F494286
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1483 | 371 | 2966 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_100416640|Ga0070663_1004166402 |
| Length | 247 |
| Sequence | MGMAEGHIDVAMTIVQNKMTARNVEEAGRQRTSMDQKLRIELSKQGIVTTTLEDLYNWGRKNSLWPMTFGLACCAIEMIATSMARYDLARFGAEVFRPSPRQADLLIVSGTVTKKMAPQVVRLYNQMAEPKYVIAMGACAISGGPFKQGYNVLKGIDRYIPVDVHIPGCPPRPEALIDAFMTLQKMIDEQPLAGKGRPRHLDPGAPSEFVVPRFGAHDLEPPSNPEVFHILNNVDSCDAGEVDAGGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 101 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 137 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 141 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 218 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 219 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 220 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 221 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 222 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 228 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 230 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 231 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 232 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 235 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 236 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 239 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 240 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 243 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 244 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 250 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 259 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 261 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 263 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 265 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 266 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 267 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 270 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 271 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 272 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 273 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 274 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 275 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 276 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 277 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 278 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 279 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 280 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 281 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 282 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 283 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 284 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 332 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 333 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 334 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 335 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 336 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 337 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 340 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 341 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 342 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 343 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 344 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 345 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 346 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 347 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 369 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 370 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 371 | 2786546517 | Verrucomicrobia bacterium LW23 | Isolate | Rhizoplane |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.39 |
| Metatranscriptomes | 0.54 |
| Isolates | 0.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.4 |
| Nodule | 0 |
| Rhizoplane | 5.39 |
| Rhizosphere | 93.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070663_100416640 | 3300005455 | Bacteria | 1101 |
| 2 | SwRhRL2b_contig_2590704 | 2162886007 | Bacteria | 1301 |
| 3 | SwRhRL2b_contig_317202 | 2162886007 | Bacteria | 1347 |
| 4 | JGI24035J26624_1000353 | 3300002126 | Bacteria | 4326 |
| 5 | JGI24035J26624_1002901 | 3300002126 | Bacteria | 1602 |
| 6 | JGI25406J46586_10007445 | 3300003203 | Unclassified | 4996 |
| 7 | JGI25406J46586_10007576 | 3300003203 | Unclassified | 4945 |
| 8 | rootH2_10052670 | 3300003320 | Bacteria | 4768 |
| 9 | JGI25405J52794_10003411 | 3300003911 | Bacteria | 2785 |
| 10 | Ga0065714_10200499 | 3300005288 | Bacteria | 897 |
| 11 | Ga0065704_10027058 | 3300005289 | Bacteria | 1186 |
| 12 | Ga0065704_10079155 | 3300005289 | Bacteria | 4243 |
| 13 | Ga0065704_10153219 | 3300005289 | Bacteria | 1406 |
| 14 | Ga0065704_10156070 | 3300005289 | Bacteria | 1367 |
| 15 | Ga0065704_10215401 | 3300005289 | Bacteria | 1088 |
| 16 | Ga0065704_10245816 | 3300005289 | Bacteria | 1003 |
| 17 | Ga0065712_10005150 | 3300005290 | Bacteria | 6898 |
| 18 | Ga0065712_10107257 | 3300005290 | Bacteria | 1899 |
| 19 | Ga0065712_10192575 | 3300005290 | Bacteria | 1142 |
| 20 | Ga0065712_10255551 | 3300005290 | Bacteria | 926 |
| 21 | Ga0065712_10256370 | 3300005290 | Bacteria | 947 |
| 22 | Ga0065715_10005010 | 3300005293 | Bacteria | 5383 |
| 23 | Ga0065715_10009930 | 3300005293 | Bacteria | 3609 |
| 24 | Ga0065715_10022121 | 3300005293 | Bacteria | 2890 |
| 25 | Ga0065715_10099444 | 3300005293 | Bacteria | 3406 |
| 26 | Ga0065715_10206275 | 3300005293 | Bacteria | 1336 |
| 27 | Ga0065715_10215981 | 3300005293 | Bacteria | 1286 |
| 28 | Ga0065715_10317598 | 3300005293 | Bacteria | 1008 |
| 29 | Ga0065707_10014467 | 3300005295 | Bacteria | 1749 |
| 30 | Ga0065707_10021565 | 3300005295 | Bacteria | 2695 |
| 31 | Ga0065707_10045644 | 3300005295 | Bacteria | 1007 |
| 32 | Ga0065707_10089817 | 3300005295 | Bacteria | 4274 |
| 33 | Ga0070658_10006417 | 3300005327 | Bacteria | 9531 |
| 34 | Ga0070658_10103061 | 3300005327 | Bacteria | 2360 |
| 35 | Ga0070658_10110133 | 3300005327 | Bacteria | 2280 |
| 36 | Ga0070658_10719006 | 3300005327 | Bacteria | 867 |
| 37 | Ga0070676_10000589 | 3300005328 | Bacteria | 17589 |
| 38 | Ga0070676_10010323 | 3300005328 | Bacteria | 5065 |
| 39 | Ga0070676_10014108 | 3300005328 | Bacteria | 4387 |
| 40 | Ga0070676_10234226 | 3300005328 | Bacteria | 1218 |
| 41 | Ga0070676_10471691 | 3300005328 | Bacteria | 886 |
| 42 | Ga0070683_100007967 | 3300005329 | Bacteria | 8987 |
| 43 | Ga0070683_100008922 | 3300005329 | Bacteria | 8545 |
| 44 | Ga0070683_100107012 | 3300005329 | Bacteria | 2637 |
| 45 | Ga0070683_100125440 | 3300005329 | Bacteria | 2427 |
| 46 | Ga0070683_100269334 | 3300005329 | Bacteria | 1620 |
| 47 | Ga0070683_100435347 | 3300005329 | Bacteria | 1251 |
| 48 | Ga0070683_100456597 | 3300005329 | Bacteria | 1219 |
| 49 | Ga0070690_100225288 | 3300005330 | Bacteria | 1316 |
| 50 | Ga0070690_100478704 | 3300005330 | Bacteria | 928 |
| 51 | Ga0070690_100647591 | 3300005330 | Bacteria | 807 |
| 52 | Ga0070670_100043223 | 3300005331 | Bacteria | 3873 |
| 53 | Ga0070670_100119649 | 3300005331 | Bacteria | 2271 |
| 54 | Ga0070670_100619566 | 3300005331 | Bacteria | 969 |
| 55 | Ga0070677_10319677 | 3300005333 | Bacteria | 795 |
| 56 | Ga0068869_100011083 | 3300005334 | Bacteria | 5904 |
| 57 | Ga0068869_100805672 | 3300005334 | Bacteria | 807 |
| 58 | Ga0070666_10090341 | 3300005335 | Bacteria | 2103 |
| 59 | Ga0070666_10107939 | 3300005335 | Bacteria | 1923 |
| 60 | Ga0070666_10115089 | 3300005335 | Unclassified | 1862 |
| 61 | Ga0070666_10175881 | 3300005335 | Bacteria | 1500 |
| 62 | Ga0070680_100024149 | 3300005336 | Bacteria | 4852 |
| 63 | Ga0070680_100042555 | 3300005336 | Bacteria | 3686 |
| 64 | Ga0070680_100188479 | 3300005336 | Bacteria | 1738 |
| 65 | Ga0070680_100357722 | 3300005336 | Bacteria | 1242 |
| 66 | Ga0070682_100348852 | 3300005337 | Bacteria | 1103 |
| 67 | Ga0068868_100063554 | 3300005338 | Bacteria | 2928 |
| 68 | Ga0068868_100266234 | 3300005338 | Bacteria | 1447 |
| 69 | Ga0068868_100388210 | 3300005338 | Unclassified | 1202 |
| 70 | Ga0070660_100000983 | 3300005339 | Bacteria | 19074 |
| 71 | Ga0070660_100001797 | 3300005339 | Bacteria | 14722 |
| 72 | Ga0070660_100003154 | 3300005339 | Bacteria | 11326 |
| 73 | Ga0070660_100097251 | 3300005339 | Bacteria | 2329 |
| 74 | Ga0070660_100215642 | 3300005339 | Bacteria | 1559 |
| 75 | Ga0070660_100289931 | 3300005339 | Bacteria | 1340 |
| 76 | Ga0070660_100510840 | 3300005339 | Bacteria | 1000 |
| 77 | Ga0070689_100001793 | 3300005340 | Bacteria | 13793 |
| 78 | Ga0070689_100001811 | 3300005340 | Bacteria | 13740 |
| 79 | Ga0070689_100002264 | 3300005340 | Bacteria | 12502 |
| 80 | Ga0070689_100041547 | 3300005340 | Bacteria | 3530 |
| 81 | Ga0070689_100110344 | 3300005340 | Unclassified | 2187 |
| 82 | Ga0070689_100158175 | 3300005340 | Bacteria | 1830 |
| 83 | Ga0070689_100200621 | 3300005340 | Bacteria | 1629 |
| 84 | Ga0070689_100202935 | 3300005340 | Bacteria | 1620 |
| 85 | Ga0070689_100246326 | 3300005340 | Bacteria | 1473 |
| 86 | Ga0070689_100460605 | 3300005340 | Bacteria | 1083 |
| 87 | Ga0070689_100720658 | 3300005340 | Bacteria | 872 |
| 88 | Ga0070691_10018830 | 3300005341 | Bacteria | 3184 |
| 89 | Ga0070687_100000780 | 3300005343 | Bacteria | 10589 |
| 90 | Ga0070687_100018387 | 3300005343 | Bacteria | 3233 |
| 91 | Ga0070687_100443045 | 3300005343 | Bacteria | 862 |
| 92 | Ga0070661_100004915 | 3300005344 | Bacteria | 9202 |
| 93 | Ga0070661_100015891 | 3300005344 | Bacteria | 5311 |
| 94 | Ga0070661_100029133 | 3300005344 | Bacteria | 3983 |
| 95 | Ga0070661_100572803 | 3300005344 | Bacteria | 910 |
| 96 | Ga0070661_100635864 | 3300005344 | Bacteria | 865 |
| 97 | Ga0070692_10108990 | 3300005345 | Bacteria | 1529 |
| 98 | Ga0070692_10522530 | 3300005345 | Bacteria | 773 |
| 99 | Ga0070668_100015886 | 3300005347 | Bacteria | 5632 |
| 100 | Ga0070668_100024796 | 3300005347 | Bacteria | 4545 |
| 101 | Ga0070668_100043188 | 3300005347 | Bacteria | 3457 |
| 102 | Ga0070668_100118276 | 3300005347 | Bacteria | 2115 |
| 103 | Ga0070668_100272665 | 3300005347 | Bacteria | 1411 |
| 104 | Ga0070669_100001631 | 3300005353 | Bacteria | 16233 |
| 105 | Ga0070669_100006376 | 3300005353 | Bacteria | 8499 |
| 106 | Ga0070669_100218611 | 3300005353 | Bacteria | 1506 |
| 107 | Ga0070675_100001249 | 3300005354 | Bacteria | 18557 |
| 108 | Ga0070675_100025921 | 3300005354 | Bacteria | 4702 |
| 109 | Ga0070675_100087975 | 3300005354 | Bacteria | 2598 |
| 110 | Ga0070675_100174020 | 3300005354 | Bacteria | 1858 |
| 111 | Ga0070671_100033767 | 3300005355 | Bacteria | 4234 |
| 112 | Ga0070671_100123266 | 3300005355 | Bacteria | 2182 |
| 113 | Ga0070671_100143015 | 3300005355 | Bacteria | 2019 |
| 114 | Ga0070671_100193160 | 3300005355 | Bacteria | 1725 |
| 115 | Ga0070674_100008167 | 3300005356 | Bacteria | 6214 |
| 116 | Ga0070674_100064965 | 3300005356 | Bacteria | 2559 |
| 117 | Ga0070674_100408109 | 3300005356 | Bacteria | 1112 |
| 118 | Ga0070673_100007143 | 3300005364 | Bacteria | 7334 |
| 119 | Ga0070673_100034620 | 3300005364 | Bacteria | 3823 |
| 120 | Ga0070688_100005935 | 3300005365 | Bacteria | 6470 |
| 121 | Ga0070688_100007000 | 3300005365 | Bacteria | 6062 |
| 122 | Ga0070688_100083650 | 3300005365 | Bacteria | 2071 |
| 123 | Ga0070688_100099028 | 3300005365 | Bacteria | 1919 |
| 124 | Ga0070688_100153313 | 3300005365 | Bacteria | 1577 |
| 125 | Ga0070688_100184439 | 3300005365 | Bacteria | 1449 |
| 126 | Ga0070688_100315758 | 3300005365 | Bacteria | 1134 |
| 127 | Ga0070659_100002955 | 3300005366 | Bacteria | 12119 |
| 128 | Ga0070659_100003726 | 3300005366 | Bacteria | 10875 |
| 129 | Ga0070659_100132820 | 3300005366 | Bacteria | 2022 |
| 130 | Ga0070659_100245142 | 3300005366 | Bacteria | 1484 |
| 131 | Ga0070659_100700271 | 3300005366 | Bacteria | 876 |
| 132 | Ga0070659_100726840 | 3300005366 | Bacteria | 860 |
| 133 | Ga0070667_100006158 | 3300005367 | Bacteria | 9970 |
| 134 | Ga0070667_100138872 | 3300005367 | Unclassified | 2126 |
| 135 | Ga0070667_100254899 | 3300005367 | Bacteria | 1569 |
| 136 | Ga0070667_100326785 | 3300005367 | Bacteria | 1385 |
| 137 | Ga0070709_10084246 | 3300005434 | Bacteria | 2082 |
| 138 | Ga0070709_10116366 | 3300005434 | Bacteria | 1805 |
| 139 | Ga0070709_10139020 | 3300005434 | Bacteria | 1667 |
| 140 | Ga0070709_10292949 | 3300005434 | Bacteria | 1186 |
| 141 | Ga0070714_100013671 | 3300005435 | Bacteria | 6510 |
| 142 | Ga0070714_100027631 | 3300005435 | Bacteria | 4700 |
| 143 | Ga0070714_100028845 | 3300005435 | Bacteria | 4608 |
| 144 | Ga0070714_100066857 | 3300005435 | Bacteria | 3098 |
| 145 | Ga0070714_100187185 | 3300005435 | Bacteria | 1887 |
| 146 | Ga0070714_100766261 | 3300005435 | Bacteria | 933 |
| 147 | Ga0070713_100054205 | 3300005436 | Bacteria | 3326 |
| 148 | Ga0070713_100109178 | 3300005436 | Bacteria | 2410 |
| 149 | Ga0070713_100229041 | 3300005436 | Bacteria | 1689 |
| 150 | Ga0070713_100230518 | 3300005436 | Bacteria | 1683 |
| 151 | Ga0070713_100299309 | 3300005436 | Bacteria | 1480 |
| 152 | Ga0070710_10057774 | 3300005437 | Bacteria | 2200 |
| 153 | Ga0070710_10313062 | 3300005437 | Bacteria | 1028 |
| 154 | Ga0070701_10008197 | 3300005438 | Bacteria | 4505 |
| 155 | Ga0070711_100001814 | 3300005439 | Bacteria | 11907 |
| 156 | Ga0070711_100069760 | 3300005439 | Bacteria | 2473 |
| 157 | Ga0070711_100077027 | 3300005439 | Bacteria | 2366 |
| 158 | Ga0070711_100209510 | 3300005439 | Bacteria | 1508 |
| 159 | Ga0070711_100521375 | 3300005439 | Bacteria | 982 |
| 160 | Ga0070711_100576879 | 3300005439 | Bacteria | 936 |
| 161 | Ga0070711_100792597 | 3300005439 | Bacteria | 803 |
| 162 | Ga0070705_100017094 | 3300005440 | Bacteria | 3781 |
| 163 | Ga0070700_100173637 | 3300005441 | Bacteria | 1494 |
| 164 | Ga0070700_100260125 | 3300005441 | Bacteria | 1249 |
| 165 | Ga0070700_100634950 | 3300005441 | Bacteria | 841 |
| 166 | Ga0070694_100000907 | 3300005444 | Bacteria | 16750 |
| 167 | Ga0070694_100027848 | 3300005444 | Bacteria | 3673 |
| 168 | Ga0070694_100561616 | 3300005444 | Bacteria | 915 |
| 169 | Ga0070708_100135198 | 3300005445 | Bacteria | 2283 |
| 170 | Ga0070708_100214158 | 3300005445 | Bacteria | 1805 |
| 171 | Ga0070708_100438864 | 3300005445 | Bacteria | 1231 |
| 172 | Ga0070708_100487711 | 3300005445 | Bacteria | 1162 |
| 173 | Ga0070708_100570829 | 3300005445 | Bacteria | 1067 |
| 174 | Ga0070708_100947850 | 3300005445 | Bacteria | 807 |
| 175 | Ga0070663_100014607 | 3300005455 | Bacteria | 5045 |
| 176 | Ga0070663_100082710 | 3300005455 | Bacteria | 2363 |
| 177 | Ga0070663_100161909 | 3300005455 | Bacteria | 1723 |
| 178 | Ga0070678_100061543 | 3300005456 | Bacteria | 2767 |
| 179 | Ga0070678_100069522 | 3300005456 | Bacteria | 2629 |
| 180 | Ga0070678_100110518 | 3300005456 | Bacteria | 2150 |
| 181 | Ga0070662_100000642 | 3300005457 | Bacteria | 21102 |
| 182 | Ga0070662_100033760 | 3300005457 | Bacteria | 3605 |
| 183 | Ga0070662_100033892 | 3300005457 | Bacteria | 3599 |
| 184 | Ga0070662_100173949 | 3300005457 | Bacteria | 1693 |
| 185 | Ga0070662_100174638 | 3300005457 | Bacteria | 1690 |
| 186 | Ga0070662_100375168 | 3300005457 | Bacteria | 1170 |
| 187 | Ga0070681_10003053 | 3300005458 | Bacteria | 15521 |
| 188 | Ga0070681_10026666 | 3300005458 | Bacteria | 5808 |
| 189 | Ga0070681_10839175 | 3300005458 | Bacteria | 836 |
| 190 | Ga0070685_10184711 | 3300005466 | Bacteria | 1345 |
| 191 | Ga0070706_100000159 | 3300005467 | Bacteria | 86016 |
| 192 | Ga0070706_100013539 | 3300005467 | Bacteria | 7542 |
| 193 | Ga0070706_100017000 | 3300005467 | Bacteria | 6720 |
| 194 | Ga0070706_100025025 | 3300005467 | Bacteria | 5495 |
| 195 | Ga0070706_100037994 | 3300005467 | Bacteria | 4446 |
| 196 | Ga0070706_100047619 | 3300005467 | Bacteria | 3956 |
| 197 | Ga0070706_100054100 | 3300005467 | Bacteria | 3705 |
| 198 | Ga0070706_100131232 | 3300005467 | Bacteria | 2338 |
| 199 | Ga0070706_100259079 | 3300005467 | Bacteria | 1623 |
| 200 | Ga0070706_100478267 | 3300005467 | Bacteria | 1159 |
| 201 | Ga0070706_100602615 | 3300005467 | Bacteria | 1021 |
| 202 | Ga0070706_100607804 | 3300005467 | Bacteria | 1016 |
| 203 | Ga0070706_100920426 | 3300005467 | Bacteria | 807 |
| 204 | Ga0070707_100000143 | 3300005468 | Bacteria | 67554 |
| 205 | Ga0070707_100017162 | 3300005468 | Bacteria | 6802 |
| 206 | Ga0070707_100024588 | 3300005468 | Bacteria | 5706 |
| 207 | Ga0070707_100026997 | 3300005468 | Bacteria | 5459 |
| 208 | Ga0070707_100082896 | 3300005468 | Bacteria | 3097 |
| 209 | Ga0070707_100212377 | 3300005468 | Bacteria | 1886 |
| 210 | Ga0070707_100214640 | 3300005468 | Bacteria | 1875 |
| 211 | Ga0070698_100007605 | 3300005471 | Bacteria | 11725 |
| 212 | Ga0070698_100014562 | 3300005471 | Bacteria | 8305 |
| 213 | Ga0070698_100024310 | 3300005471 | Bacteria | 6321 |
| 214 | Ga0070698_100028748 | 3300005471 | Bacteria | 5771 |
| 215 | Ga0070698_100398086 | 3300005471 | Bacteria | 1310 |
| 216 | Ga0070698_100507766 | 3300005471 | Bacteria | 1144 |
| 217 | Ga0070699_100063358 | 3300005518 | Bacteria | 3206 |
| 218 | Ga0070699_100109267 | 3300005518 | Bacteria | 2427 |
| 219 | Ga0070699_100777882 | 3300005518 | Bacteria | 876 |
| 220 | Ga0070679_100016261 | 3300005530 | Bacteria | 7168 |
| 221 | Ga0070679_100027673 | 3300005530 | Bacteria | 5582 |
| 222 | Ga0070679_100029298 | 3300005530 | Bacteria | 5432 |
| 223 | Ga0070679_100049428 | 3300005530 | Bacteria | 4188 |
| 224 | Ga0070679_100063991 | 3300005530 | Bacteria | 3665 |
| 225 | Ga0070679_100272913 | 3300005530 | Bacteria | 1645 |
| 226 | Ga0070679_100300229 | 3300005530 | Bacteria | 1556 |
| 227 | Ga0070684_100000179 | 3300005535 | Bacteria | 43838 |
| 228 | Ga0070684_100002270 | 3300005535 | Bacteria | 14154 |
| 229 | Ga0070684_100034669 | 3300005535 | Bacteria | 4316 |
| 230 | Ga0070684_100038565 | 3300005535 | Bacteria | 4105 |
| 231 | Ga0070684_100075039 | 3300005535 | Bacteria | 2982 |
| 232 | Ga0070684_100170051 | 3300005535 | Bacteria | 1979 |
| 233 | Ga0070684_100214004 | 3300005535 | Bacteria | 1757 |
| 234 | Ga0070684_100319249 | 3300005535 | Bacteria | 1427 |
| 235 | Ga0070684_100428535 | 3300005535 | Bacteria | 1221 |
| 236 | Ga0070684_100520702 | 3300005535 | Bacteria | 1102 |
| 237 | Ga0070697_100000294 | 3300005536 | Bacteria | 40038 |
| 238 | Ga0070697_100035635 | 3300005536 | Bacteria | 4015 |
| 239 | Ga0070697_100039614 | 3300005536 | Bacteria | 3811 |
| 240 | Ga0070697_100042274 | 3300005536 | Bacteria | 3688 |
| 241 | Ga0070697_100042819 | 3300005536 | Bacteria | 3664 |
| 242 | Ga0070697_100090580 | 3300005536 | Bacteria | 2528 |
| 243 | Ga0070697_100135617 | 3300005536 | Bacteria | 2067 |
| 244 | Ga0070697_100166721 | 3300005536 | Bacteria | 1863 |
| 245 | Ga0070697_100313723 | 3300005536 | Bacteria | 1349 |
| 246 | Ga0070697_100503024 | 3300005536 | Bacteria | 1060 |
| 247 | Ga0070697_100793116 | 3300005536 | Bacteria | 838 |
| 248 | Ga0068853_100000063 | 3300005539 | Bacteria | 75366 |
| 249 | Ga0068853_100000081 | 3300005539 | Bacteria | 66218 |
| 250 | Ga0068853_100256371 | 3300005539 | Bacteria | 1607 |
| 251 | Ga0068853_100376845 | 3300005539 | Bacteria | 1324 |
| 252 | Ga0068853_100664469 | 3300005539 | Bacteria | 992 |
| 253 | Ga0070672_100027716 | 3300005543 | Bacteria | 4228 |
| 254 | Ga0070672_100027969 | 3300005543 | Bacteria | 4212 |
| 255 | Ga0070672_100039955 | 3300005543 | Bacteria | 3597 |
| 256 | Ga0070672_100261066 | 3300005543 | Bacteria | 1461 |
| 257 | Ga0070686_100002374 | 3300005544 | Bacteria | 10371 |
| 258 | Ga0070686_100046045 | 3300005544 | Bacteria | 2750 |
| 259 | Ga0070686_100097059 | 3300005544 | Bacteria | 1983 |
| 260 | Ga0070686_100202787 | 3300005544 | Bacteria | 1423 |
| 261 | Ga0070695_100084473 | 3300005545 | Bacteria | 2106 |
| 262 | Ga0070696_100110204 | 3300005546 | Bacteria | 1982 |
| 263 | Ga0070693_100074438 | 3300005547 | Bacteria | 2009 |
| 264 | Ga0070665_100140771 | 3300005548 | Bacteria | 2416 |
| 265 | Ga0070665_100187466 | 3300005548 | Bacteria | 2069 |
| 266 | Ga0070665_100310922 | 3300005548 | Bacteria | 1579 |
| 267 | Ga0070665_100529194 | 3300005548 | Bacteria | 1190 |
| 268 | Ga0070704_100002580 | 3300005549 | Bacteria | 10220 |
| 269 | Ga0070704_100042281 | 3300005549 | Bacteria | 3151 |
| 270 | Ga0070704_100109296 | 3300005549 | Bacteria | 2101 |
| 271 | Ga0068855_100001588 | 3300005563 | Bacteria | 28536 |
| 272 | Ga0068855_100002307 | 3300005563 | Bacteria | 23584 |
| 273 | Ga0068855_100004505 | 3300005563 | Bacteria | 17019 |
| 274 | Ga0068855_100009720 | 3300005563 | Bacteria | 11608 |
| 275 | Ga0068855_100013400 | 3300005563 | Bacteria | 9888 |
| 276 | Ga0068855_100013712 | 3300005563 | Bacteria | 9771 |
| 277 | Ga0068855_100018582 | 3300005563 | Bacteria | 8360 |
| 278 | Ga0068855_100028094 | 3300005563 | Bacteria | 6728 |
| 279 | Ga0068855_100031084 | 3300005563 | Bacteria | 6379 |
| 280 | Ga0068855_100053813 | 3300005563 | Bacteria | 4735 |
| 281 | Ga0068855_100061296 | 3300005563 | Bacteria | 4395 |
| 282 | Ga0068855_100210546 | 3300005563 | Bacteria | 2185 |
| 283 | Ga0068855_100313858 | 3300005563 | Bacteria | 1734 |
| 284 | Ga0068855_100341238 | 3300005563 | Bacteria | 1652 |
| 285 | Ga0068855_100362915 | 3300005563 | Bacteria | 1594 |
| 286 | Ga0068855_100366655 | 3300005563 | Unclassified | 1584 |
| 287 | Ga0068855_100496352 | 3300005563 | Bacteria | 1327 |
| 288 | Ga0068855_100842747 | 3300005563 | Bacteria | 972 |
| 289 | Ga0068855_101087983 | 3300005563 | Bacteria | 836 |
| 290 | Ga0070664_100045734 | 3300005564 | Bacteria | 3697 |
| 291 | Ga0070664_100422399 | 3300005564 | Unclassified | 1221 |
| 292 | Ga0070664_100581180 | 3300005564 | Bacteria | 1038 |
| 293 | Ga0070664_100704377 | 3300005564 | Bacteria | 941 |
| 294 | Ga0068857_100005136 | 3300005577 | Bacteria | 11130 |
| 295 | Ga0068857_100005166 | 3300005577 | Bacteria | 11098 |
| 296 | Ga0068857_100019503 | 3300005577 | Bacteria | 5956 |
| 297 | Ga0068857_100039246 | 3300005577 | Bacteria | 4194 |
| 298 | Ga0068857_100103324 | 3300005577 | Bacteria | 2559 |
| 299 | Ga0068857_100433406 | 3300005577 | Bacteria | 1227 |
| 300 | Ga0068857_100601358 | 3300005577 | Bacteria | 1040 |
| 301 | Ga0068854_100000128 | 3300005578 | Bacteria | 52087 |
| 302 | Ga0068854_100010151 | 3300005578 | Bacteria | 6101 |
| 303 | Ga0068854_100024448 | 3300005578 | Bacteria | 4136 |
| 304 | Ga0068856_100002514 | 3300005614 | Bacteria | 18882 |
| 305 | Ga0068856_100011108 | 3300005614 | Bacteria | 8742 |
| 306 | Ga0068856_100025743 | 3300005614 | Bacteria | 5737 |
| 307 | Ga0068856_100052936 | 3300005614 | Bacteria | 4004 |
| 308 | Ga0068856_100069982 | 3300005614 | Bacteria | 3470 |
| 309 | Ga0068856_100107634 | 3300005614 | Bacteria | 2783 |
| 310 | Ga0068856_100388332 | 3300005614 | Bacteria | 1415 |
| 311 | Ga0068856_100429130 | 3300005614 | Bacteria | 1342 |
| 312 | Ga0068856_101096478 | 3300005614 | Bacteria | 813 |
| 313 | Ga0070702_100116333 | 3300005615 | Bacteria | 1667 |
| 314 | Ga0070702_100148859 | 3300005615 | Bacteria | 1500 |
| 315 | Ga0070702_100197448 | 3300005615 | Bacteria | 1329 |
| 316 | Ga0070702_100521620 | 3300005615 | Bacteria | 876 |
| 317 | Ga0068852_100000073 | 3300005616 | Bacteria | 69820 |
| 318 | Ga0068852_100000212 | 3300005616 | Bacteria | 39661 |
| 319 | Ga0068852_100095163 | 3300005616 | Bacteria | 2674 |
| 320 | Ga0068852_100120432 | 3300005616 | Bacteria | 2401 |
| 321 | Ga0068852_100129550 | 3300005616 | Bacteria | 2321 |
| 322 | Ga0068852_100141372 | 3300005616 | Bacteria | 2228 |
| 323 | Ga0068852_100188748 | 3300005616 | Unclassified | 1943 |
| 324 | Ga0068852_100280539 | 3300005616 | Bacteria | 1606 |
| 325 | Ga0068852_100311243 | 3300005616 | Bacteria | 1527 |
| 326 | Ga0068852_100525482 | 3300005616 | Bacteria | 1181 |
| 327 | Ga0068859_100009257 | 3300005617 | Bacteria | 9946 |
| 328 | Ga0068859_100077591 | 3300005617 | Bacteria | 3362 |
| 329 | Ga0068864_100015075 | 3300005618 | Bacteria | 6424 |
| 330 | Ga0068864_100055480 | 3300005618 | Bacteria | 3422 |
| 331 | Ga0068864_100061517 | 3300005618 | Bacteria | 3252 |
| 332 | Ga0068864_100121739 | 3300005618 | Bacteria | 2334 |
| 333 | Ga0068864_100140138 | 3300005618 | Bacteria | 2181 |
| 334 | Ga0068864_100286786 | 3300005618 | Bacteria | 1538 |
| 335 | Ga0068866_10026071 | 3300005718 | Bacteria | 2756 |
| 336 | Ga0068861_100321246 | 3300005719 | Bacteria | 1348 |
| 337 | Ga0068851_10025880 | 3300005834 | Bacteria | 2880 |
| 338 | Ga0068851_10044574 | 3300005834 | Bacteria | 2240 |
| 339 | Ga0068851_10060529 | 3300005834 | Bacteria | 1939 |
| 340 | Ga0068851_10119771 | 3300005834 | Unclassified | 1413 |
| 341 | Ga0068851_10325069 | 3300005834 | Bacteria | 889 |
| 342 | Ga0068863_100015084 | 3300005841 | Bacteria | 7424 |
| 343 | Ga0068863_100085766 | 3300005841 | Bacteria | 2983 |
| 344 | Ga0068863_100094717 | 3300005841 | Bacteria | 2834 |
| 345 | Ga0068863_100546303 | 3300005841 | Bacteria | 1144 |
| 346 | Ga0068863_100750486 | 3300005841 | Bacteria | 972 |
| 347 | Ga0068863_100914754 | 3300005841 | Bacteria | 878 |
| 348 | Ga0068858_100016651 | 3300005842 | Bacteria | 6903 |
| 349 | Ga0068858_100039886 | 3300005842 | Bacteria | 4353 |
| 350 | Ga0068858_100142379 | 3300005842 | Bacteria | 2251 |
| 351 | Ga0068858_100685339 | 3300005842 | Bacteria | 997 |
| 352 | Ga0068860_100022145 | 3300005843 | Bacteria | 6152 |
| 353 | Ga0068860_100027665 | 3300005843 | Bacteria | 5460 |
| 354 | Ga0068860_100056365 | 3300005843 | Bacteria | 3736 |
| 355 | Ga0068862_100004080 | 3300005844 | Bacteria | 12384 |
| 356 | Ga0081455_10001020 | 3300005937 | Bacteria | 35311 |
| 357 | Ga0081455_10007227 | 3300005937 | Bacteria | 11728 |
| 358 | Ga0081455_10015261 | 3300005937 | Bacteria | 7471 |
| 359 | Ga0081455_10038206 | 3300005937 | Bacteria | 4252 |
| 360 | Ga0081455_10078764 | 3300005937 | Bacteria | 2708 |
| 361 | Ga0081455_10107749 | 3300005937 | Bacteria | 2221 |
| 362 | Ga0081540_1011395 | 3300005983 | Bacteria | 5944 |
| 363 | Ga0081540_1042683 | 3300005983 | Bacteria | 2337 |
| 364 | Ga0081540_1063336 | 3300005983 | Bacteria | 1750 |
| 365 | Ga0081539_10000383 | 3300005985 | Bacteria | 95995 |
| 366 | Ga0081539_10015010 | 3300005985 | Bacteria | 5676 |
| 367 | Ga0081539_10017690 | 3300005985 | Bacteria | 4989 |
| 368 | Ga0070717_10001168 | 3300006028 | Bacteria | 17725 |
| 369 | Ga0070717_10015940 | 3300006028 | Bacteria | 5817 |
| 370 | Ga0070717_10377706 | 3300006028 | Bacteria | 1270 |
| 371 | Ga0070717_10442099 | 3300006028 | Bacteria | 1171 |
| 372 | Ga0070717_10506372 | 3300006028 | Bacteria | 1091 |
| 373 | Ga0070715_10024981 | 3300006163 | Bacteria | 2362 |
| 374 | Ga0070715_10084603 | 3300006163 | Bacteria | 1447 |
| 375 | Ga0070715_10089150 | 3300006163 | Bacteria | 1415 |
| 376 | Ga0070715_10260486 | 3300006163 | Bacteria | 911 |
| 377 | Ga0070716_100343284 | 3300006173 | Bacteria | 1054 |
| 378 | Ga0070716_100758852 | 3300006173 | Bacteria | 747 |
| 379 | Ga0070712_100070922 | 3300006175 | Bacteria | 2491 |
| 380 | Ga0070712_100103966 | 3300006175 | Bacteria | 2106 |
| 381 | Ga0070712_100174325 | 3300006175 | Bacteria | 1671 |
| 382 | Ga0070712_100191493 | 3300006175 | Bacteria | 1601 |
| 383 | Ga0070712_100422895 | 3300006175 | Bacteria | 1104 |
| 384 | Ga0070712_100463002 | 3300006175 | Bacteria | 1057 |
| 385 | Ga0070712_100696268 | 3300006175 | Bacteria | 866 |
| 386 | Ga0070712_100840579 | 3300006175 | Bacteria | 789 |
| 387 | Ga0070712_101208616 | 3300006175 | Bacteria | 658 |
| 388 | Ga0097621_100005910 | 3300006237 | Bacteria | 8649 |
| 389 | Ga0097621_100043102 | 3300006237 | Bacteria | 3637 |
| 390 | Ga0097621_100056582 | 3300006237 | Bacteria | 3204 |
| 391 | Ga0097621_100126763 | 3300006237 | Bacteria | 2169 |
| 392 | Ga0097621_100141649 | 3300006237 | Bacteria | 2055 |
| 393 | Ga0097621_100168849 | 3300006237 | Bacteria | 1885 |
| 394 | Ga0097621_100212491 | 3300006237 | Bacteria | 1683 |
| 395 | Ga0068871_100008204 | 3300006358 | Bacteria | 7502 |
| 396 | Ga0068871_100030469 | 3300006358 | Bacteria | 4248 |
| 397 | Ga0068871_100043481 | 3300006358 | Bacteria | 3608 |
| 398 | Ga0068871_100083761 | 3300006358 | Bacteria | 2645 |
| 399 | Ga0068871_100158555 | 3300006358 | Bacteria | 1934 |
| 400 | Ga0068871_100170869 | 3300006358 | Bacteria | 1863 |
| 401 | Ga0075428_100006169 | 3300006844 | Bacteria | 13338 |
| 402 | Ga0075428_100115229 | 3300006844 | Bacteria | 2928 |
| 403 | Ga0075431_100250925 | 3300006847 | Bacteria | 1798 |
| 404 | Ga0075433_10789172 | 3300006852 | Bacteria | 830 |
| 405 | Ga0075434_100095121 | 3300006871 | Bacteria | 2985 |
| 406 | Ga0075429_100106125 | 3300006880 | Bacteria | 2454 |
| 407 | Ga0068865_100125301 | 3300006881 | Bacteria | 1916 |
| 408 | Ga0068865_100679906 | 3300006881 | Bacteria | 877 |
| 409 | Ga0097620_100009257 | 3300006931 | Bacteria | 9946 |
| 410 | Ga0097620_100077591 | 3300006931 | Bacteria | 3362 |
| 411 | Ga0075435_100166639 | 3300007076 | Bacteria | 1858 |
| 412 | Ga0075435_100393987 | 3300007076 | Bacteria | 1190 |
| 413 | Ga0075435_100575964 | 3300007076 | Bacteria | 976 |
| 414 | Ga0099794_10105378 | 3300007265 | Bacteria | 1410 |
| 415 | Ga0099794_10255562 | 3300007265 | Bacteria | 904 |
| 416 | Ga0099794_10294353 | 3300007265 | Bacteria | 840 |
| 417 | Ga0099795_10021374 | 3300007788 | Bacteria | 2122 |
| 418 | Ga0105240_10000110 | 3300009093 | Bacteria | 171018 |
| 419 | Ga0105240_10002977 | 3300009093 | Bacteria | 26658 |
| 420 | Ga0105240_10004162 | 3300009093 | Bacteria | 22167 |
| 421 | Ga0105240_10006113 | 3300009093 | Bacteria | 17762 |
| 422 | Ga0105240_10011018 | 3300009093 | Bacteria | 12653 |
| 423 | Ga0105240_10018647 | 3300009093 | Bacteria | 9301 |
| 424 | Ga0105240_10021078 | 3300009093 | Bacteria | 8674 |
| 425 | Ga0105240_10024493 | 3300009093 | Bacteria | 7952 |
| 426 | Ga0105240_10045766 | 3300009093 | Bacteria | 5549 |
| 427 | Ga0105240_10057674 | 3300009093 | Bacteria | 4850 |
| 428 | Ga0105240_10057865 | 3300009093 | Bacteria | 4840 |
| 429 | Ga0105240_10094572 | 3300009093 | Bacteria | 3644 |
| 430 | Ga0105240_10203782 | 3300009093 | Bacteria | 2317 |
| 431 | Ga0105240_10233044 | 3300009093 | Bacteria | 2138 |
| 432 | Ga0105240_10344013 | 3300009093 | Bacteria | 1693 |
| 433 | Ga0105240_10485896 | 3300009093 | Bacteria | 1376 |
| 434 | Ga0111539_10024953 | 3300009094 | Bacteria | 7327 |
| 435 | Ga0111539_10048160 | 3300009094 | Bacteria | 5090 |
| 436 | Ga0111539_10364910 | 3300009094 | Bacteria | 1681 |
| 437 | Ga0111539_10459134 | 3300009094 | Bacteria | 1483 |
| 438 | Ga0111539_10530472 | 3300009094 | Bacteria | 1371 |
| 439 | Ga0111539_10691858 | 3300009094 | Bacteria | 1187 |
| 440 | Ga0111539_10979673 | 3300009094 | Bacteria | 983 |
| 441 | Ga0111539_11055895 | 3300009094 | Bacteria | 944 |
| 442 | Ga0111539_11801493 | 3300009094 | Bacteria | 710 |
| 443 | Ga0105245_10014499 | 3300009098 | Bacteria | 6864 |
| 444 | Ga0105245_10016368 | 3300009098 | Bacteria | 6466 |
| 445 | Ga0105245_10092826 | 3300009098 | Bacteria | 2780 |
| 446 | Ga0105245_10101893 | 3300009098 | Bacteria | 2658 |
| 447 | Ga0105245_10204100 | 3300009098 | Bacteria | 1900 |
| 448 | Ga0105245_10216453 | 3300009098 | Bacteria | 1846 |
| 449 | Ga0105245_10240811 | 3300009098 | Bacteria | 1753 |
| 450 | Ga0105245_10584080 | 3300009098 | Bacteria | 1142 |
| 451 | Ga0105245_10990091 | 3300009098 | Bacteria | 885 |
| 452 | Ga0105247_10010428 | 3300009101 | Bacteria | 5618 |
| 453 | Ga0105247_10019147 | 3300009101 | Bacteria | 4109 |
| 454 | Ga0105247_10095546 | 3300009101 | Bacteria | 1893 |
| 455 | Ga0105247_10180518 | 3300009101 | Bacteria | 1408 |
| 456 | Ga0114129_10294163 | 3300009147 | Bacteria | 2166 |
| 457 | Ga0114129_10301295 | 3300009147 | Bacteria | 2136 |
| 458 | Ga0114129_10581869 | 3300009147 | Bacteria | 1453 |
| 459 | Ga0114129_10705432 | 3300009147 | Bacteria | 1296 |
| 460 | Ga0114129_10773460 | 3300009147 | Bacteria | 1227 |
| 461 | Ga0105243_10025677 | 3300009148 | Bacteria | 4505 |
| 462 | Ga0105243_10063534 | 3300009148 | Bacteria | 2959 |
| 463 | Ga0105243_10471911 | 3300009148 | Bacteria | 1182 |
| 464 | Ga0105241_10000499 | 3300009174 | Bacteria | 29672 |
| 465 | Ga0105241_10001439 | 3300009174 | Bacteria | 18231 |
| 466 | Ga0105241_10011886 | 3300009174 | Bacteria | 6397 |
| 467 | Ga0105241_10018202 | 3300009174 | Bacteria | 5165 |
| 468 | Ga0105241_10077143 | 3300009174 | Bacteria | 2600 |
| 469 | Ga0105241_10106285 | 3300009174 | Bacteria | 2240 |
| 470 | Ga0105241_10154687 | 3300009174 | Bacteria | 1879 |
| 471 | Ga0105241_10162943 | 3300009174 | Bacteria | 1835 |
| 472 | Ga0105241_10248858 | 3300009174 | Bacteria | 1506 |
| 473 | Ga0105241_10287321 | 3300009174 | Bacteria | 1407 |
| 474 | Ga0105241_10680215 | 3300009174 | Bacteria | 937 |
| 475 | Ga0105242_10093281 | 3300009176 | Bacteria | 2538 |
| 476 | Ga0105242_10317171 | 3300009176 | Bacteria | 1428 |
| 477 | Ga0105248_10021196 | 3300009177 | Bacteria | 7200 |
| 478 | Ga0105248_10122333 | 3300009177 | Bacteria | 2935 |
| 479 | Ga0105248_10183242 | 3300009177 | Bacteria | 2359 |
| 480 | Ga0105248_10257384 | 3300009177 | Bacteria | 1965 |
| 481 | Ga0105248_10393375 | 3300009177 | Bacteria | 1561 |
| 482 | Ga0105248_10592768 | 3300009177 | Bacteria | 1250 |
| 483 | Ga0105237_10011086 | 3300009545 | Bacteria | 9552 |
| 484 | Ga0105237_10049812 | 3300009545 | Bacteria | 4209 |
| 485 | Ga0105237_10056793 | 3300009545 | Bacteria | 3917 |
| 486 | Ga0105237_10066015 | 3300009545 | Bacteria | 3613 |
| 487 | Ga0105237_10073168 | 3300009545 | Bacteria | 3420 |
| 488 | Ga0105237_10402740 | 3300009545 | Bacteria | 1373 |
| 489 | Ga0105237_10583193 | 3300009545 | Bacteria | 1125 |
| 490 | Ga0105237_10677773 | 3300009545 | Bacteria | 1038 |
| 491 | Ga0105238_10000022 | 3300009551 | Bacteria | 204310 |
| 492 | Ga0105238_10002721 | 3300009551 | Bacteria | 17603 |
| 493 | Ga0105238_10005603 | 3300009551 | Bacteria | 12408 |
| 494 | Ga0105238_10022030 | 3300009551 | Bacteria | 6494 |
| 495 | Ga0105238_10022535 | 3300009551 | Bacteria | 6420 |
| 496 | Ga0105238_10034871 | 3300009551 | Bacteria | 5118 |
| 497 | Ga0105238_10047779 | 3300009551 | Bacteria | 4314 |
| 498 | Ga0105238_10049531 | 3300009551 | Bacteria | 4230 |
| 499 | Ga0105238_10068891 | 3300009551 | Bacteria | 3539 |
| 500 | Ga0105238_10079344 | 3300009551 | Bacteria | 3273 |
| 501 | Ga0105238_10125195 | 3300009551 | Bacteria | 2549 |
| 502 | Ga0105238_10265953 | 3300009551 | Bacteria | 1695 |
| 503 | Ga0105238_10439611 | 3300009551 | Bacteria | 1300 |
| 504 | Ga0105249_10002483 | 3300009553 | Bacteria | 15976 |
| 505 | Ga0105249_10035706 | 3300009553 | Bacteria | 4507 |
| 506 | Ga0105249_10058512 | 3300009553 | Bacteria | 3532 |
| 507 | Ga0099796_10033936 | 3300010159 | Bacteria | 1682 |
| 508 | Ga0105239_10002555 | 3300010375 | Bacteria | 23081 |
| 509 | Ga0105239_10006929 | 3300010375 | Bacteria | 13073 |
| 510 | Ga0105239_10025488 | 3300010375 | Bacteria | 6511 |
| 511 | Ga0105239_10106592 | 3300010375 | Bacteria | 3104 |
| 512 | Ga0105239_10138293 | 3300010375 | Unclassified | 2712 |
| 513 | Ga0105239_10140558 | 3300010375 | Bacteria | 2690 |
| 514 | Ga0105239_10143742 | 3300010375 | Bacteria | 2659 |
| 515 | Ga0105239_10238443 | 3300010375 | Bacteria | 2041 |
| 516 | Ga0105239_10496809 | 3300010375 | Bacteria | 1387 |
| 517 | Ga0105239_10535661 | 3300010375 | Bacteria | 1333 |
| 518 | Ga0105246_10027231 | 3300011119 | Bacteria | 3743 |
| 519 | Ga0105246_10036329 | 3300011119 | Bacteria | 3300 |
| 520 | Ga0105246_10302139 | 3300011119 | Bacteria | 1293 |
| 521 | Ga0157373_10108777 | 3300013100 | Bacteria | 1949 |
| 522 | Ga0157373_10183910 | 3300013100 | Unclassified | 1472 |
| 523 | Ga0157373_10199149 | 3300013100 | Bacteria | 1412 |
| 524 | Ga0157371_10159964 | 3300013102 | Bacteria | 1608 |
| 525 | Ga0157370_10000001 | 3300013104 | Bacteria | 529517 |
| 526 | Ga0157370_10008658 | 3300013104 | Bacteria | 10950 |
| 527 | Ga0157370_10008869 | 3300013104 | Bacteria | 10809 |
| 528 | Ga0157370_10011186 | 3300013104 | Bacteria | 9409 |
| 529 | Ga0157370_10015802 | 3300013104 | Bacteria | 7660 |
| 530 | Ga0157370_10038234 | 3300013104 | Bacteria | 4643 |
| 531 | Ga0157370_10097260 | 3300013104 | Bacteria | 2761 |
| 532 | Ga0157370_10098225 | 3300013104 | Bacteria | 2746 |
| 533 | Ga0157370_10132873 | 3300013104 | Bacteria | 2321 |
| 534 | Ga0157370_10299367 | 3300013104 | Bacteria | 1485 |
| 535 | Ga0157370_10658875 | 3300013104 | Bacteria | 957 |
| 536 | Ga0157370_10748019 | 3300013104 | Bacteria | 891 |
| 537 | Ga0157369_10000017 | 3300013105 | Bacteria | 246520 |
| 538 | Ga0157369_10004551 | 3300013105 | Bacteria | 16308 |
| 539 | Ga0157369_10007293 | 3300013105 | Bacteria | 12727 |
| 540 | Ga0157369_10009433 | 3300013105 | Bacteria | 11156 |
| 541 | Ga0157369_10015411 | 3300013105 | Bacteria | 8616 |
| 542 | Ga0157369_10027881 | 3300013105 | Bacteria | 6256 |
| 543 | Ga0157369_10057968 | 3300013105 | Bacteria | 4178 |
| 544 | Ga0157369_10065204 | 3300013105 | Bacteria | 3920 |
| 545 | Ga0157369_10090600 | 3300013105 | Bacteria | 3265 |
| 546 | Ga0157369_10106727 | 3300013105 | Bacteria | 2980 |
| 547 | Ga0157369_10145401 | 3300013105 | Bacteria | 2507 |
| 548 | Ga0157369_10183205 | 3300013105 | Bacteria | 2203 |
| 549 | Ga0157369_10351609 | 3300013105 | Bacteria | 1530 |
| 550 | Ga0157369_10366909 | 3300013105 | Bacteria | 1495 |
| 551 | Ga0157369_10664640 | 3300013105 | Bacteria | 1074 |
| 552 | Ga0157374_10028878 | 3300013296 | Bacteria | 5013 |
| 553 | Ga0157374_10085775 | 3300013296 | Bacteria | 2995 |
| 554 | Ga0157374_10087966 | 3300013296 | Bacteria | 2958 |
| 555 | Ga0157374_10099198 | 3300013296 | Bacteria | 2789 |
| 556 | Ga0157374_10149667 | 3300013296 | Unclassified | 2269 |
| 557 | Ga0157374_10161820 | 3300013296 | Bacteria | 2180 |
| 558 | Ga0157374_10161959 | 3300013296 | Bacteria | 2179 |
| 559 | Ga0157374_10163756 | 3300013296 | Bacteria | 2167 |
| 560 | Ga0157374_10201931 | 3300013296 | Bacteria | 1947 |
| 561 | Ga0157374_10225485 | 3300013296 | Bacteria | 1840 |
| 562 | Ga0157374_10244240 | 3300013296 | Bacteria | 1766 |
| 563 | Ga0157374_10259379 | 3300013296 | Bacteria | 1712 |
| 564 | Ga0157374_10259948 | 3300013296 | Bacteria | 1710 |
| 565 | Ga0157374_10358844 | 3300013296 | Bacteria | 1449 |
| 566 | Ga0157374_10383353 | 3300013296 | Bacteria | 1400 |
| 567 | Ga0157374_10393051 | 3300013296 | Bacteria | 1382 |
| 568 | Ga0157374_10611134 | 3300013296 | Bacteria | 1100 |
| 569 | Ga0157374_10962331 | 3300013296 | Bacteria | 872 |
| 570 | Ga0157378_10013898 | 3300013297 | Bacteria | 7041 |
| 571 | Ga0157378_10025003 | 3300013297 | Bacteria | 5260 |
| 572 | Ga0157378_10083453 | 3300013297 | Bacteria | 2891 |
| 573 | Ga0157378_10146178 | 3300013297 | Bacteria | 2199 |
| 574 | Ga0157378_10155892 | 3300013297 | Bacteria | 2132 |
| 575 | Ga0157378_10178892 | 3300013297 | Bacteria | 1994 |
| 576 | Ga0157378_10202110 | 3300013297 | Bacteria | 1880 |
| 577 | Ga0157378_10290612 | 3300013297 | Bacteria | 1579 |
| 578 | Ga0157378_10329137 | 3300013297 | Bacteria | 1486 |
| 579 | Ga0157378_10341837 | 3300013297 | Bacteria | 1459 |
| 580 | Ga0157378_10416320 | 3300013297 | Bacteria | 1327 |
| 581 | Ga0157378_10469482 | 3300013297 | Bacteria | 1252 |
| 582 | Ga0163162_10063360 | 3300013306 | Bacteria | 3740 |
| 583 | Ga0163162_10065287 | 3300013306 | Bacteria | 3686 |
| 584 | Ga0163162_10066944 | 3300013306 | Bacteria | 3642 |
| 585 | Ga0163162_10252424 | 3300013306 | Bacteria | 1896 |
| 586 | Ga0163162_10398752 | 3300013306 | Bacteria | 1508 |
| 587 | Ga0163162_10656902 | 3300013306 | Bacteria | 1172 |
| 588 | Ga0157372_10000019 | 3300013307 | Bacteria | 209591 |
| 589 | Ga0157372_10001427 | 3300013307 | Bacteria | 25800 |
| 590 | Ga0157372_10006383 | 3300013307 | Bacteria | 12545 |
| 591 | Ga0157372_10006885 | 3300013307 | Bacteria | 12095 |
| 592 | Ga0157372_10011083 | 3300013307 | Bacteria | 9590 |
| 593 | Ga0157372_10020348 | 3300013307 | Bacteria | 7158 |
| 594 | Ga0157372_10026897 | 3300013307 | Bacteria | 6262 |
| 595 | Ga0157372_10035989 | 3300013307 | Bacteria | 5453 |
| 596 | Ga0157372_10038659 | 3300013307 | Bacteria | 5265 |
| 597 | Ga0157372_10040234 | 3300013307 | Bacteria | 5162 |
| 598 | Ga0157372_10088394 | 3300013307 | Bacteria | 3518 |
| 599 | Ga0157372_10163470 | 3300013307 | Bacteria | 2573 |
| 600 | Ga0157372_10312844 | 3300013307 | Bacteria | 1828 |
| 601 | Ga0157372_10810968 | 3300013307 | Bacteria | 1087 |
| 602 | Ga0157372_10811789 | 3300013307 | Bacteria | 1086 |
| 603 | Ga0157372_11000836 | 3300013307 | Bacteria | 968 |
| 604 | Ga0157372_11443127 | 3300013307 | Bacteria | 793 |
| 605 | Ga0157375_10000203 | 3300013308 | Bacteria | 55131 |
| 606 | Ga0157375_10002872 | 3300013308 | Bacteria | 14930 |
| 607 | Ga0157375_10025585 | 3300013308 | Bacteria | 5488 |
| 608 | Ga0157375_10060947 | 3300013308 | Bacteria | 3744 |
| 609 | Ga0157375_10112501 | 3300013308 | Bacteria | 2823 |
| 610 | Ga0157375_10162875 | 3300013308 | Unclassified | 2373 |
| 611 | Ga0157375_10199573 | 3300013308 | Bacteria | 2156 |
| 612 | Ga0157375_10243111 | 3300013308 | Bacteria | 1960 |
| 613 | Ga0157375_10246351 | 3300013308 | Bacteria | 1947 |
| 614 | Ga0157375_10411554 | 3300013308 | Bacteria | 1518 |
| 615 | Ga0157375_11953631 | 3300013308 | Bacteria | 697 |
| 616 | Ga0163163_10079191 | 3300014325 | Bacteria | 3284 |
| 617 | Ga0163163_10115383 | 3300014325 | Bacteria | 2717 |
| 618 | Ga0163163_10129386 | 3300014325 | Unclassified | 2564 |
| 619 | Ga0163163_10202216 | 3300014325 | Bacteria | 2035 |
| 620 | Ga0163163_10266375 | 3300014325 | Bacteria | 1765 |
| 621 | Ga0163163_10760543 | 3300014325 | Bacteria | 1032 |
| 622 | Ga0182008_10117825 | 3300014497 | Bacteria | 1318 |
| 623 | Ga0157377_10006952 | 3300014745 | Bacteria | 5432 |
| 624 | Ga0157377_10362341 | 3300014745 | Bacteria | 976 |
| 625 | Ga0157379_10001307 | 3300014968 | Bacteria | 20302 |
| 626 | Ga0157379_10019724 | 3300014968 | Bacteria | 5958 |
| 627 | Ga0157379_10101405 | 3300014968 | Bacteria | 2584 |
| 628 | Ga0157379_10290471 | 3300014968 | Bacteria | 1489 |
| 629 | Ga0157376_10058108 | 3300014969 | Bacteria | 3239 |
| 630 | Ga0157376_10081576 | 3300014969 | Unclassified | 2777 |
| 631 | Ga0157376_10082480 | 3300014969 | Bacteria | 2763 |
| 632 | Ga0157376_10115517 | 3300014969 | Unclassified | 2370 |
| 633 | Ga0157376_10184487 | 3300014969 | Bacteria | 1909 |
| 634 | Ga0157376_10251911 | 3300014969 | Bacteria | 1650 |
| 635 | Ga0157376_10277905 | 3300014969 | Bacteria | 1576 |
| 636 | Ga0157376_10927186 | 3300014969 | Bacteria | 890 |
| 637 | Ga0157376_11040551 | 3300014969 | Bacteria | 843 |
| 638 | Ga0182005_1129900 | 3300015265 | Bacteria | 722 |
| 639 | Ga0163161_10032942 | 3300017792 | Bacteria | 3702 |
| 640 | Ga0163161_10056210 | 3300017792 | Bacteria | 2858 |
| 641 | Ga0197907_10453974 | 3300020069 | Bacteria | 1293 |
| 642 | Ga0206356_10199215 | 3300020070 | Bacteria | 1422 |
| 643 | Ga0206349_1520185 | 3300020075 | Bacteria | 928 |
| 644 | Ga0206355_1521992 | 3300020076 | Bacteria | 744 |
| 645 | Ga0206351_10135863 | 3300020077 | Bacteria | 859 |
| 646 | Ga0206353_10775596 | 3300020082 | Bacteria | 883 |
| 647 | Ga0154015_1237230 | 3300020610 | Bacteria | 1064 |
| 648 | Ga0213872_10080591 | 3300021361 | Bacteria | 1463 |
| 649 | Ga0224712_10113778 | 3300022467 | Bacteria | 1164 |
| 650 | Ga0209233_1008597 | 3300025261 | Bacteria | 3147 |
| 651 | Ga0207666_1000344 | 3300025271 | Bacteria | 6379 |
| 652 | Ga0207666_1006695 | 3300025271 | Bacteria | 1499 |
| 653 | Ga0207666_1013616 | 3300025271 | Bacteria | 1143 |
| 654 | Ga0207673_1001188 | 3300025290 | Bacteria | 2811 |
| 655 | Ga0207673_1002355 | 3300025290 | Bacteria | 2149 |
| 656 | Ga0207673_1009877 | 3300025290 | Bacteria | 1223 |
| 657 | Ga0207697_10000626 | 3300025315 | Bacteria | 20087 |
| 658 | Ga0207697_10000790 | 3300025315 | Bacteria | 17954 |
| 659 | Ga0207697_10001407 | 3300025315 | Bacteria | 13171 |
| 660 | Ga0207697_10003875 | 3300025315 | Bacteria | 7294 |
| 661 | Ga0207697_10005474 | 3300025315 | Bacteria | 5899 |
| 662 | Ga0207697_10016550 | 3300025315 | Bacteria | 3037 |
| 663 | Ga0207697_10028878 | 3300025315 | Bacteria | 2269 |
| 664 | Ga0207697_10032102 | 3300025315 | Bacteria | 2149 |
| 665 | Ga0207697_10075687 | 3300025315 | Bacteria | 1414 |
| 666 | Ga0207656_10035064 | 3300025321 | Unclassified | 2098 |
| 667 | Ga0207656_10139306 | 3300025321 | Unclassified | 1143 |
| 668 | Ga0207656_10256448 | 3300025321 | Bacteria | 858 |
| 669 | Ga0207656_10282232 | 3300025321 | Bacteria | 819 |
| 670 | Ga0207653_10027546 | 3300025885 | Bacteria | 1825 |
| 671 | Ga0207682_10268543 | 3300025893 | Bacteria | 796 |
| 672 | Ga0207692_10314799 | 3300025898 | Bacteria | 956 |
| 673 | Ga0207692_10611692 | 3300025898 | Bacteria | 701 |
| 674 | Ga0207688_10004890 | 3300025901 | Bacteria | 7294 |
| 675 | Ga0207680_10097565 | 3300025903 | Unclassified | 1882 |
| 676 | Ga0207680_10228028 | 3300025903 | Bacteria | 1279 |
| 677 | Ga0207680_10379710 | 3300025903 | Bacteria | 996 |
| 678 | Ga0207647_10003329 | 3300025904 | Bacteria | 12071 |
| 679 | Ga0207647_10043157 | 3300025904 | Bacteria | 2823 |
| 680 | Ga0207685_10276158 | 3300025905 | Bacteria | 823 |
| 681 | Ga0207685_10330103 | 3300025905 | Bacteria | 763 |
| 682 | Ga0207699_10084554 | 3300025906 | Bacteria | 1976 |
| 683 | Ga0207699_10103220 | 3300025906 | Bacteria | 1813 |
| 684 | Ga0207699_10258085 | 3300025906 | Bacteria | 1204 |
| 685 | Ga0207645_10001183 | 3300025907 | Bacteria | 21547 |
| 686 | Ga0207645_10009277 | 3300025907 | Bacteria | 6812 |
| 687 | Ga0207645_10017845 | 3300025907 | Bacteria | 4679 |
| 688 | Ga0207645_10069224 | 3300025907 | Bacteria | 2257 |
| 689 | Ga0207645_10115310 | 3300025907 | Bacteria | 1742 |
| 690 | Ga0207645_10137033 | 3300025907 | Bacteria | 1594 |
| 691 | Ga0207645_10320979 | 3300025907 | Bacteria | 1033 |
| 692 | Ga0207705_10003109 | 3300025909 | Bacteria | 12661 |
| 693 | Ga0207705_10018357 | 3300025909 | Bacteria | 5003 |
| 694 | Ga0207705_10348684 | 3300025909 | Bacteria | 1140 |
| 695 | Ga0207705_10348721 | 3300025909 | Bacteria | 1140 |
| 696 | Ga0207705_10374887 | 3300025909 | Bacteria | 1099 |
| 697 | Ga0207705_10601248 | 3300025909 | Bacteria | 855 |
| 698 | Ga0207684_10000208 | 3300025910 | Bacteria | 91185 |
| 699 | Ga0207684_10011681 | 3300025910 | Bacteria | 7663 |
| 700 | Ga0207684_10032685 | 3300025910 | Bacteria | 4424 |
| 701 | Ga0207684_10038928 | 3300025910 | Bacteria | 4035 |
| 702 | Ga0207684_10076404 | 3300025910 | Bacteria | 2847 |
| 703 | Ga0207684_10105852 | 3300025910 | Bacteria | 2406 |
| 704 | Ga0207684_10108352 | 3300025910 | Bacteria | 2377 |
| 705 | Ga0207684_10148263 | 3300025910 | Bacteria | 2018 |
| 706 | Ga0207684_10210721 | 3300025910 | Bacteria | 1676 |
| 707 | Ga0207684_10258594 | 3300025910 | Bacteria | 1502 |
| 708 | Ga0207684_10485233 | 3300025910 | Bacteria | 1060 |
| 709 | Ga0207684_10490310 | 3300025910 | Bacteria | 1054 |
| 710 | Ga0207684_10542473 | 3300025910 | Bacteria | 995 |
| 711 | Ga0207654_10000059 | 3300025911 | Bacteria | 75594 |
| 712 | Ga0207654_10000148 | 3300025911 | Bacteria | 44438 |
| 713 | Ga0207654_10027416 | 3300025911 | Bacteria | 3096 |
| 714 | Ga0207654_10045978 | 3300025911 | Bacteria | 2487 |
| 715 | Ga0207654_10069959 | 3300025911 | Bacteria | 2082 |
| 716 | Ga0207654_10152216 | 3300025911 | Bacteria | 1486 |
| 717 | Ga0207707_10009213 | 3300025912 | Bacteria | 8569 |
| 718 | Ga0207707_10265244 | 3300025912 | Bacteria | 1489 |
| 719 | Ga0207707_10282944 | 3300025912 | Bacteria | 1436 |
| 720 | Ga0207707_10342674 | 3300025912 | Bacteria | 1288 |
| 721 | Ga0207707_10344745 | 3300025912 | Bacteria | 1284 |
| 722 | Ga0207707_10717509 | 3300025912 | Bacteria | 838 |
| 723 | Ga0207695_10000026 | 3300025913 | Bacteria | 624558 |
| 724 | Ga0207695_10000096 | 3300025913 | Bacteria | 265048 |
| 725 | Ga0207695_10000168 | 3300025913 | Bacteria | 193087 |
| 726 | Ga0207695_10000398 | 3300025913 | Bacteria | 97114 |
| 727 | Ga0207695_10000995 | 3300025913 | Bacteria | 50150 |
| 728 | Ga0207695_10003250 | 3300025913 | Bacteria | 23105 |
| 729 | Ga0207695_10026448 | 3300025913 | Bacteria | 6476 |
| 730 | Ga0207695_10028901 | 3300025913 | Bacteria | 6137 |
| 731 | Ga0207695_10036712 | 3300025913 | Bacteria | 5293 |
| 732 | Ga0207695_10037022 | 3300025913 | Bacteria | 5267 |
| 733 | Ga0207695_10070290 | 3300025913 | Bacteria | 3579 |
| 734 | Ga0207695_10102956 | 3300025913 | Bacteria | 2847 |
| 735 | Ga0207695_10107989 | 3300025913 | Bacteria | 2768 |
| 736 | Ga0207695_10139986 | 3300025913 | Unclassified | 2369 |
| 737 | Ga0207695_10256527 | 3300025913 | Bacteria | 1647 |
| 738 | Ga0207695_10522391 | 3300025913 | Bacteria | 1069 |
| 739 | Ga0207671_10000022 | 3300025914 | Bacteria | 277803 |
| 740 | Ga0207671_10004443 | 3300025914 | Bacteria | 13401 |
| 741 | Ga0207671_10234773 | 3300025914 | Bacteria | 1439 |
| 742 | Ga0207671_10274019 | 3300025914 | Bacteria | 1330 |
| 743 | Ga0207671_10412311 | 3300025914 | Bacteria | 1075 |
| 744 | Ga0207693_10059101 | 3300025915 | Bacteria | 3003 |
| 745 | Ga0207693_10075237 | 3300025915 | Bacteria | 2644 |
| 746 | Ga0207693_10083493 | 3300025915 | Bacteria | 2502 |
| 747 | Ga0207693_10089084 | 3300025915 | Bacteria | 2418 |
| 748 | Ga0207693_10371425 | 3300025915 | Bacteria | 1119 |
| 749 | Ga0207663_10017214 | 3300025916 | Bacteria | 4022 |
| 750 | Ga0207663_10025656 | 3300025916 | Bacteria | 3410 |
| 751 | Ga0207663_10028883 | 3300025916 | Bacteria | 3251 |
| 752 | Ga0207663_10083544 | 3300025916 | Bacteria | 2098 |
| 753 | Ga0207663_10127824 | 3300025916 | Bacteria | 1751 |
| 754 | Ga0207663_10242862 | 3300025916 | Bacteria | 1321 |
| 755 | Ga0207663_10301159 | 3300025916 | Bacteria | 1198 |
| 756 | Ga0207663_10466712 | 3300025916 | Bacteria | 976 |
| 757 | Ga0207663_10879380 | 3300025916 | Bacteria | 716 |
| 758 | Ga0207660_10016771 | 3300025917 | Bacteria | 4856 |
| 759 | Ga0207660_10018083 | 3300025917 | Bacteria | 4695 |
| 760 | Ga0207660_10213405 | 3300025917 | Bacteria | 1512 |
| 761 | Ga0207660_10459739 | 3300025917 | Bacteria | 1030 |
| 762 | Ga0207662_10000409 | 3300025918 | Bacteria | 18985 |
| 763 | Ga0207662_10026305 | 3300025918 | Bacteria | 3355 |
| 764 | Ga0207657_10000449 | 3300025919 | Bacteria | 43787 |
| 765 | Ga0207657_10004990 | 3300025919 | Bacteria | 13952 |
| 766 | Ga0207657_10007021 | 3300025919 | Bacteria | 11585 |
| 767 | Ga0207657_10096023 | 3300025919 | Bacteria | 2466 |
| 768 | Ga0207657_10114834 | 3300025919 | Bacteria | 2220 |
| 769 | Ga0207657_10118175 | 3300025919 | Bacteria | 2183 |
| 770 | Ga0207657_10230845 | 3300025919 | Bacteria | 1480 |
| 771 | Ga0207657_10375605 | 3300025919 | Bacteria | 1120 |
| 772 | Ga0207649_10061119 | 3300025920 | Bacteria | 2370 |
| 773 | Ga0207649_10105780 | 3300025920 | Bacteria | 1870 |
| 774 | Ga0207649_10325896 | 3300025920 | Bacteria | 1130 |
| 775 | Ga0207649_10504775 | 3300025920 | Bacteria | 920 |
| 776 | Ga0207652_10002118 | 3300025921 | Bacteria | 17032 |
| 777 | Ga0207652_10030059 | 3300025921 | Bacteria | 4547 |
| 778 | Ga0207652_10231637 | 3300025921 | Bacteria | 1665 |
| 779 | Ga0207652_10246469 | 3300025921 | Bacteria | 1611 |
| 780 | Ga0207652_10261935 | 3300025921 | Bacteria | 1560 |
| 781 | Ga0207652_10318086 | 3300025921 | Bacteria | 1405 |
| 782 | Ga0207646_10000183 | 3300025922 | Bacteria | 85731 |
| 783 | Ga0207646_10000631 | 3300025922 | Bacteria | 45798 |
| 784 | Ga0207646_10008068 | 3300025922 | Bacteria | 10613 |
| 785 | Ga0207646_10015364 | 3300025922 | Bacteria | 7232 |
| 786 | Ga0207646_10045375 | 3300025922 | Bacteria | 3945 |
| 787 | Ga0207646_10051074 | 3300025922 | Bacteria | 3700 |
| 788 | Ga0207646_10136354 | 3300025922 | Unclassified | 2210 |
| 789 | Ga0207646_10138881 | 3300025922 | Bacteria | 2188 |
| 790 | Ga0207646_10579622 | 3300025922 | Bacteria | 1008 |
| 791 | Ga0207646_10819381 | 3300025922 | Bacteria | 828 |
| 792 | Ga0207681_10004167 | 3300025923 | Bacteria | 8952 |
| 793 | Ga0207681_10250134 | 3300025923 | Bacteria | 1383 |
| 794 | Ga0207694_10000009 | 3300025924 | Bacteria | 460687 |
| 795 | Ga0207694_10002280 | 3300025924 | Bacteria | 15698 |
| 796 | Ga0207694_10002681 | 3300025924 | Bacteria | 14408 |
| 797 | Ga0207694_10027319 | 3300025924 | Bacteria | 4346 |
| 798 | Ga0207694_10069661 | 3300025924 | Bacteria | 2748 |
| 799 | Ga0207694_10076075 | 3300025924 | Bacteria | 2628 |
| 800 | Ga0207694_10099662 | 3300025924 | Bacteria | 2301 |
| 801 | Ga0207694_10108045 | 3300025924 | Bacteria | 2211 |
| 802 | Ga0207694_10153227 | 3300025924 | Bacteria | 1858 |
| 803 | Ga0207694_10193831 | 3300025924 | Bacteria | 1651 |
| 804 | Ga0207694_10523747 | 3300025924 | Bacteria | 993 |
| 805 | Ga0207650_10144327 | 3300025925 | Bacteria | 1874 |
| 806 | Ga0207650_10186786 | 3300025925 | Unclassified | 1654 |
| 807 | Ga0207650_10381794 | 3300025925 | Bacteria | 1163 |
| 808 | Ga0207659_10002134 | 3300025926 | Bacteria | 11726 |
| 809 | Ga0207659_10004521 | 3300025926 | Bacteria | 8415 |
| 810 | Ga0207659_10022319 | 3300025926 | Bacteria | 4213 |
| 811 | Ga0207659_10080718 | 3300025926 | Bacteria | 2403 |
| 812 | Ga0207659_10082531 | 3300025926 | Bacteria | 2380 |
| 813 | Ga0207659_10393905 | 3300025926 | Bacteria | 1157 |
| 814 | Ga0207687_10025546 | 3300025927 | Bacteria | 3953 |
| 815 | Ga0207687_10114379 | 3300025927 | Bacteria | 2008 |
| 816 | Ga0207687_10171903 | 3300025927 | Bacteria | 1672 |
| 817 | Ga0207687_10182982 | 3300025927 | Bacteria | 1625 |
| 818 | Ga0207687_10253943 | 3300025927 | Bacteria | 1399 |
| 819 | Ga0207687_10335212 | 3300025927 | Bacteria | 1228 |
| 820 | Ga0207687_10382388 | 3300025927 | Bacteria | 1154 |
| 821 | Ga0207687_10490679 | 3300025927 | Bacteria | 1024 |
| 822 | Ga0207700_10021387 | 3300025928 | Bacteria | 4415 |
| 823 | Ga0207700_10036389 | 3300025928 | Bacteria | 3555 |
| 824 | Ga0207700_10076986 | 3300025928 | Bacteria | 2590 |
| 825 | Ga0207700_10189011 | 3300025928 | Bacteria | 1730 |
| 826 | Ga0207700_10375563 | 3300025928 | Bacteria | 1242 |
| 827 | Ga0207700_10631256 | 3300025928 | Bacteria | 954 |
| 828 | Ga0207700_10674440 | 3300025928 | Bacteria | 922 |
| 829 | Ga0207664_10010540 | 3300025929 | Bacteria | 6530 |
| 830 | Ga0207664_10026874 | 3300025929 | Bacteria | 4356 |
| 831 | Ga0207664_10291046 | 3300025929 | Bacteria | 1435 |
| 832 | Ga0207664_10294691 | 3300025929 | Archaea | 1426 |
| 833 | Ga0207664_10510632 | 3300025929 | Unclassified | 1077 |
| 834 | Ga0207664_10749438 | 3300025929 | Bacteria | 878 |
| 835 | Ga0207644_10049564 | 3300025931 | Bacteria | 3007 |
| 836 | Ga0207644_10054221 | 3300025931 | Bacteria | 2887 |
| 837 | Ga0207644_10077141 | 3300025931 | Bacteria | 2453 |
| 838 | Ga0207644_10089702 | 3300025931 | Bacteria | 2289 |
| 839 | Ga0207644_10373882 | 3300025931 | Bacteria | 1161 |
| 840 | Ga0207644_10446155 | 3300025931 | Bacteria | 1062 |
| 841 | Ga0207690_10008491 | 3300025932 | Bacteria | 6092 |
| 842 | Ga0207690_10011663 | 3300025932 | Bacteria | 5254 |
| 843 | Ga0207690_10080976 | 3300025932 | Bacteria | 2267 |
| 844 | Ga0207690_10218374 | 3300025932 | Bacteria | 1457 |
| 845 | Ga0207690_10241491 | 3300025932 | Bacteria | 1391 |
| 846 | Ga0207706_10002682 | 3300025933 | Bacteria | 17347 |
| 847 | Ga0207706_10013334 | 3300025933 | Bacteria | 7476 |
| 848 | Ga0207706_10019967 | 3300025933 | Bacteria | 6022 |
| 849 | Ga0207706_10172907 | 3300025933 | Bacteria | 1898 |
| 850 | Ga0207706_10269673 | 3300025933 | Bacteria | 1485 |
| 851 | Ga0207686_10052496 | 3300025934 | Bacteria | 2545 |
| 852 | Ga0207709_10027034 | 3300025935 | Bacteria | 3301 |
| 853 | Ga0207709_10247346 | 3300025935 | Bacteria | 1300 |
| 854 | Ga0207709_10323921 | 3300025935 | Bacteria | 1154 |
| 855 | Ga0207670_10001469 | 3300025936 | Bacteria | 12372 |
| 856 | Ga0207670_10002885 | 3300025936 | Bacteria | 9071 |
| 857 | Ga0207670_10013641 | 3300025936 | Bacteria | 4798 |
| 858 | Ga0207670_10016080 | 3300025936 | Bacteria | 4487 |
| 859 | Ga0207670_10127738 | 3300025936 | Bacteria | 1857 |
| 860 | Ga0207670_10160414 | 3300025936 | Bacteria | 1678 |
| 861 | Ga0207670_10409195 | 3300025936 | Bacteria | 1086 |
| 862 | Ga0207670_10550060 | 3300025936 | Bacteria | 943 |
| 863 | Ga0207670_10840302 | 3300025936 | Bacteria | 767 |
| 864 | Ga0207669_10021680 | 3300025937 | Bacteria | 3397 |
| 865 | Ga0207669_10431092 | 3300025937 | Bacteria | 1040 |
| 866 | Ga0207704_10021415 | 3300025938 | Bacteria | 3443 |
| 867 | Ga0207704_10054465 | 3300025938 | Bacteria | 2439 |
| 868 | Ga0207704_10459691 | 3300025938 | Bacteria | 1018 |
| 869 | Ga0207704_10671419 | 3300025938 | Bacteria | 855 |
| 870 | Ga0207665_10038476 | 3300025939 | Bacteria | 3185 |
| 871 | Ga0207665_10160496 | 3300025939 | Bacteria | 1617 |
| 872 | Ga0207665_10788664 | 3300025939 | Bacteria | 750 |
| 873 | Ga0207665_10828660 | 3300025939 | Bacteria | 732 |
| 874 | Ga0207691_10001501 | 3300025940 | Bacteria | 23232 |
| 875 | Ga0207691_10007842 | 3300025940 | Bacteria | 10284 |
| 876 | Ga0207691_10143577 | 3300025940 | Bacteria | 2102 |
| 877 | Ga0207691_10422736 | 3300025940 | Bacteria | 1135 |
| 878 | Ga0207711_10000008 | 3300025941 | Bacteria | 597686 |
| 879 | Ga0207711_10074729 | 3300025941 | Bacteria | 2948 |
| 880 | Ga0207711_10083085 | 3300025941 | Bacteria | 2801 |
| 881 | Ga0207711_10119592 | 3300025941 | Bacteria | 2350 |
| 882 | Ga0207711_10742217 | 3300025941 | Bacteria | 915 |
| 883 | Ga0207711_11029078 | 3300025941 | Bacteria | 763 |
| 884 | Ga0207689_10002246 | 3300025942 | Bacteria | 18103 |
| 885 | Ga0207689_10039202 | 3300025942 | Bacteria | 3922 |
| 886 | Ga0207661_10005174 | 3300025944 | Bacteria | 9169 |
| 887 | Ga0207661_10011869 | 3300025944 | Bacteria | 6328 |
| 888 | Ga0207661_10051042 | 3300025944 | Bacteria | 3299 |
| 889 | Ga0207661_10112583 | 3300025944 | Bacteria | 2304 |
| 890 | Ga0207661_10204885 | 3300025944 | Bacteria | 1736 |
| 891 | Ga0207661_10264584 | 3300025944 | Bacteria | 1533 |
| 892 | Ga0207661_10403342 | 3300025944 | Bacteria | 1240 |
| 893 | Ga0207661_10650824 | 3300025944 | Bacteria | 968 |
| 894 | Ga0207661_11176228 | 3300025944 | Bacteria | 706 |
| 895 | Ga0207679_10095458 | 3300025945 | Bacteria | 2311 |
| 896 | Ga0207679_10253354 | 3300025945 | Bacteria | 1498 |
| 897 | Ga0207679_10296800 | 3300025945 | Unclassified | 1391 |
| 898 | Ga0207679_10458647 | 3300025945 | Bacteria | 1131 |
| 899 | Ga0207679_10574676 | 3300025945 | Bacteria | 1013 |
| 900 | Ga0207679_10576287 | 3300025945 | Bacteria | 1012 |
| 901 | Ga0207667_10000079 | 3300025949 | Bacteria | 163341 |
| 902 | Ga0207667_10001458 | 3300025949 | Bacteria | 29676 |
| 903 | Ga0207667_10006805 | 3300025949 | Bacteria | 13810 |
| 904 | Ga0207667_10016914 | 3300025949 | Bacteria | 8226 |
| 905 | Ga0207667_10023376 | 3300025949 | Bacteria | 6806 |
| 906 | Ga0207667_10026670 | 3300025949 | Bacteria | 6306 |
| 907 | Ga0207667_10036286 | 3300025949 | Bacteria | 5285 |
| 908 | Ga0207667_10039377 | 3300025949 | Bacteria | 5038 |
| 909 | Ga0207667_10090320 | 3300025949 | Bacteria | 3166 |
| 910 | Ga0207667_10112552 | 3300025949 | Bacteria | 2807 |
| 911 | Ga0207667_10169295 | 3300025949 | Bacteria | 2245 |
| 912 | Ga0207667_10171411 | 3300025949 | Bacteria | 2230 |
| 913 | Ga0207667_10454777 | 3300025949 | Bacteria | 1301 |
| 914 | Ga0207667_10552882 | 3300025949 | Bacteria | 1164 |
| 915 | Ga0207667_10978971 | 3300025949 | Bacteria | 834 |
| 916 | Ga0207651_10002173 | 3300025960 | Bacteria | 9282 |
| 917 | Ga0207651_10417188 | 3300025960 | Bacteria | 1145 |
| 918 | Ga0207651_11039199 | 3300025960 | Bacteria | 733 |
| 919 | Ga0207712_10003754 | 3300025961 | Bacteria | 9587 |
| 920 | Ga0207668_10002290 | 3300025972 | Bacteria | 11177 |
| 921 | Ga0207668_10130580 | 3300025972 | Bacteria | 1918 |
| 922 | Ga0207668_10275870 | 3300025972 | Bacteria | 1376 |
| 923 | Ga0207668_10347939 | 3300025972 | Bacteria | 1238 |
| 924 | Ga0207640_10000143 | 3300025981 | Bacteria | 52088 |
| 925 | Ga0207640_10150172 | 3300025981 | Bacteria | 1711 |
| 926 | Ga0207658_10001807 | 3300025986 | Bacteria | 16015 |
| 927 | Ga0207658_10027823 | 3300025986 | Bacteria | 3976 |
| 928 | Ga0207658_10124648 | 3300025986 | Bacteria | 2059 |
| 929 | Ga0207658_10289630 | 3300025986 | Bacteria | 1407 |
| 930 | Ga0207658_10468850 | 3300025986 | Bacteria | 1117 |
| 931 | Ga0207658_10800123 | 3300025986 | Bacteria | 856 |
| 932 | Ga0207658_10845929 | 3300025986 | Bacteria | 832 |
| 933 | Ga0207677_10087240 | 3300026023 | Unclassified | 2258 |
| 934 | Ga0207677_10407802 | 3300026023 | Bacteria | 1154 |
| 935 | Ga0207703_10006169 | 3300026035 | Bacteria | 9594 |
| 936 | Ga0207703_10054444 | 3300026035 | Bacteria | 3253 |
| 937 | Ga0207703_10113086 | 3300026035 | Bacteria | 2320 |
| 938 | Ga0207703_10337539 | 3300026035 | Bacteria | 1384 |
| 939 | Ga0207703_10691177 | 3300026035 | Bacteria | 970 |
| 940 | Ga0207703_11200810 | 3300026035 | Bacteria | 729 |
| 941 | Ga0207639_10000065 | 3300026041 | Bacteria | 98610 |
| 942 | Ga0207639_10000076 | 3300026041 | Bacteria | 87381 |
| 943 | Ga0207639_10120389 | 3300026041 | Bacteria | 2156 |
| 944 | Ga0207639_10169559 | 3300026041 | Bacteria | 1847 |
| 945 | Ga0207639_10377745 | 3300026041 | Bacteria | 1272 |
| 946 | Ga0207639_10726697 | 3300026041 | Bacteria | 922 |
| 947 | Ga0207678_10004055 | 3300026067 | Bacteria | 13178 |
| 948 | Ga0207678_10029719 | 3300026067 | Bacteria | 4771 |
| 949 | Ga0207678_10239216 | 3300026067 | Bacteria | 1555 |
| 950 | Ga0207678_10513620 | 3300026067 | Bacteria | 1045 |
| 951 | Ga0207678_10535677 | 3300026067 | Bacteria | 1023 |
| 952 | Ga0207708_10058723 | 3300026075 | Bacteria | 2935 |
| 953 | Ga0207702_10008193 | 3300026078 | Bacteria | 8833 |
| 954 | Ga0207702_10020253 | 3300026078 | Bacteria | 5510 |
| 955 | Ga0207702_10024812 | 3300026078 | Bacteria | 4974 |
| 956 | Ga0207702_10090998 | 3300026078 | Bacteria | 2670 |
| 957 | Ga0207702_10109479 | 3300026078 | Unclassified | 2453 |
| 958 | Ga0207702_10113044 | 3300026078 | Bacteria | 2418 |
| 959 | Ga0207702_10177309 | 3300026078 | Bacteria | 1959 |
| 960 | Ga0207702_10190710 | 3300026078 | Bacteria | 1893 |
| 961 | Ga0207702_10208961 | 3300026078 | Bacteria | 1814 |
| 962 | Ga0207702_10257874 | 3300026078 | Bacteria | 1640 |
| 963 | Ga0207702_10377644 | 3300026078 | Bacteria | 1362 |
| 964 | Ga0207702_10602674 | 3300026078 | Bacteria | 1078 |
| 965 | Ga0207641_10020528 | 3300026088 | Bacteria | 5426 |
| 966 | Ga0207641_10209974 | 3300026088 | Bacteria | 1800 |
| 967 | Ga0207641_10248048 | 3300026088 | Unclassified | 1662 |
| 968 | Ga0207641_10249979 | 3300026088 | Unclassified | 1655 |
| 969 | Ga0207641_10252063 | 3300026088 | Bacteria | 1649 |
| 970 | Ga0207641_10274222 | 3300026088 | Bacteria | 1584 |
| 971 | Ga0207641_10505316 | 3300026088 | Bacteria | 1174 |
| 972 | Ga0207641_10547831 | 3300026088 | Bacteria | 1128 |
| 973 | Ga0207676_10018477 | 3300026095 | Bacteria | 5068 |
| 974 | Ga0207676_10024666 | 3300026095 | Bacteria | 4454 |
| 975 | Ga0207676_10132178 | 3300026095 | Unclassified | 2124 |
| 976 | Ga0207676_10169266 | 3300026095 | Bacteria | 1902 |
| 977 | Ga0207676_10188292 | 3300026095 | Bacteria | 1814 |
| 978 | Ga0207676_10817971 | 3300026095 | Bacteria | 910 |
| 979 | Ga0207676_11396830 | 3300026095 | Bacteria | 696 |
| 980 | Ga0207674_10002485 | 3300026116 | Bacteria | 23236 |
| 981 | Ga0207674_10006155 | 3300026116 | Bacteria | 14169 |
| 982 | Ga0207674_10024492 | 3300026116 | Bacteria | 6449 |
| 983 | Ga0207674_10074578 | 3300026116 | Bacteria | 3404 |
| 984 | Ga0207674_10092099 | 3300026116 | Bacteria | 3021 |
| 985 | Ga0207674_10284851 | 3300026116 | Bacteria | 1601 |
| 986 | Ga0207675_100062052 | 3300026118 | Bacteria | 3490 |
| 987 | Ga0207675_100222911 | 3300026118 | Bacteria | 1817 |
| 988 | Ga0207683_10004955 | 3300026121 | Bacteria | 11452 |
| 989 | Ga0207683_10011527 | 3300026121 | Bacteria | 7546 |
| 990 | Ga0207683_10107835 | 3300026121 | Bacteria | 2492 |
| 991 | Ga0207683_10201029 | 3300026121 | Bacteria | 1811 |
| 992 | Ga0207698_10000018 | 3300026142 | Bacteria | 176540 |
| 993 | Ga0207698_10000028 | 3300026142 | Bacteria | 117250 |
| 994 | Ga0207698_10010307 | 3300026142 | Bacteria | 5994 |
| 995 | Ga0207698_10036620 | 3300026142 | Bacteria | 3604 |
| 996 | Ga0207698_10060427 | 3300026142 | Bacteria | 2947 |
| 997 | Ga0207698_10243384 | 3300026142 | Bacteria | 1641 |
| 998 | Ga0207698_10480935 | 3300026142 | Unclassified | 1205 |
| 999 | Ga0210002_1024135 | 3300027617 | Bacteria | 991 |
| 1000 | Ga0209998_10007062 | 3300027717 | Bacteria | 2329 |
| 1001 | Ga0209998_10024835 | 3300027717 | Bacteria | 1302 |
| 1002 | Ga0209974_10050524 | 3300027876 | Bacteria | 1397 |
| 1003 | Ga0207428_10538750 | 3300027907 | Bacteria | 845 |
| 1004 | Ga0268266_10045790 | 3300028379 | Bacteria | 3743 |
| 1005 | Ga0268266_10088150 | 3300028379 | Bacteria | 2716 |
| 1006 | Ga0268266_10093091 | 3300028379 | Bacteria | 2645 |
| 1007 | Ga0268266_10094038 | 3300028379 | Bacteria | 2631 |
| 1008 | Ga0268266_10158098 | 3300028379 | Bacteria | 2049 |
| 1009 | Ga0268266_10317399 | 3300028379 | Bacteria | 1457 |
| 1010 | Ga0268266_10495891 | 3300028379 | Bacteria | 1165 |
| 1011 | Ga0268266_10502677 | 3300028379 | Bacteria | 1157 |
| 1012 | Ga0268266_11398969 | 3300028379 | Bacteria | 675 |
| 1013 | Ga0268265_10200611 | 3300028380 | Bacteria | 1730 |
| 1014 | Ga0268264_10005654 | 3300028381 | Bacteria | 10595 |
| 1015 | Ga0268264_10024027 | 3300028381 | Bacteria | 4973 |
| 1016 | Ga0268264_10032921 | 3300028381 | Bacteria | 4254 |
| 1017 | Ga0265337_1011202 | 3300028556 | Bacteria | 3101 |
| 1018 | Ga0265337_1013751 | 3300028556 | Bacteria | 2703 |
| 1019 | Ga0265326_10008612 | 3300028558 | Bacteria | 3070 |
| 1020 | Ga0265326_10045660 | 3300028558 | Bacteria | 1242 |
| 1021 | Ga0265319_1023834 | 3300028563 | Bacteria | 2212 |
| 1022 | Ga0265318_10005196 | 3300028577 | Bacteria | 6145 |
| 1023 | Ga0265323_10128204 | 3300028653 | Bacteria | 823 |
| 1024 | Ga0265322_10003492 | 3300028654 | Bacteria | 4741 |
| 1025 | Ga0265336_10006704 | 3300028666 | Bacteria | 4130 |
| 1026 | Ga0265336_10007644 | 3300028666 | Bacteria | 3836 |
| 1027 | Ga0265336_10011589 | 3300028666 | Bacteria | 2990 |
| 1028 | Ga0265336_10016940 | 3300028666 | Bacteria | 2376 |
| 1029 | Ga0265338_10000009 | 3300028800 | Bacteria | 448611 |
| 1030 | Ga0265338_10000067 | 3300028800 | Bacteria | 186731 |
| 1031 | Ga0265338_10000248 | 3300028800 | Bacteria | 98976 |
| 1032 | Ga0265338_10000312 | 3300028800 | Bacteria | 87999 |
| 1033 | Ga0265338_10002280 | 3300028800 | Bacteria | 29236 |
| 1034 | Ga0265338_10011576 | 3300028800 | Bacteria | 10170 |
| 1035 | Ga0265338_10015125 | 3300028800 | Bacteria | 8512 |
| 1036 | Ga0265338_10029122 | 3300028800 | Bacteria | 5485 |
| 1037 | Ga0265338_10036878 | 3300028800 | Bacteria | 4667 |
| 1038 | Ga0265338_10037427 | 3300028800 | Bacteria | 4618 |
| 1039 | Ga0265338_10042859 | 3300028800 | Bacteria | 4207 |
| 1040 | Ga0265338_10046238 | 3300028800 | Bacteria | 3990 |
| 1041 | Ga0265338_10053101 | 3300028800 | Bacteria | 3629 |
| 1042 | Ga0265338_10107760 | 3300028800 | Bacteria | 2252 |
| 1043 | Ga0265338_10116900 | 3300028800 | Bacteria | 2135 |
| 1044 | Ga0265338_10134014 | 3300028800 | Bacteria | 1951 |
| 1045 | Ga0265338_10256516 | 3300028800 | Bacteria | 1288 |
| 1046 | Ga0265324_10001987 | 3300029957 | Bacteria | 10935 |
| 1047 | Ga0265324_10002463 | 3300029957 | Bacteria | 9418 |
| 1048 | Ga0265324_10012445 | 3300029957 | Bacteria | 3206 |
| 1049 | Ga0265324_10038514 | 3300029957 | Bacteria | 1658 |
| 1050 | Ga0265324_10040474 | 3300029957 | Bacteria | 1614 |
| 1051 | Ga0265324_10064315 | 3300029957 | Bacteria | 1252 |
| 1052 | Ga0265324_10156539 | 3300029957 | Bacteria | 774 |
| 1053 | Ga0265330_10005878 | 3300031235 | Bacteria | 6081 |
| 1054 | Ga0265330_10008019 | 3300031235 | Bacteria | 5114 |
| 1055 | Ga0265330_10009087 | 3300031235 | Bacteria | 4738 |
| 1056 | Ga0265330_10037719 | 3300031235 | Bacteria | 2151 |
| 1057 | Ga0265330_10050722 | 3300031235 | Bacteria | 1820 |
| 1058 | Ga0265332_10072711 | 3300031238 | Bacteria | 1464 |
| 1059 | Ga0265332_10085400 | 3300031238 | Bacteria | 1337 |
| 1060 | Ga0265332_10234105 | 3300031238 | Bacteria | 761 |
| 1061 | Ga0265328_10001025 | 3300031239 | Bacteria | 12877 |
| 1062 | Ga0265328_10052567 | 3300031239 | Bacteria | 1495 |
| 1063 | Ga0265328_10099826 | 3300031239 | Bacteria | 1075 |
| 1064 | Ga0265320_10002344 | 3300031240 | Bacteria | 13264 |
| 1065 | Ga0265320_10004420 | 3300031240 | Bacteria | 9217 |
| 1066 | Ga0265320_10013339 | 3300031240 | Bacteria | 4730 |
| 1067 | Ga0265320_10027966 | 3300031240 | Bacteria | 2933 |
| 1068 | Ga0265320_10031969 | 3300031240 | Bacteria | 2699 |
| 1069 | Ga0265320_10034135 | 3300031240 | Bacteria | 2591 |
| 1070 | Ga0265320_10051926 | 3300031240 | Bacteria | 1987 |
| 1071 | Ga0265320_10157237 | 3300031240 | Bacteria | 1025 |
| 1072 | Ga0265325_10000731 | 3300031241 | Bacteria | 23769 |
| 1073 | Ga0265325_10009066 | 3300031241 | Bacteria | 5836 |
| 1074 | Ga0265325_10010521 | 3300031241 | Bacteria | 5352 |
| 1075 | Ga0265325_10020022 | 3300031241 | Bacteria | 3693 |
| 1076 | Ga0265325_10079476 | 3300031241 | Bacteria | 1632 |
| 1077 | Ga0265325_10083781 | 3300031241 | Bacteria | 1581 |
| 1078 | Ga0265325_10097223 | 3300031241 | Bacteria | 1446 |
| 1079 | Ga0265325_10195137 | 3300031241 | Bacteria | 936 |
| 1080 | Ga0265329_10002584 | 3300031242 | Bacteria | 8173 |
| 1081 | Ga0265340_10248172 | 3300031247 | Bacteria | 794 |
| 1082 | Ga0265339_10000073 | 3300031249 | Bacteria | 87912 |
| 1083 | Ga0265339_10002003 | 3300031249 | Bacteria | 14962 |
| 1084 | Ga0265339_10004006 | 3300031249 | Bacteria | 10183 |
| 1085 | Ga0265339_10006069 | 3300031249 | Bacteria | 7976 |
| 1086 | Ga0265339_10018966 | 3300031249 | Bacteria | 4045 |
| 1087 | Ga0265339_10070980 | 3300031249 | Bacteria | 1856 |
| 1088 | Ga0265339_10111296 | 3300031249 | Bacteria | 1416 |
| 1089 | Ga0265339_10181892 | 3300031249 | Bacteria | 1046 |
| 1090 | Ga0265331_10028146 | 3300031250 | Bacteria | 2812 |
| 1091 | Ga0265331_10038181 | 3300031250 | Bacteria | 2349 |
| 1092 | Ga0265331_10080509 | 3300031250 | Bacteria | 1514 |
| 1093 | Ga0265331_10161682 | 3300031250 | Bacteria | 1015 |
| 1094 | Ga0265327_10002003 | 3300031251 | Bacteria | 23024 |
| 1095 | Ga0265327_10005729 | 3300031251 | Bacteria | 10237 |
| 1096 | Ga0265327_10012167 | 3300031251 | Bacteria | 5838 |
| 1097 | Ga0265327_10027709 | 3300031251 | Bacteria | 3255 |
| 1098 | Ga0265327_10266876 | 3300031251 | Bacteria | 759 |
| 1099 | Ga0265316_10003282 | 3300031344 | Bacteria | 16413 |
| 1100 | Ga0265316_10007581 | 3300031344 | Bacteria | 10211 |
| 1101 | Ga0265316_10008950 | 3300031344 | Bacteria | 9235 |
| 1102 | Ga0265316_10016155 | 3300031344 | Bacteria | 6488 |
| 1103 | Ga0265316_10078221 | 3300031344 | Bacteria | 2539 |
| 1104 | Ga0265316_10100755 | 3300031344 | Bacteria | 2196 |
| 1105 | Ga0265316_10143189 | 3300031344 | Bacteria | 1794 |
| 1106 | Ga0265316_10153916 | 3300031344 | Bacteria | 1721 |
| 1107 | Ga0265316_10225302 | 3300031344 | Bacteria | 1382 |
| 1108 | Ga0265316_10282853 | 3300031344 | Bacteria | 1212 |
| 1109 | Ga0265316_10408508 | 3300031344 | Bacteria | 977 |
| 1110 | Ga0265316_10513227 | 3300031344 | Bacteria | 855 |
| 1111 | Ga0265316_10537893 | 3300031344 | Bacteria | 832 |
| 1112 | Ga0265313_10002161 | 3300031595 | Bacteria | 17461 |
| 1113 | Ga0265313_10014334 | 3300031595 | Bacteria | 4689 |
| 1114 | Ga0265313_10030894 | 3300031595 | Bacteria | 2751 |
| 1115 | Ga0265313_10042456 | 3300031595 | Bacteria | 2233 |
| 1116 | Ga0265314_10000090 | 3300031711 | Bacteria | 137914 |
| 1117 | Ga0265314_10000435 | 3300031711 | Bacteria | 55753 |
| 1118 | Ga0265314_10020237 | 3300031711 | Bacteria | 5139 |
| 1119 | Ga0265314_10044635 | 3300031711 | Bacteria | 3141 |
| 1120 | Ga0265314_10108677 | 3300031711 | Bacteria | 1766 |
| 1121 | Ga0265314_10115583 | 3300031711 | Bacteria | 1697 |
| 1122 | Ga0265314_10257541 | 3300031711 | Bacteria | 998 |
| 1123 | Ga0265314_10291552 | 3300031711 | Bacteria | 919 |
| 1124 | Ga0265342_10001787 | 3300031712 | Bacteria | 19563 |
| 1125 | Ga0265342_10031067 | 3300031712 | Bacteria | 3305 |
| 1126 | Ga0265342_10077309 | 3300031712 | Bacteria | 1928 |
| 1127 | Ga0265342_10102740 | 3300031712 | Bacteria | 1626 |
| 1128 | Ga0265342_10141382 | 3300031712 | Bacteria | 1342 |
| 1129 | Ga0265342_10156206 | 3300031712 | Bacteria | 1263 |
| 1130 | Ga0265342_10242079 | 3300031712 | Bacteria | 965 |
| 1131 | Ga0316576_10073596 | 3300031727 | Bacteria | 2525 |
| 1132 | Ga0307413_10093490 | 3300031824 | Bacteria | 1966 |
| 1133 | Ga0307416_100454031 | 3300032002 | Bacteria | 1335 |
| 1134 | Ga0316583_10065874 | 3300032133 | Bacteria | 1268 |
| 1135 | Ga0373926_0145230 | 3300035083 | Bacteria | 902 |
| 1136 | Ga0373940_0055533 | 3300035088 | Bacteria | 1122 |
| 1137 | Ga0373940_0058205 | 3300035088 | Bacteria | 1100 |
| 1138 | Ga0373944_0055324 | 3300035089 | Bacteria | 1260 |
| 1139 | Ga0373944_0056200 | 3300035089 | Bacteria | 1252 |
| 1140 | Ga0373936_0348933 | 3300035113 | Bacteria | 674 |
| 1141 | Ga0373941_0280044 | 3300035115 | Bacteria | 660 |
| 1142 | Ga0373945_0037354 | 3300035116 | Bacteria | 1743 |
| 1143 | Ga0373945_0092254 | 3300035116 | Bacteria | 1174 |
| 1144 | Ga0373953_0089479 | 3300035117 | Bacteria | 1287 |
| 1145 | Ga0373954_0155120 | 3300035118 | Bacteria | 1119 |
| 1146 | Ga0373954_0239999 | 3300035118 | Bacteria | 892 |
| 1147 | Ga0373956_0059482 | 3300035119 | Bacteria | 1729 |
| 1148 | Ga0373943_0010233 | 3300035170 | Bacteria | 4207 |
| 1149 | Ga0373943_0021309 | 3300035170 | Bacteria | 2992 |
| 1150 | Ga0373943_0068132 | 3300035170 | Bacteria | 1796 |
| 1151 | Ga0373943_0321633 | 3300035170 | Bacteria | 882 |
| 1152 | Ga0373946_0129673 | 3300035171 | Bacteria | 1159 |
| 1153 | Ga0373946_0289936 | 3300035171 | Bacteria | 807 |
| 1154 | Ga0373955_0216377 | 3300035172 | Bacteria | 1143 |
| 1155 | Ga0373955_0441465 | 3300035172 | Bacteria | 793 |
| 1156 | Ga0373961_0108865 | 3300035241 | Bacteria | 906 |
| 1157 | Ga0373961_0124306 | 3300035241 | Bacteria | 858 |
| 1158 | Ga0373931_0089709 | 3300035691 | Bacteria | 1711 |
| 1159 | Ga0373931_0192867 | 3300035691 | Bacteria | 1213 |
| 1160 | Ga0373931_0421097 | 3300035691 | Bacteria | 849 |
| 1161 | Ga0373931_0594478 | 3300035691 | Bacteria | 723 |
| 1162 | Ga0373935_0003449 | 3300035692 | Bacteria | 9187 |
| 1163 | Ga0373935_0016871 | 3300035692 | Bacteria | 4422 |
| 1164 | Ga0373935_0036220 | 3300035692 | Bacteria | 3084 |
| 1165 | Ga0373935_0290321 | 3300035692 | Bacteria | 1153 |
| 1166 | Ga0373927_0022338 | 3300035695 | Bacteria | 4144 |
| 1167 | Ga0373927_0187914 | 3300035695 | Bacteria | 1355 |
| 1168 | Ga0373927_0221021 | 3300035695 | Bacteria | 1244 |
| 1169 | Ga0373927_0369748 | 3300035695 | Bacteria | 945 |
| 1170 | Ga0373933_0531523 | 3300035724 | Bacteria | 771 |
| 1171 | Ga0373947_0016292 | 3300035725 | Bacteria | 4272 |
| 1172 | Ga0373947_0023502 | 3300035725 | Bacteria | 3586 |
| 1173 | Ga0373947_0159162 | 3300035725 | Bacteria | 1459 |
| 1174 | Ga0373947_0160375 | 3300035725 | Bacteria | 1454 |
| 1175 | Ga0373937_0153696 | 3300036401 | Bacteria | 2156 |
| 1176 | Ga0373937_0156536 | 3300036401 | Bacteria | 2136 |
| 1177 | Ga0373937_0162024 | 3300036401 | Bacteria | 2097 |
| 1178 | Ga0373937_0231666 | 3300036401 | Bacteria | 1740 |
| 1179 | Ga0373937_0321845 | 3300036401 | Bacteria | 1463 |
| 1180 | Ga0316584_0143769 | 3300036712 | Bacteria | 1778 |
| 1181 | Ga0373925_0015486 | 3300037068 | Bacteria | 5513 |
| 1182 | Ga0373925_0046856 | 3300037068 | Bacteria | 3216 |
| 1183 | Ga0373925_0088433 | 3300037068 | Bacteria | 2366 |
| 1184 | Ga0373925_0118258 | 3300037068 | Bacteria | 2055 |
| 1185 | Ga0373925_0211504 | 3300037068 | Bacteria | 1545 |
| 1186 | Ga0373925_0217459 | 3300037068 | Bacteria | 1524 |
| 1187 | Ga0395899_0252386 | 3300037312 | Bacteria | 1210 |
| 1188 | Ga0395900_0156740 | 3300037418 | Bacteria | 2325 |
| 1189 | Ga0395900_0311639 | 3300037418 | Bacteria | 1557 |
| 1190 | Ga0395900_1043694 | 3300037418 | Bacteria | 736 |
| 1191 | Ga0395900_1065806 | 3300037418 | Bacteria | 726 |
| 1192 | Ga0395898_0021090 | 3300037466 | Bacteria | 6609 |
| 1193 | Ga0395898_0549749 | 3300037466 | Bacteria | 1097 |
| 1194 | Ga0395905_0029576 | 3300037471 | Bacteria | 5162 |
| 1195 | Ga0395905_0577809 | 3300037471 | Bacteria | 1025 |
| 1196 | Ga0395901_0030457 | 3300038443 | Bacteria | 5558 |
| 1197 | Ga0395901_0133519 | 3300038443 | Bacteria | 2609 |
| 1198 | Ga0395901_0345710 | 3300038443 | Bacteria | 1536 |
| 1199 | Ga0436361_1055724 | 3300039447 | Bacteria | 6415 |
| 1200 | Ga0451807_1519224 | 3300041486 | Bacteria | 1529 |
| 1201 | Ga0439448_0004722 | 3300042005 | Bacteria | 3857 |
| 1202 | Ga0439455_0000789 | 3300042012 | Bacteria | 4789 |
| 1203 | Ga0439455_0039797 | 3300042012 | Bacteria | 1200 |
| 1204 | Ga0439458_0106227 | 3300042157 | Bacteria | 732 |
| 1205 | Ga0439460_0063473 | 3300042461 | Bacteria | 1132 |
| 1206 | Ga0451577_0002332 | 3300042876 | Bacteria | 22872 |
| 1207 | Ga0451577_0006562 | 3300042876 | Bacteria | 11572 |
| 1208 | Ga0451577_0014048 | 3300042876 | Bacteria | 7472 |
| 1209 | Ga0451577_0117233 | 3300042876 | Bacteria | 2385 |
| 1210 | Ga0451577_0818849 | 3300042876 | Bacteria | 841 |
| 1211 | Ga0453683_0280035 | 3300044673 | Bacteria | 1065 |
| 1212 | Ga0466966_0041957 | 3300044684 | Bacteria | 2939 |
| 1213 | Ga0466966_0110329 | 3300044684 | Bacteria | 1696 |
| 1214 | Ga0466961_0216375 | 3300044693 | Bacteria | 1182 |
| 1215 | Ga0466963_0001224 | 3300044694 | Bacteria | 13545 |
| 1216 | Ga0453684_0001814 | 3300044712 | Bacteria | 56316 |
| 1217 | Ga0453684_0003288 | 3300044712 | Bacteria | 36835 |
| 1218 | Ga0453684_0003475 | 3300044712 | Bacteria | 35376 |
| 1219 | Ga0453684_0216545 | 3300044712 | Bacteria | 2221 |
| 1220 | Ga0453684_0277971 | 3300044712 | Bacteria | 1911 |
| 1221 | Ga0453684_0920154 | 3300044712 | Bacteria | 935 |
| 1222 | Ga0466959_0082969 | 3300045049 | Bacteria | 2309 |
| 1223 | Ga0451576_0015674 | 3300045051 | Bacteria | 8391 |
| 1224 | Ga0451576_0096027 | 3300045051 | Bacteria | 3083 |
| 1225 | Ga0451576_0138454 | 3300045051 | Unclassified | 2539 |
| 1226 | Ga0451576_0253167 | 3300045051 | Bacteria | 1841 |
| 1227 | Ga0451576_0259558 | 3300045051 | Bacteria | 1816 |
| 1228 | Ga0451576_0310760 | 3300045051 | Bacteria | 1649 |
| 1229 | Ga0451576_0413719 | 3300045051 | Bacteria | 1414 |
| 1230 | Ga0451576_0437054 | 3300045051 | Bacteria | 1373 |
| 1231 | Ga0451576_0453909 | 3300045051 | Bacteria | 1346 |
| 1232 | Ga0451576_0532724 | 3300045051 | Bacteria | 1234 |
| 1233 | Ga0451576_1106959 | 3300045051 | Bacteria | 829 |
| 1234 | Ga0466967_0002331 | 3300045976 | Bacteria | 11746 |
| 1235 | Ga0466967_0045966 | 3300045976 | Bacteria | 3798 |
| 1236 | Ga0466967_0206250 | 3300045976 | Bacteria | 1863 |
| 1237 | Ga0466967_0448235 | 3300045976 | Bacteria | 1261 |
| 1238 | Ga0495592_0000372 | 3300046454 | Bacteria | 35416 |
| 1239 | Ga0495592_0081941 | 3300046454 | Bacteria | 2333 |
| 1240 | Ga0495592_0249334 | 3300046454 | Bacteria | 1174 |
| 1241 | Ga0495603_0126225 | 3300046455 | Bacteria | 1491 |
| 1242 | Ga0495629_0048036 | 3300046459 | Bacteria | 2993 |
| 1243 | Ga0495629_0085818 | 3300046459 | Bacteria | 2196 |
| 1244 | Ga0495629_0623987 | 3300046459 | Bacteria | 720 |
| 1245 | Ga0495641_0121798 | 3300046461 | Bacteria | 1164 |
| 1246 | Ga0495651_0010772 | 3300046462 | Bacteria | 7030 |
| 1247 | Ga0495651_0026464 | 3300046462 | Bacteria | 4519 |
| 1248 | Ga0495653_0516474 | 3300046463 | Bacteria | 743 |
| 1249 | Ga0495580_0164314 | 3300046472 | Bacteria | 1536 |
| 1250 | Ga0495582_0023103 | 3300046473 | Bacteria | 3402 |
| 1251 | Ga0495582_0156215 | 3300046473 | Bacteria | 1296 |
| 1252 | Ga0495582_0182818 | 3300046473 | Bacteria | 1195 |
| 1253 | Ga0495639_0037472 | 3300046475 | Bacteria | 2174 |
| 1254 | Ga0495662_0247542 | 3300046476 | Bacteria | 878 |
| 1255 | Ga0495664_0013808 | 3300046477 | Bacteria | 4580 |
| 1256 | Ga0495664_0080379 | 3300046477 | Bacteria | 1954 |
| 1257 | Ga0495584_0066609 | 3300046491 | Bacteria | 1811 |
| 1258 | Ga0495618_0026947 | 3300046514 | Bacteria | 3576 |
| 1259 | Ga0495618_0462653 | 3300046514 | Bacteria | 769 |
| 1260 | Ga0495628_0001014 | 3300046516 | Bacteria | 25650 |
| 1261 | Ga0495628_0075564 | 3300046516 | Bacteria | 2624 |
| 1262 | Ga0495628_0265272 | 3300046516 | Bacteria | 1279 |
| 1263 | Ga0495630_0000010 | 3300046517 | Bacteria | 265324 |
| 1264 | Ga0495630_0000076 | 3300046517 | Bacteria | 77289 |
| 1265 | Ga0495630_0018434 | 3300046517 | Bacteria | 5127 |
| 1266 | Ga0495630_0028269 | 3300046517 | Bacteria | 4167 |
| 1267 | Ga0495630_0036429 | 3300046517 | Bacteria | 3678 |
| 1268 | Ga0495630_0079667 | 3300046517 | Bacteria | 2471 |
| 1269 | Ga0495630_0091173 | 3300046517 | Bacteria | 2303 |
| 1270 | Ga0495630_0204007 | 3300046517 | Bacteria | 1509 |
| 1271 | Ga0495630_0254131 | 3300046517 | Bacteria | 1343 |
| 1272 | Ga0495666_0022746 | 3300046526 | Bacteria | 3103 |
| 1273 | Ga0495666_0037262 | 3300046526 | Bacteria | 2366 |
| 1274 | Ga0495666_0133507 | 3300046526 | Bacteria | 1159 |
| 1275 | Ga0495652_0010307 | 3300046529 | Bacteria | 8470 |
| 1276 | Ga0495652_0034131 | 3300046529 | Bacteria | 4436 |
| 1277 | Ga0495652_0063663 | 3300046529 | Bacteria | 3104 |
| 1278 | Ga0495652_0110432 | 3300046529 | Bacteria | 2212 |
| 1279 | Ga0495652_0140709 | 3300046529 | Unclassified | 1898 |
| 1280 | Ga0495652_0431671 | 3300046529 | Bacteria | 926 |
| 1281 | Ga0495665_0358528 | 3300046531 | Bacteria | 742 |
| 1282 | Ga0495665_0376978 | 3300046531 | Bacteria | 721 |
| 1283 | Ga0495640_0078212 | 3300046533 | Bacteria | 2204 |
| 1284 | Ga0495640_0139895 | 3300046533 | Bacteria | 1561 |
| 1285 | Ga0495640_0141664 | 3300046533 | Bacteria | 1549 |
| 1286 | Ga0495586_0000001 | 3300046535 | Bacteria | 231314 |
| 1287 | Ga0495586_0000266 | 3300046535 | Bacteria | 33936 |
| 1288 | Ga0495586_0001469 | 3300046535 | Bacteria | 12993 |
| 1289 | Ga0495586_0008072 | 3300046535 | Bacteria | 5613 |
| 1290 | Ga0495586_0017365 | 3300046535 | Bacteria | 3825 |
| 1291 | Ga0495586_0250551 | 3300046535 | Bacteria | 1010 |
| 1292 | Ga0495587_0121443 | 3300046536 | Bacteria | 1496 |
| 1293 | Ga0495587_0286517 | 3300046536 | Bacteria | 923 |
| 1294 | Ga0495621_0300809 | 3300046539 | Bacteria | 665 |
| 1295 | Ga0495645_0003373 | 3300046543 | Bacteria | 10826 |
| 1296 | Ga0495645_0005573 | 3300046543 | Bacteria | 8659 |
| 1297 | Ga0495645_0007221 | 3300046543 | Bacteria | 7733 |
| 1298 | Ga0495645_0043733 | 3300046543 | Bacteria | 3268 |
| 1299 | Ga0495645_0073218 | 3300046543 | Bacteria | 2468 |
| 1300 | Ga0495645_0102792 | 3300046543 | Bacteria | 2031 |
| 1301 | Ga0495645_0117592 | 3300046543 | Bacteria | 1875 |
| 1302 | Ga0495645_0203980 | 3300046543 | Bacteria | 1339 |
| 1303 | Ga0495633_0112074 | 3300046558 | Bacteria | 1265 |
| 1304 | Ga0495667_0069948 | 3300046559 | Bacteria | 2290 |
| 1305 | Ga0495667_0163996 | 3300046559 | Bacteria | 1429 |
| 1306 | Ga0495634_0006142 | 3300046642 | Bacteria | 9144 |
| 1307 | Ga0495634_0023918 | 3300046642 | Bacteria | 4290 |
| 1308 | Ga0495634_0034067 | 3300046642 | Bacteria | 3496 |
| 1309 | Ga0495634_0081692 | 3300046642 | Bacteria | 2113 |
| 1310 | Ga0495635_0432227 | 3300046663 | Bacteria | 872 |
| 1311 | Ga0495659_0064944 | 3300046664 | Bacteria | 1356 |
| 1312 | Ga0495659_0204526 | 3300046664 | Bacteria | 811 |
| 1313 | Ga0495657_0163590 | 3300046675 | Bacteria | 1375 |
| 1314 | Ga0495657_0307650 | 3300046675 | Bacteria | 944 |
| 1315 | Ga0495657_0453682 | 3300046675 | Bacteria | 750 |
| 1316 | Ga0495599_0051135 | 3300046678 | Bacteria | 2590 |
| 1317 | Ga0495599_0115816 | 3300046678 | Bacteria | 1667 |
| 1318 | Ga0495646_0021572 | 3300046680 | Bacteria | 4068 |
| 1319 | Ga0495647_0022310 | 3300046681 | Bacteria | 2286 |
| 1320 | Ga0495658_0005146 | 3300046683 | Bacteria | 6431 |
| 1321 | Ga0495658_0113468 | 3300046683 | Bacteria | 1631 |
| 1322 | Ga0495658_0266467 | 3300046683 | Bacteria | 1079 |
| 1323 | Ga0495669_0042807 | 3300046684 | Bacteria | 2014 |
| 1324 | Ga0495669_0066657 | 3300046684 | Bacteria | 1635 |
| 1325 | Ga0495669_0116299 | 3300046684 | Bacteria | 1251 |
| 1326 | Ga0495613_0028372 | 3300046689 | Bacteria | 4162 |
| 1327 | Ga0495613_0156704 | 3300046689 | Bacteria | 1622 |
| 1328 | Ga0495613_0174711 | 3300046689 | Bacteria | 1523 |
| 1329 | Ga0495613_0289069 | 3300046689 | Bacteria | 1137 |
| 1330 | Ga0495613_0439551 | 3300046689 | Bacteria | 885 |
| 1331 | Ga0495624_0033668 | 3300046690 | Bacteria | 3318 |
| 1332 | Ga0495624_0079760 | 3300046690 | Bacteria | 2029 |
| 1333 | Ga0495624_0201639 | 3300046690 | Bacteria | 1209 |
| 1334 | Ga0495624_0388851 | 3300046690 | Bacteria | 838 |
| 1335 | Ga0495624_0523404 | 3300046690 | Bacteria | 709 |
| 1336 | Ga0495600_0051476 | 3300046809 | Bacteria | 2688 |
| 1337 | Ga0495600_0142014 | 3300046809 | Bacteria | 1558 |
| 1338 | Ga0495604_0078472 | 3300047317 | Bacteria | 2478 |
| 1339 | Ga0495604_0286194 | 3300047317 | Bacteria | 1112 |
| 1340 | Ga0495674_0011836 | 3300047319 | Bacteria | 8224 |
| 1341 | Ga0495674_0016181 | 3300047319 | Bacteria | 6958 |
| 1342 | Ga0495674_0055294 | 3300047319 | Bacteria | 3482 |
| 1343 | Ga0495674_0136251 | 3300047319 | Bacteria | 2066 |
| 1344 | Ga0495674_0335543 | 3300047319 | Bacteria | 1229 |
| 1345 | Ga0495674_0856409 | 3300047319 | Bacteria | 704 |
| 1346 | Ga0495676_0001320 | 3300047321 | Bacteria | 21258 |
| 1347 | Ga0495676_0045268 | 3300047321 | Bacteria | 3583 |
| 1348 | Ga0495676_0114234 | 3300047321 | Bacteria | 1976 |
| 1349 | Ga0495676_0205480 | 3300047321 | Bacteria | 1366 |
| 1350 | Ga0495676_0220935 | 3300047321 | Bacteria | 1306 |
| 1351 | Ga0495680_0245591 | 3300047322 | Bacteria | 1270 |
| 1352 | Ga0495680_0342250 | 3300047322 | Bacteria | 1043 |
| 1353 | Ga0495675_0034511 | 3300047444 | Bacteria | 3230 |
| 1354 | Ga0495675_0390718 | 3300047444 | Bacteria | 812 |
| 1355 | Ga0495684_0008357 | 3300047471 | Bacteria | 8021 |
| 1356 | Ga0495686_0006394 | 3300047472 | Bacteria | 9033 |
| 1357 | Ga0495602_0102510 | 3300048088 | Bacteria | 2345 |
| 1358 | Ga0495602_0118098 | 3300048088 | Bacteria | 2140 |
| 1359 | Ga0495602_0155109 | 3300048088 | Bacteria | 1794 |
| 1360 | Ga0495602_0177580 | 3300048088 | Bacteria | 1646 |
| 1361 | Ga0495602_0225212 | 3300048088 | Bacteria | 1413 |
| 1362 | Ga0496100_0010261 | 3300048903 | Bacteria | 5298 |
| 1363 | Ga0496100_0012144 | 3300048903 | Bacteria | 4928 |
| 1364 | Ga0496100_0041445 | 3300048903 | Bacteria | 2935 |
| 1365 | Ga0496100_0882846 | 3300048903 | Bacteria | 702 |
| 1366 | Ga0496101_0031453 | 3300048904 | Bacteria | 3731 |
| 1367 | Ga0496101_0052076 | 3300048904 | Bacteria | 2951 |
| 1368 | Ga0496101_0099931 | 3300048904 | Bacteria | 2170 |
| 1369 | Ga0496101_0110719 | 3300048904 | Bacteria | 2066 |
| 1370 | Ga0496101_0265373 | 3300048904 | Bacteria | 1340 |
| 1371 | Ga0496102_0023376 | 3300048905 | Bacteria | 5489 |
| 1372 | Ga0496102_0030023 | 3300048905 | Bacteria | 4865 |
| 1373 | Ga0496102_0031305 | 3300048905 | Bacteria | 4771 |
| 1374 | Ga0496102_0229886 | 3300048905 | Bacteria | 1749 |
| 1375 | Ga0496103_0285002 | 3300048906 | Bacteria | 1062 |
| 1376 | Ga0496104_0008459 | 3300048907 | Bacteria | 9149 |
| 1377 | Ga0496104_0030612 | 3300048907 | Bacteria | 5002 |
| 1378 | Ga0496104_0460491 | 3300048907 | Bacteria | 1183 |
| 1379 | Ga0496104_0464355 | 3300048907 | Bacteria | 1177 |
| 1380 | Ga0496104_0556867 | 3300048907 | Bacteria | 1057 |
| 1381 | Ga0496104_0739327 | 3300048907 | Unclassified | 891 |
| 1382 | Ga0496105_0097746 | 3300048908 | Bacteria | 2425 |
| 1383 | Ga0496105_0133818 | 3300048908 | Bacteria | 2043 |
| 1384 | Ga0496105_0247013 | 3300048908 | Bacteria | 1447 |
| 1385 | Ga0496105_0253942 | 3300048908 | Bacteria | 1424 |
| 1386 | Ga0496105_0426795 | 3300048908 | Bacteria | 1049 |
| 1387 | Ga0496105_0947717 | 3300048908 | Bacteria | 646 |
| 1388 | Ga0496106_0024667 | 3300048909 | Bacteria | 4472 |
| 1389 | Ga0496106_0034618 | 3300048909 | Bacteria | 3773 |
| 1390 | Ga0496107_0002445 | 3300048910 | Bacteria | 12042 |
| 1391 | Ga0496107_0141588 | 3300048910 | Bacteria | 1778 |
| 1392 | Ga0496107_0192804 | 3300048910 | Bacteria | 1514 |
| 1393 | Ga0496108_0038568 | 3300048911 | Bacteria | 3980 |
| 1394 | Ga0496108_0070974 | 3300048911 | Bacteria | 2939 |
| 1395 | Ga0496108_0079935 | 3300048911 | Bacteria | 2769 |
| 1396 | Ga0496108_0106119 | 3300048911 | Bacteria | 2399 |
| 1397 | Ga0496108_0113323 | 3300048911 | Bacteria | 2321 |
| 1398 | Ga0496108_1104874 | 3300048911 | Bacteria | 674 |
| 1399 | Ga0496109_0011922 | 3300048912 | Bacteria | 7486 |
| 1400 | Ga0496109_0018616 | 3300048912 | Bacteria | 6102 |
| 1401 | Ga0496109_0188575 | 3300048912 | Bacteria | 1937 |
| 1402 | Ga0496109_0320305 | 3300048912 | Bacteria | 1463 |
| 1403 | Ga0496109_0323308 | 3300048912 | Bacteria | 1456 |
| 1404 | Ga0496109_0400554 | 3300048912 | Bacteria | 1297 |
| 1405 | Ga0496109_0448901 | 3300048912 | Bacteria | 1218 |
| 1406 | Ga0496110_0014181 | 3300048913 | Bacteria | 6612 |
| 1407 | Ga0496110_0227074 | 3300048913 | Bacteria | 1698 |
| 1408 | Ga0496110_0282743 | 3300048913 | Bacteria | 1511 |
| 1409 | Ga0496110_0337914 | 3300048913 | Bacteria | 1372 |
| 1410 | Ga0496110_0387624 | 3300048913 | Bacteria | 1273 |
| 1411 | Ga0496110_0415042 | 3300048913 | Bacteria | 1227 |
| 1412 | Ga0496110_0638626 | 3300048913 | Bacteria | 964 |
| 1413 | Ga0496111_0039079 | 3300048914 | Bacteria | 3401 |
| 1414 | Ga0496111_0310931 | 3300048914 | Bacteria | 1168 |
| 1415 | Ga0496111_0335500 | 3300048914 | Bacteria | 1119 |
| 1416 | Ga0496111_0453811 | 3300048914 | Bacteria | 946 |
| 1417 | Ga0496112_0083607 | 3300048915 | Bacteria | 3157 |
| 1418 | Ga0496112_0195155 | 3300048915 | Bacteria | 1985 |
| 1419 | Ga0496112_0235238 | 3300048915 | Bacteria | 1785 |
| 1420 | Ga0496112_0236242 | 3300048915 | Bacteria | 1781 |
| 1421 | Ga0496112_0322781 | 3300048915 | Bacteria | 1488 |
| 1422 | Ga0496112_0339497 | 3300048915 | Bacteria | 1445 |
| 1423 | Ga0496112_0360453 | 3300048915 | Bacteria | 1396 |
| 1424 | Ga0496112_0565417 | 3300048915 | Bacteria | 1070 |
| 1425 | Ga0496112_0636548 | 3300048915 | Bacteria | 997 |
| 1426 | Ga0496112_0943441 | 3300048915 | Bacteria | 784 |
| 1427 | Ga0496113_0058060 | 3300048916 | Bacteria | 2911 |
| 1428 | Ga0496113_0121631 | 3300048916 | Bacteria | 2041 |
| 1429 | Ga0496113_0374133 | 3300048916 | Bacteria | 1143 |
| 1430 | Ga0496114_0098627 | 3300048917 | Bacteria | 2491 |
| 1431 | Ga0496115_0000589 | 3300048918 | Bacteria | 27866 |
| 1432 | Ga0496115_0006346 | 3300048918 | Bacteria | 8659 |
| 1433 | Ga0496115_0010025 | 3300048918 | Bacteria | 7059 |
| 1434 | Ga0496115_0013121 | 3300048918 | Bacteria | 6258 |
| 1435 | Ga0496115_0182289 | 3300048918 | Bacteria | 1736 |
| 1436 | Ga0496115_0316742 | 3300048918 | Bacteria | 1276 |
| 1437 | Ga0496115_0346238 | 3300048918 | Bacteria | 1213 |
| 1438 | Ga0496115_0435194 | 3300048918 | Bacteria | 1061 |
| 1439 | Ga0496115_0753164 | 3300048918 | Bacteria | 761 |
| 1440 | Ga0496120_0024496 | 3300048923 | Bacteria | 3763 |
| 1441 | Ga0496126_0001301 | 3300048929 | Bacteria | 39774 |
| 1442 | Ga0496126_0002319 | 3300048929 | Bacteria | 26104 |
| 1443 | Ga0501031_0000260 | 3300049568 | Bacteria | 29811 |
| 1444 | Ga0501032_0246717 | 3300049569 | Bacteria | 1159 |
| 1445 | Ga0501033_0004992 | 3300049570 | Bacteria | 10555 |
| 1446 | Ga0501034_0192862 | 3300049571 | Bacteria | 1999 |
| 1447 | Ga0501036_0116676 | 3300049572 | Bacteria | 2255 |
| 1448 | Ga0501039_0199121 | 3300049575 | Bacteria | 1575 |
| 1449 | Ga0501039_0435133 | 3300049575 | Bacteria | 1030 |
| 1450 | Ga0501043_0091751 | 3300049579 | Bacteria | 2388 |
| 1451 | Ga0501043_0323316 | 3300049579 | Bacteria | 1176 |
| 1452 | Ga0501046_0140231 | 3300049580 | Bacteria | 1830 |
| 1453 | Ga0501047_0329811 | 3300049581 | Bacteria | 1365 |
| 1454 | Ga0501216_026626 | 3300049660 | Bacteria | 1045 |
| 1455 | Ga0501035_0183715 | 3300049822 | Bacteria | 1800 |
| 1456 | Ga0501044_0190869 | 3300049823 | Bacteria | 2011 |
| 1457 | nmdc:mga05p37_1203438_c1 | 3300050507 | Bacteria | 782 |
| 1458 | nmdc:mga05p37_342265_c1 | 3300050507 | Bacteria | 1763 |
| 1459 | nmdc:mga05p37_630211_c1 | 3300050507 | Bacteria | 1205 |
| 1460 | nmdc:mga0qj67_254596_c1 | 3300050509 | Bacteria | 1424 |
| 1461 | nmdc:mga0qj67_377808_c1 | 3300050509 | Bacteria | 1144 |
| 1462 | nmdc:mga06r32_289400_c1 | 3300050510 | Bacteria | 1625 |
| 1463 | nmdc:mga08y16_264705_c1 | 3300050511 | Bacteria | 1775 |
| 1464 | nmdc:mga08y16_309011_c1 | 3300050511 | Bacteria | 1628 |
| 1465 | nmdc:mga08y16_393976_c1 | 3300050511 | Bacteria | 1418 |
| 1466 | nmdc:mga08y16_42645_c1 | 3300050511 | Bacteria | 4751 |
| 1467 | nmdc:mga08y16_568995_c1 | 3300050511 | Bacteria | 1145 |
| 1468 | nmdc:mga08y16_776047_c1 | 3300050511 | Bacteria | 953 |
| 1469 | nmdc:mga0n895_120950_c1 | 3300050512 | Bacteria | 2639 |
| 1470 | nmdc:mga0n895_174645_c1 | 3300050512 | Bacteria | 2179 |
| 1471 | nmdc:mga0n895_71993_c1 | 3300050512 | Bacteria | 3428 |
| 1472 | nmdc:mga0n895_869497_c1 | 3300050512 | Bacteria | 888 |
| 1473 | nmdc:mga0rr50_494012_c1 | 3300050513 | Bacteria | 1040 |
| 1474 | Ga0495612_0056064 | 3300053078 | Bacteria | 1626 |
| 1475 | Ga0495612_0139948 | 3300053078 | Bacteria | 1049 |
| 1476 | Ga0495619_0080812 | 3300053085 | Bacteria | 2188 |
| 1477 | Ga0495619_0116149 | 3300053085 | Bacteria | 1832 |
| 1478 | Ga0500644_0089180 | 3300053088 | Bacteria | 1151 |
| 1479 | Ga0500555_000015 | 3300053103 | Bacteria | 230204 |
| 1480 | Ga0500595_000021 | 3300053119 | Bacteria | 151277 |
| 1481 | Ga0500595_015623 | 3300053119 | Bacteria | 2845 |
| 1482 | Ga0500616_0025416 | 3300053153 | Unclassified | 3285 |
| 1483 | 2787435762 | 2786546517 | Bacteria | 6614109 |
| 1484 | Ga0070663_100416640 | |||
| 1485 | SwRhRL2b_contig_2590704 | |||
| 1486 | SwRhRL2b_contig_317202 | |||
| 1487 | JGI24035J26624_1000353 | |||
| 1488 | JGI24035J26624_1002901 | |||
| 1489 | JGI25406J46586_10007445 | |||
| 1490 | JGI25406J46586_10007576 | |||
| 1491 | rootH2_10052670 | |||
| 1492 | JGI25405J52794_10003411 | |||
| 1493 | Ga0065714_10200499 | |||
| 1494 | Ga0065704_10027058 | |||
| 1495 | Ga0065704_10079155 | |||
| 1496 | Ga0065704_10153219 | |||
| 1497 | Ga0065704_10156070 | |||
| 1498 | Ga0065704_10215401 | |||
| 1499 | Ga0065704_10245816 | |||
| 1500 | Ga0065712_10005150 | |||
| 1501 | Ga0065712_10107257 | |||
| 1502 | Ga0065712_10192575 | |||
| 1503 | Ga0065712_10255551 | |||
| 1504 | Ga0065712_10256370 | |||
| 1505 | Ga0065715_10005010 | |||
| 1506 | Ga0065715_10009930 | |||
| 1507 | Ga0065715_10022121 | |||
| 1508 | Ga0065715_10099444 | |||
| 1509 | Ga0065715_10206275 | |||
| 1510 | Ga0065715_10215981 | |||
| 1511 | Ga0065715_10317598 | |||
| 1512 | Ga0065707_10014467 | |||
| 1513 | Ga0065707_10021565 | |||
| 1514 | Ga0065707_10045644 | |||
| 1515 | Ga0065707_10089817 | |||
| 1516 | Ga0070658_10006417 | |||
| 1517 | Ga0070658_10103061 | |||
| 1518 | Ga0070658_10110133 | |||
| 1519 | Ga0070658_10719006 | |||
| 1520 | Ga0070676_10000589 | |||
| 1521 | Ga0070676_10010323 | |||
| 1522 | Ga0070676_10014108 | |||
| 1523 | Ga0070676_10234226 | |||
| 1524 | Ga0070676_10471691 | |||
| 1525 | Ga0070683_100007967 | |||
| 1526 | Ga0070683_100008922 | |||
| 1527 | Ga0070683_100107012 | |||
| 1528 | Ga0070683_100125440 | |||
| 1529 | Ga0070683_100269334 | |||
| 1530 | Ga0070683_100435347 | |||
| 1531 | Ga0070683_100456597 | |||
| 1532 | Ga0070690_100225288 | |||
| 1533 | Ga0070690_100478704 | |||
| 1534 | Ga0070690_100647591 | |||
| 1535 | Ga0070670_100043223 | |||
| 1536 | Ga0070670_100119649 | |||
| 1537 | Ga0070670_100619566 | |||
| 1538 | Ga0070677_10319677 | |||
| 1539 | Ga0068869_100011083 | |||
| 1540 | Ga0068869_100805672 | |||
| 1541 | Ga0070666_10090341 | |||
| 1542 | Ga0070666_10107939 | |||
| 1543 | Ga0070666_10115089 | |||
| 1544 | Ga0070666_10175881 | |||
| 1545 | Ga0070680_100024149 | |||
| 1546 | Ga0070680_100042555 | |||
| 1547 | Ga0070680_100188479 | |||
| 1548 | Ga0070680_100357722 | |||
| 1549 | Ga0070682_100348852 | |||
| 1550 | Ga0068868_100063554 | |||
| 1551 | Ga0068868_100266234 | |||
| 1552 | Ga0068868_100388210 | |||
| 1553 | Ga0070660_100000983 | |||
| 1554 | Ga0070660_100001797 | |||
| 1555 | Ga0070660_100003154 | |||
| 1556 | Ga0070660_100097251 | |||
| 1557 | Ga0070660_100215642 | |||
| 1558 | Ga0070660_100289931 | |||
| 1559 | Ga0070660_100510840 | |||
| 1560 | Ga0070689_100001793 | |||
| 1561 | Ga0070689_100001811 | |||
| 1562 | Ga0070689_100002264 | |||
| 1563 | Ga0070689_100041547 | |||
| 1564 | Ga0070689_100110344 | |||
| 1565 | Ga0070689_100158175 | |||
| 1566 | Ga0070689_100200621 | |||
| 1567 | Ga0070689_100202935 | |||
| 1568 | Ga0070689_100246326 | |||
| 1569 | Ga0070689_100460605 | |||
| 1570 | Ga0070689_100720658 | |||
| 1571 | Ga0070691_10018830 | |||
| 1572 | Ga0070687_100000780 | |||
| 1573 | Ga0070687_100018387 | |||
| 1574 | Ga0070687_100443045 | |||
| 1575 | Ga0070661_100004915 | |||
| 1576 | Ga0070661_100015891 | |||
| 1577 | Ga0070661_100029133 | |||
| 1578 | Ga0070661_100572803 | |||
| 1579 | Ga0070661_100635864 | |||
| 1580 | Ga0070692_10108990 | |||
| 1581 | Ga0070692_10522530 | |||
| 1582 | Ga0070668_100015886 | |||
| 1583 | Ga0070668_100024796 | |||
| 1584 | Ga0070668_100043188 | |||
| 1585 | Ga0070668_100118276 | |||
| 1586 | Ga0070668_100272665 | |||
| 1587 | Ga0070669_100001631 | |||
| 1588 | Ga0070669_100006376 | |||
| 1589 | Ga0070669_100218611 | |||
| 1590 | Ga0070675_100001249 | |||
| 1591 | Ga0070675_100025921 | |||
| 1592 | Ga0070675_100087975 | |||
| 1593 | Ga0070675_100174020 | |||
| 1594 | Ga0070671_100033767 | |||
| 1595 | Ga0070671_100123266 | |||
| 1596 | Ga0070671_100143015 | |||
| 1597 | Ga0070671_100193160 | |||
| 1598 | Ga0070674_100008167 | |||
| 1599 | Ga0070674_100064965 | |||
| 1600 | Ga0070674_100408109 | |||
| 1601 | Ga0070673_100007143 | |||
| 1602 | Ga0070673_100034620 | |||
| 1603 | Ga0070688_100005935 | |||
| 1604 | Ga0070688_100007000 | |||
| 1605 | Ga0070688_100083650 | |||
| 1606 | Ga0070688_100099028 | |||
| 1607 | Ga0070688_100153313 | |||
| 1608 | Ga0070688_100184439 | |||
| 1609 | Ga0070688_100315758 | |||
| 1610 | Ga0070659_100002955 | |||
| 1611 | Ga0070659_100003726 | |||
| 1612 | Ga0070659_100132820 | |||
| 1613 | Ga0070659_100245142 | |||
| 1614 | Ga0070659_100700271 | |||
| 1615 | Ga0070659_100726840 | |||
| 1616 | Ga0070667_100006158 | |||
| 1617 | Ga0070667_100138872 | |||
| 1618 | Ga0070667_100254899 | |||
| 1619 | Ga0070667_100326785 | |||
| 1620 | Ga0070709_10084246 | |||
| 1621 | Ga0070709_10116366 | |||
| 1622 | Ga0070709_10139020 | |||
| 1623 | Ga0070709_10292949 | |||
| 1624 | Ga0070714_100013671 | |||
| 1625 | Ga0070714_100027631 | |||
| 1626 | Ga0070714_100028845 | |||
| 1627 | Ga0070714_100066857 | |||
| 1628 | Ga0070714_100187185 | |||
| 1629 | Ga0070714_100766261 | |||
| 1630 | Ga0070713_100054205 | |||
| 1631 | Ga0070713_100109178 | |||
| 1632 | Ga0070713_100229041 | |||
| 1633 | Ga0070713_100230518 | |||
| 1634 | Ga0070713_100299309 | |||
| 1635 | Ga0070710_10057774 | |||
| 1636 | Ga0070710_10313062 | |||
| 1637 | Ga0070701_10008197 | |||
| 1638 | Ga0070711_100001814 | |||
| 1639 | Ga0070711_100069760 | |||
| 1640 | Ga0070711_100077027 | |||
| 1641 | Ga0070711_100209510 | |||
| 1642 | Ga0070711_100521375 | |||
| 1643 | Ga0070711_100576879 | |||
| 1644 | Ga0070711_100792597 | |||
| 1645 | Ga0070705_100017094 | |||
| 1646 | Ga0070700_100173637 | |||
| 1647 | Ga0070700_100260125 | |||
| 1648 | Ga0070700_100634950 | |||
| 1649 | Ga0070694_100000907 | |||
| 1650 | Ga0070694_100027848 | |||
| 1651 | Ga0070694_100561616 | |||
| 1652 | Ga0070708_100135198 | |||
| 1653 | Ga0070708_100214158 | |||
| 1654 | Ga0070708_100438864 | |||
| 1655 | Ga0070708_100487711 | |||
| 1656 | Ga0070708_100570829 | |||
| 1657 | Ga0070708_100947850 | |||
| 1658 | Ga0070663_100014607 | |||
| 1659 | Ga0070663_100082710 | |||
| 1660 | Ga0070663_100161909 | |||
| 1661 | Ga0070678_100061543 | |||
| 1662 | Ga0070678_100069522 | |||
| 1663 | Ga0070678_100110518 | |||
| 1664 | Ga0070662_100000642 | |||
| 1665 | Ga0070662_100033760 | |||
| 1666 | Ga0070662_100033892 | |||
| 1667 | Ga0070662_100173949 | |||
| 1668 | Ga0070662_100174638 | |||
| 1669 | Ga0070662_100375168 | |||
| 1670 | Ga0070681_10003053 | |||
| 1671 | Ga0070681_10026666 | |||
| 1672 | Ga0070681_10839175 | |||
| 1673 | Ga0070685_10184711 | |||
| 1674 | Ga0070706_100000159 | |||
| 1675 | Ga0070706_100013539 | |||
| 1676 | Ga0070706_100017000 | |||
| 1677 | Ga0070706_100025025 | |||
| 1678 | Ga0070706_100037994 | |||
| 1679 | Ga0070706_100047619 | |||
| 1680 | Ga0070706_100054100 | |||
| 1681 | Ga0070706_100131232 | |||
| 1682 | Ga0070706_100259079 | |||
| 1683 | Ga0070706_100478267 | |||
| 1684 | Ga0070706_100602615 | |||
| 1685 | Ga0070706_100607804 | |||
| 1686 | Ga0070706_100920426 | |||
| 1687 | Ga0070707_100000143 | |||
| 1688 | Ga0070707_100017162 | |||
| 1689 | Ga0070707_100024588 | |||
| 1690 | Ga0070707_100026997 | |||
| 1691 | Ga0070707_100082896 | |||
| 1692 | Ga0070707_100212377 | |||
| 1693 | Ga0070707_100214640 | |||
| 1694 | Ga0070698_100007605 | |||
| 1695 | Ga0070698_100014562 | |||
| 1696 | Ga0070698_100024310 | |||
| 1697 | Ga0070698_100028748 | |||
| 1698 | Ga0070698_100398086 | |||
| 1699 | Ga0070698_100507766 | |||
| 1700 | Ga0070699_100063358 | |||
| 1701 | Ga0070699_100109267 | |||
| 1702 | Ga0070699_100777882 | |||
| 1703 | Ga0070679_100016261 | |||
| 1704 | Ga0070679_100027673 | |||
| 1705 | Ga0070679_100029298 | |||
| 1706 | Ga0070679_100049428 | |||
| 1707 | Ga0070679_100063991 | |||
| 1708 | Ga0070679_100272913 | |||
| 1709 | Ga0070679_100300229 | |||
| 1710 | Ga0070684_100000179 | |||
| 1711 | Ga0070684_100002270 | |||
| 1712 | Ga0070684_100034669 | |||
| 1713 | Ga0070684_100038565 | |||
| 1714 | Ga0070684_100075039 | |||
| 1715 | Ga0070684_100170051 | |||
| 1716 | Ga0070684_100214004 | |||
| 1717 | Ga0070684_100319249 | |||
| 1718 | Ga0070684_100428535 | |||
| 1719 | Ga0070684_100520702 | |||
| 1720 | Ga0070697_100000294 | |||
| 1721 | Ga0070697_100035635 | |||
| 1722 | Ga0070697_100039614 | |||
| 1723 | Ga0070697_100042274 | |||
| 1724 | Ga0070697_100042819 | |||
| 1725 | Ga0070697_100090580 | |||
| 1726 | Ga0070697_100135617 | |||
| 1727 | Ga0070697_100166721 | |||
| 1728 | Ga0070697_100313723 | |||
| 1729 | Ga0070697_100503024 | |||
| 1730 | Ga0070697_100793116 | |||
| 1731 | Ga0068853_100000063 | |||
| 1732 | Ga0068853_100000081 | |||
| 1733 | Ga0068853_100256371 | |||
| 1734 | Ga0068853_100376845 | |||
| 1735 | Ga0068853_100664469 | |||
| 1736 | Ga0070672_100027716 | |||
| 1737 | Ga0070672_100027969 | |||
| 1738 | Ga0070672_100039955 | |||
| 1739 | Ga0070672_100261066 | |||
| 1740 | Ga0070686_100002374 | |||
| 1741 | Ga0070686_100046045 | |||
| 1742 | Ga0070686_100097059 | |||
| 1743 | Ga0070686_100202787 | |||
| 1744 | Ga0070695_100084473 | |||
| 1745 | Ga0070696_100110204 | |||
| 1746 | Ga0070693_100074438 | |||
| 1747 | Ga0070665_100140771 | |||
| 1748 | Ga0070665_100187466 | |||
| 1749 | Ga0070665_100310922 | |||
| 1750 | Ga0070665_100529194 | |||
| 1751 | Ga0070704_100002580 | |||
| 1752 | Ga0070704_100042281 | |||
| 1753 | Ga0070704_100109296 | |||
| 1754 | Ga0068855_100001588 | |||
| 1755 | Ga0068855_100002307 | |||
| 1756 | Ga0068855_100004505 | |||
| 1757 | Ga0068855_100009720 | |||
| 1758 | Ga0068855_100013400 | |||
| 1759 | Ga0068855_100013712 | |||
| 1760 | Ga0068855_100018582 | |||
| 1761 | Ga0068855_100028094 | |||
| 1762 | Ga0068855_100031084 | |||
| 1763 | Ga0068855_100053813 | |||
| 1764 | Ga0068855_100061296 | |||
| 1765 | Ga0068855_100210546 | |||
| 1766 | Ga0068855_100313858 | |||
| 1767 | Ga0068855_100341238 | |||
| 1768 | Ga0068855_100362915 | |||
| 1769 | Ga0068855_100366655 | |||
| 1770 | Ga0068855_100496352 | |||
| 1771 | Ga0068855_100842747 | |||
| 1772 | Ga0068855_101087983 | |||
| 1773 | Ga0070664_100045734 | |||
| 1774 | Ga0070664_100422399 | |||
| 1775 | Ga0070664_100581180 | |||
| 1776 | Ga0070664_100704377 | |||
| 1777 | Ga0068857_100005136 | |||
| 1778 | Ga0068857_100005166 | |||
| 1779 | Ga0068857_100019503 | |||
| 1780 | Ga0068857_100039246 | |||
| 1781 | Ga0068857_100103324 | |||
| 1782 | Ga0068857_100433406 | |||
| 1783 | Ga0068857_100601358 | |||
| 1784 | Ga0068854_100000128 | |||
| 1785 | Ga0068854_100010151 | |||
| 1786 | Ga0068854_100024448 | |||
| 1787 | Ga0068856_100002514 | |||
| 1788 | Ga0068856_100011108 | |||
| 1789 | Ga0068856_100025743 | |||
| 1790 | Ga0068856_100052936 | |||
| 1791 | Ga0068856_100069982 | |||
| 1792 | Ga0068856_100107634 | |||
| 1793 | Ga0068856_100388332 | |||
| 1794 | Ga0068856_100429130 | |||
| 1795 | Ga0068856_101096478 | |||
| 1796 | Ga0070702_100116333 | |||
| 1797 | Ga0070702_100148859 | |||
| 1798 | Ga0070702_100197448 | |||
| 1799 | Ga0070702_100521620 | |||
| 1800 | Ga0068852_100000073 | |||
| 1801 | Ga0068852_100000212 | |||
| 1802 | Ga0068852_100095163 | |||
| 1803 | Ga0068852_100120432 | |||
| 1804 | Ga0068852_100129550 | |||
| 1805 | Ga0068852_100141372 | |||
| 1806 | Ga0068852_100188748 | |||
| 1807 | Ga0068852_100280539 | |||
| 1808 | Ga0068852_100311243 | |||
| 1809 | Ga0068852_100525482 | |||
| 1810 | Ga0068859_100009257 | |||
| 1811 | Ga0068859_100077591 | |||
| 1812 | Ga0068864_100015075 | |||
| 1813 | Ga0068864_100055480 | |||
| 1814 | Ga0068864_100061517 | |||
| 1815 | Ga0068864_100121739 | |||
| 1816 | Ga0068864_100140138 | |||
| 1817 | Ga0068864_100286786 | |||
| 1818 | Ga0068866_10026071 | |||
| 1819 | Ga0068861_100321246 | |||
| 1820 | Ga0068851_10025880 | |||
| 1821 | Ga0068851_10044574 | |||
| 1822 | Ga0068851_10060529 | |||
| 1823 | Ga0068851_10119771 | |||
| 1824 | Ga0068851_10325069 | |||
| 1825 | Ga0068863_100015084 | |||
| 1826 | Ga0068863_100085766 | |||
| 1827 | Ga0068863_100094717 | |||
| 1828 | Ga0068863_100546303 | |||
| 1829 | Ga0068863_100750486 | |||
| 1830 | Ga0068863_100914754 | |||
| 1831 | Ga0068858_100016651 | |||
| 1832 | Ga0068858_100039886 | |||
| 1833 | Ga0068858_100142379 | |||
| 1834 | Ga0068858_100685339 | |||
| 1835 | Ga0068860_100022145 | |||
| 1836 | Ga0068860_100027665 | |||
| 1837 | Ga0068860_100056365 | |||
| 1838 | Ga0068862_100004080 | |||
| 1839 | Ga0081455_10001020 | |||
| 1840 | Ga0081455_10007227 | |||
| 1841 | Ga0081455_10015261 | |||
| 1842 | Ga0081455_10038206 | |||
| 1843 | Ga0081455_10078764 | |||
| 1844 | Ga0081455_10107749 | |||
| 1845 | Ga0081540_1011395 | |||
| 1846 | Ga0081540_1042683 | |||
| 1847 | Ga0081540_1063336 | |||
| 1848 | Ga0081539_10000383 | |||
| 1849 | Ga0081539_10015010 | |||
| 1850 | Ga0081539_10017690 | |||
| 1851 | Ga0070717_10001168 | |||
| 1852 | Ga0070717_10015940 | |||
| 1853 | Ga0070717_10377706 | |||
| 1854 | Ga0070717_10442099 | |||
| 1855 | Ga0070717_10506372 | |||
| 1856 | Ga0070715_10024981 | |||
| 1857 | Ga0070715_10084603 | |||
| 1858 | Ga0070715_10089150 | |||
| 1859 | Ga0070715_10260486 | |||
| 1860 | Ga0070716_100343284 | |||
| 1861 | Ga0070716_100758852 | |||
| 1862 | Ga0070712_100070922 | |||
| 1863 | Ga0070712_100103966 | |||
| 1864 | Ga0070712_100174325 | |||
| 1865 | Ga0070712_100191493 | |||
| 1866 | Ga0070712_100422895 | |||
| 1867 | Ga0070712_100463002 | |||
| 1868 | Ga0070712_100696268 | |||
| 1869 | Ga0070712_100840579 | |||
| 1870 | Ga0070712_101208616 | |||
| 1871 | Ga0097621_100005910 | |||
| 1872 | Ga0097621_100043102 | |||
| 1873 | Ga0097621_100056582 | |||
| 1874 | Ga0097621_100126763 | |||
| 1875 | Ga0097621_100141649 | |||
| 1876 | Ga0097621_100168849 | |||
| 1877 | Ga0097621_100212491 | |||
| 1878 | Ga0068871_100008204 | |||
| 1879 | Ga0068871_100030469 | |||
| 1880 | Ga0068871_100043481 | |||
| 1881 | Ga0068871_100083761 | |||
| 1882 | Ga0068871_100158555 | |||
| 1883 | Ga0068871_100170869 | |||
| 1884 | Ga0075428_100006169 | |||
| 1885 | Ga0075428_100115229 | |||
| 1886 | Ga0075431_100250925 | |||
| 1887 | Ga0075433_10789172 | |||
| 1888 | Ga0075434_100095121 | |||
| 1889 | Ga0075429_100106125 | |||
| 1890 | Ga0068865_100125301 | |||
| 1891 | Ga0068865_100679906 | |||
| 1892 | Ga0097620_100009257 | |||
| 1893 | Ga0097620_100077591 | |||
| 1894 | Ga0075435_100166639 | |||
| 1895 | Ga0075435_100393987 | |||
| 1896 | Ga0075435_100575964 | |||
| 1897 | Ga0099794_10105378 | |||
| 1898 | Ga0099794_10255562 | |||
| 1899 | Ga0099794_10294353 | |||
| 1900 | Ga0099795_10021374 | |||
| 1901 | Ga0105240_10000110 | |||
| 1902 | Ga0105240_10002977 | |||
| 1903 | Ga0105240_10004162 | |||
| 1904 | Ga0105240_10006113 | |||
| 1905 | Ga0105240_10011018 | |||
| 1906 | Ga0105240_10018647 | |||
| 1907 | Ga0105240_10021078 | |||
| 1908 | Ga0105240_10024493 | |||
| 1909 | Ga0105240_10045766 | |||
| 1910 | Ga0105240_10057674 | |||
| 1911 | Ga0105240_10057865 | |||
| 1912 | Ga0105240_10094572 | |||
| 1913 | Ga0105240_10203782 | |||
| 1914 | Ga0105240_10233044 | |||
| 1915 | Ga0105240_10344013 | |||
| 1916 | Ga0105240_10485896 | |||
| 1917 | Ga0111539_10024953 | |||
| 1918 | Ga0111539_10048160 | |||
| 1919 | Ga0111539_10364910 | |||
| 1920 | Ga0111539_10459134 | |||
| 1921 | Ga0111539_10530472 | |||
| 1922 | Ga0111539_10691858 | |||
| 1923 | Ga0111539_10979673 | |||
| 1924 | Ga0111539_11055895 | |||
| 1925 | Ga0111539_11801493 | |||
| 1926 | Ga0105245_10014499 | |||
| 1927 | Ga0105245_10016368 | |||
| 1928 | Ga0105245_10092826 | |||
| 1929 | Ga0105245_10101893 | |||
| 1930 | Ga0105245_10204100 | |||
| 1931 | Ga0105245_10216453 | |||
| 1932 | Ga0105245_10240811 | |||
| 1933 | Ga0105245_10584080 | |||
| 1934 | Ga0105245_10990091 | |||
| 1935 | Ga0105247_10010428 | |||
| 1936 | Ga0105247_10019147 | |||
| 1937 | Ga0105247_10095546 | |||
| 1938 | Ga0105247_10180518 | |||
| 1939 | Ga0114129_10294163 | |||
| 1940 | Ga0114129_10301295 | |||
| 1941 | Ga0114129_10581869 | |||
| 1942 | Ga0114129_10705432 | |||
| 1943 | Ga0114129_10773460 | |||
| 1944 | Ga0105243_10025677 | |||
| 1945 | Ga0105243_10063534 | |||
| 1946 | Ga0105243_10471911 | |||
| 1947 | Ga0105241_10000499 | |||
| 1948 | Ga0105241_10001439 | |||
| 1949 | Ga0105241_10011886 | |||
| 1950 | Ga0105241_10018202 | |||
| 1951 | Ga0105241_10077143 | |||
| 1952 | Ga0105241_10106285 | |||
| 1953 | Ga0105241_10154687 | |||
| 1954 | Ga0105241_10162943 | |||
| 1955 | Ga0105241_10248858 | |||
| 1956 | Ga0105241_10287321 | |||
| 1957 | Ga0105241_10680215 | |||
| 1958 | Ga0105242_10093281 | |||
| 1959 | Ga0105242_10317171 | |||
| 1960 | Ga0105248_10021196 | |||
| 1961 | Ga0105248_10122333 | |||
| 1962 | Ga0105248_10183242 | |||
| 1963 | Ga0105248_10257384 | |||
| 1964 | Ga0105248_10393375 | |||
| 1965 | Ga0105248_10592768 | |||
| 1966 | Ga0105237_10011086 | |||
| 1967 | Ga0105237_10049812 | |||
| 1968 | Ga0105237_10056793 | |||
| 1969 | Ga0105237_10066015 | |||
| 1970 | Ga0105237_10073168 | |||
| 1971 | Ga0105237_10402740 | |||
| 1972 | Ga0105237_10583193 | |||
| 1973 | Ga0105237_10677773 | |||
| 1974 | Ga0105238_10000022 | |||
| 1975 | Ga0105238_10002721 | |||
| 1976 | Ga0105238_10005603 | |||
| 1977 | Ga0105238_10022030 | |||
| 1978 | Ga0105238_10022535 | |||
| 1979 | Ga0105238_10034871 | |||
| 1980 | Ga0105238_10047779 | |||
| 1981 | Ga0105238_10049531 | |||
| 1982 | Ga0105238_10068891 | |||
| 1983 | Ga0105238_10079344 | |||
| 1984 | Ga0105238_10125195 | |||
| 1985 | Ga0105238_10265953 | |||
| 1986 | Ga0105238_10439611 | |||
| 1987 | Ga0105249_10002483 | |||
| 1988 | Ga0105249_10035706 | |||
| 1989 | Ga0105249_10058512 | |||
| 1990 | Ga0099796_10033936 | |||
| 1991 | Ga0105239_10002555 | |||
| 1992 | Ga0105239_10006929 | |||
| 1993 | Ga0105239_10025488 | |||
| 1994 | Ga0105239_10106592 | |||
| 1995 | Ga0105239_10138293 | |||
| 1996 | Ga0105239_10140558 | |||
| 1997 | Ga0105239_10143742 | |||
| 1998 | Ga0105239_10238443 | |||
| 1999 | Ga0105239_10496809 | |||
| 2000 | Ga0105239_10535661 | |||
| 2001 | Ga0105246_10027231 | |||
| 2002 | Ga0105246_10036329 | |||
| 2003 | Ga0105246_10302139 | |||
| 2004 | Ga0157373_10108777 | |||
| 2005 | Ga0157373_10183910 | |||
| 2006 | Ga0157373_10199149 | |||
| 2007 | Ga0157371_10159964 | |||
| 2008 | Ga0157370_10000001 | |||
| 2009 | Ga0157370_10008658 | |||
| 2010 | Ga0157370_10008869 | |||
| 2011 | Ga0157370_10011186 | |||
| 2012 | Ga0157370_10015802 | |||
| 2013 | Ga0157370_10038234 | |||
| 2014 | Ga0157370_10097260 | |||
| 2015 | Ga0157370_10098225 | |||
| 2016 | Ga0157370_10132873 | |||
| 2017 | Ga0157370_10299367 | |||
| 2018 | Ga0157370_10658875 | |||
| 2019 | Ga0157370_10748019 | |||
| 2020 | Ga0157369_10000017 | |||
| 2021 | Ga0157369_10004551 | |||
| 2022 | Ga0157369_10007293 | |||
| 2023 | Ga0157369_10009433 | |||
| 2024 | Ga0157369_10015411 | |||
| 2025 | Ga0157369_10027881 | |||
| 2026 | Ga0157369_10057968 | |||
| 2027 | Ga0157369_10065204 | |||
| 2028 | Ga0157369_10090600 | |||
| 2029 | Ga0157369_10106727 | |||
| 2030 | Ga0157369_10145401 | |||
| 2031 | Ga0157369_10183205 | |||
| 2032 | Ga0157369_10351609 | |||
| 2033 | Ga0157369_10366909 | |||
| 2034 | Ga0157369_10664640 | |||
| 2035 | Ga0157374_10028878 | |||
| 2036 | Ga0157374_10085775 | |||
| 2037 | Ga0157374_10087966 | |||
| 2038 | Ga0157374_10099198 | |||
| 2039 | Ga0157374_10149667 | |||
| 2040 | Ga0157374_10161820 | |||
| 2041 | Ga0157374_10161959 | |||
| 2042 | Ga0157374_10163756 | |||
| 2043 | Ga0157374_10201931 | |||
| 2044 | Ga0157374_10225485 | |||
| 2045 | Ga0157374_10244240 | |||
| 2046 | Ga0157374_10259379 | |||
| 2047 | Ga0157374_10259948 | |||
| 2048 | Ga0157374_10358844 | |||
| 2049 | Ga0157374_10383353 | |||
| 2050 | Ga0157374_10393051 | |||
| 2051 | Ga0157374_10611134 | |||
| 2052 | Ga0157374_10962331 | |||
| 2053 | Ga0157378_10013898 | |||
| 2054 | Ga0157378_10025003 | |||
| 2055 | Ga0157378_10083453 | |||
| 2056 | Ga0157378_10146178 | |||
| 2057 | Ga0157378_10155892 | |||
| 2058 | Ga0157378_10178892 | |||
| 2059 | Ga0157378_10202110 | |||
| 2060 | Ga0157378_10290612 | |||
| 2061 | Ga0157378_10329137 | |||
| 2062 | Ga0157378_10341837 | |||
| 2063 | Ga0157378_10416320 | |||
| 2064 | Ga0157378_10469482 | |||
| 2065 | Ga0163162_10063360 | |||
| 2066 | Ga0163162_10065287 | |||
| 2067 | Ga0163162_10066944 | |||
| 2068 | Ga0163162_10252424 | |||
| 2069 | Ga0163162_10398752 | |||
| 2070 | Ga0163162_10656902 | |||
| 2071 | Ga0157372_10000019 | |||
| 2072 | Ga0157372_10001427 | |||
| 2073 | Ga0157372_10006383 | |||
| 2074 | Ga0157372_10006885 | |||
| 2075 | Ga0157372_10011083 | |||
| 2076 | Ga0157372_10020348 | |||
| 2077 | Ga0157372_10026897 | |||
| 2078 | Ga0157372_10035989 | |||
| 2079 | Ga0157372_10038659 | |||
| 2080 | Ga0157372_10040234 | |||
| 2081 | Ga0157372_10088394 | |||
| 2082 | Ga0157372_10163470 | |||
| 2083 | Ga0157372_10312844 | |||
| 2084 | Ga0157372_10810968 | |||
| 2085 | Ga0157372_10811789 | |||
| 2086 | Ga0157372_11000836 | |||
| 2087 | Ga0157372_11443127 | |||
| 2088 | Ga0157375_10000203 | |||
| 2089 | Ga0157375_10002872 | |||
| 2090 | Ga0157375_10025585 | |||
| 2091 | Ga0157375_10060947 | |||
| 2092 | Ga0157375_10112501 | |||
| 2093 | Ga0157375_10162875 | |||
| 2094 | Ga0157375_10199573 | |||
| 2095 | Ga0157375_10243111 | |||
| 2096 | Ga0157375_10246351 | |||
| 2097 | Ga0157375_10411554 | |||
| 2098 | Ga0157375_11953631 | |||
| 2099 | Ga0163163_10079191 | |||
| 2100 | Ga0163163_10115383 | |||
| 2101 | Ga0163163_10129386 | |||
| 2102 | Ga0163163_10202216 | |||
| 2103 | Ga0163163_10266375 | |||
| 2104 | Ga0163163_10760543 | |||
| 2105 | Ga0182008_10117825 | |||
| 2106 | Ga0157377_10006952 | |||
| 2107 | Ga0157377_10362341 | |||
| 2108 | Ga0157379_10001307 | |||
| 2109 | Ga0157379_10019724 | |||
| 2110 | Ga0157379_10101405 | |||
| 2111 | Ga0157379_10290471 | |||
| 2112 | Ga0157376_10058108 | |||
| 2113 | Ga0157376_10081576 | |||
| 2114 | Ga0157376_10082480 | |||
| 2115 | Ga0157376_10115517 | |||
| 2116 | Ga0157376_10184487 | |||
| 2117 | Ga0157376_10251911 | |||
| 2118 | Ga0157376_10277905 | |||
| 2119 | Ga0157376_10927186 | |||
| 2120 | Ga0157376_11040551 | |||
| 2121 | Ga0182005_1129900 | |||
| 2122 | Ga0163161_10032942 | |||
| 2123 | Ga0163161_10056210 | |||
| 2124 | Ga0197907_10453974 | |||
| 2125 | Ga0206356_10199215 | |||
| 2126 | Ga0206349_1520185 | |||
| 2127 | Ga0206355_1521992 | |||
| 2128 | Ga0206351_10135863 | |||
| 2129 | Ga0206353_10775596 | |||
| 2130 | Ga0154015_1237230 | |||
| 2131 | Ga0213872_10080591 | |||
| 2132 | Ga0224712_10113778 | |||
| 2133 | Ga0209233_1008597 | |||
| 2134 | Ga0207666_1000344 | |||
| 2135 | Ga0207666_1006695 | |||
| 2136 | Ga0207666_1013616 | |||
| 2137 | Ga0207673_1001188 | |||
| 2138 | Ga0207673_1002355 | |||
| 2139 | Ga0207673_1009877 | |||
| 2140 | Ga0207697_10000626 | |||
| 2141 | Ga0207697_10000790 | |||
| 2142 | Ga0207697_10001407 | |||
| 2143 | Ga0207697_10003875 | |||
| 2144 | Ga0207697_10005474 | |||
| 2145 | Ga0207697_10016550 | |||
| 2146 | Ga0207697_10028878 | |||
| 2147 | Ga0207697_10032102 | |||
| 2148 | Ga0207697_10075687 | |||
| 2149 | Ga0207656_10035064 | |||
| 2150 | Ga0207656_10139306 | |||
| 2151 | Ga0207656_10256448 | |||
| 2152 | Ga0207656_10282232 | |||
| 2153 | Ga0207653_10027546 | |||
| 2154 | Ga0207682_10268543 | |||
| 2155 | Ga0207692_10314799 | |||
| 2156 | Ga0207692_10611692 | |||
| 2157 | Ga0207688_10004890 | |||
| 2158 | Ga0207680_10097565 | |||
| 2159 | Ga0207680_10228028 | |||
| 2160 | Ga0207680_10379710 | |||
| 2161 | Ga0207647_10003329 | |||
| 2162 | Ga0207647_10043157 | |||
| 2163 | Ga0207685_10276158 | |||
| 2164 | Ga0207685_10330103 | |||
| 2165 | Ga0207699_10084554 | |||
| 2166 | Ga0207699_10103220 | |||
| 2167 | Ga0207699_10258085 | |||
| 2168 | Ga0207645_10001183 | |||
| 2169 | Ga0207645_10009277 | |||
| 2170 | Ga0207645_10017845 | |||
| 2171 | Ga0207645_10069224 | |||
| 2172 | Ga0207645_10115310 | |||
| 2173 | Ga0207645_10137033 | |||
| 2174 | Ga0207645_10320979 | |||
| 2175 | Ga0207705_10003109 | |||
| 2176 | Ga0207705_10018357 | |||
| 2177 | Ga0207705_10348684 | |||
| 2178 | Ga0207705_10348721 | |||
| 2179 | Ga0207705_10374887 | |||
| 2180 | Ga0207705_10601248 | |||
| 2181 | Ga0207684_10000208 | |||
| 2182 | Ga0207684_10011681 | |||
| 2183 | Ga0207684_10032685 | |||
| 2184 | Ga0207684_10038928 | |||
| 2185 | Ga0207684_10076404 | |||
| 2186 | Ga0207684_10105852 | |||
| 2187 | Ga0207684_10108352 | |||
| 2188 | Ga0207684_10148263 | |||
| 2189 | Ga0207684_10210721 | |||
| 2190 | Ga0207684_10258594 | |||
| 2191 | Ga0207684_10485233 | |||
| 2192 | Ga0207684_10490310 | |||
| 2193 | Ga0207684_10542473 | |||
| 2194 | Ga0207654_10000059 | |||
| 2195 | Ga0207654_10000148 | |||
| 2196 | Ga0207654_10027416 | |||
| 2197 | Ga0207654_10045978 | |||
| 2198 | Ga0207654_10069959 | |||
| 2199 | Ga0207654_10152216 | |||
| 2200 | Ga0207707_10009213 | |||
| 2201 | Ga0207707_10265244 | |||
| 2202 | Ga0207707_10282944 | |||
| 2203 | Ga0207707_10342674 | |||
| 2204 | Ga0207707_10344745 | |||
| 2205 | Ga0207707_10717509 | |||
| 2206 | Ga0207695_10000026 | |||
| 2207 | Ga0207695_10000096 | |||
| 2208 | Ga0207695_10000168 | |||
| 2209 | Ga0207695_10000398 | |||
| 2210 | Ga0207695_10000995 | |||
| 2211 | Ga0207695_10003250 | |||
| 2212 | Ga0207695_10026448 | |||
| 2213 | Ga0207695_10028901 | |||
| 2214 | Ga0207695_10036712 | |||
| 2215 | Ga0207695_10037022 | |||
| 2216 | Ga0207695_10070290 | |||
| 2217 | Ga0207695_10102956 | |||
| 2218 | Ga0207695_10107989 | |||
| 2219 | Ga0207695_10139986 | |||
| 2220 | Ga0207695_10256527 | |||
| 2221 | Ga0207695_10522391 | |||
| 2222 | Ga0207671_10000022 | |||
| 2223 | Ga0207671_10004443 | |||
| 2224 | Ga0207671_10234773 | |||
| 2225 | Ga0207671_10274019 | |||
| 2226 | Ga0207671_10412311 | |||
| 2227 | Ga0207693_10059101 | |||
| 2228 | Ga0207693_10075237 | |||
| 2229 | Ga0207693_10083493 | |||
| 2230 | Ga0207693_10089084 | |||
| 2231 | Ga0207693_10371425 | |||
| 2232 | Ga0207663_10017214 | |||
| 2233 | Ga0207663_10025656 | |||
| 2234 | Ga0207663_10028883 | |||
| 2235 | Ga0207663_10083544 | |||
| 2236 | Ga0207663_10127824 | |||
| 2237 | Ga0207663_10242862 | |||
| 2238 | Ga0207663_10301159 | |||
| 2239 | Ga0207663_10466712 | |||
| 2240 | Ga0207663_10879380 | |||
| 2241 | Ga0207660_10016771 | |||
| 2242 | Ga0207660_10018083 | |||
| 2243 | Ga0207660_10213405 | |||
| 2244 | Ga0207660_10459739 | |||
| 2245 | Ga0207662_10000409 | |||
| 2246 | Ga0207662_10026305 | |||
| 2247 | Ga0207657_10000449 | |||
| 2248 | Ga0207657_10004990 | |||
| 2249 | Ga0207657_10007021 | |||
| 2250 | Ga0207657_10096023 | |||
| 2251 | Ga0207657_10114834 | |||
| 2252 | Ga0207657_10118175 | |||
| 2253 | Ga0207657_10230845 | |||
| 2254 | Ga0207657_10375605 | |||
| 2255 | Ga0207649_10061119 | |||
| 2256 | Ga0207649_10105780 | |||
| 2257 | Ga0207649_10325896 | |||
| 2258 | Ga0207649_10504775 | |||
| 2259 | Ga0207652_10002118 | |||
| 2260 | Ga0207652_10030059 | |||
| 2261 | Ga0207652_10231637 | |||
| 2262 | Ga0207652_10246469 | |||
| 2263 | Ga0207652_10261935 | |||
| 2264 | Ga0207652_10318086 | |||
| 2265 | Ga0207646_10000183 | |||
| 2266 | Ga0207646_10000631 | |||
| 2267 | Ga0207646_10008068 | |||
| 2268 | Ga0207646_10015364 | |||
| 2269 | Ga0207646_10045375 | |||
| 2270 | Ga0207646_10051074 | |||
| 2271 | Ga0207646_10136354 | |||
| 2272 | Ga0207646_10138881 | |||
| 2273 | Ga0207646_10579622 | |||
| 2274 | Ga0207646_10819381 | |||
| 2275 | Ga0207681_10004167 | |||
| 2276 | Ga0207681_10250134 | |||
| 2277 | Ga0207694_10000009 | |||
| 2278 | Ga0207694_10002280 | |||
| 2279 | Ga0207694_10002681 | |||
| 2280 | Ga0207694_10027319 | |||
| 2281 | Ga0207694_10069661 | |||
| 2282 | Ga0207694_10076075 | |||
| 2283 | Ga0207694_10099662 | |||
| 2284 | Ga0207694_10108045 | |||
| 2285 | Ga0207694_10153227 | |||
| 2286 | Ga0207694_10193831 | |||
| 2287 | Ga0207694_10523747 | |||
| 2288 | Ga0207650_10144327 | |||
| 2289 | Ga0207650_10186786 | |||
| 2290 | Ga0207650_10381794 | |||
| 2291 | Ga0207659_10002134 | |||
| 2292 | Ga0207659_10004521 | |||
| 2293 | Ga0207659_10022319 | |||
| 2294 | Ga0207659_10080718 | |||
| 2295 | Ga0207659_10082531 | |||
| 2296 | Ga0207659_10393905 | |||
| 2297 | Ga0207687_10025546 | |||
| 2298 | Ga0207687_10114379 | |||
| 2299 | Ga0207687_10171903 | |||
| 2300 | Ga0207687_10182982 | |||
| 2301 | Ga0207687_10253943 | |||
| 2302 | Ga0207687_10335212 | |||
| 2303 | Ga0207687_10382388 | |||
| 2304 | Ga0207687_10490679 | |||
| 2305 | Ga0207700_10021387 | |||
| 2306 | Ga0207700_10036389 | |||
| 2307 | Ga0207700_10076986 | |||
| 2308 | Ga0207700_10189011 | |||
| 2309 | Ga0207700_10375563 | |||
| 2310 | Ga0207700_10631256 | |||
| 2311 | Ga0207700_10674440 | |||
| 2312 | Ga0207664_10010540 | |||
| 2313 | Ga0207664_10026874 | |||
| 2314 | Ga0207664_10291046 | |||
| 2315 | Ga0207664_10294691 | |||
| 2316 | Ga0207664_10510632 | |||
| 2317 | Ga0207664_10749438 | |||
| 2318 | Ga0207644_10049564 | |||
| 2319 | Ga0207644_10054221 | |||
| 2320 | Ga0207644_10077141 | |||
| 2321 | Ga0207644_10089702 | |||
| 2322 | Ga0207644_10373882 | |||
| 2323 | Ga0207644_10446155 | |||
| 2324 | Ga0207690_10008491 | |||
| 2325 | Ga0207690_10011663 | |||
| 2326 | Ga0207690_10080976 | |||
| 2327 | Ga0207690_10218374 | |||
| 2328 | Ga0207690_10241491 | |||
| 2329 | Ga0207706_10002682 | |||
| 2330 | Ga0207706_10013334 | |||
| 2331 | Ga0207706_10019967 | |||
| 2332 | Ga0207706_10172907 | |||
| 2333 | Ga0207706_10269673 | |||
| 2334 | Ga0207686_10052496 | |||
| 2335 | Ga0207709_10027034 | |||
| 2336 | Ga0207709_10247346 | |||
| 2337 | Ga0207709_10323921 | |||
| 2338 | Ga0207670_10001469 | |||
| 2339 | Ga0207670_10002885 | |||
| 2340 | Ga0207670_10013641 | |||
| 2341 | Ga0207670_10016080 | |||
| 2342 | Ga0207670_10127738 | |||
| 2343 | Ga0207670_10160414 | |||
| 2344 | Ga0207670_10409195 | |||
| 2345 | Ga0207670_10550060 | |||
| 2346 | Ga0207670_10840302 | |||
| 2347 | Ga0207669_10021680 | |||
| 2348 | Ga0207669_10431092 | |||
| 2349 | Ga0207704_10021415 | |||
| 2350 | Ga0207704_10054465 | |||
| 2351 | Ga0207704_10459691 | |||
| 2352 | Ga0207704_10671419 | |||
| 2353 | Ga0207665_10038476 | |||
| 2354 | Ga0207665_10160496 | |||
| 2355 | Ga0207665_10788664 | |||
| 2356 | Ga0207665_10828660 | |||
| 2357 | Ga0207691_10001501 | |||
| 2358 | Ga0207691_10007842 | |||
| 2359 | Ga0207691_10143577 | |||
| 2360 | Ga0207691_10422736 | |||
| 2361 | Ga0207711_10000008 | |||
| 2362 | Ga0207711_10074729 | |||
| 2363 | Ga0207711_10083085 | |||
| 2364 | Ga0207711_10119592 | |||
| 2365 | Ga0207711_10742217 | |||
| 2366 | Ga0207711_11029078 | |||
| 2367 | Ga0207689_10002246 | |||
| 2368 | Ga0207689_10039202 | |||
| 2369 | Ga0207661_10005174 | |||
| 2370 | Ga0207661_10011869 | |||
| 2371 | Ga0207661_10051042 | |||
| 2372 | Ga0207661_10112583 | |||
| 2373 | Ga0207661_10204885 | |||
| 2374 | Ga0207661_10264584 | |||
| 2375 | Ga0207661_10403342 | |||
| 2376 | Ga0207661_10650824 | |||
| 2377 | Ga0207661_11176228 | |||
| 2378 | Ga0207679_10095458 | |||
| 2379 | Ga0207679_10253354 | |||
| 2380 | Ga0207679_10296800 | |||
| 2381 | Ga0207679_10458647 | |||
| 2382 | Ga0207679_10574676 | |||
| 2383 | Ga0207679_10576287 | |||
| 2384 | Ga0207667_10000079 | |||
| 2385 | Ga0207667_10001458 | |||
| 2386 | Ga0207667_10006805 | |||
| 2387 | Ga0207667_10016914 | |||
| 2388 | Ga0207667_10023376 | |||
| 2389 | Ga0207667_10026670 | |||
| 2390 | Ga0207667_10036286 | |||
| 2391 | Ga0207667_10039377 | |||
| 2392 | Ga0207667_10090320 | |||
| 2393 | Ga0207667_10112552 | |||
| 2394 | Ga0207667_10169295 | |||
| 2395 | Ga0207667_10171411 | |||
| 2396 | Ga0207667_10454777 | |||
| 2397 | Ga0207667_10552882 | |||
| 2398 | Ga0207667_10978971 | |||
| 2399 | Ga0207651_10002173 | |||
| 2400 | Ga0207651_10417188 | |||
| 2401 | Ga0207651_11039199 | |||
| 2402 | Ga0207712_10003754 | |||
| 2403 | Ga0207668_10002290 | |||
| 2404 | Ga0207668_10130580 | |||
| 2405 | Ga0207668_10275870 | |||
| 2406 | Ga0207668_10347939 | |||
| 2407 | Ga0207640_10000143 | |||
| 2408 | Ga0207640_10150172 | |||
| 2409 | Ga0207658_10001807 | |||
| 2410 | Ga0207658_10027823 | |||
| 2411 | Ga0207658_10124648 | |||
| 2412 | Ga0207658_10289630 | |||
| 2413 | Ga0207658_10468850 | |||
| 2414 | Ga0207658_10800123 | |||
| 2415 | Ga0207658_10845929 | |||
| 2416 | Ga0207677_10087240 | |||
| 2417 | Ga0207677_10407802 | |||
| 2418 | Ga0207703_10006169 | |||
| 2419 | Ga0207703_10054444 | |||
| 2420 | Ga0207703_10113086 | |||
| 2421 | Ga0207703_10337539 | |||
| 2422 | Ga0207703_10691177 | |||
| 2423 | Ga0207703_11200810 | |||
| 2424 | Ga0207639_10000065 | |||
| 2425 | Ga0207639_10000076 | |||
| 2426 | Ga0207639_10120389 | |||
| 2427 | Ga0207639_10169559 | |||
| 2428 | Ga0207639_10377745 | |||
| 2429 | Ga0207639_10726697 | |||
| 2430 | Ga0207678_10004055 | |||
| 2431 | Ga0207678_10029719 | |||
| 2432 | Ga0207678_10239216 | |||
| 2433 | Ga0207678_10513620 | |||
| 2434 | Ga0207678_10535677 | |||
| 2435 | Ga0207708_10058723 | |||
| 2436 | Ga0207702_10008193 | |||
| 2437 | Ga0207702_10020253 | |||
| 2438 | Ga0207702_10024812 | |||
| 2439 | Ga0207702_10090998 | |||
| 2440 | Ga0207702_10109479 | |||
| 2441 | Ga0207702_10113044 | |||
| 2442 | Ga0207702_10177309 | |||
| 2443 | Ga0207702_10190710 | |||
| 2444 | Ga0207702_10208961 | |||
| 2445 | Ga0207702_10257874 | |||
| 2446 | Ga0207702_10377644 | |||
| 2447 | Ga0207702_10602674 | |||
| 2448 | Ga0207641_10020528 | |||
| 2449 | Ga0207641_10209974 | |||
| 2450 | Ga0207641_10248048 | |||
| 2451 | Ga0207641_10249979 | |||
| 2452 | Ga0207641_10252063 | |||
| 2453 | Ga0207641_10274222 | |||
| 2454 | Ga0207641_10505316 | |||
| 2455 | Ga0207641_10547831 | |||
| 2456 | Ga0207676_10018477 | |||
| 2457 | Ga0207676_10024666 | |||
| 2458 | Ga0207676_10132178 | |||
| 2459 | Ga0207676_10169266 | |||
| 2460 | Ga0207676_10188292 | |||
| 2461 | Ga0207676_10817971 | |||
| 2462 | Ga0207676_11396830 | |||
| 2463 | Ga0207674_10002485 | |||
| 2464 | Ga0207674_10006155 | |||
| 2465 | Ga0207674_10024492 | |||
| 2466 | Ga0207674_10074578 | |||
| 2467 | Ga0207674_10092099 | |||
| 2468 | Ga0207674_10284851 | |||
| 2469 | Ga0207675_100062052 | |||
| 2470 | Ga0207675_100222911 | |||
| 2471 | Ga0207683_10004955 | |||
| 2472 | Ga0207683_10011527 | |||
| 2473 | Ga0207683_10107835 | |||
| 2474 | Ga0207683_10201029 | |||
| 2475 | Ga0207698_10000018 | |||
| 2476 | Ga0207698_10000028 | |||
| 2477 | Ga0207698_10010307 | |||
| 2478 | Ga0207698_10036620 | |||
| 2479 | Ga0207698_10060427 | |||
| 2480 | Ga0207698_10243384 | |||
| 2481 | Ga0207698_10480935 | |||
| 2482 | Ga0210002_1024135 | |||
| 2483 | Ga0209998_10007062 | |||
| 2484 | Ga0209998_10024835 | |||
| 2485 | Ga0209974_10050524 | |||
| 2486 | Ga0207428_10538750 | |||
| 2487 | Ga0268266_10045790 | |||
| 2488 | Ga0268266_10088150 | |||
| 2489 | Ga0268266_10093091 | |||
| 2490 | Ga0268266_10094038 | |||
| 2491 | Ga0268266_10158098 | |||
| 2492 | Ga0268266_10317399 | |||
| 2493 | Ga0268266_10495891 | |||
| 2494 | Ga0268266_10502677 | |||
| 2495 | Ga0268266_11398969 | |||
| 2496 | Ga0268265_10200611 | |||
| 2497 | Ga0268264_10005654 | |||
| 2498 | Ga0268264_10024027 | |||
| 2499 | Ga0268264_10032921 | |||
| 2500 | Ga0265337_1011202 | |||
| 2501 | Ga0265337_1013751 | |||
| 2502 | Ga0265326_10008612 | |||
| 2503 | Ga0265326_10045660 | |||
| 2504 | Ga0265319_1023834 | |||
| 2505 | Ga0265318_10005196 | |||
| 2506 | Ga0265323_10128204 | |||
| 2507 | Ga0265322_10003492 | |||
| 2508 | Ga0265336_10006704 | |||
| 2509 | Ga0265336_10007644 | |||
| 2510 | Ga0265336_10011589 | |||
| 2511 | Ga0265336_10016940 | |||
| 2512 | Ga0265338_10000009 | |||
| 2513 | Ga0265338_10000067 | |||
| 2514 | Ga0265338_10000248 | |||
| 2515 | Ga0265338_10000312 | |||
| 2516 | Ga0265338_10002280 | |||
| 2517 | Ga0265338_10011576 | |||
| 2518 | Ga0265338_10015125 | |||
| 2519 | Ga0265338_10029122 | |||
| 2520 | Ga0265338_10036878 | |||
| 2521 | Ga0265338_10037427 | |||
| 2522 | Ga0265338_10042859 | |||
| 2523 | Ga0265338_10046238 | |||
| 2524 | Ga0265338_10053101 | |||
| 2525 | Ga0265338_10107760 | |||
| 2526 | Ga0265338_10116900 | |||
| 2527 | Ga0265338_10134014 | |||
| 2528 | Ga0265338_10256516 | |||
| 2529 | Ga0265324_10001987 | |||
| 2530 | Ga0265324_10002463 | |||
| 2531 | Ga0265324_10012445 | |||
| 2532 | Ga0265324_10038514 | |||
| 2533 | Ga0265324_10040474 | |||
| 2534 | Ga0265324_10064315 | |||
| 2535 | Ga0265324_10156539 | |||
| 2536 | Ga0265330_10005878 | |||
| 2537 | Ga0265330_10008019 | |||
| 2538 | Ga0265330_10009087 | |||
| 2539 | Ga0265330_10037719 | |||
| 2540 | Ga0265330_10050722 | |||
| 2541 | Ga0265332_10072711 | |||
| 2542 | Ga0265332_10085400 | |||
| 2543 | Ga0265332_10234105 | |||
| 2544 | Ga0265328_10001025 | |||
| 2545 | Ga0265328_10052567 | |||
| 2546 | Ga0265328_10099826 | |||
| 2547 | Ga0265320_10002344 | |||
| 2548 | Ga0265320_10004420 | |||
| 2549 | Ga0265320_10013339 | |||
| 2550 | Ga0265320_10027966 | |||
| 2551 | Ga0265320_10031969 | |||
| 2552 | Ga0265320_10034135 | |||
| 2553 | Ga0265320_10051926 | |||
| 2554 | Ga0265320_10157237 | |||
| 2555 | Ga0265325_10000731 | |||
| 2556 | Ga0265325_10009066 | |||
| 2557 | Ga0265325_10010521 | |||
| 2558 | Ga0265325_10020022 | |||
| 2559 | Ga0265325_10079476 | |||
| 2560 | Ga0265325_10083781 | |||
| 2561 | Ga0265325_10097223 | |||
| 2562 | Ga0265325_10195137 | |||
| 2563 | Ga0265329_10002584 | |||
| 2564 | Ga0265340_10248172 | |||
| 2565 | Ga0265339_10000073 | |||
| 2566 | Ga0265339_10002003 | |||
| 2567 | Ga0265339_10004006 | |||
| 2568 | Ga0265339_10006069 | |||
| 2569 | Ga0265339_10018966 | |||
| 2570 | Ga0265339_10070980 | |||
| 2571 | Ga0265339_10111296 | |||
| 2572 | Ga0265339_10181892 | |||
| 2573 | Ga0265331_10028146 | |||
| 2574 | Ga0265331_10038181 | |||
| 2575 | Ga0265331_10080509 | |||
| 2576 | Ga0265331_10161682 | |||
| 2577 | Ga0265327_10002003 | |||
| 2578 | Ga0265327_10005729 | |||
| 2579 | Ga0265327_10012167 | |||
| 2580 | Ga0265327_10027709 | |||
| 2581 | Ga0265327_10266876 | |||
| 2582 | Ga0265316_10003282 | |||
| 2583 | Ga0265316_10007581 | |||
| 2584 | Ga0265316_10008950 | |||
| 2585 | Ga0265316_10016155 | |||
| 2586 | Ga0265316_10078221 | |||
| 2587 | Ga0265316_10100755 | |||
| 2588 | Ga0265316_10143189 | |||
| 2589 | Ga0265316_10153916 | |||
| 2590 | Ga0265316_10225302 | |||
| 2591 | Ga0265316_10282853 | |||
| 2592 | Ga0265316_10408508 | |||
| 2593 | Ga0265316_10513227 | |||
| 2594 | Ga0265316_10537893 | |||
| 2595 | Ga0265313_10002161 | |||
| 2596 | Ga0265313_10014334 | |||
| 2597 | Ga0265313_10030894 | |||
| 2598 | Ga0265313_10042456 | |||
| 2599 | Ga0265314_10000090 | |||
| 2600 | Ga0265314_10000435 | |||
| 2601 | Ga0265314_10020237 | |||
| 2602 | Ga0265314_10044635 | |||
| 2603 | Ga0265314_10108677 | |||
| 2604 | Ga0265314_10115583 | |||
| 2605 | Ga0265314_10257541 | |||
| 2606 | Ga0265314_10291552 | |||
| 2607 | Ga0265342_10001787 | |||
| 2608 | Ga0265342_10031067 | |||
| 2609 | Ga0265342_10077309 | |||
| 2610 | Ga0265342_10102740 | |||
| 2611 | Ga0265342_10141382 | |||
| 2612 | Ga0265342_10156206 | |||
| 2613 | Ga0265342_10242079 | |||
| 2614 | Ga0316576_10073596 | |||
| 2615 | Ga0307413_10093490 | |||
| 2616 | Ga0307416_100454031 | |||
| 2617 | Ga0316583_10065874 | |||
| 2618 | Ga0373926_0145230 | |||
| 2619 | Ga0373940_0055533 | |||
| 2620 | Ga0373940_0058205 | |||
| 2621 | Ga0373944_0055324 | |||
| 2622 | Ga0373944_0056200 | |||
| 2623 | Ga0373936_0348933 | |||
| 2624 | Ga0373941_0280044 | |||
| 2625 | Ga0373945_0037354 | |||
| 2626 | Ga0373945_0092254 | |||
| 2627 | Ga0373953_0089479 | |||
| 2628 | Ga0373954_0155120 | |||
| 2629 | Ga0373954_0239999 | |||
| 2630 | Ga0373956_0059482 | |||
| 2631 | Ga0373943_0010233 | |||
| 2632 | Ga0373943_0021309 | |||
| 2633 | Ga0373943_0068132 | |||
| 2634 | Ga0373943_0321633 | |||
| 2635 | Ga0373946_0129673 | |||
| 2636 | Ga0373946_0289936 | |||
| 2637 | Ga0373955_0216377 | |||
| 2638 | Ga0373955_0441465 | |||
| 2639 | Ga0373961_0108865 | |||
| 2640 | Ga0373961_0124306 | |||
| 2641 | Ga0373931_0089709 | |||
| 2642 | Ga0373931_0192867 | |||
| 2643 | Ga0373931_0421097 | |||
| 2644 | Ga0373931_0594478 | |||
| 2645 | Ga0373935_0003449 | |||
| 2646 | Ga0373935_0016871 | |||
| 2647 | Ga0373935_0036220 | |||
| 2648 | Ga0373935_0290321 | |||
| 2649 | Ga0373927_0022338 | |||
| 2650 | Ga0373927_0187914 | |||
| 2651 | Ga0373927_0221021 | |||
| 2652 | Ga0373927_0369748 | |||
| 2653 | Ga0373933_0531523 | |||
| 2654 | Ga0373947_0016292 | |||
| 2655 | Ga0373947_0023502 | |||
| 2656 | Ga0373947_0159162 | |||
| 2657 | Ga0373947_0160375 | |||
| 2658 | Ga0373937_0153696 | |||
| 2659 | Ga0373937_0156536 | |||
| 2660 | Ga0373937_0162024 | |||
| 2661 | Ga0373937_0231666 | |||
| 2662 | Ga0373937_0321845 | |||
| 2663 | Ga0316584_0143769 | |||
| 2664 | Ga0373925_0015486 | |||
| 2665 | Ga0373925_0046856 | |||
| 2666 | Ga0373925_0088433 | |||
| 2667 | Ga0373925_0118258 | |||
| 2668 | Ga0373925_0211504 | |||
| 2669 | Ga0373925_0217459 | |||
| 2670 | Ga0395899_0252386 | |||
| 2671 | Ga0395900_0156740 | |||
| 2672 | Ga0395900_0311639 | |||
| 2673 | Ga0395900_1043694 | |||
| 2674 | Ga0395900_1065806 | |||
| 2675 | Ga0395898_0021090 | |||
| 2676 | Ga0395898_0549749 | |||
| 2677 | Ga0395905_0029576 | |||
| 2678 | Ga0395905_0577809 | |||
| 2679 | Ga0395901_0030457 | |||
| 2680 | Ga0395901_0133519 | |||
| 2681 | Ga0395901_0345710 | |||
| 2682 | Ga0436361_1055724 | |||
| 2683 | Ga0451807_1519224 | |||
| 2684 | Ga0439448_0004722 | |||
| 2685 | Ga0439455_0000789 | |||
| 2686 | Ga0439455_0039797 | |||
| 2687 | Ga0439458_0106227 | |||
| 2688 | Ga0439460_0063473 | |||
| 2689 | Ga0451577_0002332 | |||
| 2690 | Ga0451577_0006562 | |||
| 2691 | Ga0451577_0014048 | |||
| 2692 | Ga0451577_0117233 | |||
| 2693 | Ga0451577_0818849 | |||
| 2694 | Ga0453683_0280035 | |||
| 2695 | Ga0466966_0041957 | |||
| 2696 | Ga0466966_0110329 | |||
| 2697 | Ga0466961_0216375 | |||
| 2698 | Ga0466963_0001224 | |||
| 2699 | Ga0453684_0001814 | |||
| 2700 | Ga0453684_0003288 | |||
| 2701 | Ga0453684_0003475 | |||
| 2702 | Ga0453684_0216545 | |||
| 2703 | Ga0453684_0277971 | |||
| 2704 | Ga0453684_0920154 | |||
| 2705 | Ga0466959_0082969 | |||
| 2706 | Ga0451576_0015674 | |||
| 2707 | Ga0451576_0096027 | |||
| 2708 | Ga0451576_0138454 | |||
| 2709 | Ga0451576_0253167 | |||
| 2710 | Ga0451576_0259558 | |||
| 2711 | Ga0451576_0310760 | |||
| 2712 | Ga0451576_0413719 | |||
| 2713 | Ga0451576_0437054 | |||
| 2714 | Ga0451576_0453909 | |||
| 2715 | Ga0451576_0532724 | |||
| 2716 | Ga0451576_1106959 | |||
| 2717 | Ga0466967_0002331 | |||
| 2718 | Ga0466967_0045966 | |||
| 2719 | Ga0466967_0206250 | |||
| 2720 | Ga0466967_0448235 | |||
| 2721 | Ga0495592_0000372 | |||
| 2722 | Ga0495592_0081941 | |||
| 2723 | Ga0495592_0249334 | |||
| 2724 | Ga0495603_0126225 | |||
| 2725 | Ga0495629_0048036 | |||
| 2726 | Ga0495629_0085818 | |||
| 2727 | Ga0495629_0623987 | |||
| 2728 | Ga0495641_0121798 | |||
| 2729 | Ga0495651_0010772 | |||
| 2730 | Ga0495651_0026464 | |||
| 2731 | Ga0495653_0516474 | |||
| 2732 | Ga0495580_0164314 | |||
| 2733 | Ga0495582_0023103 | |||
| 2734 | Ga0495582_0156215 | |||
| 2735 | Ga0495582_0182818 | |||
| 2736 | Ga0495639_0037472 | |||
| 2737 | Ga0495662_0247542 | |||
| 2738 | Ga0495664_0013808 | |||
| 2739 | Ga0495664_0080379 | |||
| 2740 | Ga0495584_0066609 | |||
| 2741 | Ga0495618_0026947 | |||
| 2742 | Ga0495618_0462653 | |||
| 2743 | Ga0495628_0001014 | |||
| 2744 | Ga0495628_0075564 | |||
| 2745 | Ga0495628_0265272 | |||
| 2746 | Ga0495630_0000010 | |||
| 2747 | Ga0495630_0000076 | |||
| 2748 | Ga0495630_0018434 | |||
| 2749 | Ga0495630_0028269 | |||
| 2750 | Ga0495630_0036429 | |||
| 2751 | Ga0495630_0079667 | |||
| 2752 | Ga0495630_0091173 | |||
| 2753 | Ga0495630_0204007 | |||
| 2754 | Ga0495630_0254131 | |||
| 2755 | Ga0495666_0022746 | |||
| 2756 | Ga0495666_0037262 | |||
| 2757 | Ga0495666_0133507 | |||
| 2758 | Ga0495652_0010307 | |||
| 2759 | Ga0495652_0034131 | |||
| 2760 | Ga0495652_0063663 | |||
| 2761 | Ga0495652_0110432 | |||
| 2762 | Ga0495652_0140709 | |||
| 2763 | Ga0495652_0431671 | |||
| 2764 | Ga0495665_0358528 | |||
| 2765 | Ga0495665_0376978 | |||
| 2766 | Ga0495640_0078212 | |||
| 2767 | Ga0495640_0139895 | |||
| 2768 | Ga0495640_0141664 | |||
| 2769 | Ga0495586_0000001 | |||
| 2770 | Ga0495586_0000266 | |||
| 2771 | Ga0495586_0001469 | |||
| 2772 | Ga0495586_0008072 | |||
| 2773 | Ga0495586_0017365 | |||
| 2774 | Ga0495586_0250551 | |||
| 2775 | Ga0495587_0121443 | |||
| 2776 | Ga0495587_0286517 | |||
| 2777 | Ga0495621_0300809 | |||
| 2778 | Ga0495645_0003373 | |||
| 2779 | Ga0495645_0005573 | |||
| 2780 | Ga0495645_0007221 | |||
| 2781 | Ga0495645_0043733 | |||
| 2782 | Ga0495645_0073218 | |||
| 2783 | Ga0495645_0102792 | |||
| 2784 | Ga0495645_0117592 | |||
| 2785 | Ga0495645_0203980 | |||
| 2786 | Ga0495633_0112074 | |||
| 2787 | Ga0495667_0069948 | |||
| 2788 | Ga0495667_0163996 | |||
| 2789 | Ga0495634_0006142 | |||
| 2790 | Ga0495634_0023918 | |||
| 2791 | Ga0495634_0034067 | |||
| 2792 | Ga0495634_0081692 | |||
| 2793 | Ga0495635_0432227 | |||
| 2794 | Ga0495659_0064944 | |||
| 2795 | Ga0495659_0204526 | |||
| 2796 | Ga0495657_0163590 | |||
| 2797 | Ga0495657_0307650 | |||
| 2798 | Ga0495657_0453682 | |||
| 2799 | Ga0495599_0051135 | |||
| 2800 | Ga0495599_0115816 | |||
| 2801 | Ga0495646_0021572 | |||
| 2802 | Ga0495647_0022310 | |||
| 2803 | Ga0495658_0005146 | |||
| 2804 | Ga0495658_0113468 | |||
| 2805 | Ga0495658_0266467 | |||
| 2806 | Ga0495669_0042807 | |||
| 2807 | Ga0495669_0066657 | |||
| 2808 | Ga0495669_0116299 | |||
| 2809 | Ga0495613_0028372 | |||
| 2810 | Ga0495613_0156704 | |||
| 2811 | Ga0495613_0174711 | |||
| 2812 | Ga0495613_0289069 | |||
| 2813 | Ga0495613_0439551 | |||
| 2814 | Ga0495624_0033668 | |||
| 2815 | Ga0495624_0079760 | |||
| 2816 | Ga0495624_0201639 | |||
| 2817 | Ga0495624_0388851 | |||
| 2818 | Ga0495624_0523404 | |||
| 2819 | Ga0495600_0051476 | |||
| 2820 | Ga0495600_0142014 | |||
| 2821 | Ga0495604_0078472 | |||
| 2822 | Ga0495604_0286194 | |||
| 2823 | Ga0495674_0011836 | |||
| 2824 | Ga0495674_0016181 | |||
| 2825 | Ga0495674_0055294 | |||
| 2826 | Ga0495674_0136251 | |||
| 2827 | Ga0495674_0335543 | |||
| 2828 | Ga0495674_0856409 | |||
| 2829 | Ga0495676_0001320 | |||
| 2830 | Ga0495676_0045268 | |||
| 2831 | Ga0495676_0114234 | |||
| 2832 | Ga0495676_0205480 | |||
| 2833 | Ga0495676_0220935 | |||
| 2834 | Ga0495680_0245591 | |||
| 2835 | Ga0495680_0342250 | |||
| 2836 | Ga0495675_0034511 | |||
| 2837 | Ga0495675_0390718 | |||
| 2838 | Ga0495684_0008357 | |||
| 2839 | Ga0495686_0006394 | |||
| 2840 | Ga0495602_0102510 | |||
| 2841 | Ga0495602_0118098 | |||
| 2842 | Ga0495602_0155109 | |||
| 2843 | Ga0495602_0177580 | |||
| 2844 | Ga0495602_0225212 | |||
| 2845 | Ga0496100_0010261 | |||
| 2846 | Ga0496100_0012144 | |||
| 2847 | Ga0496100_0041445 | |||
| 2848 | Ga0496100_0882846 | |||
| 2849 | Ga0496101_0031453 | |||
| 2850 | Ga0496101_0052076 | |||
| 2851 | Ga0496101_0099931 | |||
| 2852 | Ga0496101_0110719 | |||
| 2853 | Ga0496101_0265373 | |||
| 2854 | Ga0496102_0023376 | |||
| 2855 | Ga0496102_0030023 | |||
| 2856 | Ga0496102_0031305 | |||
| 2857 | Ga0496102_0229886 | |||
| 2858 | Ga0496103_0285002 | |||
| 2859 | Ga0496104_0008459 | |||
| 2860 | Ga0496104_0030612 | |||
| 2861 | Ga0496104_0460491 | |||
| 2862 | Ga0496104_0464355 | |||
| 2863 | Ga0496104_0556867 | |||
| 2864 | Ga0496104_0739327 | |||
| 2865 | Ga0496105_0097746 | |||
| 2866 | Ga0496105_0133818 | |||
| 2867 | Ga0496105_0247013 | |||
| 2868 | Ga0496105_0253942 | |||
| 2869 | Ga0496105_0426795 | |||
| 2870 | Ga0496105_0947717 | |||
| 2871 | Ga0496106_0024667 | |||
| 2872 | Ga0496106_0034618 | |||
| 2873 | Ga0496107_0002445 | |||
| 2874 | Ga0496107_0141588 | |||
| 2875 | Ga0496107_0192804 | |||
| 2876 | Ga0496108_0038568 | |||
| 2877 | Ga0496108_0070974 | |||
| 2878 | Ga0496108_0079935 | |||
| 2879 | Ga0496108_0106119 | |||
| 2880 | Ga0496108_0113323 | |||
| 2881 | Ga0496108_1104874 | |||
| 2882 | Ga0496109_0011922 | |||
| 2883 | Ga0496109_0018616 | |||
| 2884 | Ga0496109_0188575 | |||
| 2885 | Ga0496109_0320305 | |||
| 2886 | Ga0496109_0323308 | |||
| 2887 | Ga0496109_0400554 | |||
| 2888 | Ga0496109_0448901 | |||
| 2889 | Ga0496110_0014181 | |||
| 2890 | Ga0496110_0227074 | |||
| 2891 | Ga0496110_0282743 | |||
| 2892 | Ga0496110_0337914 | |||
| 2893 | Ga0496110_0387624 | |||
| 2894 | Ga0496110_0415042 | |||
| 2895 | Ga0496110_0638626 | |||
| 2896 | Ga0496111_0039079 | |||
| 2897 | Ga0496111_0310931 | |||
| 2898 | Ga0496111_0335500 | |||
| 2899 | Ga0496111_0453811 | |||
| 2900 | Ga0496112_0083607 | |||
| 2901 | Ga0496112_0195155 | |||
| 2902 | Ga0496112_0235238 | |||
| 2903 | Ga0496112_0236242 | |||
| 2904 | Ga0496112_0322781 | |||
| 2905 | Ga0496112_0339497 | |||
| 2906 | Ga0496112_0360453 | |||
| 2907 | Ga0496112_0565417 | |||
| 2908 | Ga0496112_0636548 | |||
| 2909 | Ga0496112_0943441 | |||
| 2910 | Ga0496113_0058060 | |||
| 2911 | Ga0496113_0121631 | |||
| 2912 | Ga0496113_0374133 | |||
| 2913 | Ga0496114_0098627 | |||
| 2914 | Ga0496115_0000589 | |||
| 2915 | Ga0496115_0006346 | |||
| 2916 | Ga0496115_0010025 | |||
| 2917 | Ga0496115_0013121 | |||
| 2918 | Ga0496115_0182289 | |||
| 2919 | Ga0496115_0316742 | |||
| 2920 | Ga0496115_0346238 | |||
| 2921 | Ga0496115_0435194 | |||
| 2922 | Ga0496115_0753164 | |||
| 2923 | Ga0496120_0024496 | |||
| 2924 | Ga0496126_0001301 | |||
| 2925 | Ga0496126_0002319 | |||
| 2926 | Ga0501031_0000260 | |||
| 2927 | Ga0501032_0246717 | |||
| 2928 | Ga0501033_0004992 | |||
| 2929 | Ga0501034_0192862 | |||
| 2930 | Ga0501036_0116676 | |||
| 2931 | Ga0501039_0199121 | |||
| 2932 | Ga0501039_0435133 | |||
| 2933 | Ga0501043_0091751 | |||
| 2934 | Ga0501043_0323316 | |||
| 2935 | Ga0501046_0140231 | |||
| 2936 | Ga0501047_0329811 | |||
| 2937 | Ga0501216_026626 | |||
| 2938 | Ga0501035_0183715 | |||
| 2939 | Ga0501044_0190869 | |||
| 2940 | nmdc:mga05p37_1203438_c1 | |||
| 2941 | nmdc:mga05p37_342265_c1 | |||
| 2942 | nmdc:mga05p37_630211_c1 | |||
| 2943 | nmdc:mga0qj67_254596_c1 | |||
| 2944 | nmdc:mga0qj67_377808_c1 | |||
| 2945 | nmdc:mga06r32_289400_c1 | |||
| 2946 | nmdc:mga08y16_264705_c1 | |||
| 2947 | nmdc:mga08y16_309011_c1 | |||
| 2948 | nmdc:mga08y16_393976_c1 | |||
| 2949 | nmdc:mga08y16_42645_c1 | |||
| 2950 | nmdc:mga08y16_568995_c1 | |||
| 2951 | nmdc:mga08y16_776047_c1 | |||
| 2952 | nmdc:mga0n895_120950_c1 | |||
| 2953 | nmdc:mga0n895_174645_c1 | |||
| 2954 | nmdc:mga0n895_71993_c1 | |||
| 2955 | nmdc:mga0n895_869497_c1 | |||
| 2956 | nmdc:mga0rr50_494012_c1 | |||
| 2957 | Ga0495612_0056064 | |||
| 2958 | Ga0495612_0139948 | |||
| 2959 | Ga0495619_0080812 | |||
| 2960 | Ga0495619_0116149 | |||
| 2961 | Ga0500644_0089180 | |||
| 2962 | Ga0500555_000015 | |||
| 2963 | Ga0500595_000021 | |||
| 2964 | Ga0500595_015623 | |||
| 2965 | Ga0500616_0025416 | |||
| 2966 | 2787435762 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nz1-assembly1.cif.gz_B | respiratory complex i from escherichia coli - focused refinement of cytoplasmic arm | 0.7613 | 40 | 161 |
| 7awt-assembly1.cif.gz_B | e. coli nadh quinone oxidoreductase hydrophilic arm | 0.6888 | 40 | 158 |
| 7v2f-assembly1.cif.gz_C | deactive state complex i from q10-nadh dataset | 0.6773 | 40 | 162 |
| 7ard-assembly1.cif.gz_B | cryo-em structure of polytomella complex-i (complete composition) | 0.6646 | 40 | 158 |
| 6cfw-assembly1.cif.gz_J | cryoem structure of a respiratory membrane-bound hydrogenase | 0.6641 | 45 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0V7L4_105_258_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7322 | 76 | 109 | 3.40.50.300 |
| 6cfwJ00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.6641 | 45 | 159 | 3.40.50.12280 |
| 3c1nD01 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.6596 | 76 | 112 | 3.40.1160.10 |
| af_I6XUD2_20_159_3.40.50.12280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.6413 | 43 | 156 | 3.40.50.12280 |
| af_P9WG77_1_265_3.40.1190.20 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.6236 | 77 | 110 | 3.40.1190.20 |