteria | 1533 |
| 407 | Ga0207688_10148840 | 3300025901 | Bacteria | 1382 |
| 408 | Ga0207688_10205271 | 3300025901 | Bacteria | 1183 |
| 409 | Ga0207647_10009168 | 3300025904 | Bacteria | 7040 |
| 410 | Ga0207647_10138451 | 3300025904 | Bacteria | 1427 |
| 411 | Ga0207685_10017070 | 3300025905 | Bacteria | 2337 |
| 412 | Ga0207685_10116154 | 3300025905 | Bacteria | 1167 |
| 413 | Ga0207699_10000514 | 3300025906 | Bacteria | 19239 |
| 414 | Ga0207645_10082783 | 3300025907 | Bacteria | 2057 |
| 415 | Ga0207645_10214197 | 3300025907 | Bacteria | 1269 |
| 416 | Ga0207643_10047401 | 3300025908 | Bacteria | 2431 |
| 417 | Ga0207643_10214645 | 3300025908 | Bacteria | 1176 |
| 418 | Ga0207643_10274946 | 3300025908 | Bacteria | 1043 |
| 419 | Ga0207705_10164146 | 3300025909 | Bacteria | 1670 |
| 420 | Ga0207705_10175451 | 3300025909 | Bacteria | 1615 |
| 421 | Ga0207705_10698945 | 3300025909 | Bacteria | 788 |
| 422 | Ga0207684_10642969 | 3300025910 | Bacteria | 904 |
| 423 | Ga0207654_10024270 | 3300025911 | Bacteria | 3258 |
| 424 | Ga0207654_10411346 | 3300025911 | Bacteria | 942 |
| 425 | Ga0207654_10795968 | 3300025911 | Bacteria | 683 |
| 426 | Ga0207695_10320248 | 3300025913 | Bacteria | 1440 |
| 427 | Ga0207695_10341970 | 3300025913 | Bacteria | 1384 |
| 428 | Ga0207695_10370168 | 3300025913 | Bacteria | 1319 |
| 429 | Ga0207671_10038928 | 3300025914 | Bacteria | 3523 |
| 430 | Ga0207671_10327691 | 3300025914 | Bacteria | 1212 |
| 431 | Ga0207671_10480717 | 3300025914 | Bacteria | 990 |
| 432 | Ga0207671_10532225 | 3300025914 | Bacteria | 937 |
| 433 | Ga0207671_10573074 | 3300025914 | Bacteria | 900 |
| 434 | Ga0207693_10008295 | 3300025915 | Bacteria | 8507 |
| 435 | Ga0207693_10011107 | 3300025915 | Bacteria | 7295 |
| 436 | Ga0207693_10077119 | 3300025915 | Bacteria | 2610 |
| 437 | Ga0207693_10337439 | 3300025915 | Bacteria | 1180 |
| 438 | Ga0207693_10788662 | 3300025915 | Bacteria | 733 |
| 439 | Ga0207663_10171760 | 3300025916 | Bacteria | 1540 |
| 440 | Ga0207657_10209041 | 3300025919 | Bacteria | 1567 |
| 441 | Ga0207657_10464155 | 3300025919 | Bacteria | 993 |
| 442 | Ga0207657_10493126 | 3300025919 | Bacteria | 960 |
| 443 | Ga0207649_10267205 | 3300025920 | Bacteria | 1238 |
| 444 | Ga0207649_10617338 | 3300025920 | Bacteria | 835 |
| 445 | Ga0207646_10105273 | 3300025922 | Bacteria | 2530 |
| 446 | Ga0207681_10070638 | 3300025923 | Bacteria | 2432 |
| 447 | Ga0207681_10827855 | 3300025923 | Bacteria | 774 |
| 448 | Ga0207694_10199050 | 3300025924 | Bacteria | 1629 |
| 449 | Ga0207694_10410858 | 3300025924 | Bacteria | 1126 |
| 450 | Ga0207694_10777121 | 3300025924 | Bacteria | 809 |
| 451 | Ga0207694_10946197 | 3300025924 | Bacteria | 729 |
| 452 | Ga0207650_10651439 | 3300025925 | Bacteria | 888 |
| 453 | Ga0207650_11376228 | 3300025925 | Bacteria | 600 |
| 454 | Ga0207659_10281115 | 3300025926 | Bacteria | 1361 |
| 455 | Ga0207659_10407214 | 3300025926 | Bacteria | 1139 |
| 456 | Ga0207687_10022504 | 3300025927 | Bacteria | 4195 |
| 457 | Ga0207687_10710600 | 3300025927 | Bacteria | 853 |
| 458 | Ga0207700_10004601 | 3300025928 | Bacteria | 8166 |
| 459 | Ga0207700_10046786 | 3300025928 | Bacteria | 3202 |
| 460 | Ga0207700_10157523 | 3300025928 | Bacteria | 1883 |
| 461 | Ga0207700_10253220 | 3300025928 | Bacteria | 1505 |
| 462 | Ga0207664_10040008 | 3300025929 | Bacteria | 3642 |
| 463 | Ga0207664_10172365 | 3300025929 | Bacteria | 1853 |
| 464 | Ga0207644_10224481 | 3300025931 | Bacteria | 1490 |
| 465 | Ga0207644_10396134 | 3300025931 | Bacteria | 1128 |
| 466 | Ga0207644_10579870 | 3300025931 | Bacteria | 930 |
| 467 | Ga0207690_10146061 | 3300025932 | Bacteria | 1749 |
| 468 | Ga0207690_10504883 | 3300025932 | Bacteria | 978 |
| 469 | Ga0207690_10716679 | 3300025932 | Bacteria | 823 |
| 470 | Ga0207706_10291959 | 3300025933 | Bacteria | 1421 |
| 471 | Ga0207706_10298695 | 3300025933 | Bacteria | 1403 |
| 472 | Ga0207706_10510052 | 3300025933 | Bacteria | 1038 |
| 473 | Ga0207706_10798769 | 3300025933 | Bacteria | 802 |
| 474 | Ga0207686_10215785 | 3300025934 | Bacteria | 1382 |
| 475 | Ga0207686_10338281 | 3300025934 | Bacteria | 1130 |
| 476 | Ga0207686_10468151 | 3300025934 | Bacteria | 972 |
| 477 | Ga0207686_10668772 | 3300025934 | Bacteria | 823 |
| 478 | Ga0207709_10085394 | 3300025935 | Bacteria | 2046 |
| 479 | Ga0207709_10396460 | 3300025935 | Bacteria | 1054 |
| 480 | Ga0207670_10411581 | 3300025936 | Bacteria | 1083 |
| 481 | Ga0207669_10060896 | 3300025937 | Bacteria | 2316 |
| 482 | Ga0207669_10149698 | 3300025937 | Bacteria | 1633 |
| 483 | Ga0207669_10352590 | 3300025937 | Bacteria | 1137 |
| 484 | Ga0207669_10577417 | 3300025937 | Bacteria | 911 |
| 485 | Ga0207704_10293428 | 3300025938 | Bacteria | 1242 |
| 486 | Ga0207704_10421295 | 3300025938 | Bacteria | 1059 |
| 487 | Ga0207665_10406552 | 3300025939 | Bacteria | 1038 |
| 488 | Ga0207691_10045505 | 3300025940 | Bacteria | 4033 |
| 489 | Ga0207691_10094759 | 3300025940 | Bacteria | 2671 |
| 490 | Ga0207691_10375552 | 3300025940 | Bacteria | 1214 |
| 491 | Ga0207711_10068416 | 3300025941 | Bacteria | 3075 |
| 492 | Ga0207711_10236862 | 3300025941 | Bacteria | 1673 |
| 493 | Ga0207711_10589281 | 3300025941 | Bacteria | 1037 |
| 494 | Ga0207689_10012963 | 3300025942 | Bacteria | 7118 |
| 495 | Ga0207689_10143353 | 3300025942 | Bacteria | 1968 |
| 496 | Ga0207689_10213806 | 3300025942 | Bacteria | 1593 |
| 497 | Ga0207679_10386125 | 3300025945 | Bacteria | 1229 |
| 498 | Ga0207679_10962248 | 3300025945 | Bacteria | 782 |
| 499 | Ga0207667_10289550 | 3300025949 | Bacteria | 1673 |
| 500 | Ga0207667_11148259 | 3300025949 | Bacteria | 758 |
| 501 | Ga0207712_10040689 | 3300025961 | Bacteria | 3192 |
| 502 | Ga0207712_10624128 | 3300025961 | Bacteria | 935 |
| 503 | Ga0207668_10048924 | 3300025972 | Bacteria | 2903 |
| 504 | Ga0207668_10160677 | 3300025972 | Bacteria | 1750 |
| 505 | Ga0207668_10225530 | 3300025972 | Bacteria | 1507 |
| 506 | Ga0207668_10301972 | 3300025972 | Bacteria | 1321 |
| 507 | Ga0207668_10510058 | 3300025972 | Bacteria | 1036 |
| 508 | Ga0207668_10756753 | 3300025972 | Bacteria | 857 |
| 509 | Ga0207640_10284234 | 3300025981 | Bacteria | 1301 |
| 510 | Ga0207640_10525771 | 3300025981 | Bacteria | 989 |
| 511 | Ga0207658_10066181 | 3300025986 | Bacteria | 2717 |
| 512 | Ga0207658_10138311 | 3300025986 | Bacteria | 1967 |
| 513 | Ga0207658_10229032 | 3300025986 | Bacteria | 1568 |
| 514 | Ga0207677_10232224 | 3300026023 | Bacteria | 1487 |
| 515 | Ga0207677_10247489 | 3300026023 | Bacteria | 1446 |
| 516 | Ga0207677_11152790 | 3300026023 | Bacteria | 708 |
| 517 | Ga0207703_10333753 | 3300026035 | Bacteria | 1392 |
| 518 | Ga0207703_11350834 | 3300026035 | Bacteria | 685 |
| 519 | Ga0207639_10181545 | 3300026041 | Bacteria | 1790 |
| 520 | Ga0207639_10284713 | 3300026041 | Bacteria | 1455 |
| 521 | Ga0207639_10516100 | 3300026041 | Bacteria | 1094 |
| 522 | Ga0207678_10016938 | 3300026067 | Bacteria | 6400 |
| 523 | Ga0207678_10097135 | 3300026067 | Bacteria | 2517 |
| 524 | Ga0207678_10105038 | 3300026067 | Bacteria | 2410 |
| 525 | Ga0207678_10110740 | 3300026067 | Bacteria | 2342 |
| 526 | Ga0207678_10121192 | 3300026067 | Bacteria | 2232 |
| 527 | Ga0207678_10543179 | 3300026067 | Bacteria | 1016 |
| 528 | Ga0207678_10873472 | 3300026067 | Bacteria | 795 |
| 529 | Ga0207678_10893466 | 3300026067 | Bacteria | 786 |
| 530 | Ga0207678_10975680 | 3300026067 | Bacteria | 750 |
| 531 | Ga0207708_10216595 | 3300026075 | Bacteria | 1532 |
| 532 | Ga0207702_10306634 | 3300026078 | Bacteria | 1508 |
| 533 | Ga0207702_10314000 | 3300026078 | Bacteria | 1491 |
| 534 | Ga0207702_11714122 | 3300026078 | Bacteria | 621 |
| 535 | Ga0207641_10518813 | 3300026088 | Bacteria | 1159 |
| 536 | Ga0207641_10586085 | 3300026088 | Bacteria | 1090 |
| 537 | Ga0207641_11322477 | 3300026088 | Bacteria | 721 |
| 538 | Ga0207648_10171204 | 3300026089 | Bacteria | 1919 |
| 539 | Ga0207648_11101054 | 3300026089 | Bacteria | 745 |
| 540 | Ga0207676_10261998 | 3300026095 | Bacteria | 1561 |
| 541 | Ga0207676_10289778 | 3300026095 | Bacteria | 1490 |
| 542 | Ga0207676_10657127 | 3300026095 | Bacteria | 1012 |
| 543 | Ga0207674_10307071 | 3300026116 | Bacteria | 1535 |
| 544 | Ga0207675_100124474 | 3300026118 | Bacteria | 2441 |
| 545 | Ga0207675_100326301 | 3300026118 | Bacteria | 1499 |
| 546 | Ga0207675_100332410 | 3300026118 | Bacteria | 1486 |
| 547 | Ga0207675_100600992 | 3300026118 | Bacteria | 1103 |
| 548 | Ga0207675_100928190 | 3300026118 | Bacteria | 887 |
| 549 | Ga0207683_10115817 | 3300026121 | Bacteria | 2402 |
| 550 | Ga0207683_10167729 | 3300026121 | Bacteria | 1987 |
| 551 | Ga0207683_10173569 | 3300026121 | Bacteria | 1953 |
| 552 | Ga0207683_10466989 | 3300026121 | Bacteria | 1164 |
| 553 | Ga0207698_10302685 | 3300026142 | Bacteria | 1489 |
| 554 | Ga0207698_10724072 | 3300026142 | Bacteria | 992 |
| 555 | Ga0209389_1000102 | 3300027296 | Bacteria | 78475 |
| 556 | Ga0209389_1000142 | 3300027296 | Bacteria | 62072 |
| 557 | Ga0209589_1000331 | 3300027357 | Bacteria | 62072 |
| 558 | Ga0209489_100404 | 3300027361 | Bacteria | 78473 |
| 559 | Ga0209489_100818 | 3300027361 | Bacteria | 62070 |
| 560 | Ga0209700_100408 | 3300027363 | Bacteria | 78496 |
| 561 | Ga0209179_1111495 | 3300027512 | Bacteria | 610 |
| 562 | Ga0209588_1051525 | 3300027671 | Bacteria | 1331 |
| 563 | Ga0209588_1176845 | 3300027671 | Bacteria | 670 |
| 564 | Ga0209813_10008392 | 3300027866 | Bacteria | 2609 |
| 565 | Ga0209813_10010724 | 3300027866 | Bacteria | 2378 |
| 566 | Ga0207428_10223601 | 3300027907 | Bacteria | 1410 |
| 567 | Ga0268266_10008616 | 3300028379 | Bacteria | 9058 |
| 568 | Ga0268266_10028293 | 3300028379 | Bacteria | 4764 |
| 569 | Ga0268266_10048797 | 3300028379 | Bacteria | 3629 |
| 570 | Ga0268266_10399636 | 3300028379 | Bacteria | 1299 |
| 571 | Ga0268266_11523558 | 3300028379 | Bacteria | 644 |
| 572 | Ga0268265_10014031 | 3300028380 | Bacteria | 5457 |
| 573 | Ga0268265_10102999 | 3300028380 | Bacteria | 2310 |
| 574 | Ga0268265_10183395 | 3300028380 | Bacteria | 1800 |
| 575 | Ga0268265_10474181 | 3300028380 | Bacteria | 1174 |
| 576 | Ga0268265_10480658 | 3300028380 | Bacteria | 1166 |
| 577 | Ga0268265_10569855 | 3300028380 | Bacteria | 1077 |
| 578 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 579 | Ga0268264_10050935 | 3300028381 | Bacteria | 3449 |
| 580 | Ga0268264_11297118 | 3300028381 | Bacteria | 738 |
| 581 | Ga0268264_11324678 | 3300028381 | Bacteria | 730 |
| 582 | Ga0265319_1030726 | 3300028563 | Bacteria | 1875 |
| 583 | Ga0265334_10005800 | 3300028573 | Bacteria | 5380 |
| 584 | Ga0265318_10012602 | 3300028577 | Bacteria | 3592 |
| 585 | Ga0265323_10002871 | 3300028653 | Bacteria | 7739 |
| 586 | Ga0265322_10049751 | 3300028654 | Bacteria | 1190 |
| 587 | Ga0265336_10002816 | 3300028666 | Bacteria | 7027 |
| 588 | Ga0307517_10000232 | 3300028786 | Bacteria | 94332 |
| 589 | Ga0307517_10328450 | 3300028786 | Bacteria | 842 |
| 590 | Ga0307515_10050080 | 3300028794 | Bacteria | 6264 |
| 591 | Ga0265338_10000422 | 3300028800 | Bacteria | 75820 |
| 592 | Ga0307511_10137689 | 3300030521 | Bacteria | 1447 |
| 593 | Ga0265760_10026912 | 3300031090 | Bacteria | 1684 |
| 594 | Ga0307513_10189662 | 3300031456 | Bacteria | 1909 |
| 595 | Ga0307513_10358722 | 3300031456 | Bacteria | 1203 |
| 596 | Ga0307509_10844940 | 3300031507 | Bacteria | 580 |
| 597 | Ga0307408_100107648 | 3300031548 | Bacteria | 2135 |
| 598 | Ga0307408_100520348 | 3300031548 | Bacteria | 1045 |
| 599 | Ga0307408_101142355 | 3300031548 | Bacteria | 724 |
| 600 | Ga0307508_10039596 | 3300031616 | Bacteria | 4233 |
| 601 | Ga0307508_10117670 | 3300031616 | Bacteria | 2258 |
| 602 | Ga0307508_10553899 | 3300031616 | Bacteria | 748 |
| 603 | Ga0307516_10078366 | 3300031730 | Bacteria | 3151 |
| 604 | Ga0307516_10078911 | 3300031730 | Bacteria | 3137 |
| 605 | Ga0307516_10107836 | 3300031730 | Bacteria | 2593 |
| 606 | Ga0307516_10186022 | 3300031730 | Bacteria | 1807 |
| 607 | Ga0307516_10238958 | 3300031730 | Bacteria | 1516 |
| 608 | Ga0307516_10445321 | 3300031730 | Bacteria | 952 |
| 609 | Ga0307413_10046715 | 3300031824 | Bacteria | 2577 |
| 610 | Ga0307413_10189102 | 3300031824 | Bacteria | 1476 |
| 611 | Ga0307410_10467545 | 3300031852 | Bacteria | 1032 |
| 612 | Ga0307406_10138092 | 3300031901 | Bacteria | 1721 |
| 613 | Ga0307406_10225754 | 3300031901 | Bacteria | 1395 |
| 614 | Ga0307406_10268796 | 3300031901 | Bacteria | 1294 |
| 615 | Ga0307407_10396216 | 3300031903 | Bacteria | 989 |
| 616 | Ga0307412_10209929 | 3300031911 | Bacteria | 1485 |
| 617 | Ga0307409_100739361 | 3300031995 | Bacteria | 986 |
| 618 | Ga0307416_100123117 | 3300032002 | Bacteria | 2317 |
| 619 | Ga0307416_100248362 | 3300032002 | Bacteria | 1730 |
| 620 | Ga0307416_100349319 | 3300032002 | Bacteria | 1496 |
| 621 | Ga0307411_10110047 | 3300032005 | Bacteria | 1969 |
| 622 | Ga0307415_100050805 | 3300032126 | Bacteria | 2811 |
| 623 | Ga0307415_100233049 | 3300032126 | Bacteria | 1484 |
| 624 | Ga0307507_10063749 | 3300033179 | Bacteria | 3408 |
| 625 | Ga0307510_10005192 | 3300033180 | Bacteria | 15482 |
| 626 | Ga0307510_10036976 | 3300033180 | Bacteria | 5426 |
| 627 | Ga0373926_0011112 | 3300035083 | Bacteria | 3026 |
| 628 | Ga0373926_0024481 | 3300035083 | Bacteria | 2103 |
| 629 | Ga0373934_0059329 | 3300035086 | Bacteria | 1523 |
| 630 | Ga0373951_0017931 | 3300035091 | Bacteria | 1605 |
| 631 | Ga0373923_0122663 | 3300035111 | Bacteria | 1162 |
| 632 | Ga0373923_0180281 | 3300035111 | Bacteria | 970 |
| 633 | Ga0373932_0318529 | 3300035112 | Bacteria | 584 |
| 634 | Ga0373936_0007829 | 3300035113 | Bacteria | 4014 |
| 635 | Ga0373936_0168922 | 3300035113 | Bacteria | 956 |
| 636 | Ga0373945_0033750 | 3300035116 | Bacteria | 1821 |
| 637 | Ga0373953_0007669 | 3300035117 | Bacteria | 3625 |
| 638 | Ga0373954_0011714 | 3300035118 | Bacteria | 3890 |
| 639 | Ga0373954_0044076 | 3300035118 | Bacteria | 2081 |
| 640 | Ga0373956_0019947 | 3300035119 | Bacteria | 2847 |
| 641 | Ga0373957_0005744 | 3300035120 | Bacteria | 3866 |
| 642 | Ga0373960_0280982 | 3300035121 | Bacteria | 613 |
| 643 | Ga0373943_0003229 | 3300035170 | Bacteria | 7401 |
| 644 | Ga0373943_0111820 | 3300035170 | Bacteria | 1442 |
| 645 | Ga0373946_0007257 | 3300035171 | Bacteria | 4047 |
| 646 | Ga0373946_0102886 | 3300035171 | Bacteria | 1283 |
| 647 | Ga0373955_0011290 | 3300035172 | Bacteria | 4250 |
| 648 | Ga0373955_0070950 | 3300035172 | Bacteria | 1947 |
| 649 | Ga0373942_0256780 | 3300035207 | Bacteria | 596 |
| 650 | Ga0373924_0002441 | 3300035410 | Bacteria | 6254 |
| 651 | Ga0373924_0427177 | 3300035410 | Bacteria | 593 |
| 652 | Ga0373931_0090396 | 3300035691 | Bacteria | 1705 |
| 653 | Ga0373931_0368580 | 3300035691 | Bacteria | 903 |
| 654 | Ga0373935_0004301 | 3300035692 | Bacteria | 8357 |
| 655 | Ga0373935_0139374 | 3300035692 | Bacteria | 1637 |
| 656 | Ga0373927_0000766 | 3300035695 | Bacteria | 24573 |
| 657 | Ga0373927_0002321 | 3300035695 | Bacteria | 13895 |
| 658 | Ga0373927_0016726 | 3300035695 | Bacteria | 4838 |
| 659 | Ga0373933_0052367 | 3300035724 | Bacteria | 2442 |
| 660 | Ga0373933_0095429 | 3300035724 | Bacteria | 1840 |
| 661 | Ga0373947_0000310 | 3300035725 | Bacteria | 27577 |
| 662 | Ga0373947_0021132 | 3300035725 | Bacteria | 3766 |
| 663 | Ga0373947_0026772 | 3300035725 | Bacteria | 3372 |
| 664 | Ga0373937_1289280 | 3300036401 | Bacteria | 678 |
| 665 | Ga0373925_0008418 | 3300037068 | Bacteria | 7511 |
| 666 | Ga0373925_0016057 | 3300037068 | Bacteria | 5421 |
| 667 | Ga0373925_0044131 | 3300037068 | Bacteria | 3310 |
| 668 | Ga0373925_1330677 | 3300037068 | Bacteria | 589 |
| 669 | Ga0395900_0000423 | 3300037418 | Bacteria | 60773 |
| 670 | Ga0395898_0010460 | 3300037466 | Bacteria | 9699 |
| 671 | Ga0395905_0092357 | 3300037471 | Bacteria | 2838 |
| 672 | Ga0395905_0268368 | 3300037471 | Bacteria | 1592 |
| 673 | Ga0395905_0277344 | 3300037471 | Bacteria | 1562 |
| 674 | Ga0395905_1009238 | 3300037471 | Bacteria | 735 |
| 675 | Ga0395905_1089476 | 3300037471 | Bacteria | 702 |
| 676 | Ga0395905_1184253 | 3300037471 | Bacteria | 668 |
| 677 | Ga0436364_0628911 | 3300037853 | Bacteria | 4501 |
| 678 | Ga0436364_0760368 | 3300037853 | Bacteria | 1055 |
| 679 | Ga0436364_0953579 | 3300037853 | Bacteria | 865 |
| 680 | Ga0436364_1117557 | 3300037853 | Bacteria | 1638 |
| 681 | Ga0436364_1523184 | 3300037853 | Bacteria | 1178 |
| 682 | Ga0395901_0101076 | 3300038443 | Bacteria | 3026 |
| 683 | Ga0436365_0285466 | 3300039437 | Bacteria | 1462 |
| 684 | Ga0436365_1227774 | 3300039437 | Bacteria | 2955 |
| 685 | Ga0436365_1254305 | 3300039437 | Bacteria | 4008 |
| 686 | Ga0436365_1567631 | 3300039437 | Bacteria | 595 |
| 687 | Ga0436363_1561683 | 3300039450 | Bacteria | 713 |
| 688 | Ga0451791_0396477 | 3300041451 | Bacteria | 758 |
| 689 | Ga0451791_0424813 | 3300041451 | Bacteria | 853 |
| 690 | Ga0451793_1501710 | 3300041452 | Bacteria | 759 |
| 691 | Ga0451797_0957375 | 3300041453 | Bacteria | 1132 |
| 692 | Ga0451802_1930506 | 3300041460 | Bacteria | 1286 |
| 693 | Ga0451804_0020778 | 3300041463 | Bacteria | 698 |
| 694 | Ga0451835_0562890 | 3300041492 | Bacteria | 804 |
| 695 | Ga0451841_1340266 | 3300041498 | Bacteria | 1494 |
| 696 | Ga0451849_0890308 | 3300041505 | Bacteria | 918 |
| 697 | Ga0451851_1013094 | 3300041507 | Bacteria | 662 |
| 698 | Ga0451855_0310176 | 3300041511 | Bacteria | 700 |
| 699 | Ga0451853_0527059 | 3300041512 | Bacteria | 1060 |
| 700 | Ga0439448_0193791 | 3300042005 | Bacteria | 712 |
| 701 | Ga0439458_0185223 | 3300042157 | Bacteria | 566 |
| 702 | Ga0439459_0006680 | 3300042438 | Bacteria | 1930 |
| 703 | Ga0439459_0034763 | 3300042438 | Bacteria | 1044 |
| 704 | Ga0466972_0047042 | 3300044658 | Bacteria | 2087 |
| 705 | Ga0466972_0125356 | 3300044658 | Bacteria | 1210 |
| 706 | Ga0466965_0208416 | 3300044683 | Bacteria | 1039 |
| 707 | Ga0466966_0000628 | 3300044684 | Bacteria | 22447 |
| 708 | Ga0466961_0002516 | 3300044693 | Bacteria | 11373 |
| 709 | Ga0466968_0139422 | 3300044735 | Bacteria | 1108 |
| 710 | Ga0466968_0298774 | 3300044735 | Bacteria | 774 |
| 711 | Ga0466970_0047275 | 3300044765 | Bacteria | 2293 |
| 712 | Ga0466960_0073114 | 3300044901 | Bacteria | 1710 |
| 713 | Ga0466960_0485017 | 3300044901 | Bacteria | 722 |
| 714 | Ga0466959_0033457 | 3300045049 | Bacteria | 3801 |
| 715 | Ga0466967_0241336 | 3300045976 | Bacteria | 1724 |
| 716 | Ga0495617_035848 | 3300046452 | Bacteria | 1665 |
| 717 | Ga0495617_040028 | 3300046452 | Bacteria | 1568 |
| 718 | Ga0495617_208192 | 3300046452 | Bacteria | 610 |
| 719 | Ga0495592_0021717 | 3300046454 | Bacteria | 4883 |
| 720 | Ga0495592_0029657 | 3300046454 | Bacteria | 4142 |
| 721 | Ga0495592_0084325 | 3300046454 | Bacteria | 2293 |
| 722 | Ga0495592_0143017 | 3300046454 | Bacteria | 1662 |
| 723 | Ga0495592_0182910 | 3300046454 | Bacteria | 1426 |
| 724 | Ga0495603_0000936 | 3300046455 | Bacteria | 16788 |
| 725 | Ga0495603_0014727 | 3300046455 | Bacteria | 4729 |
| 726 | Ga0495603_0024867 | 3300046455 | Bacteria | 3623 |
| 727 | Ga0495603_0025116 | 3300046455 | Bacteria | 3603 |
| 728 | Ga0495603_0113161 | 3300046455 | Bacteria | 1582 |
| 729 | Ga0495603_0121441 | 3300046455 | Bacteria | 1522 |
| 730 | Ga0495590_0027483 | 3300046457 | Bacteria | 1996 |
| 731 | Ga0495629_0001416 | 3300046459 | Bacteria | 18913 |
| 732 | Ga0495629_0003103 | 3300046459 | Bacteria | 12597 |
| 733 | Ga0495629_0049337 | 3300046459 | Bacteria | 2950 |
| 734 | Ga0495629_0182713 | 3300046459 | Bacteria | 1453 |
| 735 | Ga0495629_0335352 | 3300046459 | Bacteria | 1033 |
| 736 | Ga0495629_0441399 | 3300046459 | Bacteria | 882 |
| 737 | Ga0495638_0068794 | 3300046460 | Bacteria | 2170 |
| 738 | Ga0495638_0215046 | 3300046460 | Bacteria | 1077 |
| 739 | Ga0495641_0005002 | 3300046461 | Bacteria | 9142 |
| 740 | Ga0495641_0033486 | 3300046461 | Bacteria | 2438 |
| 741 | Ga0495651_0008730 | 3300046462 | Bacteria | 7772 |
| 742 | Ga0495651_0041654 | 3300046462 | Bacteria | 3566 |
| 743 | Ga0495651_0110186 | 3300046462 | Bacteria | 2037 |
| 744 | Ga0495651_0328589 | 3300046462 | Bacteria | 1017 |
| 745 | Ga0495653_0028280 | 3300046463 | Bacteria | 4483 |
| 746 | Ga0495653_0050804 | 3300046463 | Bacteria | 3187 |
| 747 | Ga0495653_0058545 | 3300046463 | Bacteria | 2928 |
| 748 | Ga0495650_0090423 | 3300046471 | Bacteria | 1165 |
| 749 | Ga0495580_0002805 | 3300046472 | Bacteria | 14983 |
| 750 | Ga0495580_0062616 | 3300046472 | Bacteria | 2610 |
| 751 | Ga0495580_0236049 | 3300046472 | Bacteria | 1254 |
| 752 | Ga0495582_0000302 | 3300046473 | Bacteria | 27218 |
| 753 | Ga0495605_0050188 | 3300046474 | Bacteria | 2036 |
| 754 | Ga0495605_0103601 | 3300046474 | Bacteria | 1305 |
| 755 | Ga0495639_0000072 | 3300046475 | Bacteria | 46904 |
| 756 | Ga0495662_0001578 | 3300046476 | Bacteria | 11325 |
| 757 | Ga0495662_0095461 | 3300046476 | Bacteria | 1453 |
| 758 | Ga0495664_0015202 | 3300046477 | Bacteria | 4374 |
| 759 | Ga0495664_0044387 | 3300046477 | Bacteria | 2634 |
| 760 | Ga0495664_0045491 | 3300046477 | Bacteria | 2603 |
| 761 | Ga0495664_0137848 | 3300046477 | Bacteria | 1479 |
| 762 | Ga0495584_0129680 | 3300046491 | Bacteria | 1279 |
| 763 | Ga0495584_0131185 | 3300046491 | Bacteria | 1271 |
| 764 | Ga0495584_0307972 | 3300046491 | Bacteria | 804 |
| 765 | Ga0495584_0402809 | 3300046491 | Bacteria | 695 |
| 766 | Ga0495585_0036674 | 3300046492 | Bacteria | 2763 |
| 767 | Ga0495585_0112731 | 3300046492 | Bacteria | 1445 |
| 768 | Ga0495594_0000046 | 3300046499 | Bacteria | 53822 |
| 769 | Ga0495594_0117110 | 3300046499 | Bacteria | 1505 |
| 770 | Ga0495594_0466224 | 3300046499 | Bacteria | 718 |
| 771 | Ga0495596_0035053 | 3300046500 | Bacteria | 1991 |
| 772 | Ga0495596_0077695 | 3300046500 | Bacteria | 1289 |
| 773 | Ga0495607_0106803 | 3300046501 | Bacteria | 1490 |
| 774 | Ga0495583_0060950 | 3300046506 | Bacteria | 1685 |
| 775 | Ga0495583_0322073 | 3300046506 | Bacteria | 612 |
| 776 | Ga0495606_0034214 | 3300046507 | Bacteria | 3490 |
| 777 | Ga0495606_0102033 | 3300046507 | Bacteria | 1745 |
| 778 | Ga0495606_0264218 | 3300046507 | Bacteria | 948 |
| 779 | Ga0495606_0312184 | 3300046507 | Bacteria | 848 |
| 780 | Ga0495606_0403479 | 3300046507 | Bacteria | 711 |
| 781 | Ga0495606_0452802 | 3300046507 | Bacteria | 657 |
| 782 | Ga0495608_0019870 | 3300046511 | Bacteria | 4619 |
| 783 | Ga0495608_0080255 | 3300046511 | Bacteria | 2121 |
| 784 | Ga0495610_0107052 | 3300046512 | Bacteria | 1244 |
| 785 | Ga0495610_0124279 | 3300046512 | Bacteria | 1127 |
| 786 | Ga0495616_0026546 | 3300046513 | Bacteria | 3081 |
| 787 | Ga0495618_0028578 | 3300046514 | Bacteria | 3476 |
| 788 | Ga0495620_0055847 | 3300046515 | Bacteria | 1663 |
| 789 | Ga0495620_0175927 | 3300046515 | Bacteria | 828 |
| 790 | Ga0495620_0239742 | 3300046515 | Bacteria | 692 |
| 791 | Ga0495620_0284325 | 3300046515 | Bacteria | 629 |
| 792 | Ga0495628_0015500 | 3300046516 | Bacteria | 6365 |
| 793 | Ga0495628_0079992 | 3300046516 | Bacteria | 2541 |
| 794 | Ga0495628_0162717 | 3300046516 | Bacteria | 1695 |
| 795 | Ga0495630_0005610 | 3300046517 | Bacteria | 8864 |
| 796 | Ga0495630_0147147 | 3300046517 | Bacteria | 1792 |
| 797 | Ga0495631_0096176 | 3300046518 | Bacteria | 1275 |
| 798 | Ga0495631_0118301 | 3300046518 | Bacteria | 1139 |
| 799 | Ga0495631_0162016 | 3300046518 | Bacteria | 960 |
| 800 | Ga0495631_0222239 | 3300046518 | Bacteria | 806 |
| 801 | Ga0495632_0096886 | 3300046519 | Bacteria | 1393 |
| 802 | Ga0495632_0203258 | 3300046519 | Bacteria | 901 |
| 803 | Ga0495632_0278902 | 3300046519 | Bacteria | 744 |
| 804 | Ga0495637_0074429 | 3300046520 | Bacteria | 1364 |
| 805 | Ga0495643_0118009 | 3300046522 | Bacteria | 1343 |
| 806 | Ga0495643_0124891 | 3300046522 | Bacteria | 1296 |
| 807 | Ga0495643_0198153 | 3300046522 | Bacteria | 965 |
| 808 | Ga0495644_0026767 | 3300046523 | Bacteria | 2187 |
| 809 | Ga0495644_0068917 | 3300046523 | Bacteria | 1329 |
| 810 | Ga0495644_0104544 | 3300046523 | Bacteria | 1072 |
| 811 | Ga0495648_0001071 | 3300046524 | Bacteria | 27799 |
| 812 | Ga0495648_0055289 | 3300046524 | Bacteria | 2393 |
| 813 | Ga0495648_0128362 | 3300046524 | Bacteria | 1352 |
| 814 | Ga0495648_0144527 | 3300046524 | Bacteria | 1248 |
| 815 | Ga0495648_0167446 | 3300046524 | Bacteria | 1130 |
| 816 | Ga0495648_0176996 | 3300046524 | Bacteria | 1088 |
| 817 | Ga0495648_0385547 | 3300046524 | Bacteria | 630 |
| 818 | Ga0495666_0020390 | 3300046526 | Bacteria | 3285 |
| 819 | Ga0495666_0067929 | 3300046526 | Bacteria | 1698 |
| 820 | Ga0495642_0139880 | 3300046528 | Bacteria | 1045 |
| 821 | Ga0495652_0014684 | 3300046529 | Bacteria | 7023 |
| 822 | Ga0495652_0019166 | 3300046529 | Bacteria | 6095 |
| 823 | Ga0495652_0020755 | 3300046529 | Bacteria | 5838 |
| 824 | Ga0495652_0191690 | 3300046529 | Bacteria | 1559 |
| 825 | Ga0495652_0538472 | 3300046529 | Bacteria | 804 |
| 826 | Ga0495665_0000335 | 3300046531 | Bacteria | 23811 |
| 827 | Ga0495665_0223245 | 3300046531 | Bacteria | 974 |
| 828 | Ga0495640_0002138 | 3300046533 | Bacteria | 15789 |
| 829 | Ga0495640_0016721 | 3300046533 | Bacteria | 5485 |
| 830 | Ga0495640_0095555 | 3300046533 | Bacteria | 1956 |
| 831 | Ga0495640_0255127 | 3300046533 | Bacteria | 1097 |
| 832 | Ga0495586_0098735 | 3300046535 | Bacteria | 1619 |
| 833 | Ga0495586_0271468 | 3300046535 | Bacteria | 970 |
| 834 | Ga0495587_0011102 | 3300046536 | Bacteria | 5713 |
| 835 | Ga0495587_0063598 | 3300046536 | Bacteria | 2158 |
| 836 | Ga0495587_0267144 | 3300046536 | Bacteria | 960 |
| 837 | Ga0495598_0016310 | 3300046537 | Bacteria | 1893 |
| 838 | Ga0495598_0098282 | 3300046537 | Bacteria | 965 |
| 839 | Ga0495609_0043359 | 3300046538 | Bacteria | 2020 |
| 840 | Ga0495609_0067067 | 3300046538 | Bacteria | 1581 |
| 841 | Ga0495609_0207978 | 3300046538 | Bacteria | 816 |
| 842 | Ga0495609_0217489 | 3300046538 | Bacteria | 794 |
| 843 | Ga0495621_0150103 | 3300046539 | Bacteria | 916 |
| 844 | Ga0495597_0018060 | 3300046542 | Bacteria | 3314 |
| 845 | Ga0495597_0125685 | 3300046542 | Bacteria | 1066 |
| 846 | Ga0495645_0008238 | 3300046543 | Bacteria | 7269 |
| 847 | Ga0495622_0001664 | 3300046557 | Bacteria | 11001 |
| 848 | Ga0495622_0031861 | 3300046557 | Bacteria | 2462 |
| 849 | Ga0495622_0032621 | 3300046557 | Bacteria | 2432 |
| 850 | Ga0495622_0101650 | 3300046557 | Bacteria | 1317 |
| 851 | Ga0495622_0107212 | 3300046557 | Bacteria | 1280 |
| 852 | Ga0495633_0090609 | 3300046558 | Bacteria | 1421 |
| 853 | Ga0495667_0003584 | 3300046559 | Bacteria | 10443 |
| 854 | Ga0495667_0008501 | 3300046559 | Bacteria | 6968 |
| 855 | Ga0495667_0017003 | 3300046559 | Bacteria | 4910 |
| 856 | Ga0495667_0697603 | 3300046559 | Bacteria | 629 |
| 857 | Ga0495656_0007208 | 3300046615 | Bacteria | 3924 |
| 858 | Ga0495656_0019568 | 3300046615 | Bacteria | 2614 |
| 859 | Ga0495656_0057557 | 3300046615 | Bacteria | 1683 |
| 860 | Ga0495656_0086279 | 3300046615 | Bacteria | 1427 |
| 861 | Ga0495656_0341476 | 3300046615 | Bacteria | 774 |
| 862 | Ga0495668_0013886 | 3300046616 | Bacteria | 4736 |
| 863 | Ga0495668_0106847 | 3300046616 | Bacteria | 1531 |
| 864 | Ga0495668_0185513 | 3300046616 | Bacteria | 1139 |
| 865 | Ga0495668_0225484 | 3300046616 | Bacteria | 1026 |
| 866 | Ga0495668_0251215 | 3300046616 | Bacteria | 968 |
| 867 | Ga0495668_0513438 | 3300046616 | Bacteria | 661 |
| 868 | Ga0495634_0004622 | 3300046642 | Bacteria | 10742 |
| 869 | Ga0495634_0020900 | 3300046642 | Bacteria | 4636 |
| 870 | Ga0495634_0360494 | 3300046642 | Bacteria | 869 |
| 871 | Ga0495611_0069655 | 3300046648 | Bacteria | 1607 |
| 872 | Ga0495611_0109377 | 3300046648 | Bacteria | 1286 |
| 873 | Ga0495611_0154025 | 3300046648 | Bacteria | 1073 |
| 874 | Ga0495625_0109767 | 3300046660 | Bacteria | 1887 |
| 875 | Ga0495625_0159799 | 3300046660 | Bacteria | 1510 |
| 876 | Ga0495625_0389022 | 3300046660 | Bacteria | 873 |
| 877 | Ga0495625_0677335 | 3300046660 | Bacteria | 611 |
| 878 | Ga0495635_0006671 | 3300046663 | Bacteria | 8062 |
| 879 | Ga0495635_0014178 | 3300046663 | Bacteria | 5577 |
| 880 | Ga0495635_0048596 | 3300046663 | Bacteria | 2924 |
| 881 | Ga0495635_0073979 | 3300046663 | Bacteria | 2334 |
| 882 | Ga0495635_0510332 | 3300046663 | Bacteria | 791 |
| 883 | Ga0495659_0002107 | 3300046664 | Bacteria | 6497 |
| 884 | Ga0495659_0029020 | 3300046664 | Bacteria | 1918 |
| 885 | Ga0495659_0125976 | 3300046664 | Bacteria | 1012 |
| 886 | Ga0495661_0041610 | 3300046665 | Bacteria | 2841 |
| 887 | Ga0495661_0128554 | 3300046665 | Bacteria | 1391 |
| 888 | Ga0495661_0200602 | 3300046665 | Bacteria | 1045 |
| 889 | Ga0495588_0008571 | 3300046674 | Bacteria | 4696 |
| 890 | Ga0495588_0128553 | 3300046674 | Bacteria | 1336 |
| 891 | Ga0495588_0234405 | 3300046674 | Bacteria | 968 |
| 892 | Ga0495657_0005477 | 3300046675 | Bacteria | 10046 |
| 893 | Ga0495657_0031180 | 3300046675 | Bacteria | 3728 |
| 894 | Ga0495657_0032801 | 3300046675 | Bacteria | 3621 |
| 895 | Ga0495599_0071655 | 3300046678 | Bacteria | 2163 |
| 896 | Ga0495599_0085847 | 3300046678 | Bacteria | 1966 |
| 897 | Ga0495623_0010119 | 3300046679 | Bacteria | 6105 |
| 898 | Ga0495623_0016092 | 3300046679 | Bacteria | 4833 |
| 899 | Ga0495646_0026987 | 3300046680 | Bacteria | 3605 |
| 900 | Ga0495646_0063333 | 3300046680 | Bacteria | 2196 |
| 901 | Ga0495646_0172205 | 3300046680 | Bacteria | 1192 |
| 902 | Ga0495647_0022488 | 3300046681 | Bacteria | 2278 |
| 903 | Ga0495658_0014486 | 3300046683 | Bacteria | 4031 |
| 904 | Ga0495658_0163835 | 3300046683 | Bacteria | 1373 |
| 905 | Ga0495669_0054908 | 3300046684 | Bacteria | 1793 |
| 906 | Ga0495669_0088458 | 3300046684 | Bacteria | 1428 |
| 907 | Ga0495669_0185413 | 3300046684 | Bacteria | 992 |
| 908 | Ga0495669_0229042 | 3300046684 | Bacteria | 891 |
| 909 | Ga0495669_0318477 | 3300046684 | Bacteria | 750 |
| 910 | Ga0495613_0004485 | 3300046689 | Bacteria | 10464 |
| 911 | Ga0495613_0181544 | 3300046689 | Bacteria | 1490 |
| 912 | Ga0495613_0234957 | 3300046689 | Bacteria | 1283 |
| 913 | Ga0495613_0674964 | 3300046689 | Bacteria | 682 |
| 914 | Ga0495624_0000795 | 3300046690 | Bacteria | 24919 |
| 915 | Ga0495624_0096546 | 3300046690 | Bacteria | 1821 |
| 916 | Ga0495624_0226423 | 3300046690 | Bacteria | 1133 |
| 917 | Ga0495624_0290436 | 3300046690 | Bacteria | 987 |
| 918 | Ga0495670_0063562 | 3300046691 | Bacteria | 1858 |
| 919 | Ga0495670_0078060 | 3300046691 | Bacteria | 1684 |
| 920 | Ga0495671_0274728 | 3300046692 | Bacteria | 812 |
| 921 | Ga0495671_0402317 | 3300046692 | Bacteria | 655 |
| 922 | Ga0495649_0047616 | 3300046694 | Bacteria | 2331 |
| 923 | Ga0495649_0199931 | 3300046694 | Bacteria | 1038 |
| 924 | Ga0495649_0289086 | 3300046694 | Bacteria | 836 |
| 925 | Ga0495589_0099620 | 3300046794 | Bacteria | 1407 |
| 926 | Ga0495589_0143196 | 3300046794 | Bacteria | 1144 |
| 927 | Ga0495589_0173165 | 3300046794 | Bacteria | 1026 |
| 928 | Ga0495589_0241200 | 3300046794 | Bacteria | 846 |
| 929 | Ga0495600_0041236 | 3300046809 | Bacteria | 3008 |
| 930 | Ga0495600_0059007 | 3300046809 | Bacteria | 2506 |
| 931 | Ga0495600_0396510 | 3300046809 | Bacteria | 859 |
| 932 | Ga0495660_0050740 | 3300046810 | Bacteria | 2259 |
| 933 | Ga0495660_0186809 | 3300046810 | Bacteria | 999 |
| 934 | Ga0495581_0000030 | 3300047315 | Bacteria | 53487 |
| 935 | Ga0495581_0028132 | 3300047315 | Bacteria | 3259 |
| 936 | Ga0495581_0074821 | 3300047315 | Bacteria | 1960 |
| 937 | Ga0495581_0159180 | 3300047315 | Bacteria | 1320 |
| 938 | Ga0495604_0005369 | 3300047317 | Bacteria | 10163 |
| 939 | Ga0495604_0030536 | 3300047317 | Bacteria | 4279 |
| 940 | Ga0495636_0043015 | 3300047318 | Bacteria | 1878 |
| 941 | Ga0495636_0310154 | 3300047318 | Bacteria | 739 |
| 942 | Ga0495674_0004821 | 3300047319 | Bacteria | 12972 |
| 943 | Ga0495674_0029055 | 3300047319 | Bacteria | 5036 |
| 944 | Ga0495674_0046737 | 3300047319 | Bacteria | 3842 |
| 945 | Ga0495672_0037365 | 3300047320 | Bacteria | 2972 |
| 946 | Ga0495672_0314720 | 3300047320 | Bacteria | 737 |
| 947 | Ga0495676_0039329 | 3300047321 | Bacteria | 3918 |
| 948 | Ga0495676_0047874 | 3300047321 | Bacteria | 3452 |
| 949 | Ga0495676_0055320 | 3300047321 | Bacteria | 3147 |
| 950 | Ga0495676_0581215 | 3300047321 | Bacteria | 730 |
| 951 | Ga0495680_0008881 | 3300047322 | Bacteria | 9087 |
| 952 | Ga0495680_0045020 | 3300047322 | Bacteria | 3486 |
| 953 | Ga0495680_0094553 | 3300047322 | Bacteria | 2236 |
| 954 | Ga0495683_0091526 | 3300047323 | Bacteria | 1473 |
| 955 | Ga0495683_0163907 | 3300047323 | Bacteria | 1026 |
| 956 | Ga0495683_0208964 | 3300047323 | Bacteria | 876 |
| 957 | Ga0495687_126162 | 3300047443 | Bacteria | 914 |
| 958 | Ga0495687_142791 | 3300047443 | Bacteria | 830 |
| 959 | Ga0495675_0020892 | 3300047444 | Bacteria | 4167 |
| 960 | Ga0495675_0028927 | 3300047444 | Bacteria | 3532 |
| 961 | Ga0495677_0118428 | 3300047445 | Bacteria | 1009 |
| 962 | Ga0495677_0220164 | 3300047445 | Bacteria | 739 |
| 963 | Ga0495685_101503 | 3300047447 | Bacteria | 950 |
| 964 | Ga0495673_0027495 | 3300047469 | Bacteria | 2706 |
| 965 | Ga0495673_0083345 | 3300047469 | Bacteria | 1320 |
| 966 | Ga0495673_0103545 | 3300047469 | Bacteria | 1147 |
| 967 | Ga0495673_0108010 | 3300047469 | Bacteria | 1116 |
| 968 | Ga0495673_0152098 | 3300047469 | Bacteria | 894 |
| 969 | Ga0495673_0168073 | 3300047469 | Bacteria | 837 |
| 970 | Ga0495673_0223046 | 3300047469 | Bacteria | 697 |
| 971 | Ga0495681_0097731 | 3300047470 | Bacteria | 1288 |
| 972 | Ga0495681_0236490 | 3300047470 | Bacteria | 727 |
| 973 | Ga0495684_0117000 | 3300047471 | Bacteria | 2009 |
| 974 | Ga0495684_0127826 | 3300047471 | Bacteria | 1910 |
| 975 | Ga0495684_0351610 | 3300047471 | Bacteria | 1046 |
| 976 | Ga0495686_0150331 | 3300047472 | Bacteria | 1367 |
| 977 | Ga0495686_0354173 | 3300047472 | Bacteria | 797 |
| 978 | Ga0495686_0426761 | 3300047472 | Bacteria | 708 |
| 979 | Ga0495593_0000398 | 3300047673 | Bacteria | 24218 |
| 980 | Ga0495593_0037445 | 3300047673 | Bacteria | 2624 |
| 981 | Ga0495593_0118506 | 3300047673 | Bacteria | 1348 |
| 982 | Ga0495602_0023058 | 3300048088 | Bacteria | 6075 |
| 983 | Ga0495602_0050036 | 3300048088 | Bacteria | 3737 |
| 984 | Ga0495614_0027576 | 3300048089 | Bacteria | 2448 |
| 985 | Ga0495614_0357666 | 3300048089 | Bacteria | 681 |
| 986 | Ga0495615_0090478 | 3300048090 | Bacteria | 852 |
| 987 | Ga0495615_0138603 | 3300048090 | Bacteria | 716 |
| 988 | Ga0495626_0175237 | 3300048091 | Bacteria | 892 |
| 989 | Ga0496100_0046419 | 3300048903 | Bacteria | 2793 |
| 990 | Ga0496100_0188849 | 3300048903 | Bacteria | 1495 |
| 991 | Ga0496100_0246888 | 3300048903 | Bacteria | 1319 |
| 992 | Ga0496101_0289568 | 3300048904 | Bacteria | 1281 |
| 993 | Ga0496101_0430373 | 3300048904 | Bacteria | 1040 |
| 994 | Ga0496101_0433593 | 3300048904 | Bacteria | 1036 |
| 995 | Ga0496102_0071540 | 3300048905 | Bacteria | 3184 |
| 996 | Ga0496102_0074603 | 3300048905 | Bacteria | 3118 |
| 997 | Ga0496102_0074762 | 3300048905 | Bacteria | 3115 |
| 998 | Ga0496102_0282570 | 3300048905 | Bacteria | 1564 |
| 999 | Ga0496102_0610220 | 3300048905 | Bacteria | 1014 |
| 1000 | Ga0496102_0640126 | 3300048905 | Bacteria | 986 |
| 1001 | Ga0496103_0021472 | 3300048906 | Bacteria | 3885 |
| 1002 | Ga0496104_0023224 | 3300048907 | Bacteria | 5702 |
| 1003 | Ga0496104_0137738 | 3300048907 | Bacteria | 2345 |
| 1004 | Ga0496104_0223045 | 3300048907 | Bacteria | 1797 |
| 1005 | Ga0496104_0447321 | 3300048907 | Bacteria | 1204 |
| 1006 | Ga0496104_0486997 | 3300048907 | Bacteria | 1145 |
| 1007 | Ga0496105_0002119 | 3300048908 | Bacteria | 14370 |
| 1008 | Ga0496105_0053620 | 3300048908 | Bacteria | 3330 |
| 1009 | Ga0496105_0078315 | 3300048908 | Bacteria | 2729 |
| 1010 | Ga0496105_0298503 | 3300048908 | Bacteria | 1295 |
| 1011 | Ga0496106_0005807 | 3300048909 | Bacteria | 9124 |
| 1012 | Ga0496106_0131388 | 3300048909 | Bacteria | 1964 |
| 1013 | Ga0496106_0190826 | 3300048909 | Bacteria | 1629 |
| 1014 | Ga0496106_0461761 | 3300048909 | Bacteria | 1020 |
| 1015 | Ga0496106_0464355 | 3300048909 | Bacteria | 1017 |
| 1016 | Ga0496106_0520498 | 3300048909 | Bacteria | 955 |
| 1017 | Ga0496106_1063317 | 3300048909 | Bacteria | 635 |
| 1018 | Ga0496107_0084269 | 3300048910 | Bacteria | 2319 |
| 1019 | Ga0496107_0315893 | 3300048910 | Bacteria | 1163 |
| 1020 | Ga0496107_0765599 | 3300048910 | Bacteria | 708 |
| 1021 | Ga0496108_0267633 | 3300048911 | Bacteria | 1487 |
| 1022 | Ga0496108_0276122 | 3300048911 | Bacteria | 1463 |
| 1023 | Ga0496108_0459592 | 3300048911 | Bacteria | 1112 |
| 1024 | Ga0496108_0675677 | 3300048911 | Bacteria | 897 |
| 1025 | Ga0496108_1182871 | 3300048911 | Bacteria | 647 |
| 1026 | Ga0496108_1201958 | 3300048911 | Bacteria | 641 |
| 1027 | Ga0496109_0021697 | 3300048912 | Bacteria | 5683 |
| 1028 | Ga0496109_0071834 | 3300048912 | Bacteria | 3178 |
| 1029 | Ga0496109_0162309 | 3300048912 | Bacteria | 2094 |
| 1030 | Ga0496109_0196394 | 3300048912 | Bacteria | 1896 |
| 1031 | Ga0496109_1219651 | 3300048912 | Bacteria | 689 |
| 1032 | Ga0496109_1502556 | 3300048912 | Bacteria | 608 |
| 1033 | Ga0496110_0088471 | 3300048913 | Bacteria | 2766 |
| 1034 | Ga0496110_0125988 | 3300048913 | Bacteria | 2311 |
| 1035 | Ga0496110_0174824 | 3300048913 | Bacteria | 1949 |
| 1036 | Ga0496110_0281445 | 3300048913 | Bacteria | 1514 |
| 1037 | Ga0496110_0731836 | 3300048913 | Bacteria | 892 |
| 1038 | Ga0496110_1069359 | 3300048913 | Bacteria | 715 |
| 1039 | Ga0496111_0047295 | 3300048914 | Bacteria | 3098 |
| 1040 | Ga0496111_0131513 | 3300048914 | Bacteria | 1852 |
| 1041 | Ga0496111_0142191 | 3300048914 | Bacteria | 1778 |
| 1042 | Ga0496111_0244844 | 3300048914 | Bacteria | 1331 |
| 1043 | Ga0496112_0000018 | 3300048915 | Bacteria | 188820 |
| 1044 | Ga0496112_0070075 | 3300048915 | Bacteria | 3464 |
| 1045 | Ga0496112_0093432 | 3300048915 | Bacteria | 2978 |
| 1046 | Ga0496112_0123986 | 3300048915 | Bacteria | 2554 |
| 1047 | Ga0496112_0520433 | 3300048915 | Bacteria | 1124 |
| 1048 | Ga0496112_0798307 | 3300048915 | Bacteria | 869 |
| 1049 | Ga0496113_0053535 | 3300048916 | Bacteria | 3018 |
| 1050 | Ga0496113_0084992 | 3300048916 | Bacteria | 2430 |
| 1051 | Ga0496113_0105250 | 3300048916 | Bacteria | 2190 |
| 1052 | Ga0496113_0325241 | 3300048916 | Bacteria | 1233 |
| 1053 | Ga0496113_0632027 | 3300048916 | Bacteria | 856 |
| 1054 | Ga0496113_0710822 | 3300048916 | Bacteria | 801 |
| 1055 | Ga0496114_0305804 | 3300048917 | Bacteria | 1404 |
| 1056 | Ga0496114_0436833 | 3300048917 | Bacteria | 1159 |
| 1057 | Ga0496114_0700432 | 3300048917 | Bacteria | 888 |
| 1058 | Ga0496115_0084663 | 3300048918 | Bacteria | 2585 |
| 1059 | Ga0496115_0157355 | 3300048918 | Bacteria | 1877 |
| 1060 | Ga0496115_0237536 | 3300048918 | Bacteria | 1502 |
| 1061 | Ga0496116_0165046 | 3300048919 | Bacteria | 1209 |
| 1062 | Ga0496116_0174683 | 3300048919 | Bacteria | 1159 |
| 1063 | Ga0496116_0193715 | 3300048919 | Bacteria | 1072 |
| 1064 | Ga0496116_0294710 | 3300048919 | Bacteria | 776 |
| 1065 | Ga0496117_0032990 | 3300048920 | Bacteria | 3922 |
| 1066 | Ga0496117_0046740 | 3300048920 | Bacteria | 3111 |
| 1067 | Ga0496117_0133093 | 3300048920 | Bacteria | 1503 |
| 1068 | Ga0496117_0226790 | 3300048920 | Bacteria | 1035 |
| 1069 | Ga0496117_0410600 | 3300048920 | Bacteria | 680 |
| 1070 | Ga0496118_0005692 | 3300048921 | Bacteria | 14039 |
| 1071 | Ga0496118_0037135 | 3300048921 | Bacteria | 3926 |
| 1072 | Ga0496118_0113965 | 3300048921 | Bacteria | 1784 |
| 1073 | Ga0496118_0166548 | 3300048921 | Bacteria | 1354 |
| 1074 | Ga0496118_0211512 | 3300048921 | Bacteria | 1137 |
| 1075 | Ga0496118_0484516 | 3300048921 | Bacteria | 619 |
| 1076 | Ga0496119_0026589 | 3300048922 | Bacteria | 4008 |
| 1077 | Ga0496119_0054547 | 3300048922 | Bacteria | 2433 |
| 1078 | Ga0496119_0059029 | 3300048922 | Bacteria | 2307 |
| 1079 | Ga0496119_0062447 | 3300048922 | Bacteria | 2220 |
| 1080 | Ga0496119_0102491 | 3300048922 | Bacteria | 1604 |
| 1081 | Ga0496119_0162252 | 3300048922 | Bacteria | 1187 |
| 1082 | Ga0496119_0437327 | 3300048922 | Bacteria | 618 |
| 1083 | Ga0496120_0040266 | 3300048923 | Bacteria | 2747 |
| 1084 | Ga0496121_0000278 | 3300048924 | Bacteria | 106838 |
| 1085 | Ga0496121_0000870 | 3300048924 | Bacteria | 54546 |
| 1086 | Ga0496121_0010173 | 3300048924 | Bacteria | 10650 |
| 1087 | Ga0496121_0096171 | 3300048924 | Bacteria | 2299 |
| 1088 | Ga0496121_0126343 | 3300048924 | Bacteria | 1921 |
| 1089 | Ga0496121_0138497 | 3300048924 | Bacteria | 1809 |
| 1090 | Ga0496121_0192329 | 3300048924 | Bacteria | 1462 |
| 1091 | Ga0496121_0237709 | 3300048924 | Bacteria | 1272 |
| 1092 | Ga0496121_0264483 | 3300048924 | Bacteria | 1186 |
| 1093 | Ga0496121_0288805 | 3300048924 | Bacteria | 1118 |
| 1094 | Ga0496121_0296409 | 3300048924 | Bacteria | 1099 |
| 1095 | Ga0496121_0519332 | 3300048924 | Bacteria | 752 |
| 1096 | Ga0496121_0534225 | 3300048924 | Bacteria | 737 |
| 1097 | Ga0496121_0580805 | 3300048924 | Bacteria | 695 |
| 1098 | Ga0496121_0704692 | 3300048924 | Bacteria | 607 |
| 1099 | Ga0496122_0017924 | 3300048925 | Bacteria | 6575 |
| 1100 | Ga0496122_0267463 | 3300048925 | Bacteria | 944 |
| 1101 | Ga0496124_0001369 | 3300048927 | Bacteria | 36505 |
| 1102 | Ga0496124_0164318 | 3300048927 | Bacteria | 1727 |
| 1103 | Ga0496124_0288202 | 3300048927 | Bacteria | 1193 |
| 1104 | Ga0496124_0398661 | 3300048927 | Bacteria | 956 |
| 1105 | Ga0496124_0489142 | 3300048927 | Bacteria | 828 |
| 1106 | Ga0496124_0601934 | 3300048927 | Bacteria | 715 |
| 1107 | Ga0496125_0012916 | 3300048928 | Bacteria | 8246 |
| 1108 | Ga0496125_0078047 | 3300048928 | Bacteria | 2548 |
| 1109 | Ga0496125_0133097 | 3300048928 | Bacteria | 1746 |
| 1110 | Ga0496125_0166528 | 3300048928 | Bacteria | 1488 |
| 1111 | Ga0496125_0182460 | 3300048928 | Bacteria | 1396 |
| 1112 | Ga0496125_0392879 | 3300048928 | Bacteria | 813 |
| 1113 | Ga0496126_0008213 | 3300048929 | Bacteria | 11288 |
| 1114 | Ga0496126_0016831 | 3300048929 | Bacteria | 7298 |
| 1115 | Ga0496126_0053878 | 3300048929 | Bacteria | 3647 |
| 1116 | Ga0496126_0068252 | 3300048929 | Bacteria | 3175 |
| 1117 | Ga0496126_0080618 | 3300048929 | Bacteria | 2880 |
| 1118 | Ga0496126_0153361 | 3300048929 | Bacteria | 1973 |
| 1119 | Ga0496126_0219098 | 3300048929 | Bacteria | 1599 |
| 1120 | Ga0496126_0239605 | 3300048929 | Bacteria | 1516 |
| 1121 | Ga0496126_0377072 | 3300048929 | Bacteria | 1155 |
| 1122 | Ga0496126_0383439 | 3300048929 | Bacteria | 1143 |
| 1123 | Ga0496126_0437004 | 3300048929 | Bacteria | 1055 |
| 1124 | Ga0496126_0514831 | 3300048929 | Bacteria | 954 |
| 1125 | Ga0496126_0608735 | 3300048929 | Bacteria | 860 |
| 1126 | Ga0496126_0618714 | 3300048929 | Bacteria | 851 |
| 1127 | Ga0496126_0647077 | 3300048929 | Bacteria | 827 |
| 1128 | Ga0496126_0666168 | 3300048929 | Bacteria | 812 |
| 1129 | Ga0495678_166440 | 3300049459 | Bacteria | 701 |
| 1130 | Ga0495682_0024271 | 3300049460 | Bacteria | 2261 |
| 1131 | Ga0501048_0306506 | 3300049582 | Bacteria | 1130 |
| 1132 | Ga0501067_0144909 | 3300049583 | Bacteria | 1323 |
| 1133 | Ga0501080_0696706 | 3300049742 | Bacteria | 896 |
| 1134 | nmdc:mga03683_100167_c1 | 3300050489 | Bacteria | 1273 |
| 1135 | nmdc:mga03683_195531_c1 | 3300050489 | Bacteria | 927 |
| 1136 | nmdc:mga03683_63870_c1 | 3300050489 | Bacteria | 1561 |
| 1137 | nmdc:mga03683_78981_c1 | 3300050489 | Bacteria | 1418 |
| 1138 | nmdc:mga03n38_25280_c1 | 3300050490 | Bacteria | 2437 |
| 1139 | nmdc:mga03n38_51750_c1 | 3300050490 | Bacteria | 1835 |
| 1140 | nmdc:mga00v17_104028_c1 | 3300050491 | Bacteria | 1795 |
| 1141 | nmdc:mga00v17_134887_c1 | 3300050491 | Bacteria | 1580 |
| 1142 | nmdc:mga00v17_399883_c1 | 3300050491 | Bacteria | 893 |
| 1143 | nmdc:mga0yw44_136693_c1 | 3300050492 | Bacteria | 1591 |
| 1144 | nmdc:mga0yw44_197542_c1 | 3300050492 | Bacteria | 1328 |
| 1145 | nmdc:mga0yw44_234584_c1 | 3300050492 | Bacteria | 1218 |
| 1146 | nmdc:mga0yw44_4136_c1 | 3300050492 | Bacteria | 6589 |
| 1147 | nmdc:mga0yw44_61384_c1 | 3300050492 | Bacteria | 2306 |
| 1148 | nmdc:mga0yw44_702768_c1 | 3300050492 | Bacteria | 687 |
| 1149 | nmdc:mga0yw44_94133_c1 | 3300050492 | Bacteria | 1898 |
| 1150 | nmdc:mga0k408_114095_c1 | 3300050493 | Bacteria | 1598 |
| 1151 | nmdc:mga0k408_245765_c1 | 3300050493 | Bacteria | 1069 |
| 1152 | nmdc:mga0k408_311530_c1 | 3300050493 | Bacteria | 939 |
| 1153 | nmdc:mga0k408_49688_c1 | 3300050493 | Bacteria | 2428 |
| 1154 | nmdc:mga0k408_620462_c1 | 3300050493 | Bacteria | 637 |
| 1155 | nmdc:mga0k408_632294_c1 | 3300050493 | Bacteria | 630 |
| 1156 | nmdc:mga0k408_68006_c1 | 3300050493 | Bacteria | 2077 |
| 1157 | nmdc:mga06z11_164199_c1 | 3300050494 | Bacteria | 1271 |
| 1158 | nmdc:mga06z11_247797_c1 | 3300050494 | Bacteria | 1048 |
| 1159 | nmdc:mga06z11_98186_c1 | 3300050494 | Bacteria | 1602 |
| 1160 | nmdc:mga04h51_39790_c1 | 3300050495 | Bacteria | 1529 |
| 1161 | nmdc:mga04h51_4594_c1 | 3300050495 | Bacteria | 3452 |
| 1162 | nmdc:mga07m45_49037_c1 | 3300050496 | Bacteria | 2376 |
| 1163 | nmdc:mga07m45_72272_c1 | 3300050496 | Bacteria | 1963 |
| 1164 | nmdc:mga07m45_85238_c1 | 3300050496 | Bacteria | 1807 |
| 1165 | nmdc:mga05p37_715928_c1 | 3300050507 | Bacteria | 1109 |
| 1166 | nmdc:mga05p37_766833_c1 | 3300050507 | Bacteria | 1061 |
| 1167 | nmdc:mga08y16_1079285_c1 | 3300050511 | Bacteria | 779 |
| 1168 | nmdc:mga0n895_1169042_c1 | 3300050512 | Bacteria | 744 |
| 1169 | nmdc:mga0n895_55593_c1 | 3300050512 | Bacteria | 3895 |
| 1170 | nmdc:mga0rr50_401671_c1 | 3300050513 | Bacteria | 1157 |
| 1171 | nmdc:mga0rr50_812014_c1 | 3300050513 | Bacteria | 798 |
| 1172 | nmdc:mga0sz30_201948_c1 | 3300050516 | Bacteria | 883 |
| 1173 | nmdc:mga0sz30_240549_c1 | 3300050516 | Bacteria | 806 |
| 1174 | nmdc:mga0sz30_24637_c2 | 3300050516 | Bacteria | 2130 |
| 1175 | nmdc:mga0sz30_276370_c1 | 3300050516 | Bacteria | 748 |
| 1176 | nmdc:mga0sz30_52513_c1 | 3300050516 | Bacteria | 1731 |
| 1177 | nmdc:mga0sz30_6719_c1 | 3300050516 | Bacteria | 2580 |
| 1178 | Ga0495601_0072078 | 3300053077 | Bacteria | 2206 |
| 1179 | Ga0495601_0189917 | 3300053077 | Bacteria | 1343 |
| 1180 | Ga0495612_0003340 | 3300053078 | Bacteria | 6648 |
| 1181 | Ga0500635_0001019 | 3300053080 | Bacteria | 6708 |
| 1182 | Ga0500635_0083337 | 3300053080 | Bacteria | 1153 |
| 1183 | Ga0495655_0017739 | 3300053083 | Bacteria | 1555 |
| 1184 | Ga0495655_0028351 | 3300053083 | Bacteria | 1336 |
| 1185 | Ga0495655_0054284 | 3300053083 | Bacteria | 1072 |
| 1186 | Ga0495655_0130147 | 3300053083 | Bacteria | 774 |
| 1187 | Ga0495595_0006434 | 3300053084 | Bacteria | 4791 |
| 1188 | Ga0495619_0097925 | 3300053085 | Bacteria | 1993 |
| 1189 | Ga0495619_0232345 | 3300053085 | Bacteria | 1278 |
| 1190 | Ga0495619_0256677 | 3300053085 | Bacteria | 1211 |
| 1191 | Ga0500643_000112 | 3300053087 | Bacteria | 84793 |
| 1192 | Ga0500647_0087402 | 3300053091 | Bacteria | 1494 |
| 1193 | Ga0500583_0109258 | 3300053092 | Bacteria | 1360 |
| 1194 | Ga0500583_0389437 | 3300053092 | Bacteria | 670 |
| 1195 | Ga0500651_0013790 | 3300053093 | Bacteria | 4932 |
| 1196 | Ga0500651_0204118 | 3300053093 | Bacteria | 1165 |
| 1197 | Ga0500651_0426263 | 3300053093 | Bacteria | 741 |
| 1198 | Ga0500651_0613454 | 3300053093 | Bacteria | 589 |
| 1199 | Ga0500566_0028718 | 3300053094 | Bacteria | 3250 |
| 1200 | Ga0500566_0060656 | 3300053094 | Bacteria | 2141 |
| 1201 | Ga0500640_031812 | 3300053095 | Bacteria | 2314 |
| 1202 | Ga0500641_0005732 | 3300053096 | Bacteria | 4401 |
| 1203 | Ga0500641_0034832 | 3300053096 | Bacteria | 2006 |
| 1204 | Ga0500641_0125390 | 3300053096 | Bacteria | 1107 |
| 1205 | Ga0500650_0182444 | 3300053098 | Bacteria | 961 |
| 1206 | Ga0500554_084081 | 3300053102 | Bacteria | 1051 |
| 1207 | Ga0500555_029367 | 3300053103 | Bacteria | 1564 |
| 1208 | Ga0500556_0116736 | 3300053104 | Bacteria | 1039 |
| 1209 | Ga0500557_000021 | 3300053105 | Bacteria | 89662 |
| 1210 | Ga0500558_226386 | 3300053106 | Bacteria | 632 |
| 1211 | Ga0500562_005565 | 3300053108 | Bacteria | 3166 |
| 1212 | Ga0500562_077165 | 3300053108 | Bacteria | 900 |
| 1213 | Ga0500569_005793 | 3300053109 | Bacteria | 2674 |
| 1214 | Ga0500569_145089 | 3300053109 | Bacteria | 799 |
| 1215 | Ga0500569_184397 | 3300053109 | Bacteria | 709 |
| 1216 | Ga0500594_0014142 | 3300053118 | Bacteria | 1907 |
| 1217 | Ga0500595_002722 | 3300053119 | Bacteria | 8560 |
| 1218 | Ga0500595_004714 | 3300053119 | Bacteria | 6055 |
| 1219 | Ga0500595_017174 | 3300053119 | Bacteria | 2677 |
| 1220 | Ga0500595_020317 | 3300053119 | Bacteria | 2393 |
| 1221 | Ga0500595_030265 | 3300053119 | Bacteria | 1826 |
| 1222 | Ga0500597_140240 | 3300053120 | Bacteria | 1042 |
| 1223 | Ga0500607_037964 | 3300053121 | Bacteria | 2622 |
| 1224 | Ga0500617_129887 | 3300053124 | Bacteria | 1027 |
| 1225 | Ga0500621_219643 | 3300053126 | Bacteria | 659 |
| 1226 | Ga0500626_120643 | 3300053128 | Bacteria | 1122 |
| 1227 | Ga0500642_0000362 | 3300053130 | Bacteria | 15284 |
| 1228 | Ga0500642_0083225 | 3300053130 | Bacteria | 1472 |
| 1229 | Ga0500642_0161139 | 3300053130 | Bacteria | 1051 |
| 1230 | Ga0500642_0208301 | 3300053130 | Bacteria | 908 |
| 1231 | Ga0500655_058384 | 3300053133 | Bacteria | 775 |
| 1232 | Ga0500658_0061598 | 3300053134 | Bacteria | 1561 |
| 1233 | Ga0500658_0103613 | 3300053134 | Bacteria | 1244 |
| 1234 | Ga0500658_0335099 | 3300053134 | Bacteria | 695 |
| 1235 | Ga0500559_0034845 | 3300053136 | Bacteria | 2171 |
| 1236 | Ga0500561_0027024 | 3300053137 | Bacteria | 1411 |
| 1237 | Ga0500568_0011399 | 3300053139 | Bacteria | 4130 |
| 1238 | Ga0500568_0013697 | 3300053139 | Bacteria | 3687 |
| 1239 | Ga0500568_0132269 | 3300053139 | Bacteria | 927 |
| 1240 | Ga0500573_0007614 | 3300053140 | Bacteria | 5917 |
| 1241 | Ga0500585_051506 | 3300053144 | Bacteria | 1471 |
| 1242 | Ga0500588_0109718 | 3300053146 | Bacteria | 961 |
| 1243 | Ga0500588_0251092 | 3300053146 | Bacteria | 664 |
| 1244 | Ga0500588_0311862 | 3300053146 | Bacteria | 596 |
| 1245 | Ga0500589_139840 | 3300053147 | Bacteria | 999 |
| 1246 | Ga0500590_012459 | 3300053148 | Bacteria | 4334 |
| 1247 | Ga0500590_152328 | 3300053148 | Bacteria | 1041 |
| 1248 | Ga0500603_008315 | 3300053150 | Bacteria | 2299 |
| 1249 | Ga0500604_0283040 | 3300053151 | Bacteria | 575 |
| 1250 | Ga0500616_0125886 | 3300053153 | Bacteria | 1217 |
| 1251 | Ga0500619_164871 | 3300053154 | Bacteria | 751 |
| 1252 | Ga0500620_051888 | 3300053155 | Bacteria | 1377 |
| 1253 | Ga0500622_0005248 | 3300053156 | Bacteria | 7825 |
| 1254 | Ga0500627_0091031 | 3300053158 | Bacteria | 1365 |
| 1255 | Ga0500627_0149510 | 3300053158 | Bacteria | 1055 |
| 1256 | Ga0500627_0173120 | 3300053158 | Bacteria | 972 |
| 1257 | Ga0500627_0310906 | 3300053158 | Bacteria | 686 |
| 1258 | Ga0500633_0074370 | 3300053160 | Bacteria | 1219 |
| 1259 | Ga0500639_267963 | 3300053163 | Bacteria | 669 |
| 1260 | Ga0500636_0000834 | 3300053177 | Bacteria | 16602 |
| 1261 | Ga0500636_0114438 | 3300053177 | Bacteria | 1520 |
| 1262 | Ga0500636_0156896 | 3300053177 | Bacteria | 1244 |
| 1263 | Ga0500636_0262295 | 3300053177 | Bacteria | 874 |
| 1264 | Ga0500637_0107654 | 3300053178 | Bacteria | 1616 |
| 1265 | Ga0500637_0544021 | 3300053178 | Bacteria | 564 |
| 1266 | Ga0500649_206274 | 3300053722 | Bacteria | 628 |
| 1267 | Ga0500649_208297 | 3300053722 | Bacteria | 622 |
| 1268 | Ga0500625_054654 | 3300053729 | Bacteria | 1832 |
| 1269 | Ga0500645_028937 | 3300053730 | Bacteria | 1674 |
| 1270 | Ga0500645_092338 | 3300053730 | Bacteria | 858 |
| 1271 | Ga0500609_012382 | 3300053731 | Bacteria | 1153 |
| 1272 | Ga0500656_006149 | 3300053732 | Bacteria | 1209 |
| 1273 | Ga0500552_069122 | 3300053733 | Bacteria | 631 |
| 1274 | Ga0500596_024173 | 3300053735 | Bacteria | 923 |
| 1275 | Ga0500599_002952 | 3300053736 | Bacteria | 2063 |
| 1276 | Ga0500601_000419 | 3300053737 | Bacteria | 7101 |
| 1277 | Ga0500601_018425 | 3300053737 | Bacteria | 802 |
| 1278 | Ga0500661_010749 | 3300055283 | Bacteria | 1664 |
| 1279 | Ga0500661_061784 | 3300055283 | Bacteria | 677 |
| 1280 | Ga0501082_0323771 | 3300060353 | Bacteria | 1343 |
| 1281 | 2507505456 | 2507262055 | Bacteria | 8048963 |
| 1282 | 2508539341 | 2508501009 | Bacteria | 7784016 |
| 1283 | 2508695670 | 2508501042 | Bacteria | 8719808 |
| 1284 | 2511395682 | 2511231028 | Bacteria | 8046582 |
| 1285 | 2513642198 | 2513237094 | Bacteria | 8789602 |
| 1286 | 2513651328 | 2513237095 | Bacteria | 8976980 |
| 1287 | 2513676321 | 2513237098 | Bacteria | 9902361 |
| 1288 | 2513695293 | 2513237101 | Bacteria | 7952346 |
| 1289 | 2513718246 | 2513237104 | Bacteria | 10034502 |
| 1290 | 2513859378 | 2513237137 | Bacteria | 9558895 |
| 1291 | 2513873341 | 2513237139 | Bacteria | 8737671 |
| 1292 | 2513921552 | 2513237145 | Bacteria | 8979722 |
| 1293 | 2514014671 | 2513237161 | Bacteria | 8871253 |
| 1294 | 2515627651 | 2515154112 | Bacteria | 8294334 |
| 1295 | 2517106274 | 2517093001 | Bacteria | 9002274 |
| 1296 | 2524441447 | 2524023205 | Bacteria | 8918781 |
| 1297 | 2524467221 | 2524023210 | Bacteria | 9029266 |
| 1298 | 2528853312 | 2528768022 | Bacteria | 10457665 |
| 1299 | 2617352054 | 2617270735 | Bacteria | 9163226 |
| 1300 | 2723841827 | 2721755755 | Bacteria | 8322773 |
| 1301 | 2728748426 | 2728368998 | Bacteria | 8720350 |
| 1302 | 2745077581 | 2744054633 | Bacteria | 8678936 |
| 1303 | 2793062243 | 2791355196 | Bacteria | 7323613 |
| 1304 | 2793078299 | |||
| 1305 | 2805920689 | 2802429603 | Bacteria | 8777136 |
| 1306 | 2818237862 | 2816332527 | Bacteria | 8933356 |
| 1307 | 2824604417 | 2824600985 | Bacteria | 8488197 |
| 1308 | 2824614853 | 2824609381 | Bacteria | 8672835 |
| 1309 | 2824656299 | 2824653114 | Bacteria | 8493680 |
| 1310 | 2824669885 | 2824661429 | Bacteria | 9877870 |
| 1311 | 2824671755 | 2824671348 | Bacteria | 8369588 |
| 1312 | 2824684806 | 2824679649 | Bacteria | 8248951 |
| 1313 | 2824695784 | 2824687955 | Bacteria | 8360029 |
| 1314 | 2824701665 | 2824696289 | Bacteria | 8335049 |
| 1315 | 2824710873 | 2824704595 | Bacteria | 9667483 |
| 1316 | 2824760656 | 2824753945 | Bacteria | 9787441 |
| 1317 | 2824768460 | 2824763712 | Bacteria | 9792355 |
| 1318 | 2824781375 | 2824773399 | Bacteria | 8360218 |
| 1319 | 2838124705 | 2838122688 | Bacteria | 8803140 |
| 1320 | 2841945396 | 2841941048 | Bacteria | 8688029 |
| 1321 | 2841952182 | 2841949485 | Bacteria | 8680857 |
| 1322 | 2841965340 | 2841957949 | Bacteria | 8652217 |
| 1323 | 2841970431 | 2841966195 | Bacteria | 8673214 |
| 1324 | 2841981679 | 2841974524 | Bacteria | 8931498 |
| 1325 | 2841984959 | 2841983080 | Bacteria | 8395090 |
| 1326 | 2842043314 | 2842038055 | Bacteria | 8002051 |
| 1327 | 2842052696 | 2842045827 | Bacteria | 8006841 |
| 1328 | 2844315551 | 2844315083 | Bacteria | 8138177 |
| 1329 | 2847931254 | 2847930680 | Bacteria | 9342022 |
| 1330 | 2847942347 | 2847939898 | Bacteria | 8606328 |
| 1331 | 2849083219 | 2849076700 | Bacteria | 7039503 |
| 1332 | 2857516348 | 2857509624 | Bacteria | 7472071 |
| 1333 | 2874592543 | 2874590934 | Bacteria | 8299676 |
| 1334 | 2874607880 | 2874604998 | Bacteria | 7834745 |
| 1335 | 2874617974 | 2874612657 | Bacteria | 8252029 |
| 1336 | 2874621197 | 2874620515 | Bacteria | 8290088 |
| 1337 | 2874628596 | 2874628541 | Bacteria | 8630250 |
| 1338 | 2874647162 | 2874645413 | Bacteria | 8214782 |
| 1339 | 2876769647 | 2876761206 | Bacteria | 10111113 |
| 1340 | 2876772546 | 2876771140 | Bacteria | 8287509 |
| 1341 | 2876816464 | 2876808645 | Bacteria | 8824342 |
| 1342 | 2876819807 | 2876818435 | Bacteria | 8274608 |
| 1343 | 2879076313 | 2879074833 | Bacteria | 8279565 |
| 1344 | 2879083776 | 2879083081 | Bacteria | 8587928 |
| 1345 | 2879100445 | 2879099564 | Bacteria | 10442239 |
| 1346 | 2879113307 | 2879110137 | Bacteria | 8907982 |
| 1347 | 2879128797 | 2879127579 | Bacteria | 8294491 |
| 1348 | 2879143618 | 2879142872 | Bacteria | 8267021 |
| 1349 | 2881673215 | 2881665667 | Bacteria | 8175609 |
| 1350 | 2885369329 | 2885366525 | Bacteria | 8326213 |
| 1351 | 2885377560 | 2885374607 | Bacteria | 8927485 |
| 1352 | 2885386726 | 2885383462 | Bacteria | 9473874 |
| 1353 | 2885415196 | 2885409591 | Bacteria | 9235467 |
| 1354 | 2888379395 | 2888378607 | Bacteria | 9652610 |
| 1355 | 2888390495 | 2888388044 | Bacteria | 7304136 |
| 1356 | 2888420116 | 2888419890 | Bacteria | 7857137 |
| 1357 | 2889035296 | 2889033259 | Bacteria | 9099371 |
| 1358 | 2903733540 | 2903727486 | Bacteria | 8281579 |
| 1359 | 2903777917 | 2903768456 | Bacteria | 9749579 |
| 1360 | 2904667742 | 2904666416 | Bacteria | 8226587 |
| 1361 | 2904708396 | |||
| 1362 | 2904716324 | 2904711408 | Bacteria | 9771557 |
| 1363 | 2906608894 | 2906602504 | Bacteria | 8295279 |
| 1364 | 2906613568 | |||
| 1365 | 2906631674 | 2906626472 | Bacteria | 8826946 |
| 1366 | 2906636576 | 2906635258 | Bacteria | 8601019 |
| 1367 | 2906648340 | 2906643746 | Bacteria | 8722424 |
| 1368 | 2906668102 | 2906660503 | Bacteria | 8595048 |
| 1369 | 2908747659 | 2908739725 | Bacteria | 8628932 |
| 1370 | 2922363213 | 2922361189 | Bacteria | 7436256 |
| 1371 | 2922369382 | |||
| 1372 | 2922388482 | 2922386360 | Bacteria | 7017218 |
| 1373 | 2922396578 | 2922393267 | Bacteria | 8285685 |
| 1374 | 2922434005 | |||
| 1375 | 2929618789 | 2929615660 | Bacteria | 9193770 |
| 1376 | 2929628526 | 2929624759 | Bacteria | 9339455 |
| 1377 | 2932790971 | 2932784394 | Bacteria | 9704911 |
| 1378 | 2932794136 | 2932794094 | Bacteria | 7915132 |
| 1379 | 2932809212 | 2932801729 | Bacteria | 7987968 |
| 1380 | 2932811975 | 2932809354 | Bacteria | 9135765 |
| 1381 | 2932825574 | 2932818245 | Bacteria | 9955613 |
| 1382 | 2932833687 | 2932828146 | Bacteria | 9745859 |
| 1383 | 2933580501 | 2933577622 | Bacteria | 9116884 |
| 1384 | 2935615514 | 2935608549 | Bacteria | 8203142 |
| 1385 | 2935623213 | 2935616580 | Bacteria | 9032984 |
| 1386 | 2935644288 | 2935638405 | Bacteria | 10015038 |
| 1387 | 2935654443 | 2935648319 | Bacteria | 8801166 |
| 1388 | 2935663323 | 2935656913 | Bacteria | 8965014 |
| 1389 | 2935672130 | 2935665750 | Bacteria | 9571747 |
| 1390 | 2935679350 | 2935675223 | Bacteria | 9928132 |
| 1391 | 2935686592 | 2935684952 | Bacteria | 9590419 |
| 1392 | 2935700373 | 2935694250 | Bacteria | 9291695 |
| 1393 | 2935710321 | 2935703347 | Bacteria | 10242284 |
| 1394 | 2935716280 | 2935713505 | Bacteria | 9608509 |
| 1395 | 2935723596 | 2935722832 | Bacteria | 9608746 |
| 1396 | 2935735151 | 2935732158 | Bacteria | 9706831 |
| 1397 | 2935744058 | 2935741537 | Bacteria | 9707219 |
| 1398 | 2935752558 | 2935750917 | Bacteria | 9590372 |
| 1399 | 2935763309 | 2935760218 | Bacteria | 9817913 |
| 1400 | 2935774282 | 2935769743 | Bacteria | 7878163 |
| 1401 | 2935783352 | 2935777560 | Bacteria | 8077691 |
| 1402 | 2935789003 | 2935785616 | Bacteria | 7962367 |
| 1403 | 2935796753 | 2935793552 | Bacteria | 8012592 |
| 1404 | 2935808312 | 2935801545 | Bacteria | 9301974 |
| 1405 | 2935816074 | 2935810662 | Bacteria | 9401221 |
| 1406 | 2935825685 | 2935819856 | Bacteria | 8261050 |
| 1407 | 2935833468 | 2935827899 | Bacteria | 10038562 |
| 1408 | 2935845974 | 2935837841 | Bacteria | 9454360 |
| 1409 | 2935853449 | 2935847175 | Bacteria | 8228321 |
| 1410 | 2935861461 | 2935855204 | Bacteria | 9035059 |
| 1411 | 2935869580 | 2935864058 | Bacteria | 9784707 |
| 1412 | 2935879909 | 2935873716 | Bacteria | 9632195 |
| 1413 | 2935889163 | 2935883170 | Bacteria | 7964738 |
| 1414 | 2935915051 | 2935908558 | Bacteria | 8568796 |
| 1415 | 2935918899 | 2935916978 | Bacteria | 9113783 |
| 1416 | 2935931384 | 2935926038 | Bacteria | 8601059 |
| 1417 | 2935939981 | 2935934488 | Bacteria | 8602579 |
| 1418 | 2935947672 | 2935942939 | Bacteria | 8599779 |
| 1419 | 2935956443 | 2935951376 | Bacteria | 8602333 |
| 1420 | 2935966711 | 2935959822 | Bacteria | 7869783 |
| 1421 | 2935973237 | 2935967501 | Bacteria | 8603075 |
| 1422 | 2935980520 | 2935975950 | Bacteria | 8347125 |
| 1423 | 2935990130 | 2935984226 | Bacteria | 8302647 |
| 1424 | 2935997868 | 2935992306 | Bacteria | 9802711 |
| 1425 | 2936008867 | 2936002035 | Bacteria | 9362176 |
| 1426 | 2936017518 | 2936011229 | Bacteria | 8801034 |
| 1427 | 2936025981 | 2936019824 | Bacteria | 8804134 |
| 1428 | 2936034823 | 2936028420 | Bacteria | 8965941 |
| 1429 | 2936041079 | 2936037263 | Bacteria | 9446081 |
| 1430 | 2936052919 | 2936046547 | Bacteria | 8903709 |
| 1431 | 2936060222 | 2936055302 | Bacteria | 8785755 |
| 1432 | 2940558471 | 2940556831 | Bacteria | 9590747 |
| 1433 | 2941535337 | 2941531003 | Bacteria | 7653939 |
| 1434 | 2941547143 | 2941538514 | Bacteria | 9402094 |
| 1435 | 3005475280 | 3005474847 | Bacteria | 9259049 |
| 1436 | 3005486668 | 3005483717 | Bacteria | 7877331 |
| 1437 | 3005508974 | 3005506211 | Bacteria | 6943378 |
| 1438 | 3005594143 | 3005587118 | Bacteria | 7794411 |
| 1439 | 3005595241 | 3005594810 | Bacteria | 8716512 |
| 1440 | 3005711184 | 3005710791 | Bacteria | 7622528 |
| 1441 | 3005718479 | 3005718088 | Bacteria | 8283608 |
| 1442 | 8006927254 | 8006926726 | Bacteria | 6749210 |
| 1443 | 8006935997 | 8006933436 | Bacteria | 10410654 |
| 1444 | 8006967642 | 8006964411 | Bacteria | 8966052 |
| 1445 | 8006975879 | 8006973647 | Bacteria | 10679141 |
| 1446 | 8006991112 | 8006984368 | Bacteria | 9651211 |
| 1447 | 8007000441 | 8006994254 | Bacteria | 8309700 |
| 1448 | 8016517985 | 8016511872 | Bacteria | 9921665 |
| 1449 | 8016526334 | 8016522445 | Bacteria | 8156687 |
| 1450 | 8016531398 | 8016530956 | Bacteria | 8155261 |
| 1451 | 8016544610 | 8016539877 | Bacteria | 8155419 |
| 1452 | 8016557464 | 8016548790 | Bacteria | 8155074 |
| 1453 | 8016565822 | 8016557553 | Bacteria | 8154380 |
| 1454 | 8016569665 | 8016566248 | Bacteria | 8158151 |
| 1455 | 8016582273 | 8016575299 | Bacteria | 8154085 |
| 1456 | 8016586143 | 8016583857 | Bacteria | 10421953 |
| 1457 | 8016603422 | 8016595262 | Bacteria | 8149947 |
| 1458 | 8016606357 | 8016603502 | Bacteria | 8731218 |
| 1459 | 8016618264 | 8016613128 | Bacteria | 8794220 |
| 1460 | 8016622913 | 8016622563 | Bacteria | 7999408 |
| 1461 | 8016635419 | 8016630954 | Bacteria | 9217207 |
| 1462 | 8017058655 | 8017057580 | Bacteria | 10023680 |
| 1463 | 8019531231 | 8019530166 | Bacteria | 8155624 |
| 1464 | 8019540321 | 8019538911 | Bacteria | 7872763 |
| 1465 | 8019549912 | 8019547302 | Bacteria | 7996444 |
| 1466 | 8019562660 | 8019555841 | Bacteria | 9642137 |
| 1467 | 8019572737 | 8019565922 | Bacteria | 9639779 |
| 1468 | 8019577002 | 8019576017 | Bacteria | 10049540 |
| 1469 | 8019606675 | 8019597564 | Bacteria | 10041141 |
| 1470 | 8019623169 | 8019619141 | Bacteria | 9218857 |
| 1471 | 8019629929 | 8019629233 | Bacteria | 8687553 |
| 1472 | 8019652276 | 8019648815 | Bacteria | 10014479 |
| 1473 | 8019666765 | 8019659431 | Bacteria | 8577854 |
| 1474 | 8019676526 | 8019668869 | Bacteria | 8791617 |
| 1475 | 8019679463 | 8019678201 | Bacteria | 8863603 |
| 1476 | 8019696041 | 8019687851 | Bacteria | 8712826 |
| 1477 | 8055742638 | 8055742211 | Bacteria | 9226248 |
| 1478 | 8056676147 | 8056673599 | Bacteria | 7871253 |
| 1479 | 8056682946 | 8056681323 | Bacteria | 8472857 |
| 1480 | 8056971499 | 8056967851 | Bacteria | 9038162 |
| 1481 | Ga0068856_100261863 | |||
| 1482 | JGI24736J21556_1009058 | |||
| 1483 | JGI24737J22298_10067448 | |||
| 1484 | JGI24744J21845_10006651 | |||
| 1485 | JGI25406J46586_10009349 | |||
| 1486 | JGI25406J46586_10154205 | |||
| 1487 | JGI25165J46597_1005291 | |||
| 1488 | JGI25153J46596_10005387 | |||
| 1489 | JGI25153J46596_10006271 | |||
| 1490 | JGI25153J46596_10006385 | |||
| 1491 | JGI25153J46596_10014578 | |||
| 1492 | JGI25153J46596_10042166 | |||
| 1493 | rootL2_10223649 | |||
| 1494 | JGI25160J50197_1002041 | |||
| 1495 | JGI25160J50197_1004384 | |||
| 1496 | JGI25160J50197_1005378 | |||
| 1497 | JGI25161J50226_1018010 | |||
| 1498 | JGI25404J52841_10000873 | |||
| 1499 | JGI25404J52841_10013024 | |||
| 1500 | JGI25404J52841_10067389 | |||
| 1501 | JGI25404J52841_10106369 | |||
| 1502 | Ga0055531_10004632 | |||
| 1503 | Ga0055531_10027490 | |||
| 1504 | Ga0055543_1007172 | |||
| 1505 | Ga0055543_1026148 | |||
| 1506 | Ga0065165_1003775 | |||
| 1507 | Ga0065165_1003886 | |||
| 1508 | Ga0065165_1019062 | |||
| 1509 | Ga0070658_10291913 | |||
| 1510 | Ga0070676_10547942 | |||
| 1511 | Ga0070690_100099015 | |||
| 1512 | Ga0070670_100525653 | |||
| 1513 | Ga0068869_100031930 | |||
| 1514 | Ga0068869_100401449 | |||
| 1515 | Ga0068869_100433628 | |||
| 1516 | Ga0070666_10322709 | |||
| 1517 | Ga0070666_10664934 | |||
| 1518 | Ga0070680_100277401 | |||
| 1519 | Ga0070682_100240415 | |||
| 1520 | Ga0068868_100162758 | |||
| 1521 | Ga0068868_100435601 | |||
| 1522 | Ga0068868_100614006 | |||
| 1523 | Ga0068868_100981123 | |||
| 1524 | Ga0068868_101352447 | |||
| 1525 | Ga0070660_100505443 | |||
| 1526 | Ga0070689_100143600 | |||
| 1527 | Ga0070687_100653555 | |||
| 1528 | Ga0070661_100268021 | |||
| 1529 | Ga0070668_100052173 | |||
| 1530 | Ga0070668_100080823 | |||
| 1531 | Ga0070668_100092406 | |||
| 1532 | Ga0070668_100093376 | |||
| 1533 | Ga0070668_100146930 | |||
| 1534 | Ga0070668_100226037 | |||
| 1535 | Ga0070668_100461726 | |||
| 1536 | Ga0070669_100196111 | |||
| 1537 | Ga0070675_100174031 | |||
| 1538 | Ga0070675_101051968 | |||
| 1539 | Ga0070671_100457252 | |||
| 1540 | Ga0070671_100577311 | |||
| 1541 | Ga0070674_100286693 | |||
| 1542 | Ga0070674_100476657 | |||
| 1543 | Ga0070674_101173489 | |||
| 1544 | Ga0070673_100288838 | |||
| 1545 | Ga0070673_100459906 | |||
| 1546 | Ga0070673_101509513 | |||
| 1547 | Ga0070688_100937311 | |||
| 1548 | Ga0070659_100129249 | |||
| 1549 | Ga0070659_101040940 | |||
| 1550 | Ga0070667_100184393 | |||
| 1551 | Ga0070709_10000164 | |||
| 1552 | Ga0070709_10184937 | |||
| 1553 | Ga0070714_100047913 | |||
| 1554 | Ga0070714_100116517 | |||
| 1555 | Ga0070713_100004014 | |||
| 1556 | Ga0070713_100094561 | |||
| 1557 | Ga0070713_100196055 | |||
| 1558 | Ga0070713_100906911 | |||
| 1559 | Ga0070710_10000283 | |||
| 1560 | Ga0070710_10153524 | |||
| 1561 | Ga0070701_10438818 | |||
| 1562 | Ga0070711_100005189 | |||
| 1563 | Ga0070711_100015539 | |||
| 1564 | Ga0070663_100040755 | |||
| 1565 | Ga0070663_100048472 | |||
| 1566 | Ga0070663_100124021 | |||
| 1567 | Ga0070663_100124757 | |||
| 1568 | Ga0070663_100126633 | |||
| 1569 | Ga0070663_100206905 | |||
| 1570 | Ga0070663_100455756 | |||
| 1571 | Ga0070663_100586840 | |||
| 1572 | Ga0070663_100617546 | |||
| 1573 | Ga0070663_100845157 | |||
| 1574 | Ga0070678_100031271 | |||
| 1575 | Ga0070678_100298265 | |||
| 1576 | Ga0070678_100376863 | |||
| 1577 | Ga0070678_100435374 | |||
| 1578 | Ga0070662_100249738 | |||
| 1579 | Ga0070662_100412757 | |||
| 1580 | Ga0070681_10099168 | |||
| 1581 | Ga0070706_100375313 | |||
| 1582 | Ga0070707_100137959 | |||
| 1583 | Ga0070679_100177508 | |||
| 1584 | Ga0070697_100073538 | |||
| 1585 | Ga0068853_100272640 | |||
| 1586 | Ga0068853_100330786 | |||
| 1587 | Ga0068853_100366307 | |||
| 1588 | Ga0068853_100504203 | |||
| 1589 | Ga0068853_100588946 | |||
| 1590 | Ga0070672_100133626 | |||
| 1591 | Ga0070672_100209828 | |||
| 1592 | Ga0070686_100300815 | |||
| 1593 | Ga0070693_100054359 | |||
| 1594 | Ga0070693_100334448 | |||
| 1595 | Ga0070665_100024388 | |||
| 1596 | Ga0070665_100113273 | |||
| 1597 | Ga0070665_100232557 | |||
| 1598 | Ga0070665_100263835 | |||
| 1599 | Ga0070665_100423701 | |||
| 1600 | Ga0070665_100666282 | |||
| 1601 | Ga0070665_101829538 | |||
| 1602 | Ga0068855_100205366 | |||
| 1603 | Ga0070664_100114656 | |||
| 1604 | Ga0068857_100276126 | |||
| 1605 | Ga0068857_100480307 | |||
| 1606 | Ga0068857_100538843 | |||
| 1607 | Ga0068857_100574455 | |||
| 1608 | Ga0068854_100037985 | |||
| 1609 | Ga0068854_100350862 | |||
| 1610 | Ga0068856_100101992 | |||
| 1611 | Ga0068856_100151979 | |||
| 1612 | Ga0068856_100762197 | |||
| 1613 | Ga0068856_100892822 | |||
| 1614 | Ga0070702_100034991 | |||
| 1615 | Ga0070702_100176664 | |||
| 1616 | Ga0068852_100164356 | |||
| 1617 | Ga0068852_100340850 | |||
| 1618 | Ga0068852_100695221 | |||
| 1619 | Ga0068852_100819838 | |||
| 1620 | Ga0068859_100320351 | |||
| 1621 | Ga0068859_100404153 | |||
| 1622 | Ga0068859_100673693 | |||
| 1623 | Ga0068859_100930930 | |||
| 1624 | Ga0068864_100076165 | |||
| 1625 | Ga0068866_10064783 | |||
| 1626 | Ga0068866_10154652 | |||
| 1627 | Ga0068861_100362861 | |||
| 1628 | Ga0068861_100401389 | |||
| 1629 | Ga0068861_100672704 | |||
| 1630 | Ga0068870_10362037 | |||
| 1631 | Ga0068863_100572227 | |||
| 1632 | Ga0068863_100585417 | |||
| 1633 | Ga0068863_100687203 | |||
| 1634 | Ga0068863_100792837 | |||
| 1635 | Ga0068863_101031747 | |||
| 1636 | Ga0068858_100241443 | |||
| 1637 | Ga0068858_100292276 | |||
| 1638 | Ga0068858_100326385 | |||
| 1639 | Ga0068858_100414739 | |||
| 1640 | Ga0068858_100504965 | |||
| 1641 | Ga0068858_100514563 | |||
| 1642 | Ga0068860_100017741 | |||
| 1643 | Ga0068860_100253173 | |||
| 1644 | Ga0068860_100443083 | |||
| 1645 | Ga0068862_100086095 | |||
| 1646 | Ga0081455_10016293 | |||
| 1647 | Ga0081455_10027264 | |||
| 1648 | Ga0081455_10169663 | |||
| 1649 | Ga0081455_10196830 | |||
| 1650 | Ga0081455_10205630 | |||
| 1651 | Ga0081455_10209159 | |||
| 1652 | Ga0081455_10400114 | |||
| 1653 | Ga0081540_1002717 | |||
| 1654 | Ga0081540_1004243 | |||
| 1655 | Ga0081540_1004583 | |||
| 1656 | Ga0081540_1006735 | |||
| 1657 | Ga0081540_1014469 | |||
| 1658 | Ga0081540_1018204 | |||
| 1659 | Ga0081540_1036177 | |||
| 1660 | Ga0081540_1049325 | |||
| 1661 | Ga0081540_1080078 | |||
| 1662 | Ga0081539_10000371 | |||
| 1663 | Ga0081539_10018231 | |||
| 1664 | Ga0081539_10078005 | |||
| 1665 | Ga0081539_10143754 | |||
| 1666 | Ga0070717_10038762 | |||
| 1667 | Ga0070717_10616045 | |||
| 1668 | Ga0070717_11219148 | |||
| 1669 | Ga0075365_10007177 | |||
| 1670 | Ga0075365_10007995 | |||
| 1671 | Ga0075365_10044897 | |||
| 1672 | Ga0075365_10117749 | |||
| 1673 | Ga0075365_10171744 | |||
| 1674 | Ga0075365_10196786 | |||
| 1675 | Ga0075365_10264509 | |||
| 1676 | Ga0075365_10337125 | |||
| 1677 | Ga0075368_10014493 | |||
| 1678 | Ga0075363_100000382 | |||
| 1679 | Ga0075363_100009480 | |||
| 1680 | Ga0075363_100171579 | |||
| 1681 | Ga0075364_10072888 | |||
| 1682 | Ga0075364_10096242 | |||
| 1683 | Ga0075364_10114904 | |||
| 1684 | Ga0075364_10170040 | |||
| 1685 | Ga0075364_10415813 | |||
| 1686 | Ga0070715_10086905 | |||
| 1687 | Ga0070715_10161682 | |||
| 1688 | Ga0070715_10304498 | |||
| 1689 | Ga0070716_100168012 | |||
| 1690 | Ga0070716_100307856 | |||
| 1691 | Ga0070712_100014272 | |||
| 1692 | Ga0070712_100026701 | |||
| 1693 | Ga0070712_100248984 | |||
| 1694 | Ga0075362_10001063 | |||
| 1695 | Ga0075362_10093881 | |||
| 1696 | Ga0075367_10026606 | |||
| 1697 | Ga0075367_10066229 | |||
| 1698 | Ga0075367_10084792 | |||
| 1699 | Ga0075367_10122497 | |||
| 1700 | Ga0075367_10128287 | |||
| 1701 | Ga0075367_10259502 | |||
| 1702 | Ga0075367_10376682 | |||
| 1703 | Ga0075369_10184077 | |||
| 1704 | Ga0075369_10205841 | |||
| 1705 | Ga0075369_10424051 | |||
| 1706 | Ga0075366_10043941 | |||
| 1707 | Ga0075366_10065380 | |||
| 1708 | Ga0075366_10086496 | |||
| 1709 | Ga0075366_10106390 | |||
| 1710 | Ga0075366_10186447 | |||
| 1711 | Ga0075366_10231164 | |||
| 1712 | Ga0075366_10383996 | |||
| 1713 | Ga0075366_10455285 | |||
| 1714 | Ga0075366_10495048 | |||
| 1715 | Ga0097621_100892052 | |||
| 1716 | Ga0097621_100951034 | |||
| 1717 | Ga0075370_10029240 | |||
| 1718 | Ga0075370_10112638 | |||
| 1719 | Ga0075370_10144561 | |||
| 1720 | Ga0075370_10202053 | |||
| 1721 | Ga0068871_100360992 | |||
| 1722 | Ga0068871_101296814 | |||
| 1723 | Ga0075428_100221744 | |||
| 1724 | Ga0068865_100128766 | |||
| 1725 | Ga0068865_100323303 | |||
| 1726 | Ga0075436_100497088 | |||
| 1727 | Ga0097620_100320365 | |||
| 1728 | Ga0097620_100404141 | |||
| 1729 | Ga0097620_100673723 | |||
| 1730 | Ga0097620_100930904 | |||
| 1731 | Ga0099824_1015237 | |||
| 1732 | Ga0099822_1035053 | |||
| 1733 | Ga0075435_100168984 | |||
| 1734 | Ga0099794_10421978 | |||
| 1735 | Ga0099795_10029851 | |||
| 1736 | Ga0099795_10119526 | |||
| 1737 | Ga0105251_10189061 | |||
| 1738 | Ga0105250_10186222 | |||
| 1739 | Ga0105250_10401323 | |||
| 1740 | Ga0105240_10178027 | |||
| 1741 | Ga0105240_10226073 | |||
| 1742 | Ga0105240_10642954 | |||
| 1743 | Ga0105240_10758931 | |||
| 1744 | Ga0111539_10417181 | |||
| 1745 | Ga0105245_10306632 | |||
| 1746 | Ga0105245_10504544 | |||
| 1747 | Ga0105245_11323201 | |||
| 1748 | Ga0105247_10023886 | |||
| 1749 | Ga0105247_10131208 | |||
| 1750 | Ga0105247_10142907 | |||
| 1751 | Ga0105247_10167541 | |||
| 1752 | Ga0105247_10275874 | |||
| 1753 | Ga0105247_10413079 | |||
| 1754 | Ga0114129_11026378 | |||
| 1755 | Ga0105243_10121232 | |||
| 1756 | Ga0105243_11260329 | |||
| 1757 | Ga0105241_10127058 | |||
| 1758 | Ga0105241_11041033 | |||
| 1759 | Ga0105241_11076802 | |||
| 1760 | Ga0105242_10129766 | |||
| 1761 | Ga0105242_10215683 | |||
| 1762 | Ga0105242_11013291 | |||
| 1763 | Ga0105242_11025958 | |||
| 1764 | Ga0105248_10041030 | |||
| 1765 | Ga0105248_10220918 | |||
| 1766 | Ga0105248_10342081 | |||
| 1767 | Ga0105248_10392667 | |||
| 1768 | Ga0105248_11057603 | |||
| 1769 | Ga0105237_10069275 | |||
| 1770 | Ga0105237_10142859 | |||
| 1771 | Ga0105237_10400005 | |||
| 1772 | Ga0105237_10443980 | |||
| 1773 | Ga0105237_10531032 | |||
| 1774 | Ga0105237_10907925 | |||
| 1775 | Ga0105237_10970004 | |||
| 1776 | Ga0105237_11191088 | |||
| 1777 | Ga0105238_10194243 | |||
| 1778 | Ga0105238_10215852 | |||
| 1779 | Ga0105238_10538750 | |||
| 1780 | Ga0105238_10563306 | |||
| 1781 | Ga0105238_10583601 | |||
| 1782 | Ga0105238_11456335 | |||
| 1783 | Ga0105249_10059548 | |||
| 1784 | Ga0105249_10149581 | |||
| 1785 | Ga0105249_10432199 | |||
| 1786 | Ga0105249_11609445 | |||
| 1787 | Ga0099796_10006414 | |||
| 1788 | Ga0099796_10015670 | |||
| 1789 | Ga0099796_10141877 | |||
| 1790 | Ga0105239_10066302 | |||
| 1791 | Ga0105239_10246790 | |||
| 1792 | Ga0105239_10280959 | |||
| 1793 | Ga0105239_10343708 | |||
| 1794 | Ga0105239_10495695 | |||
| 1795 | Ga0105239_10509286 | |||
| 1796 | Ga0105239_10572339 | |||
| 1797 | Ga0105239_10996996 | |||
| 1798 | Ga0105246_10040758 | |||
| 1799 | Ga0105246_10239352 | |||
| 1800 | Ga0105246_10374335 | |||
| 1801 | Ga0157370_10074997 | |||
| 1802 | Ga0157370_10222534 | |||
| 1803 | Ga0157369_10030438 | |||
| 1804 | Ga0157374_10255525 | |||
| 1805 | Ga0157374_10270162 | |||
| 1806 | Ga0157374_10838057 | |||
| 1807 | Ga0157378_10020915 | |||
| 1808 | Ga0157378_10070174 | |||
| 1809 | Ga0157378_10233186 | |||
| 1810 | Ga0157378_10444310 | |||
| 1811 | Ga0157378_10466163 | |||
| 1812 | Ga0157378_10714024 | |||
| 1813 | Ga0163162_10211259 | |||
| 1814 | Ga0163162_10413485 | |||
| 1815 | Ga0163162_10413874 | |||
| 1816 | Ga0163162_10743862 | |||
| 1817 | Ga0163162_10824995 | |||
| 1818 | Ga0157372_10718860 | |||
| 1819 | Ga0157375_10217414 | |||
| 1820 | Ga0157375_10783766 | |||
| 1821 | Ga0157375_11007278 | |||
| 1822 | Ga0157375_11227028 | |||
| 1823 | Ga0163163_10028423 | |||
| 1824 | Ga0163163_10133712 | |||
| 1825 | Ga0163163_10690854 | |||
| 1826 | Ga0163163_10899950 | |||
| 1827 | Ga0163163_11046276 | |||
| 1828 | Ga0157380_10114201 | |||
| 1829 | Ga0157380_10239624 | |||
| 1830 | Ga0157380_10873498 | |||
| 1831 | Ga0157380_11253403 | |||
| 1832 | Ga0157377_10207455 | |||
| 1833 | Ga0157377_10295538 | |||
| 1834 | Ga0157379_10289247 | |||
| 1835 | Ga0157379_10381779 | |||
| 1836 | Ga0157379_10707919 | |||
| 1837 | Ga0157376_10163532 | |||
| 1838 | Ga0157376_10166023 | |||
| 1839 | Ga0157376_11292722 | |||
| 1840 | Ga0163161_10072163 | |||
| 1841 | Ga0163161_10265581 | |||
| 1842 | Ga0206353_11400766 | |||
| 1843 | Ga0213876_10249333 | |||
| 1844 | Ga0213875_10243397 | |||
| 1845 | Ga0213875_10395076 | |||
| 1846 | Ga0209563_105793 | |||
| 1847 | Ga0209677_105710 | |||
| 1848 | Ga0209148_1000295 | |||
| 1849 | Ga0209233_1003058 | |||
| 1850 | Ga0209233_1055178 | |||
| 1851 | Ga0209233_1060958 | |||
| 1852 | Ga0209455_1008110 | |||
| 1853 | Ga0209455_1021718 | |||
| 1854 | Ga0209673_1032099 | |||
| 1855 | Ga0209564_1007238 | |||
| 1856 | Ga0209564_1015758 | |||
| 1857 | Ga0209758_1000069 | |||
| 1858 | Ga0209758_1001816 | |||
| 1859 | Ga0209758_1002809 | |||
| 1860 | Ga0209758_1003717 | |||
| 1861 | Ga0209758_1006696 | |||
| 1862 | Ga0209758_1007298 | |||
| 1863 | Ga0209758_1039944 | |||
| 1864 | Ga0209758_1041471 | |||
| 1865 | Ga0209758_1053011 | |||
| 1866 | Ga0209758_1057118 | |||
| 1867 | Ga0209758_1102552 | |||
| 1868 | Ga0209758_1119004 | |||
| 1869 | Ga0209050_1074670 | |||
| 1870 | Ga0209256_1005844 | |||
| 1871 | Ga0209256_1016629 | |||
| 1872 | Ga0209256_1034701 | |||
| 1873 | Ga0209256_1056171 | |||
| 1874 | Ga0207426_1001802 | |||
| 1875 | Ga0207426_1004864 | |||
| 1876 | Ga0207426_1027673 | |||
| 1877 | Ga0209257_1004375 | |||
| 1878 | Ga0209257_1020602 | |||
| 1879 | Ga0207697_10087462 | |||
| 1880 | Ga0207697_10474344 | |||
| 1881 | Ga0207656_10081557 | |||
| 1882 | Ga0207692_10000528 | |||
| 1883 | Ga0207692_10142642 | |||
| 1884 | Ga0207642_10336808 | |||
| 1885 | Ga0207710_10062593 | |||
| 1886 | Ga0207710_10077845 | |||
| 1887 | Ga0207688_10148840 | |||
| 1888 | Ga0207688_10205271 | |||
| 1889 | Ga0207647_10009168 | |||
| 1890 | Ga0207647_10138451 | |||
| 1891 | Ga0207685_10017070 | |||
| 1892 | Ga0207685_10116154 | |||
| 1893 | Ga0207699_10000514 | |||
| 1894 | Ga0207645_10082783 | |||
| 1895 | Ga0207645_10214197 | |||
| 1896 | Ga0207643_10047401 | |||
| 1897 | Ga0207643_10214645 | |||
| 1898 | Ga0207643_10274946 | |||
| 1899 | Ga0207705_10164146 | |||
| 1900 | Ga0207705_10175451 | |||
| 1901 | Ga0207705_10698945 | |||
| 1902 | Ga0207684_10642969 | |||
| 1903 | Ga0207654_10024270 | |||
| 1904 | Ga0207654_10411346 | |||
| 1905 | Ga0207654_10795968 | |||
| 1906 | Ga0207695_10320248 | |||
| 1907 | Ga0207695_10341970 | |||
| 1908 | Ga0207695_10370168 | |||
| 1909 | Ga0207671_10038928 | |||
| 1910 | Ga0207671_10327691 | |||
| 1911 | Ga0207671_10480717 | |||
| 1912 | Ga0207671_10532225 | |||
| 1913 | Ga0207671_10573074 | |||
| 1914 | Ga0207693_10008295 | |||
| 1915 | Ga0207693_10011107 | |||
| 1916 | Ga0207693_10077119 | |||
| 1917 | Ga0207693_10337439 | |||
| 1918 | Ga0207693_10788662 | |||
| 1919 | Ga0207663_10171760 | |||
| 1920 | Ga0207657_10209041 | |||
| 1921 | Ga0207657_10464155 | |||
| 1922 | Ga0207657_10493126 | |||
| 1923 | Ga0207649_10267205 | |||
| 1924 | Ga0207649_10617338 | |||
| 1925 | Ga0207646_10105273 | |||
| 1926 | Ga0207681_10070638 | |||
| 1927 | Ga0207681_10827855 | |||
| 1928 | Ga0207694_10199050 | |||
| 1929 | Ga0207694_10410858 | |||
| 1930 | Ga0207694_10777121 | |||
| 1931 | Ga0207694_10946197 | |||
| 1932 | Ga0207650_10651439 | |||
| 1933 | Ga0207650_11376228 | |||
| 1934 | Ga0207659_10281115 | |||
| 1935 | Ga0207659_10407214 | |||
| 1936 | Ga0207687_10022504 | |||
| 1937 | Ga0207687_10710600 | |||
| 1938 | Ga0207700_10004601 | |||
| 1939 | Ga0207700_10046786 | |||
| 1940 | Ga0207700_10157523 | |||
| 1941 | Ga0207700_10253220 | |||
| 1942 | Ga0207664_10040008 | |||
| 1943 | Ga0207664_10172365 | |||
| 1944 | Ga0207644_10224481 | |||
| 1945 | Ga0207644_10396134 | |||
| 1946 | Ga0207644_10579870 | |||
| 1947 | Ga0207690_10146061 | |||
| 1948 | Ga0207690_10504883 | |||
| 1949 | Ga0207690_10716679 | |||
| 1950 | Ga0207706_10291959 | |||
| 1951 | Ga0207706_10298695 | |||
| 1952 | Ga0207706_10510052 | |||
| 1953 | Ga0207706_10798769 | |||
| 1954 | Ga0207686_10215785 | |||
| 1955 | Ga0207686_10338281 | |||
| 1956 | Ga0207686_10468151 | |||
| 1957 | Ga0207686_10668772 | |||
| 1958 | Ga0207709_10085394 | |||
| 1959 | Ga0207709_10396460 | |||
| 1960 | Ga0207670_10411581 | |||
| 1961 | Ga0207669_10060896 | |||
| 1962 | Ga0207669_10149698 | |||
| 1963 | Ga0207669_10352590 | |||
| 1964 | Ga0207669_10577417 | |||
| 1965 | Ga0207704_10293428 | |||
| 1966 | Ga0207704_10421295 | |||
| 1967 | Ga0207665_10406552 | |||
| 1968 | Ga0207691_10045505 | |||
| 1969 | Ga0207691_10094759 | |||
| 1970 | Ga0207691_10375552 | |||
| 1971 | Ga0207711_10068416 | |||
| 1972 | Ga0207711_10236862 | |||
| 1973 | Ga0207711_10589281 | |||
| 1974 | Ga0207689_10012963 | |||
| 1975 | Ga0207689_10143353 | |||
| 1976 | Ga0207689_10213806 | |||
| 1977 | Ga0207679_10386125 | |||
| 1978 | Ga0207679_10962248 | |||
| 1979 | Ga0207667_10289550 | |||
| 1980 | Ga0207667_11148259 | |||
| 1981 | Ga0207712_10040689 | |||
| 1982 | Ga0207712_10624128 | |||
| 1983 | Ga0207668_10048924 | |||
| 1984 | Ga0207668_10160677 | |||
| 1985 | Ga0207668_10225530 | |||
| 1986 | Ga0207668_10301972 | |||
| 1987 | Ga0207668_10510058 | |||
| 1988 | Ga0207668_10756753 | |||
| 1989 | Ga0207640_10284234 | |||
| 1990 | Ga0207640_10525771 | |||
| 1991 | Ga0207658_10066181 | |||
| 1992 | Ga0207658_10138311 | |||
| 1993 | Ga0207658_10229032 | |||
| 1994 | Ga0207677_10232224 | |||
| 1995 | Ga0207677_10247489 | |||
| 1996 | Ga0207677_11152790 | |||
| 1997 | Ga0207703_10333753 | |||
| 1998 | Ga0207703_11350834 | |||
| 1999 | Ga0207639_10181545 | |||
| 2000 | Ga0207639_10284713 | |||
| 2001 | Ga0207639_10516100 | |||
| 2002 | Ga0207678_10016938 | |||
| 2003 | Ga0207678_10097135 | |||
| 2004 | Ga0207678_10105038 | |||
| 2005 | Ga0207678_10110740 | |||
| 2006 | Ga0207678_10121192 | |||
| 2007 | Ga0207678_10543179 | |||
| 2008 | Ga0207678_10873472 | |||
| 2009 | Ga0207678_10893466 | |||
| 2010 | Ga0207678_10975680 | |||
| 2011 | Ga0207708_10216595 | |||
| 2012 | Ga0207702_10306634 | |||
| 2013 | Ga0207702_10314000 | |||
| 2014 | Ga0207702_11714122 | |||
| 2015 | Ga0207641_10518813 | |||
| 2016 | Ga0207641_10586085 | |||
| 2017 | Ga0207641_11322477 | |||
| 2018 | Ga0207648_10171204 | |||
| 2019 | Ga0207648_11101054 | |||
| 2020 | Ga0207676_10261998 | |||
| 2021 | Ga0207676_10289778 | |||
| 2022 | Ga0207676_10657127 | |||
| 2023 | Ga0207674_10307071 | |||
| 2024 | Ga0207675_100124474 | |||
| 2025 | Ga0207675_100326301 | |||
| 2026 | Ga0207675_100332410 | |||
| 2027 | Ga0207675_100600992 | |||
| 2028 | Ga0207675_100928190 | |||
| 2029 | Ga0207683_10115817 | |||
| 2030 | Ga0207683_10167729 | |||
| 2031 | Ga0207683_10173569 | |||
| 2032 | Ga0207683_10466989 | |||
| 2033 | Ga0207698_10302685 | |||
| 2034 | Ga0207698_10724072 | |||
| 2035 | Ga0209389_1000102 | |||
| 2036 | Ga0209389_1000142 | |||
| 2037 | Ga0209589_1000331 | |||
| 2038 | Ga0209489_100404 | |||
| 2039 | Ga0209489_100818 | |||
| 2040 | Ga0209700_100408 | |||
| 2041 | Ga0209179_1111495 | |||
| 2042 | Ga0209588_1051525 | |||
| 2043 | Ga0209588_1176845 | |||
| 2044 | Ga0209813_10008392 | |||
| 2045 | Ga0209813_10010724 | |||
| 2046 | Ga0207428_10223601 | |||
| 2047 | Ga0268266_10008616 | |||
| 2048 | Ga0268266_10028293 | |||
| 2049 | Ga0268266_10048797 | |||
| 2050 | Ga0268266_10399636 | |||
| 2051 | Ga0268266_11523558 | |||
| 2052 | Ga0268265_10014031 | |||
| 2053 | Ga0268265_10102999 | |||
| 2054 | Ga0268265_10183395 | |||
| 2055 | Ga0268265_10474181 | |||
| 2056 | Ga0268265_10480658 | |||
| 2057 | Ga0268265_10569855 | |||
| 2058 | Ga0268264_10000062 | |||
| 2059 | Ga0268264_10050935 | |||
| 2060 | Ga0268264_11297118 | |||
| 2061 | Ga0268264_11324678 | |||
| 2062 | Ga0265319_1030726 | |||
| 2063 | Ga0265334_10005800 | |||
| 2064 | Ga0265318_10012602 | |||
| 2065 | Ga0265323_10002871 | |||
| 2066 | Ga0265322_10049751 | |||
| 2067 | Ga0265336_10002816 | |||
| 2068 | Ga0307517_10000232 | |||
| 2069 | Ga0307517_10328450 | |||
| 2070 | Ga0307515_10050080 | |||
| 2071 | Ga0265338_10000422 | |||
| 2072 | Ga0307511_10137689 | |||
| 2073 | Ga0265760_10026912 | |||
| 2074 | Ga0307513_10189662 | |||
| 2075 | Ga0307513_10358722 | |||
| 2076 | Ga0307509_10844940 | |||
| 2077 | Ga0307408_100107648 | |||
| 2078 | Ga0307408_100520348 | |||
| 2079 | Ga0307408_101142355 | |||
| 2080 | Ga0307508_10039596 | |||
| 2081 | Ga0307508_10117670 | |||
| 2082 | Ga0307508_10553899 | |||
| 2083 | Ga0307516_10078366 | |||
| 2084 | Ga0307516_10078911 | |||
| 2085 | Ga0307516_10107836 | |||
| 2086 | Ga0307516_10186022 | |||
| 2087 | Ga0307516_10238958 | |||
| 2088 | Ga0307516_10445321 | |||
| 2089 | Ga0307413_10046715 | |||
| 2090 | Ga0307413_10189102 | |||
| 2091 | Ga0307410_10467545 | |||
| 2092 | Ga0307406_10138092 | |||
| 2093 | Ga0307406_10225754 | |||
| 2094 | Ga0307406_10268796 | |||
| 2095 | Ga0307407_10396216 | |||
| 2096 | Ga0307412_10209929 | |||
| 2097 | Ga0307409_100739361 | |||
| 2098 | Ga0307416_100123117 | |||
| 2099 | Ga0307416_100248362 | |||
| 2100 | Ga0307416_100349319 | |||
| 2101 | Ga0307411_10110047 | |||
| 2102 | Ga0307415_100050805 | |||
| 2103 | Ga0307415_100233049 | |||
| 2104 | Ga0307507_10063749 | |||
| 2105 | Ga0307510_10005192 | |||
| 2106 | Ga0307510_10036976 | |||
| 2107 | Ga0373926_0011112 | |||
| 2108 | Ga0373926_0024481 | |||
| 2109 | Ga0373934_0059329 | |||
| 2110 | Ga0373951_0017931 | |||
| 2111 | Ga0373923_0122663 | |||
| 2112 | Ga0373923_0180281 | |||
| 2113 | Ga0373932_0318529 | |||
| 2114 | Ga0373936_0007829 | |||
| 2115 | Ga0373936_0168922 | |||
| 2116 | Ga0373945_0033750 | |||
| 2117 | Ga0373953_0007669 | |||
| 2118 | Ga0373954_0011714 | |||
| 2119 | Ga0373954_0044076 | |||
| 2120 | Ga0373956_0019947 | |||
| 2121 | Ga0373957_0005744 | |||
| 2122 | Ga0373960_0280982 | |||
| 2123 | Ga0373943_0003229 | |||
| 2124 | Ga0373943_0111820 | |||
| 2125 | Ga0373946_0007257 | |||
| 2126 | Ga0373946_0102886 | |||
| 2127 | Ga0373955_0011290 | |||
| 2128 | Ga0373955_0070950 | |||
| 2129 | Ga0373942_0256780 | |||
| 2130 | Ga0373924_0002441 | |||
| 2131 | Ga0373924_0427177 | |||
| 2132 | Ga0373931_0090396 | |||
| 2133 | Ga0373931_0368580 | |||
| 2134 | Ga0373935_0004301 | |||
| 2135 | Ga0373935_0139374 | |||
| 2136 | Ga0373927_0000766 | |||
| 2137 | Ga0373927_0002321 | |||
| 2138 | Ga0373927_0016726 | |||
| 2139 | Ga0373933_0052367 | |||
| 2140 | Ga0373933_0095429 | |||
| 2141 | Ga0373947_0000310 | |||
| 2142 | Ga0373947_0021132 | |||
| 2143 | Ga0373947_0026772 | |||
| 2144 | Ga0373937_1289280 | |||
| 2145 | Ga0373925_0008418 | |||
| 2146 | Ga0373925_0016057 | |||
| 2147 | Ga0373925_0044131 | |||
| 2148 | Ga0373925_1330677 | |||
| 2149 | Ga0395900_0000423 | |||
| 2150 | Ga0395898_0010460 | |||
| 2151 | Ga0395905_0092357 | |||
| 2152 | Ga0395905_0268368 | |||
| 2153 | Ga0395905_0277344 | |||
| 2154 | Ga0395905_1009238 | |||
| 2155 | Ga0395905_1089476 | |||
| 2156 | Ga0395905_1184253 | |||
| 2157 | Ga0436364_0628911 | |||
| 2158 | Ga0436364_0760368 | |||
| 2159 | Ga0436364_0953579 | |||
| 2160 | Ga0436364_1117557 | |||
| 2161 | Ga0436364_1523184 | |||
| 2162 | Ga0395901_0101076 | |||
| 2163 | Ga0436365_0285466 | |||
| 2164 | Ga0436365_1227774 | |||
| 2165 | Ga0436365_1254305 | |||
| 2166 | Ga0436365_1567631 | |||
| 2167 | Ga0436363_1561683 | |||
| 2168 | Ga0451791_0396477 | |||
| 2169 | Ga0451791_0424813 | |||
| 2170 | Ga0451793_1501710 | |||
| 2171 | Ga0451797_0957375 | |||
| 2172 | Ga0451802_1930506 | |||
| 2173 | Ga0451804_0020778 | |||
| 2174 | Ga0451835_0562890 | |||
| 2175 | Ga0451841_1340266 | |||
| 2176 | Ga0451849_0890308 | |||
| 2177 | Ga0451851_1013094 | |||
| 2178 | Ga0451855_0310176 | |||
| 2179 | Ga0451853_0527059 | |||
| 2180 | Ga0439448_0193791 | |||
| 2181 | Ga0439458_0185223 | |||
| 2182 | Ga0439459_0006680 | |||
| 2183 | Ga0439459_0034763 | |||
| 2184 | Ga0466972_0047042 | |||
| 2185 | Ga0466972_0125356 | |||
| 2186 | Ga0466965_0208416 | |||
| 2187 | Ga0466966_0000628 | |||
| 2188 | Ga0466961_0002516 | |||
| 2189 | Ga0466968_0139422 | |||
| 2190 | Ga0466968_0298774 | |||
| 2191 | Ga0466970_0047275 | |||
| 2192 | Ga0466960_0073114 | |||
| 2193 | Ga0466960_0485017 | |||
| 2194 | Ga0466959_0033457 | |||
| 2195 | Ga0466967_0241336 | |||
| 2196 | Ga0495617_035848 | |||
| 2197 | Ga0495617_040028 | |||
| 2198 | Ga0495617_208192 | |||
| 2199 | Ga0495592_0021717 | |||
| 2200 | Ga0495592_0029657 | |||
| 2201 | Ga0495592_0084325 | |||
| 2202 | Ga0495592_0143017 | |||
| 2203 | Ga0495592_0182910 | |||
| 2204 | Ga0495603_0000936 | |||
| 2205 | Ga0495603_0014727 | |||
| 2206 | Ga0495603_0024867 | |||
| 2207 | Ga0495603_0025116 | |||
| 2208 | Ga0495603_0113161 | |||
| 2209 | Ga0495603_0121441 | |||
| 2210 | Ga0495590_0027483 | |||
| 2211 | Ga0495629_0001416 | |||
| 2212 | Ga0495629_0003103 | |||
| 2213 | Ga0495629_0049337 | |||
| 2214 | Ga0495629_0182713 | |||
| 2215 | Ga0495629_0335352 | |||
| 2216 | Ga0495629_0441399 | |||
| 2217 | Ga0495638_0068794 | |||
| 2218 | Ga0495638_0215046 | |||
| 2219 | Ga0495641_0005002 | |||
| 2220 | Ga0495641_0033486 | |||
| 2221 | Ga0495651_0008730 | |||
| 2222 | Ga0495651_0041654 | |||
| 2223 | Ga0495651_0110186 | |||
| 2224 | Ga0495651_0328589 | |||
| 2225 | Ga0495653_0028280 | |||
| 2226 | Ga0495653_0050804 | |||
| 2227 | Ga0495653_0058545 | |||
| 2228 | Ga0495650_0090423 | |||
| 2229 | Ga0495580_0002805 | |||
| 2230 | Ga0495580_0062616 | |||
| 2231 | Ga0495580_0236049 | |||
| 2232 | Ga0495582_0000302 | |||
| 2233 | Ga0495605_0050188 | |||
| 2234 | Ga0495605_0103601 | |||
| 2235 | Ga0495639_0000072 | |||
| 2236 | Ga0495662_0001578 | |||
| 2237 | Ga0495662_0095461 | |||
| 2238 | Ga0495664_0015202 | |||
| 2239 | Ga0495664_0044387 | |||
| 2240 | Ga0495664_0045491 | |||
| 2241 | Ga0495664_0137848 | |||
| 2242 | Ga0495584_0129680 | |||
| 2243 | Ga0495584_0131185 | |||
| 2244 | Ga0495584_0307972 | |||
| 2245 | Ga0495584_0402809 | |||
| 2246 | Ga0495585_0036674 | |||
| 2247 | Ga0495585_0112731 | |||
| 2248 | Ga0495594_0000046 | |||
| 2249 | Ga0495594_0117110 | |||
| 2250 | Ga0495594_0466224 | |||
| 2251 | Ga0495596_0035053 | |||
| 2252 | Ga0495596_0077695 | |||
| 2253 | Ga0495607_0106803 | |||
| 2254 | Ga0495583_0060950 | |||
| 2255 | Ga0495583_0322073 | |||
| 2256 | Ga0495606_0034214 | |||
| 2257 | Ga0495606_0102033 | |||
| 2258 | Ga0495606_0264218 | |||
| 2259 | Ga0495606_0312184 | |||
| 2260 | Ga0495606_0403479 | |||
| 2261 | Ga0495606_0452802 | |||
| 2262 | Ga0495608_0019870 | |||
| 2263 | Ga0495608_0080255 | |||
| 2264 | Ga0495610_0107052 | |||
| 2265 | Ga0495610_0124279 | |||
| 2266 | Ga0495616_0026546 | |||
| 2267 | Ga0495618_0028578 | |||
| 2268 | Ga0495620_0055847 | |||
| 2269 | Ga0495620_0175927 | |||
| 2270 | Ga0495620_0239742 | |||
| 2271 | Ga0495620_0284325 | |||
| 2272 | Ga0495628_0015500 | |||
| 2273 | Ga0495628_0079992 | |||
| 2274 | Ga0495628_0162717 | |||
| 2275 | Ga0495630_0005610 | |||
| 2276 | Ga0495630_0147147 | |||
| 2277 | Ga0495631_0096176 | |||
| 2278 | Ga0495631_0118301 | |||
| 2279 | Ga0495631_0162016 | |||
| 2280 | Ga0495631_0222239 | |||
| 2281 | Ga0495632_0096886 | |||
| 2282 | Ga0495632_0203258 | |||
| 2283 | Ga0495632_0278902 | |||
| 2284 | Ga0495637_0074429 | |||
| 2285 | Ga0495643_0118009 | |||
| 2286 | Ga0495643_0124891 | |||
| 2287 | Ga0495643_0198153 | |||
| 2288 | Ga0495644_0026767 | |||
| 2289 | Ga0495644_0068917 | |||
| 2290 | Ga0495644_0104544 | |||
| 2291 | Ga0495648_0001071 | |||
| 2292 | Ga0495648_0055289 | |||
| 2293 | Ga0495648_0128362 | |||
| 2294 | Ga0495648_0144527 | |||
| 2295 | Ga0495648_0167446 | |||
| 2296 | Ga0495648_0176996 | |||
| 2297 | Ga0495648_0385547 | |||
| 2298 | Ga0495666_0020390 | |||
| 2299 | Ga0495666_0067929 | |||
| 2300 | Ga0495642_0139880 | |||
| 2301 | Ga0495652_0014684 | |||
| 2302 | Ga0495652_0019166 | |||
| 2303 | Ga0495652_0020755 | |||
| 2304 | Ga0495652_0191690 | |||
| 2305 | Ga0495652_0538472 | |||
| 2306 | Ga0495665_0000335 | |||
| 2307 | Ga0495665_0223245 | |||
| 2308 | Ga0495640_0002138 | |||
| 2309 | Ga0495640_0016721 | |||
| 2310 | Ga0495640_0095555 | |||
| 2311 | Ga0495640_0255127 | |||
| 2312 | Ga0495586_0098735 | |||
| 2313 | Ga0495586_0271468 | |||
| 2314 | Ga0495587_0011102 | |||
| 2315 | Ga0495587_0063598 | |||
| 2316 | Ga0495587_0267144 | |||
| 2317 | Ga0495598_0016310 | |||
| 2318 | Ga0495598_0098282 | |||
| 2319 | Ga0495609_0043359 | |||
| 2320 | Ga0495609_0067067 | |||
| 2321 | Ga0495609_0207978 | |||
| 2322 | Ga0495609_0217489 | |||
| 2323 | Ga0495621_0150103 | |||
| 2324 | Ga0495597_0018060 | |||
| 2325 | Ga0495597_0125685 | |||
| 2326 | Ga0495645_0008238 | |||
| 2327 | Ga0495622_0001664 | |||
| 2328 | Ga0495622_0031861 | |||
| 2329 | Ga0495622_0032621 | |||
| 2330 | Ga0495622_0101650 | |||
| 2331 | Ga0495622_0107212 | |||
| 2332 | Ga0495633_0090609 | |||
| 2333 | Ga0495667_0003584 | |||
| 2334 | Ga0495667_0008501 | |||
| 2335 | Ga0495667_0017003 | |||
| 2336 | Ga0495667_0697603 | |||
| 2337 | Ga0495656_0007208 | |||
| 2338 | Ga0495656_0019568 | |||
| 2339 | Ga0495656_0057557 | |||
| 2340 | Ga0495656_0086279 | |||
| 2341 | Ga0495656_0341476 | |||
| 2342 | Ga0495668_0013886 | |||
| 2343 | Ga0495668_0106847 | |||
| 2344 | Ga0495668_0185513 | |||
| 2345 | Ga0495668_0225484 | |||
| 2346 | Ga0495668_0251215 | |||
| 2347 | Ga0495668_0513438 | |||
| 2348 | Ga0495634_0004622 | |||
| 2349 | Ga0495634_0020900 | |||
| 2350 | Ga0495634_0360494 | |||
| 2351 | Ga0495611_0069655 | |||
| 2352 | Ga0495611_0109377 | |||
| 2353 | Ga0495611_0154025 | |||
| 2354 | Ga0495625_0109767 | |||
| 2355 | Ga0495625_0159799 | |||
| 2356 | Ga0495625_0389022 | |||
| 2357 | Ga0495625_0677335 | |||
| 2358 | Ga0495635_0006671 | |||
| 2359 | Ga0495635_0014178 | |||
| 2360 | Ga0495635_0048596 | |||
| 2361 | Ga0495635_0073979 | |||
| 2362 | Ga0495635_0510332 | |||
| 2363 | Ga0495659_0002107 | |||
| 2364 | Ga0495659_0029020 | |||
| 2365 | Ga0495659_0125976 | |||
| 2366 | Ga0495661_0041610 | |||
| 2367 | Ga0495661_0128554 | |||
| 2368 | Ga0495661_0200602 | |||
| 2369 | Ga0495588_0008571 | |||
| 2370 | Ga0495588_0128553 | |||
| 2371 | Ga0495588_0234405 | |||
| 2372 | Ga0495657_0005477 | |||
| 2373 | Ga0495657_0031180 | |||
| 2374 | Ga0495657_0032801 | |||
| 2375 | Ga0495599_0071655 | |||
| 2376 | Ga0495599_0085847 | |||
| 2377 | Ga0495623_0010119 | |||
| 2378 | Ga0495623_0016092 | |||
| 2379 | Ga0495646_0026987 | |||
| 2380 | Ga0495646_0063333 | |||
| 2381 | Ga0495646_0172205 | |||
| 2382 | Ga0495647_0022488 | |||
| 2383 | Ga0495658_0014486 | |||
| 2384 | Ga0495658_0163835 | |||
| 2385 | Ga0495669_0054908 | |||
| 2386 | Ga0495669_0088458 | |||
| 2387 | Ga0495669_0185413 | |||
| 2388 | Ga0495669_0229042 | |||
| 2389 | Ga0495669_0318477 | |||
| 2390 | Ga0495613_0004485 | |||
| 2391 | Ga0495613_0181544 | |||
| 2392 | Ga0495613_0234957 | |||
| 2393 | Ga0495613_0674964 | |||
| 2394 | Ga0495624_0000795 | |||
| 2395 | Ga0495624_0096546 | |||
| 2396 | Ga0495624_0226423 | |||
| 2397 | Ga0495624_0290436 | |||
| 2398 | Ga0495670_0063562 | |||
| 2399 | Ga0495670_0078060 | |||
| 2400 | Ga0495671_0274728 | |||
| 2401 | Ga0495671_0402317 | |||
| 2402 | Ga0495649_0047616 | |||
| 2403 | Ga0495649_0199931 | |||
| 2404 | Ga0495649_0289086 | |||
| 2405 | Ga0495589_0099620 | |||
| 2406 | Ga0495589_0143196 | |||
| 2407 | Ga0495589_0173165 | |||
| 2408 | Ga0495589_0241200 | |||
| 2409 | Ga0495600_0041236 | |||
| 2410 | Ga0495600_0059007 | |||
| 2411 | Ga0495600_0396510 | |||
| 2412 | Ga0495660_0050740 | |||
| 2413 | Ga0495660_0186809 | |||
| 2414 | Ga0495581_0000030 | |||
| 2415 | Ga0495581_0028132 | |||
| 2416 | Ga0495581_0074821 | |||
| 2417 | Ga0495581_0159180 | |||
| 2418 | Ga0495604_0005369 | |||
| 2419 | Ga0495604_0030536 | |||
| 2420 | Ga0495636_0043015 | |||
| 2421 | Ga0495636_0310154 | |||
| 2422 | Ga0495674_0004821 | |||
| 2423 | Ga0495674_0029055 | |||
| 2424 | Ga0495674_0046737 | |||
| 2425 | Ga0495672_0037365 | |||
| 2426 | Ga0495672_0314720 | |||
| 2427 | Ga0495676_0039329 | |||
| 2428 | Ga0495676_0047874 | |||
| 2429 | Ga0495676_0055320 | |||
| 2430 | Ga0495676_0581215 | |||
| 2431 | Ga0495680_0008881 | |||
| 2432 | Ga0495680_0045020 | |||
| 2433 | Ga0495680_0094553 | |||
| 2434 | Ga0495683_0091526 | |||
| 2435 | Ga0495683_0163907 | |||
| 2436 | Ga0495683_0208964 | |||
| 2437 | Ga0495687_126162 | |||
| 2438 | Ga0495687_142791 | |||
| 2439 | Ga0495675_0020892 | |||
| 2440 | Ga0495675_0028927 | |||
| 2441 | Ga0495677_0118428 | |||
| 2442 | Ga0495677_0220164 | |||
| 2443 | Ga0495685_101503 | |||
| 2444 | Ga0495673_0027495 | |||
| 2445 | Ga0495673_0083345 | |||
| 2446 | Ga0495673_0103545 | |||
| 2447 | Ga0495673_0108010 | |||
| 2448 | Ga0495673_0152098 | |||
| 2449 | Ga0495673_0168073 | |||
| 2450 | Ga0495673_0223046 | |||
| 2451 | Ga0495681_0097731 | |||
| 2452 | Ga0495681_0236490 | |||
| 2453 | Ga0495684_0117000 | |||
| 2454 | Ga0495684_0127826 | |||
| 2455 | Ga0495684_0351610 | |||
| 2456 | Ga0495686_0150331 | |||
| 2457 | Ga0495686_0354173 | |||
| 2458 | Ga0495686_0426761 | |||
| 2459 | Ga0495593_0000398 | |||
| 2460 | Ga0495593_0037445 | |||
| 2461 | Ga0495593_0118506 | |||
| 2462 | Ga0495602_0023058 | |||
| 2463 | Ga0495602_0050036 | |||
| 2464 | Ga0495614_0027576 | |||
| 2465 | Ga0495614_0357666 | |||
| 2466 | Ga0495615_0090478 | |||
| 2467 | Ga0495615_0138603 | |||
| 2468 | Ga0495626_0175237 | |||
| 2469 | Ga0496100_0046419 | |||
| 2470 | Ga0496100_0188849 | |||
| 2471 | Ga0496100_0246888 | |||
| 2472 | Ga0496101_0289568 | |||
| 2473 | Ga0496101_0430373 | |||
| 2474 | Ga0496101_0433593 | |||
| 2475 | Ga0496102_0071540 | |||
| 2476 | Ga0496102_0074603 | |||
| 2477 | Ga0496102_0074762 | |||
| 2478 | Ga0496102_0282570 | |||
| 2479 | Ga0496102_0610220 | |||
| 2480 | Ga0496102_0640126 | |||
| 2481 | Ga0496103_0021472 | |||
| 2482 | Ga0496104_0023224 | |||
| 2483 | Ga0496104_0137738 | |||
| 2484 | Ga0496104_0223045 | |||
| 2485 | Ga0496104_0447321 | |||
| 2486 | Ga0496104_0486997 | |||
| 2487 | Ga0496105_0002119 | |||
| 2488 | Ga0496105_0053620 | |||
| 2489 | Ga0496105_0078315 | |||
| 2490 | Ga0496105_0298503 | |||
| 2491 | Ga0496106_0005807 | |||
| 2492 | Ga0496106_0131388 | |||
| 2493 | Ga0496106_0190826 | |||
| 2494 | Ga0496106_0461761 | |||
| 2495 | Ga0496106_0464355 | |||
| 2496 | Ga0496106_0520498 | |||
| 2497 | Ga0496106_1063317 | |||
| 2498 | Ga0496107_0084269 | |||
| 2499 | Ga0496107_0315893 | |||
| 2500 | Ga0496107_0765599 | |||
| 2501 | Ga0496108_0267633 | |||
| 2502 | Ga0496108_0276122 | |||
| 2503 | Ga0496108_0459592 | |||
| 2504 | Ga0496108_0675677 | |||
| 2505 | Ga0496108_1182871 | |||
| 2506 | Ga0496108_1201958 | |||
| 2507 | Ga0496109_0021697 | |||
| 2508 | Ga0496109_0071834 | |||
| 2509 | Ga0496109_0162309 | |||
| 2510 | Ga0496109_0196394 | |||
| 2511 | Ga0496109_1219651 | |||
| 2512 | Ga0496109_1502556 | |||
| 2513 | Ga0496110_0088471 | |||
| 2514 | Ga0496110_0125988 | |||
| 2515 | Ga0496110_0174824 | |||
| 2516 | Ga0496110_0281445 | |||
| 2517 | Ga0496110_0731836 | |||
| 2518 | Ga0496110_1069359 | |||
| 2519 | Ga0496111_0047295 | |||
| 2520 | Ga0496111_0131513 | |||
| 2521 | Ga0496111_0142191 | |||
| 2522 | Ga0496111_0244844 | |||
| 2523 | Ga0496112_0000018 | |||
| 2524 | Ga0496112_0070075 | |||
| 2525 | Ga0496112_0093432 | |||
| 2526 | Ga0496112_0123986 | |||
| 2527 | Ga0496112_0520433 | |||
| 2528 | Ga0496112_0798307 | |||
| 2529 | Ga0496113_0053535 | |||
| 2530 | Ga0496113_0084992 | |||
| 2531 | Ga0496113_0105250 | |||
| 2532 | Ga0496113_0325241 | |||
| 2533 | Ga0496113_0632027 | |||
| 2534 | Ga0496113_0710822 | |||
| 2535 | Ga0496114_0305804 | |||
| 2536 | Ga0496114_0436833 | |||
| 2537 | Ga0496114_0700432 | |||
| 2538 | Ga0496115_0084663 | |||
| 2539 | Ga0496115_0157355 | |||
| 2540 | Ga0496115_0237536 | |||
| 2541 | Ga0496116_0165046 | |||
| 2542 | Ga0496116_0174683 | |||
| 2543 | Ga0496116_0193715 | |||
| 2544 | Ga0496116_0294710 | |||
| 2545 | Ga0496117_0032990 | |||
| 2546 | Ga0496117_0046740 | |||
| 2547 | Ga0496117_0133093 | |||
| 2548 | Ga0496117_0226790 | |||
| 2549 | Ga0496117_0410600 | |||
| 2550 | Ga0496118_0005692 | |||
| 2551 | Ga0496118_0037135 | |||
| 2552 | Ga0496118_0113965 | |||
| 2553 | Ga0496118_0166548 | |||
| 2554 | Ga0496118_0211512 | |||
| 2555 | Ga0496118_0484516 | |||
| 2556 | Ga0496119_0026589 | |||
| 2557 | Ga0496119_0054547 | |||
| 2558 | Ga0496119_0059029 | |||
| 2559 | Ga0496119_0062447 | |||
| 2560 | Ga0496119_0102491 | |||
| 2561 | Ga0496119_0162252 | |||
| 2562 | Ga0496119_0437327 | |||
| 2563 | Ga0496120_0040266 | |||
| 2564 | Ga0496121_0000278 | |||
| 2565 | Ga0496121_0000870 | |||
| 2566 | Ga0496121_0010173 | |||
| 2567 | Ga0496121_0096171 | |||
| 2568 | Ga0496121_0126343 | |||
| 2569 | Ga0496121_0138497 | |||
| 2570 | Ga0496121_0192329 | |||
| 2571 | Ga0496121_0237709 | |||
| 2572 | Ga0496121_0264483 | |||
| 2573 | Ga0496121_0288805 | |||
| 2574 | Ga0496121_0296409 | |||
| 2575 | Ga0496121_0519332 | |||
| 2576 | Ga0496121_0534225 | |||
| 2577 | Ga0496121_0580805 | |||
| 2578 | Ga0496121_0704692 | |||
| 2579 | Ga0496122_0017924 | |||
| 2580 | Ga0496122_0267463 | |||
| 2581 | Ga0496124_0001369 | |||
| 2582 | Ga0496124_0164318 | |||
| 2583 | Ga0496124_0288202 | |||
| 2584 | Ga0496124_0398661 | |||
| 2585 | Ga0496124_0489142 | |||
| 2586 | Ga0496124_0601934 | |||
| 2587 | Ga0496125_0012916 | |||
| 2588 | Ga0496125_0078047 | |||
| 2589 | Ga0496125_0133097 | |||
| 2590 | Ga0496125_0166528 | |||
| 2591 | Ga0496125_0182460 | |||
| 2592 | Ga0496125_0392879 | |||
| 2593 | Ga0496126_0008213 | |||
| 2594 | Ga0496126_0016831 | |||
| 2595 | Ga0496126_0053878 | |||
| 2596 | Ga0496126_0068252 | |||
| 2597 | Ga0496126_0080618 | |||
| 2598 | Ga0496126_0153361 | |||
| 2599 | Ga0496126_0219098 | |||
| 2600 | Ga0496126_0239605 | |||
| 2601 | Ga0496126_0377072 | |||
| 2602 | Ga0496126_0383439 | |||
| 2603 | Ga0496126_0437004 | |||
| 2604 | Ga0496126_0514831 | |||
| 2605 | Ga0496126_0608735 | |||
| 2606 | Ga0496126_0618714 | |||
| 2607 | Ga0496126_0647077 | |||
| 2608 | Ga0496126_0666168 | |||
| 2609 | Ga0495678_166440 | |||
| 2610 | Ga0495682_0024271 | |||
| 2611 | Ga0501048_0306506 | |||
| 2612 | Ga0501067_0144909 | |||
| 2613 | Ga0501080_0696706 | |||
| 2614 | nmdc:mga03683_100167_c1 | |||
| 2615 | nmdc:mga03683_195531_c1 | |||
| 2616 | nmdc:mga03683_63870_c1 | |||
| 2617 | nmdc:mga03683_78981_c1 | |||
| 2618 | nmdc:mga03n38_25280_c1 | |||
| 2619 | nmdc:mga03n38_51750_c1 | |||
| 2620 | nmdc:mga00v17_104028_c1 | |||
| 2621 | nmdc:mga00v17_134887_c1 | |||
| 2622 | nmdc:mga00v17_399883_c1 | |||
| 2623 | nmdc:mga0yw44_136693_c1 | |||
| 2624 | nmdc:mga0yw44_197542_c1 | |||
| 2625 | nmdc:mga0yw44_234584_c1 | |||
| 2626 | nmdc:mga0yw44_4136_c1 | |||
| 2627 | nmdc:mga0yw44_61384_c1 | |||
| 2628 | nmdc:mga0yw44_702768_c1 | |||
| 2629 | nmdc:mga0yw44_94133_c1 | |||
| 2630 | nmdc:mga0k408_114095_c1 | |||
| 2631 | nmdc:mga0k408_245765_c1 | |||
| 2632 | nmdc:mga0k408_311530_c1 | |||
| 2633 | nmdc:mga0k408_49688_c1 | |||
| 2634 | nmdc:mga0k408_620462_c1 | |||
| 2635 | nmdc:mga0k408_632294_c1 | |||
| 2636 | nmdc:mga0k408_68006_c1 | |||
| 2637 | nmdc:mga06z11_164199_c1 | |||
| 2638 | nmdc:mga06z11_247797_c1 | |||
| 2639 | nmdc:mga06z11_98186_c1 | |||
| 2640 | nmdc:mga04h51_39790_c1 | |||
| 2641 | nmdc:mga04h51_4594_c1 | |||
| 2642 | nmdc:mga07m45_49037_c1 | |||
| 2643 | nmdc:mga07m45_72272_c1 | |||
| 2644 | nmdc:mga07m45_85238_c1 | |||
| 2645 | nmdc:mga05p37_715928_c1 | |||
| 2646 | nmdc:mga05p37_766833_c1 | |||
| 2647 | nmdc:mga08y16_1079285_c1 | |||
| 2648 | nmdc:mga0n895_1169042_c1 | |||
| 2649 | nmdc:mga0n895_55593_c1 | |||
| 2650 | nmdc:mga0rr50_401671_c1 | |||
| 2651 | nmdc:mga0rr50_812014_c1 | |||
| 2652 | nmdc:mga0sz30_201948_c1 | |||
| 2653 | nmdc:mga0sz30_240549_c1 | |||
| 2654 | nmdc:mga0sz30_24637_c2 | |||
| 2655 | nmdc:mga0sz30_276370_c1 | |||
| 2656 | nmdc:mga0sz30_52513_c1 | |||
| 2657 | nmdc:mga0sz30_6719_c1 | |||
| 2658 | Ga0495601_0072078 | |||
| 2659 | Ga0495601_0189917 | |||
| 2660 | Ga0495612_0003340 | |||
| 2661 | Ga0500635_0001019 | |||
| 2662 | Ga0500635_0083337 | |||
| 2663 | Ga0495655_0017739 | |||
| 2664 | Ga0495655_0028351 | |||
| 2665 | Ga0495655_0054284 | |||
| 2666 | Ga0495655_0130147 | |||
| 2667 | Ga0495595_0006434 | |||
| 2668 | Ga0495619_0097925 | |||
| 2669 | Ga0495619_0232345 | |||
| 2670 | Ga0495619_0256677 | |||
| 2671 | Ga0500643_000112 | |||
| 2672 | Ga0500647_0087402 | |||
| 2673 | Ga0500583_0109258 | |||
| 2674 | Ga0500583_0389437 | |||
| 2675 | Ga0500651_0013790 | |||
| 2676 | Ga0500651_0204118 | |||
| 2677 | Ga0500651_0426263 | |||
| 2678 | Ga0500651_0613454 | |||
| 2679 | Ga0500566_0028718 | |||
| 2680 | Ga0500566_0060656 | |||
| 2681 | Ga0500640_031812 | |||
| 2682 | Ga0500641_0005732 | |||
| 2683 | Ga0500641_0034832 | |||
| 2684 | Ga0500641_0125390 | |||
| 2685 | Ga0500650_0182444 | |||
| 2686 | Ga0500554_084081 | |||
| 2687 | Ga0500555_029367 | |||
| 2688 | Ga0500556_0116736 | |||
| 2689 | Ga0500557_000021 | |||
| 2690 | Ga0500558_226386 | |||
| 2691 | Ga0500562_005565 | |||
| 2692 | Ga0500562_077165 | |||
| 2693 | Ga0500569_005793 | |||
| 2694 | Ga0500569_145089 | |||
| 2695 | Ga0500569_184397 | |||
| 2696 | Ga0500594_0014142 | |||
| 2697 | Ga0500595_002722 | |||
| 2698 | Ga0500595_004714 | |||
| 2699 | Ga0500595_017174 | |||
| 2700 | Ga0500595_020317 | |||
| 2701 | Ga0500595_030265 | |||
| 2702 | Ga0500597_140240 | |||
| 2703 | Ga0500607_037964 | |||
| 2704 | Ga0500617_129887 | |||
| 2705 | Ga0500621_219643 | |||
| 2706 | Ga0500626_120643 | |||
| 2707 | Ga0500642_0000362 | |||
| 2708 | Ga0500642_0083225 | |||
| 2709 | Ga0500642_0161139 | |||
| 2710 | Ga0500642_0208301 | |||
| 2711 | Ga0500655_058384 | |||
| 2712 | Ga0500658_0061598 | |||
| 2713 | Ga0500658_0103613 | |||
| 2714 | Ga0500658_0335099 | |||
| 2715 | Ga0500559_0034845 | |||
| 2716 | Ga0500561_0027024 | |||
| 2717 | Ga0500568_0011399 | |||
| 2718 | Ga0500568_0013697 | |||
| 2719 | Ga0500568_0132269 | |||
| 2720 | Ga0500573_0007614 | |||
| 2721 | Ga0500585_051506 | |||
| 2722 | Ga0500588_0109718 | |||
| 2723 | Ga0500588_0251092 | |||
| 2724 | Ga0500588_0311862 | |||
| 2725 | Ga0500589_139840 | |||
| 2726 | Ga0500590_012459 | |||
| 2727 | Ga0500590_152328 | |||
| 2728 | Ga0500603_008315 | |||
| 2729 | Ga0500604_0283040 | |||
| 2730 | Ga0500616_0125886 | |||
| 2731 | Ga0500619_164871 | |||
| 2732 | Ga0500620_051888 | |||
| 2733 | Ga0500622_0005248 | |||
| 2734 | Ga0500627_0091031 | |||
| 2735 | Ga0500627_0149510 | |||
| 2736 | Ga0500627_0173120 | |||
| 2737 | Ga0500627_0310906 | |||
| 2738 | Ga0500633_0074370 | |||
| 2739 | Ga0500639_267963 | |||
| 2740 | Ga0500636_0000834 | |||
| 2741 | Ga0500636_0114438 | |||
| 2742 | Ga0500636_0156896 | |||
| 2743 | Ga0500636_0262295 | |||
| 2744 | Ga0500637_0107654 | |||
| 2745 | Ga0500637_0544021 | |||
| 2746 | Ga0500649_206274 | |||
| 2747 | Ga0500649_208297 | |||
| 2748 | Ga0500625_054654 | |||
| 2749 | Ga0500645_028937 | |||
| 2750 | Ga0500645_092338 | |||
| 2751 | Ga0500609_012382 | |||
| 2752 | Ga0500656_006149 | |||
| 2753 | Ga0500552_069122 | |||
| 2754 | Ga0500596_024173 | |||
| 2755 | Ga0500599_002952 | |||
| 2756 | Ga0500601_000419 | |||
| 2757 | Ga0500601_018425 | |||
| 2758 | Ga0500661_010749 | |||
| 2759 | Ga0500661_061784 | |||
| 2760 | Ga0501082_0323771 | |||
| 2761 | 2507505456 | |||
| 2762 | 2508539341 | |||
| 2763 | 2508695670 | |||
| 2764 | 2511395682 | |||
| 2765 | 2513642198 | |||
| 2766 | 2513651328 | |||
| 2767 | 2513676321 | |||
| 2768 | 2513695293 | |||
| 2769 | 2513718246 | |||
| 2770 | 2513859378 | |||
| 2771 | 2513873341 | |||
| 2772 | 2513921552 | |||
| 2773 | 2514014671 | |||
| 2774 | 2515627651 | |||
| 2775 | 2517106274 | |||
| 2776 | 2524441447 | |||
| 2777 | 2524467221 | |||
| 2778 | 2528853312 | |||
| 2779 | 2617352054 | |||
| 2780 | 2723841827 | |||
| 2781 | 2728748426 | |||
| 2782 | 2745077581 | |||
| 2783 | 2793062243 | |||
| 2784 | 2793078299 | |||
| 2785 | 2805920689 | |||
| 2786 | 2818237862 | |||
| 2787 | 2824604417 | |||
| 2788 | 2824614853 | |||
| 2789 | 2824656299 | |||
| 2790 | 2824669885 | |||
| 2791 | 2824671755 | |||
| 2792 | 2824684806 | |||
| 2793 | 2824695784 | |||
| 2794 | 2824701665 | |||
| 2795 | 2824710873 | |||
| 2796 | 2824760656 | |||
| 2797 | 2824768460 | |||
| 2798 | 2824781375 | |||
| 2799 | 2838124705 | |||
| 2800 | 2841945396 | |||
| 2801 | 2841952182 | |||
| 2802 | 2841965340 | |||
| 2803 | 2841970431 | |||
| 2804 | 2841981679 | |||
| 2805 | 2841984959 | |||
| 2806 | 2842043314 | |||
| 2807 | 2842052696 | |||
| 2808 | 2844315551 | |||
| 2809 | 2847931254 | |||
| 2810 | 2847942347 | |||
| 2811 | 2849083219 | |||
| 2812 | 2857516348 | |||
| 2813 | 2874592543 | |||
| 2814 | 2874607880 | |||
| 2815 | 2874617974 | |||
| 2816 | 2874621197 | |||
| 2817 | 2874628596 | |||
| 2818 | 2874647162 | |||
| 2819 | 2876769647 | |||
| 2820 | 2876772546 | |||
| 2821 | 2876816464 | |||
| 2822 | 2876819807 | |||
| 2823 | 2879076313 | |||
| 2824 | 2879083776 | |||
| 2825 | 2879100445 | |||
| 2826 | 2879113307 | |||
| 2827 | 2879128797 | |||
| 2828 | 2879143618 | |||
| 2829 | 2881673215 | |||
| 2830 | 2885369329 | |||
| 2831 | 2885377560 | |||
| 2832 | 2885386726 | |||
| 2833 | 2885415196 | |||
| 2834 | 2888379395 | |||
| 2835 | 2888390495 | |||
| 2836 | 2888420116 | |||
| 2837 | 2889035296 | |||
| 2838 | 2903733540 | |||
| 2839 | 2903777917 | |||
| 2840 | 2904667742 | |||
| 2841 | 2904708396 | |||
| 2842 | 2904716324 | |||
| 2843 | 2906608894 | |||
| 2844 | 2906613568 | |||
| 2845 | 2906631674 | |||
| 2846 | 2906636576 | |||
| 2847 | 2906648340 | |||
| 2848 | 2906668102 | |||
| 2849 | 2908747659 | |||
| 2850 | 2922363213 | |||
| 2851 | 2922369382 | |||
| 2852 | 2922388482 | |||
| 2853 | 2922396578 | |||
| 2854 | 2922434005 | |||
| 2855 | 2929618789 | |||
| 2856 | 2929628526 | |||
| 2857 | 2932790971 | |||
| 2858 | 2932794136 | |||
| 2859 | 2932809212 | |||
| 2860 | 2932811975 | |||
| 2861 | 2932825574 | |||
| 2862 | 2932833687 | |||
| 2863 | 2933580501 | |||
| 2864 | 2935615514 | |||
| 2865 | 2935623213 | |||
| 2866 | 2935644288 | |||
| 2867 | 2935654443 | |||
| 2868 | 2935663323 | |||
| 2869 | 2935672130 | |||
| 2870 | 2935679350 | |||
| 2871 | 2935686592 | |||
| 2872 | 2935700373 | |||
| 2873 | 2935710321 | |||
| 2874 | 2935716280 | |||
| 2875 | 2935723596 | |||
| 2876 | 2935735151 | |||
| 2877 | 2935744058 | |||
| 2878 | 2935752558 | |||
| 2879 | 2935763309 | |||
| 2880 | 2935774282 | |||
| 2881 | 2935783352 | |||
| 2882 | 2935789003 | |||
| 2883 | 2935796753 | |||
| 2884 | 2935808312 | |||
| 2885 | 2935816074 | |||
| 2886 | 2935825685 | |||
| 2887 | 2935833468 | |||
| 2888 | 2935845974 | |||
| 2889 | 2935853449 | |||
| 2890 | 2935861461 | |||
| 2891 | 2935869580 | |||
| 2892 | 2935879909 | |||
| 2893 | 2935889163 | |||
| 2894 | 2935915051 | |||
| 2895 | 2935918899 | |||
| 2896 | 2935931384 | |||
| 2897 | 2935939981 | |||
| 2898 | 2935947672 | |||
| 2899 | 2935956443 | |||
| 2900 | 2935966711 | |||
| 2901 | 2935973237 | |||
| 2902 | 2935980520 | |||
| 2903 | 2935990130 | |||
| 2904 | 2935997868 | |||
| 2905 | 2936008867 | |||
| 2906 | 2936017518 | |||
| 2907 | 2936025981 | |||
| 2908 | 2936034823 | |||
| 2909 | 2936041079 | |||
| 2910 | 2936052919 | |||
| 2911 | 2936060222 | |||
| 2912 | 2940558471 | |||
| 2913 | 2941535337 | |||
| 2914 | 2941547143 | |||
| 2915 | 3005475280 | |||
| 2916 | 3005486668 | |||
| 2917 | 3005508974 | |||
| 2918 | 3005594143 | |||
| 2919 | 3005595241 | |||
| 2920 | 3005711184 | |||
| 2921 | 3005718479 | |||
| 2922 | 8006927254 | |||
| 2923 | 8006935997 | |||
| 2924 | 8006967642 | |||
| 2925 | 8006975879 | |||
| 2926 | 8006991112 | |||
| 2927 | 8007000441 | |||
| 2928 | 8016517985 | |||
| 2929 | 8016526334 | |||
| 2930 | 8016531398 | |||
| 2931 | 8016544610 | |||
| 2932 | 8016557464 | |||
| 2933 | 8016565822 | |||
| 2934 | 8016569665 | |||
| 2935 | 8016582273 | |||
| 2936 | 8016586143 | |||
| 2937 | 8016603422 | |||
| 2938 | 8016606357 | |||
| 2939 | 8016618264 | |||
| 2940 | 8016622913 | |||
| 2941 | 8016635419 | |||
| 2942 | 8017058655 | |||
| 2943 | 8019531231 | |||
| 2944 | 8019540321 | |||
| 2945 | 8019549912 | |||
| 2946 | 8019562660 | |||
| 2947 | 8019572737 | |||
| 2948 | 8019577002 | |||
| 2949 | 8019606675 | |||
| 2950 | 8019623169 | |||
| 2951 | 8019629929 | |||
| 2952 | 8019652276 | |||
| 2953 | 8019666765 | |||
| 2954 | 8019676526 | |||
| 2955 | 8019679463 | |||
| 2956 | 8019696041 | |||
| 2957 | 8055742638 | |||
| 2958 | 8056676147 | |||
| 2959 | 8056682946 | |||
| 2960 | 8056971499 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zvt-assembly1.cif.gz_A | c13 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. | 0.4187 | 25 | 170 |
| 6zvs-assembly1.cif.gz_A | c12 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. | 0.4169 | 25 | 170 |
| 6zw6-assembly1.cif.gz_A | c16 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. | 0.4145 | 25 | 170 |
| 6zw5-assembly1.cif.gz_A | c15 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. | 0.4122 | 25 | 170 |
| 6zw4-assembly1.cif.gz_A | c14 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. | 0.4107 | 25 | 170 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VEW3_1_165_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.5172 | 56 | 134 | 1.20.140.150 |
| af_Q8NF91_7459_7567_1.20.58.60 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.4514 | 17 | 126 | 1.20.58.60 |
| af_Q8NF91_7459_7567_1.20.58.60 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.4395 | 17 | 126 | 1.20.58.60 |
| af_R9PY72_1_190_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.4371 | 7 | 143 | 1.20.140.150 |
| af_Q7K1I4_1_105_1.20.120.350 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C | 0.4357 | 56 | 144 | 1.20.120.350 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q0S4M6-F1-model_v4 | Uncharacterized protein | 0.8869 | 29 | 139 |
GO:0016020
|
| AF-A0A4Q0S4M6-F1-model_v4 | Uncharacterized protein | 0.865 | 29 | 139 |
GO:0016020
|
| AF-A0A0N0GPP8-F1-model_v4 | Transmembrane protein | 0.7504 | 13 | 164 |
|
| AF-A0A537SV41-F1-model_v4 | Uncharacterized protein | 0.7267 | 31 | 176 |
GO:0016020
|
| AF-A0A537SV41-F1-model_v4 | Uncharacterized protein | 0.7179 | 31 | 176 |
GO:0016020
|