F494288
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1483 | 515 | 2966 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10072723|Ga0105247_100727234 |
| Length | 226 |
| Sequence | MKTQVTSLDSKATGDIELADEIFGLEVRNDLIHRMVRYQTLKRMAGTHHAQDRSEVAVTGKKMYKQKGTGGARHGDKSAPQFRGGGKAFGPKPRSHAIDMPKKVRALALRHALSSKAKAGEIVILDKASSAEGKTGALKAQFAKLEWSNVLIIDGAELEASFVRAVRNLPNIDVLPVQGINVYDILRRKTLVLTKAAIAALEERFKDAGNGKSDAKAPKARAEAKQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 10 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 15 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 16 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 17 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 18 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 19 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 20 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 21 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 28 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 31 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 91 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 92 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 94 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 95 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 96 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 97 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 98 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 99 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 102 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 103 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 104 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 105 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 106 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 113 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 114 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 115 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 116 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 118 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 119 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 120 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 121 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 122 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 123 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 124 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 125 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 126 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 129 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 130 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 145 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 149 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 150 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 164 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 168 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 169 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 170 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 171 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 256 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 260 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 261 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 262 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 263 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 264 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 265 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 266 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 267 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 268 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 269 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 270 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 271 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 272 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 273 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 274 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 275 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 276 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 277 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 278 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 279 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 280 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 281 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 282 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 283 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 284 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 286 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 288 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 289 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 290 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 291 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 292 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 293 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 294 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 295 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 296 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 297 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 298 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 299 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 300 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 301 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 302 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 303 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 304 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 305 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 306 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 307 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 308 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 309 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 310 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 311 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 312 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 313 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 314 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 315 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 316 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 317 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 318 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 319 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 320 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 321 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 322 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 323 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 324 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 325 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 326 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 327 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 328 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 329 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 330 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 331 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 332 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 333 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 334 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 335 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 336 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 337 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 338 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 339 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 340 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 341 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 342 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 343 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 344 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 345 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 346 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 347 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 348 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 349 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 350 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 351 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 352 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 353 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 354 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 355 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 356 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 357 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 358 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 359 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 360 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 361 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 362 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 415 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 416 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 417 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 418 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 419 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 420 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 423 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 424 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 425 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 426 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 427 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 428 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 429 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 430 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 431 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 463 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 464 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 465 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 466 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 467 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 468 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 469 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 470 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 484 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 485 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 486 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 487 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 488 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 489 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 490 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 491 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 492 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 493 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 494 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 495 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 496 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 497 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 498 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 501 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 502 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 503 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 504 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 505 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 506 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 507 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 508 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 509 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 510 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 511 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 512 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 513 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 514 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 515 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.45 |
| Metatranscriptomes | 0.54 |
| Isolates | 1.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.45 |
| Nodule | 0.13 |
| Rhizoplane | 5.87 |
| Rhizosphere | 86.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105247_10072723 | 3300009101 | Bacteria | 2153 |
| 2 | 2214820216 | 2209111006 | Bacteria | 1877 |
| 3 | ARcpr5oldR_c000035 | 3300000041 | Bacteria | 26838 |
| 4 | ARcpr5oldR_c003327 | 3300000041 | Bacteria | 1431 |
| 5 | ARSoilYngRDRAFT_c00061 | 3300000042 | Bacteria | 17682 |
| 6 | ARcpr5yngRDRAFT_c000212 | 3300000043 | Bacteria | 8945 |
| 7 | ARcpr5yngRDRAFT_c001457 | 3300000043 | Bacteria | 2608 |
| 8 | ARSoilOldRDRAFT_c000208 | 3300000044 | Bacteria | 9345 |
| 9 | ARSoilOldRDRAFT_c001089 | 3300000044 | Bacteria | 2613 |
| 10 | ARCol0oldRDRAFT_c00767 | 3300000045 | Bacteria | 2705 |
| 11 | ARCol0yngRDRAFT_1000025 | 3300000652 | Bacteria | 26845 |
| 12 | JGI24752J21851_1005432 | 3300001976 | Bacteria | 1662 |
| 13 | JGI24746J21847_1000313 | 3300001977 | Bacteria | 6996 |
| 14 | JGI24740J21852_10033527 | 3300001979 | Bacteria | 1628 |
| 15 | JGI24739J22299_10001271 | 3300001989 | Bacteria | 9474 |
| 16 | JGI24739J22299_10097892 | 3300001989 | Bacteria | 887 |
| 17 | JGI24737J22298_10002998 | 3300001990 | Bacteria | 5985 |
| 18 | JGI24737J22298_10007299 | 3300001990 | Bacteria | 3735 |
| 19 | JGI24737J22298_10008806 | 3300001990 | Bacteria | 3369 |
| 20 | JGI24737J22298_10020339 | 3300001990 | Bacteria | 2119 |
| 21 | JGI24743J22301_10002158 | 3300001991 | Bacteria | 2910 |
| 22 | JGI24735J21928_10012540 | 3300002067 | Bacteria | 2677 |
| 23 | JGI24750J21931_1001136 | 3300002070 | Bacteria | 3432 |
| 24 | JGI24750J21931_1037024 | 3300002070 | Bacteria | 732 |
| 25 | JGI24745J21846_1000034 | 3300002073 | Bacteria | 9049 |
| 26 | JGI24745J21846_1000277 | 3300002073 | Bacteria | 4362 |
| 27 | JGI24748J21848_1000741 | 3300002074 | Bacteria | 3527 |
| 28 | JGI24749J21850_1002096 | 3300002076 | Bacteria | 2811 |
| 29 | JGI24744J21845_10000241 | 3300002077 | Bacteria | 8837 |
| 30 | JGI24035J26624_1000089 | 3300002126 | Bacteria | 7679 |
| 31 | JGI24034J26672_10021074 | 3300002239 | Bacteria | 1023 |
| 32 | JGI24742J22300_10000465 | 3300002244 | Bacteria | 6004 |
| 33 | JGI24751J29686_10015322 | 3300002459 | Bacteria | 1581 |
| 34 | JGI24751J29686_10056778 | 3300002459 | Bacteria | 806 |
| 35 | JGI25165J46597_1000961 | 3300003214 | Bacteria | 19619 |
| 36 | Ga0055526_1033563 | 3300003771 | Bacteria | 1422 |
| 37 | JGI25405J52794_10040823 | 3300003911 | Bacteria | 981 |
| 38 | Ga0065716_1002185 | 3300005277 | Bacteria | 2128 |
| 39 | Ga0065704_10093450 | 3300005289 | Bacteria | 2596 |
| 40 | Ga0065712_10073769 | 3300005290 | Bacteria | 4278 |
| 41 | Ga0065712_10112498 | 3300005290 | Bacteria | 1799 |
| 42 | Ga0065715_10002813 | 3300005293 | Bacteria | 5934 |
| 43 | Ga0065715_10009083 | 3300005293 | Bacteria | 5124 |
| 44 | Ga0065707_10155627 | 3300005295 | Bacteria | 1612 |
| 45 | Ga0070676_10001242 | 3300005328 | Bacteria | 12829 |
| 46 | Ga0070683_100002064 | 3300005329 | Bacteria | 15853 |
| 47 | Ga0070683_100023089 | 3300005329 | Bacteria | 5563 |
| 48 | Ga0070683_100335946 | 3300005329 | Bacteria | 1438 |
| 49 | Ga0070683_101197940 | 3300005329 | Bacteria | 730 |
| 50 | Ga0070690_100013717 | 3300005330 | Bacteria | 4798 |
| 51 | Ga0070690_100020216 | 3300005330 | Bacteria | 4054 |
| 52 | Ga0070690_100213076 | 3300005330 | Bacteria | 1350 |
| 53 | Ga0070670_100006103 | 3300005331 | Bacteria | 10185 |
| 54 | Ga0070670_100036557 | 3300005331 | Bacteria | 4226 |
| 55 | Ga0070677_10003234 | 3300005333 | Bacteria | 5245 |
| 56 | Ga0070677_10152049 | 3300005333 | Bacteria | 1078 |
| 57 | Ga0068869_100000755 | 3300005334 | Bacteria | 18338 |
| 58 | Ga0068869_100786912 | 3300005334 | Bacteria | 817 |
| 59 | Ga0070666_10144097 | 3300005335 | Bacteria | 1660 |
| 60 | Ga0070666_10172384 | 3300005335 | Bacteria | 1515 |
| 61 | Ga0070666_10318343 | 3300005335 | Bacteria | 1109 |
| 62 | Ga0070680_100013921 | 3300005336 | Bacteria | 6276 |
| 63 | Ga0070680_100052638 | 3300005336 | Bacteria | 3322 |
| 64 | Ga0070680_100052655 | 3300005336 | Bacteria | 3322 |
| 65 | Ga0070680_100076449 | 3300005336 | Bacteria | 2756 |
| 66 | Ga0070680_100084451 | 3300005336 | Bacteria | 2622 |
| 67 | Ga0070680_100232973 | 3300005336 | Bacteria | 1556 |
| 68 | Ga0070682_100000693 | 3300005337 | Bacteria | 20306 |
| 69 | Ga0070682_100009142 | 3300005337 | Bacteria | 5601 |
| 70 | Ga0070682_100067778 | 3300005337 | Bacteria | 2273 |
| 71 | Ga0070682_100077207 | 3300005337 | Bacteria | 2145 |
| 72 | Ga0068868_100026839 | 3300005338 | Bacteria | 4391 |
| 73 | Ga0068868_100043374 | 3300005338 | Bacteria | 3513 |
| 74 | Ga0068868_100262925 | 3300005338 | Bacteria | 1456 |
| 75 | Ga0070660_100004264 | 3300005339 | Bacteria | 9871 |
| 76 | Ga0070660_100019097 | 3300005339 | Bacteria | 5017 |
| 77 | Ga0070660_100061814 | 3300005339 | Bacteria | 2908 |
| 78 | Ga0070660_100194015 | 3300005339 | Bacteria | 1646 |
| 79 | Ga0070660_100678355 | 3300005339 | Bacteria | 863 |
| 80 | Ga0070689_100018438 | 3300005340 | Bacteria | 5141 |
| 81 | Ga0070689_100051585 | 3300005340 | Bacteria | 3180 |
| 82 | Ga0070689_100643822 | 3300005340 | Bacteria | 921 |
| 83 | Ga0070691_10007803 | 3300005341 | Bacteria | 4900 |
| 84 | Ga0070691_10039574 | 3300005341 | Bacteria | 2228 |
| 85 | Ga0070691_10172836 | 3300005341 | Bacteria | 1121 |
| 86 | Ga0070687_100000768 | 3300005343 | Bacteria | 10675 |
| 87 | Ga0070687_100017582 | 3300005343 | Bacteria | 3291 |
| 88 | Ga0070687_100080418 | 3300005343 | Bacteria | 1777 |
| 89 | Ga0070661_100006236 | 3300005344 | Bacteria | 8222 |
| 90 | Ga0070661_100224434 | 3300005344 | Bacteria | 1442 |
| 91 | Ga0070661_100267705 | 3300005344 | Bacteria | 1322 |
| 92 | Ga0070661_100386150 | 3300005344 | Bacteria | 1105 |
| 93 | Ga0070692_10019783 | 3300005345 | Bacteria | 3254 |
| 94 | Ga0070668_100002043 | 3300005347 | Bacteria | 14764 |
| 95 | Ga0070668_100332644 | 3300005347 | Bacteria | 1281 |
| 96 | Ga0070669_100004204 | 3300005353 | Bacteria | 10419 |
| 97 | Ga0070669_100056953 | 3300005353 | Bacteria | 2866 |
| 98 | Ga0070669_100523038 | 3300005353 | Bacteria | 986 |
| 99 | Ga0070675_100004033 | 3300005354 | Bacteria | 11145 |
| 100 | Ga0070675_100096029 | 3300005354 | Bacteria | 2490 |
| 101 | Ga0070675_100142778 | 3300005354 | Bacteria | 2047 |
| 102 | Ga0070675_100371447 | 3300005354 | Bacteria | 1271 |
| 103 | Ga0070671_100029434 | 3300005355 | Bacteria | 4528 |
| 104 | Ga0070671_100145487 | 3300005355 | Bacteria | 2001 |
| 105 | Ga0070671_100209226 | 3300005355 | Bacteria | 1654 |
| 106 | Ga0070674_100001294 | 3300005356 | Bacteria | 13164 |
| 107 | Ga0070674_100249892 | 3300005356 | Bacteria | 1392 |
| 108 | Ga0070674_100386599 | 3300005356 | Bacteria | 1140 |
| 109 | Ga0070673_100002364 | 3300005364 | Bacteria | 11471 |
| 110 | Ga0070673_100175789 | 3300005364 | Bacteria | 1830 |
| 111 | Ga0070673_100619208 | 3300005364 | Bacteria | 989 |
| 112 | Ga0070688_100012304 | 3300005365 | Bacteria | 4790 |
| 113 | Ga0070688_100019070 | 3300005365 | Bacteria | 3970 |
| 114 | Ga0070688_100447015 | 3300005365 | Bacteria | 965 |
| 115 | Ga0070659_100005048 | 3300005366 | Bacteria | 9461 |
| 116 | Ga0070659_100045894 | 3300005366 | Bacteria | 3424 |
| 117 | Ga0070659_100057149 | 3300005366 | Bacteria | 3076 |
| 118 | Ga0070659_100175959 | 3300005366 | Bacteria | 1755 |
| 119 | Ga0070659_100190290 | 3300005366 | Bacteria | 1686 |
| 120 | Ga0070659_100252566 | 3300005366 | Bacteria | 1462 |
| 121 | Ga0070659_100638282 | 3300005366 | Bacteria | 917 |
| 122 | Ga0070667_100010781 | 3300005367 | Bacteria | 7552 |
| 123 | Ga0070667_100139919 | 3300005367 | Bacteria | 2119 |
| 124 | Ga0070667_100155731 | 3300005367 | Bacteria | 2009 |
| 125 | Ga0070667_101117153 | 3300005367 | Bacteria | 737 |
| 126 | Ga0070703_10045405 | 3300005406 | Bacteria | 1385 |
| 127 | Ga0070709_10064061 | 3300005434 | Bacteria | 2350 |
| 128 | Ga0070709_10180561 | 3300005434 | Bacteria | 1482 |
| 129 | Ga0070714_100148074 | 3300005435 | Bacteria | 2113 |
| 130 | Ga0070713_100051698 | 3300005436 | Bacteria | 3399 |
| 131 | Ga0070713_100060535 | 3300005436 | Bacteria | 3165 |
| 132 | Ga0070713_100171196 | 3300005436 | Bacteria | 1945 |
| 133 | Ga0070710_10014954 | 3300005437 | Bacteria | 3916 |
| 134 | Ga0070710_10052773 | 3300005437 | Bacteria | 2287 |
| 135 | Ga0070710_10070107 | 3300005437 | Bacteria | 2018 |
| 136 | Ga0070701_10012548 | 3300005438 | Bacteria | 3825 |
| 137 | Ga0070701_10137536 | 3300005438 | Bacteria | 1394 |
| 138 | Ga0070701_10227360 | 3300005438 | Bacteria | 1116 |
| 139 | Ga0070711_100027798 | 3300005439 | Bacteria | 3716 |
| 140 | Ga0070711_100045777 | 3300005439 | Bacteria | 2978 |
| 141 | Ga0070711_100148495 | 3300005439 | Bacteria | 1765 |
| 142 | Ga0070711_100256941 | 3300005439 | Bacteria | 1373 |
| 143 | Ga0070705_100001981 | 3300005440 | Bacteria | 10455 |
| 144 | Ga0070705_100023843 | 3300005440 | Bacteria | 3293 |
| 145 | Ga0070705_100048908 | 3300005440 | Bacteria | 2453 |
| 146 | Ga0070705_100266449 | 3300005440 | Bacteria | 1211 |
| 147 | Ga0070700_100010431 | 3300005441 | Bacteria | 5131 |
| 148 | Ga0070700_100017413 | 3300005441 | Bacteria | 4108 |
| 149 | Ga0070694_100007138 | 3300005444 | Bacteria | 6802 |
| 150 | Ga0070694_100010924 | 3300005444 | Bacteria | 5618 |
| 151 | Ga0070694_100013142 | 3300005444 | Bacteria | 5166 |
| 152 | Ga0070663_100010153 | 3300005455 | Bacteria | 5859 |
| 153 | Ga0070663_100028446 | 3300005455 | Bacteria | 3805 |
| 154 | Ga0070663_100050961 | 3300005455 | Bacteria | 2946 |
| 155 | Ga0070663_100271074 | 3300005455 | Bacteria | 1349 |
| 156 | Ga0070663_100509440 | 3300005455 | Bacteria | 1000 |
| 157 | Ga0070663_100511528 | 3300005455 | Bacteria | 999 |
| 158 | Ga0070678_100004700 | 3300005456 | Bacteria | 7775 |
| 159 | Ga0070678_100010048 | 3300005456 | Bacteria | 5761 |
| 160 | Ga0070678_100237716 | 3300005456 | Bacteria | 1521 |
| 161 | Ga0070678_100301998 | 3300005456 | Bacteria | 1361 |
| 162 | Ga0070678_100375070 | 3300005456 | Bacteria | 1229 |
| 163 | Ga0070662_100007011 | 3300005457 | Bacteria | 7290 |
| 164 | Ga0070662_100024005 | 3300005457 | Bacteria | 4196 |
| 165 | Ga0070662_100135464 | 3300005457 | Bacteria | 1904 |
| 166 | Ga0070662_100145370 | 3300005457 | Bacteria | 1841 |
| 167 | Ga0070681_10010029 | 3300005458 | Bacteria | 9338 |
| 168 | Ga0070681_10029025 | 3300005458 | Bacteria | 5554 |
| 169 | Ga0070681_10078949 | 3300005458 | Bacteria | 3248 |
| 170 | Ga0070681_10079820 | 3300005458 | Bacteria | 3228 |
| 171 | Ga0070681_10183807 | 3300005458 | Bacteria | 2011 |
| 172 | Ga0070681_10394065 | 3300005458 | Bacteria | 1296 |
| 173 | Ga0068867_100003543 | 3300005459 | Bacteria | 10976 |
| 174 | Ga0068867_100037405 | 3300005459 | Bacteria | 3527 |
| 175 | Ga0068867_100077308 | 3300005459 | Bacteria | 2501 |
| 176 | Ga0070685_10005750 | 3300005466 | Bacteria | 6302 |
| 177 | Ga0070685_10086009 | 3300005466 | Bacteria | 1894 |
| 178 | Ga0070706_100100968 | 3300005467 | Bacteria | 2681 |
| 179 | Ga0070698_100149346 | 3300005471 | Bacteria | 2285 |
| 180 | Ga0070679_100049456 | 3300005530 | Bacteria | 4187 |
| 181 | Ga0070679_100058331 | 3300005530 | Bacteria | 3846 |
| 182 | Ga0070679_100069873 | 3300005530 | Bacteria | 3503 |
| 183 | Ga0070679_100155434 | 3300005530 | Bacteria | 2262 |
| 184 | Ga0070679_100239219 | 3300005530 | Bacteria | 1773 |
| 185 | Ga0070684_100007624 | 3300005535 | Bacteria | 8437 |
| 186 | Ga0070684_100309342 | 3300005535 | Bacteria | 1451 |
| 187 | Ga0070697_100058906 | 3300005536 | Bacteria | 3126 |
| 188 | Ga0070697_100597675 | 3300005536 | Bacteria | 970 |
| 189 | Ga0068853_100006917 | 3300005539 | Bacteria | 9054 |
| 190 | Ga0068853_100023191 | 3300005539 | Bacteria | 5193 |
| 191 | Ga0068853_100026550 | 3300005539 | Bacteria | 4863 |
| 192 | Ga0068853_100089524 | 3300005539 | Bacteria | 2703 |
| 193 | Ga0068853_100117767 | 3300005539 | Bacteria | 2366 |
| 194 | Ga0068853_100289310 | 3300005539 | Bacteria | 1512 |
| 195 | Ga0068853_100316564 | 3300005539 | Bacteria | 1446 |
| 196 | Ga0070672_100002637 | 3300005543 | Bacteria | 11467 |
| 197 | Ga0070672_100687094 | 3300005543 | Bacteria | 896 |
| 198 | Ga0070672_100792201 | 3300005543 | Bacteria | 834 |
| 199 | Ga0070672_100807708 | 3300005543 | Bacteria | 825 |
| 200 | Ga0070686_100004029 | 3300005544 | Bacteria | 8075 |
| 201 | Ga0070686_100109614 | 3300005544 | Bacteria | 1878 |
| 202 | Ga0070686_100212365 | 3300005544 | Bacteria | 1394 |
| 203 | Ga0070686_100365633 | 3300005544 | Bacteria | 1088 |
| 204 | Ga0070686_100398877 | 3300005544 | Bacteria | 1046 |
| 205 | Ga0070695_100014423 | 3300005545 | Bacteria | 4764 |
| 206 | Ga0070695_100039405 | 3300005545 | Bacteria | 2986 |
| 207 | Ga0070695_100869083 | 3300005545 | Bacteria | 727 |
| 208 | Ga0070696_100010916 | 3300005546 | Bacteria | 6087 |
| 209 | Ga0070696_100062849 | 3300005546 | Bacteria | 2600 |
| 210 | Ga0070696_100134946 | 3300005546 | Bacteria | 1799 |
| 211 | Ga0070696_100233202 | 3300005546 | Bacteria | 1385 |
| 212 | Ga0070696_100667072 | 3300005546 | Bacteria | 845 |
| 213 | Ga0070693_100010280 | 3300005547 | Bacteria | 4685 |
| 214 | Ga0070693_100112590 | 3300005547 | Bacteria | 1676 |
| 215 | Ga0070693_100283061 | 3300005547 | Bacteria | 1111 |
| 216 | Ga0070665_100054832 | 3300005548 | Bacteria | 3998 |
| 217 | Ga0070665_100128255 | 3300005548 | Bacteria | 2539 |
| 218 | Ga0070665_100576621 | 3300005548 | Bacteria | 1138 |
| 219 | Ga0070704_100004936 | 3300005549 | Bacteria | 7744 |
| 220 | Ga0070704_100044766 | 3300005549 | Bacteria | 3077 |
| 221 | Ga0070704_100174040 | 3300005549 | Bacteria | 1715 |
| 222 | Ga0068855_100041438 | 3300005563 | Bacteria | 5457 |
| 223 | Ga0068855_100076631 | 3300005563 | Bacteria | 3880 |
| 224 | Ga0068855_100093513 | 3300005563 | Bacteria | 3467 |
| 225 | Ga0068855_100209628 | 3300005563 | Bacteria | 2190 |
| 226 | Ga0068855_100399007 | 3300005563 | Bacteria | 1507 |
| 227 | Ga0068855_100791206 | 3300005563 | Bacteria | 1009 |
| 228 | Ga0070664_100004534 | 3300005564 | Bacteria | 11145 |
| 229 | Ga0070664_100066218 | 3300005564 | Bacteria | 3084 |
| 230 | Ga0070664_100153248 | 3300005564 | Bacteria | 2035 |
| 231 | Ga0070664_100376882 | 3300005564 | Bacteria | 1294 |
| 232 | Ga0070664_100583807 | 3300005564 | Bacteria | 1036 |
| 233 | Ga0068857_100006037 | 3300005577 | Bacteria | 10344 |
| 234 | Ga0068857_100099806 | 3300005577 | Bacteria | 2604 |
| 235 | Ga0068857_100171780 | 3300005577 | Bacteria | 1970 |
| 236 | Ga0068857_100175405 | 3300005577 | Bacteria | 1950 |
| 237 | Ga0068857_100209278 | 3300005577 | Bacteria | 1779 |
| 238 | Ga0068854_100006037 | 3300005578 | Bacteria | 7675 |
| 239 | Ga0068854_100076978 | 3300005578 | Bacteria | 2453 |
| 240 | Ga0068854_100281861 | 3300005578 | Bacteria | 1338 |
| 241 | Ga0068854_100520613 | 3300005578 | Bacteria | 1004 |
| 242 | Ga0068854_100930728 | 3300005578 | Bacteria | 765 |
| 243 | Ga0068856_100008706 | 3300005614 | Bacteria | 9874 |
| 244 | Ga0068856_100105907 | 3300005614 | Bacteria | 2806 |
| 245 | Ga0068856_100106131 | 3300005614 | Bacteria | 2803 |
| 246 | Ga0068856_100165589 | 3300005614 | Bacteria | 2222 |
| 247 | Ga0068856_100605523 | 3300005614 | Bacteria | 1116 |
| 248 | Ga0068856_100731067 | 3300005614 | Bacteria | 1010 |
| 249 | Ga0070702_100000378 | 3300005615 | Bacteria | 15718 |
| 250 | Ga0070702_100009357 | 3300005615 | Bacteria | 4793 |
| 251 | Ga0070702_100334133 | 3300005615 | Bacteria | 1061 |
| 252 | Ga0068852_100017082 | 3300005616 | Bacteria | 5683 |
| 253 | Ga0068852_100141603 | 3300005616 | Bacteria | 2226 |
| 254 | Ga0068852_100264197 | 3300005616 | Bacteria | 1653 |
| 255 | Ga0068852_100372300 | 3300005616 | Bacteria | 1400 |
| 256 | Ga0068859_100007402 | 3300005617 | Bacteria | 11142 |
| 257 | Ga0068859_100029393 | 3300005617 | Bacteria | 5514 |
| 258 | Ga0068859_100120397 | 3300005617 | Bacteria | 2691 |
| 259 | Ga0068864_100000595 | 3300005618 | Bacteria | 30701 |
| 260 | Ga0068864_100274594 | 3300005618 | Bacteria | 1571 |
| 261 | Ga0068864_100327081 | 3300005618 | Bacteria | 1441 |
| 262 | Ga0068866_10000834 | 3300005718 | Bacteria | 13673 |
| 263 | Ga0068866_10512607 | 3300005718 | Bacteria | 796 |
| 264 | Ga0068861_100002973 | 3300005719 | Bacteria | 11183 |
| 265 | Ga0068861_100189622 | 3300005719 | Bacteria | 1718 |
| 266 | Ga0068861_100587738 | 3300005719 | Bacteria | 1020 |
| 267 | Ga0068861_100610490 | 3300005719 | Bacteria | 1002 |
| 268 | Ga0068851_10037994 | 3300005834 | Bacteria | 2414 |
| 269 | Ga0068851_10052847 | 3300005834 | Bacteria | 2066 |
| 270 | Ga0068851_10263122 | 3300005834 | Bacteria | 982 |
| 271 | Ga0068870_10000216 | 3300005840 | Bacteria | 20877 |
| 272 | Ga0068870_10728866 | 3300005840 | Bacteria | 686 |
| 273 | Ga0068863_100022557 | 3300005841 | Bacteria | 6011 |
| 274 | Ga0068863_101462135 | 3300005841 | Bacteria | 692 |
| 275 | Ga0068858_100024760 | 3300005842 | Bacteria | 5589 |
| 276 | Ga0068858_100153137 | 3300005842 | Bacteria | 2168 |
| 277 | Ga0068858_100177076 | 3300005842 | Bacteria | 2013 |
| 278 | Ga0068858_100254749 | 3300005842 | Bacteria | 1667 |
| 279 | Ga0068860_100007174 | 3300005843 | Bacteria | 11145 |
| 280 | Ga0068860_100274265 | 3300005843 | Bacteria | 1647 |
| 281 | Ga0068860_100672172 | 3300005843 | Bacteria | 1044 |
| 282 | Ga0068862_100017504 | 3300005844 | Bacteria | 5970 |
| 283 | Ga0068862_100018639 | 3300005844 | Bacteria | 5781 |
| 284 | Ga0068862_100875688 | 3300005844 | Bacteria | 881 |
| 285 | Ga0081455_10000048 | 3300005937 | Bacteria | 126551 |
| 286 | Ga0081540_1007553 | 3300005983 | Bacteria | 7734 |
| 287 | Ga0070717_10130640 | 3300006028 | Bacteria | 2159 |
| 288 | Ga0070717_10527301 | 3300006028 | Bacteria | 1069 |
| 289 | Ga0070717_10838447 | 3300006028 | Bacteria | 836 |
| 290 | Ga0075365_10377161 | 3300006038 | Bacteria | 1000 |
| 291 | Ga0075363_100033628 | 3300006048 | Bacteria | 2672 |
| 292 | Ga0075364_10028265 | 3300006051 | Bacteria | 3589 |
| 293 | Ga0070715_10011926 | 3300006163 | Bacteria | 3144 |
| 294 | Ga0070715_10050851 | 3300006163 | Bacteria | 1780 |
| 295 | Ga0070715_10086181 | 3300006163 | Bacteria | 1436 |
| 296 | Ga0070712_100052884 | 3300006175 | Bacteria | 2834 |
| 297 | Ga0070712_100092034 | 3300006175 | Bacteria | 2223 |
| 298 | Ga0070712_100127948 | 3300006175 | Bacteria | 1921 |
| 299 | Ga0070712_100472287 | 3300006175 | Bacteria | 1047 |
| 300 | Ga0075362_10056472 | 3300006177 | Bacteria | 1767 |
| 301 | Ga0075367_10028327 | 3300006178 | Bacteria | 3195 |
| 302 | Ga0075367_10068874 | 3300006178 | Bacteria | 2123 |
| 303 | Ga0075367_10224145 | 3300006178 | Bacteria | 1177 |
| 304 | Ga0075367_10224329 | 3300006178 | Bacteria | 1176 |
| 305 | Ga0075369_10015315 | 3300006186 | Bacteria | 3075 |
| 306 | Ga0075369_10147796 | 3300006186 | Bacteria | 1073 |
| 307 | Ga0075366_10029773 | 3300006195 | Bacteria | 3208 |
| 308 | Ga0075366_10168285 | 3300006195 | Bacteria | 1329 |
| 309 | Ga0075366_10234544 | 3300006195 | Bacteria | 1118 |
| 310 | Ga0097621_100000600 | 3300006237 | Bacteria | 25393 |
| 311 | Ga0097621_100042187 | 3300006237 | Bacteria | 3674 |
| 312 | Ga0097621_100892556 | 3300006237 | Bacteria | 827 |
| 313 | Ga0075370_10046577 | 3300006353 | Bacteria | 2454 |
| 314 | Ga0075370_10240538 | 3300006353 | Bacteria | 1072 |
| 315 | Ga0068871_100000118 | 3300006358 | Bacteria | 49211 |
| 316 | Ga0068871_100181189 | 3300006358 | Bacteria | 1810 |
| 317 | Ga0068871_100182502 | 3300006358 | Bacteria | 1804 |
| 318 | Ga0075428_100161072 | 3300006844 | Bacteria | 2435 |
| 319 | Ga0075430_100102806 | 3300006846 | Bacteria | 2386 |
| 320 | Ga0075431_100004125 | 3300006847 | Bacteria | 14184 |
| 321 | Ga0075431_100123156 | 3300006847 | Bacteria | 2675 |
| 322 | Ga0075431_100180851 | 3300006847 | Bacteria | 2164 |
| 323 | Ga0075431_100453776 | 3300006847 | Bacteria | 1277 |
| 324 | Ga0075433_10104991 | 3300006852 | Bacteria | 2503 |
| 325 | Ga0075434_100051111 | 3300006871 | Bacteria | 4106 |
| 326 | Ga0075434_100620498 | 3300006871 | Bacteria | 1100 |
| 327 | Ga0075429_100065551 | 3300006880 | Bacteria | 3162 |
| 328 | Ga0068865_100007181 | 3300006881 | Bacteria | 6840 |
| 329 | Ga0068865_100062519 | 3300006881 | Bacteria | 2613 |
| 330 | Ga0068865_100212159 | 3300006881 | Bacteria | 1509 |
| 331 | Ga0068865_100410156 | 3300006881 | Bacteria | 1111 |
| 332 | Ga0075436_100289370 | 3300006914 | Bacteria | 1173 |
| 333 | Ga0097620_100007402 | 3300006931 | Bacteria | 11142 |
| 334 | Ga0097620_100029394 | 3300006931 | Bacteria | 5514 |
| 335 | Ga0097620_100120404 | 3300006931 | Bacteria | 2691 |
| 336 | Ga0097620_100298643 | 3300006931 | Bacteria | 1704 |
| 337 | Ga0099794_10277287 | 3300007265 | Bacteria | 867 |
| 338 | Ga0099794_10291468 | 3300007265 | Bacteria | 844 |
| 339 | Ga0099795_10216884 | 3300007788 | Bacteria | 813 |
| 340 | Ga0105251_10011425 | 3300009011 | Bacteria | 5076 |
| 341 | Ga0105244_10037290 | 3300009036 | Bacteria | 2542 |
| 342 | Ga0105250_10022202 | 3300009092 | Bacteria | 2559 |
| 343 | Ga0105250_10111300 | 3300009092 | Bacteria | 1121 |
| 344 | Ga0105240_10011051 | 3300009093 | Bacteria | 12622 |
| 345 | Ga0105240_10133003 | 3300009093 | Bacteria | 2981 |
| 346 | Ga0105240_10328274 | 3300009093 | Bacteria | 1742 |
| 347 | Ga0105240_10685963 | 3300009093 | Bacteria | 1119 |
| 348 | Ga0105240_10808535 | 3300009093 | Bacteria | 1015 |
| 349 | Ga0105240_10818346 | 3300009093 | Bacteria | 1008 |
| 350 | Ga0111539_10010079 | 3300009094 | Bacteria | 11909 |
| 351 | Ga0111539_10080440 | 3300009094 | Bacteria | 3833 |
| 352 | Ga0111539_10119168 | 3300009094 | Bacteria | 3093 |
| 353 | Ga0105245_10017665 | 3300009098 | Bacteria | 6226 |
| 354 | Ga0105245_10072236 | 3300009098 | Bacteria | 3134 |
| 355 | Ga0105245_11016557 | 3300009098 | Bacteria | 874 |
| 356 | Ga0105245_11109512 | 3300009098 | Bacteria | 837 |
| 357 | Ga0105247_10156301 | 3300009101 | Bacteria | 1506 |
| 358 | Ga0105247_10173630 | 3300009101 | Bacteria | 1434 |
| 359 | Ga0114129_10366058 | 3300009147 | Bacteria | 1907 |
| 360 | Ga0105243_10009969 | 3300009148 | Bacteria | 7221 |
| 361 | Ga0105243_10068588 | 3300009148 | Bacteria | 2858 |
| 362 | Ga0105243_10348654 | 3300009148 | Bacteria | 1359 |
| 363 | Ga0105243_10799371 | 3300009148 | Bacteria | 929 |
| 364 | Ga0105241_10064717 | 3300009174 | Bacteria | 2824 |
| 365 | Ga0105241_10079658 | 3300009174 | Bacteria | 2562 |
| 366 | Ga0105241_10142659 | 3300009174 | Bacteria | 1952 |
| 367 | Ga0105241_10211682 | 3300009174 | Bacteria | 1624 |
| 368 | Ga0105241_10326504 | 3300009174 | Bacteria | 1325 |
| 369 | Ga0105242_10016828 | 3300009176 | Bacteria | 5691 |
| 370 | Ga0105242_10078822 | 3300009176 | Bacteria | 2750 |
| 371 | Ga0105248_10114304 | 3300009177 | Bacteria | 3044 |
| 372 | Ga0105248_10243143 | 3300009177 | Bacteria | 2026 |
| 373 | Ga0105237_10027530 | 3300009545 | Bacteria | 5801 |
| 374 | Ga0105237_10041848 | 3300009545 | Bacteria | 4620 |
| 375 | Ga0105237_10066669 | 3300009545 | Bacteria | 3594 |
| 376 | Ga0105237_10355757 | 3300009545 | Bacteria | 1469 |
| 377 | Ga0105237_10394223 | 3300009545 | Bacteria | 1389 |
| 378 | Ga0105238_10025155 | 3300009551 | Bacteria | 6067 |
| 379 | Ga0105238_10070568 | 3300009551 | Bacteria | 3492 |
| 380 | Ga0105238_10110641 | 3300009551 | Bacteria | 2727 |
| 381 | Ga0105238_10286485 | 3300009551 | Bacteria | 1629 |
| 382 | Ga0105238_10641453 | 3300009551 | Bacteria | 1072 |
| 383 | Ga0105249_10023350 | 3300009553 | Bacteria | 5549 |
| 384 | Ga0105249_11544874 | 3300009553 | Bacteria | 736 |
| 385 | Ga0105035_101192 | 3300009988 | Bacteria | 1748 |
| 386 | Ga0099796_10209839 | 3300010159 | Bacteria | 794 |
| 387 | Ga0105239_10052904 | 3300010375 | Bacteria | 4454 |
| 388 | Ga0105239_10057391 | 3300010375 | Bacteria | 4270 |
| 389 | Ga0105239_10090514 | 3300010375 | Bacteria | 3375 |
| 390 | Ga0105239_10162528 | 3300010375 | Bacteria | 2495 |
| 391 | Ga0105239_10408427 | 3300010375 | Bacteria | 1537 |
| 392 | Ga0105239_10572363 | 3300010375 | Bacteria | 1287 |
| 393 | Ga0105239_11658294 | 3300010375 | Bacteria | 740 |
| 394 | Ga0105246_10002558 | 3300011119 | Bacteria | 10995 |
| 395 | Ga0105246_10004854 | 3300011119 | Bacteria | 8191 |
| 396 | Ga0105246_10045899 | 3300011119 | Bacteria | 2978 |
| 397 | Ga0105246_10479733 | 3300011119 | Bacteria | 1052 |
| 398 | Ga0105246_11112431 | 3300011119 | Bacteria | 722 |
| 399 | Ga0157342_1021460 | 3300012507 | Bacteria | 753 |
| 400 | Ga0157338_1002157 | 3300012515 | Bacteria | 1517 |
| 401 | Ga0157371_10057710 | 3300013102 | Bacteria | 2753 |
| 402 | Ga0157370_10089027 | 3300013104 | Bacteria | 2899 |
| 403 | Ga0157370_10093542 | 3300013104 | Bacteria | 2821 |
| 404 | Ga0157370_10140549 | 3300013104 | Bacteria | 2249 |
| 405 | Ga0157370_10302071 | 3300013104 | Bacteria | 1477 |
| 406 | Ga0157369_10153459 | 3300013105 | Bacteria | 2434 |
| 407 | Ga0157369_10388377 | 3300013105 | Bacteria | 1448 |
| 408 | Ga0157374_10018401 | 3300013296 | Bacteria | 6164 |
| 409 | Ga0157374_10115150 | 3300013296 | Bacteria | 2589 |
| 410 | Ga0157378_10015153 | 3300013297 | Bacteria | 6749 |
| 411 | Ga0157378_10165874 | 3300013297 | Bacteria | 2069 |
| 412 | Ga0157378_10182088 | 3300013297 | Bacteria | 1977 |
| 413 | Ga0157378_10183754 | 3300013297 | Bacteria | 1968 |
| 414 | Ga0163162_10028695 | 3300013306 | Bacteria | 5508 |
| 415 | Ga0163162_10289023 | 3300013306 | Bacteria | 1771 |
| 416 | Ga0157372_10790476 | 3300013307 | Bacteria | 1103 |
| 417 | Ga0157375_10007178 | 3300013308 | Bacteria | 9737 |
| 418 | Ga0157375_10020813 | 3300013308 | Bacteria | 6003 |
| 419 | Ga0163163_10002129 | 3300014325 | Bacteria | 16714 |
| 420 | Ga0163163_10113766 | 3300014325 | Bacteria | 2736 |
| 421 | Ga0163163_10240369 | 3300014325 | Bacteria | 1860 |
| 422 | Ga0163163_10886414 | 3300014325 | Bacteria | 956 |
| 423 | Ga0157380_10021174 | 3300014326 | Bacteria | 4874 |
| 424 | Ga0157380_11012547 | 3300014326 | Bacteria | 865 |
| 425 | Ga0157380_11679675 | 3300014326 | Bacteria | 692 |
| 426 | Ga0157377_10000628 | 3300014745 | Bacteria | 14665 |
| 427 | Ga0157377_10292657 | 3300014745 | Bacteria | 1072 |
| 428 | Ga0157377_10639224 | 3300014745 | Bacteria | 764 |
| 429 | Ga0157377_10727893 | 3300014745 | Bacteria | 723 |
| 430 | Ga0157379_10021324 | 3300014968 | Bacteria | 5734 |
| 431 | Ga0157379_10085756 | 3300014968 | Bacteria | 2823 |
| 432 | Ga0157379_10209261 | 3300014968 | Bacteria | 1765 |
| 433 | Ga0157379_10610794 | 3300014968 | Bacteria | 1018 |
| 434 | Ga0157376_10006966 | 3300014969 | Bacteria | 8018 |
| 435 | Ga0182005_1006944 | 3300015265 | Bacteria | 3424 |
| 436 | Ga0163161_10009359 | 3300017792 | Bacteria | 6779 |
| 437 | Ga0163161_10224666 | 3300017792 | Bacteria | 1455 |
| 438 | Ga0206354_10419390 | 3300020081 | Bacteria | 865 |
| 439 | Ga0206353_10593523 | 3300020082 | Bacteria | 1418 |
| 440 | Ga0206353_11417346 | 3300020082 | Bacteria | 942 |
| 441 | Ga0213872_10023323 | 3300021361 | Bacteria | 2847 |
| 442 | Ga0213874_10010979 | 3300021377 | Bacteria | 2283 |
| 443 | Ga0213876_10019675 | 3300021384 | Bacteria | 3565 |
| 444 | Ga0213875_10269195 | 3300021388 | Bacteria | 804 |
| 445 | Ga0207427_101449 | 3300025231 | Bacteria | 8554 |
| 446 | Ga0209233_1000293 | 3300025261 | Bacteria | 63470 |
| 447 | Ga0207666_1000185 | 3300025271 | Bacteria | 9376 |
| 448 | Ga0207666_1004262 | 3300025271 | Bacteria | 1787 |
| 449 | Ga0209564_1009622 | 3300025295 | Bacteria | 4572 |
| 450 | Ga0209758_1006193 | 3300025297 | Bacteria | 8738 |
| 451 | Ga0207697_10003861 | 3300025315 | Bacteria | 7309 |
| 452 | Ga0207697_10018234 | 3300025315 | Bacteria | 2880 |
| 453 | Ga0207656_10025078 | 3300025321 | Bacteria | 2418 |
| 454 | Ga0207656_10365593 | 3300025321 | Bacteria | 722 |
| 455 | Ga0207713_1060865 | 3300025735 | Bacteria | 1440 |
| 456 | Ga0207653_10200022 | 3300025885 | Bacteria | 753 |
| 457 | Ga0207682_10000350 | 3300025893 | Bacteria | 21096 |
| 458 | Ga0207692_10043759 | 3300025898 | Bacteria | 2230 |
| 459 | Ga0207642_10001478 | 3300025899 | Bacteria | 7266 |
| 460 | Ga0207642_10047526 | 3300025899 | Bacteria | 1919 |
| 461 | Ga0207710_10010087 | 3300025900 | Bacteria | 3975 |
| 462 | Ga0207710_10118871 | 3300025900 | Bacteria | 1260 |
| 463 | Ga0207688_10007287 | 3300025901 | Bacteria | 6019 |
| 464 | Ga0207688_10020869 | 3300025901 | Bacteria | 3576 |
| 465 | Ga0207688_10074491 | 3300025901 | Bacteria | 1931 |
| 466 | Ga0207680_10293343 | 3300025903 | Bacteria | 1132 |
| 467 | Ga0207680_10408714 | 3300025903 | Bacteria | 960 |
| 468 | Ga0207647_10030675 | 3300025904 | Bacteria | 3466 |
| 469 | Ga0207647_10033853 | 3300025904 | Bacteria | 3267 |
| 470 | Ga0207647_10055947 | 3300025904 | Bacteria | 2422 |
| 471 | Ga0207647_10504708 | 3300025904 | Bacteria | 674 |
| 472 | Ga0207685_10006758 | 3300025905 | Bacteria | 3150 |
| 473 | Ga0207699_10181090 | 3300025906 | Bacteria | 1417 |
| 474 | Ga0207699_10339908 | 3300025906 | Bacteria | 1057 |
| 475 | Ga0207645_10091158 | 3300025907 | Bacteria | 1960 |
| 476 | Ga0207645_10111940 | 3300025907 | Bacteria | 1768 |
| 477 | Ga0207645_10512605 | 3300025907 | Bacteria | 812 |
| 478 | Ga0207643_10000009 | 3300025908 | Bacteria | 160496 |
| 479 | Ga0207705_10034426 | 3300025909 | Bacteria | 3621 |
| 480 | Ga0207684_10583174 | 3300025910 | Bacteria | 956 |
| 481 | Ga0207654_10048041 | 3300025911 | Bacteria | 2441 |
| 482 | Ga0207654_10074102 | 3300025911 | Bacteria | 2031 |
| 483 | Ga0207654_10077388 | 3300025911 | Bacteria | 1994 |
| 484 | Ga0207654_10222073 | 3300025911 | Bacteria | 1254 |
| 485 | Ga0207707_10002337 | 3300025912 | Bacteria | 17081 |
| 486 | Ga0207707_10004335 | 3300025912 | Bacteria | 12560 |
| 487 | Ga0207707_10006091 | 3300025912 | Bacteria | 10552 |
| 488 | Ga0207707_10022768 | 3300025912 | Bacteria | 5478 |
| 489 | Ga0207707_10094574 | 3300025912 | Bacteria | 2611 |
| 490 | Ga0207707_10188949 | 3300025912 | Bacteria | 1797 |
| 491 | Ga0207695_10001032 | 3300025913 | Bacteria | 48974 |
| 492 | Ga0207695_10063576 | 3300025913 | Bacteria | 3804 |
| 493 | Ga0207695_10231339 | 3300025913 | Bacteria | 1753 |
| 494 | Ga0207671_10050006 | 3300025914 | Bacteria | 3095 |
| 495 | Ga0207671_10050376 | 3300025914 | Bacteria | 3084 |
| 496 | Ga0207671_10063751 | 3300025914 | Bacteria | 2739 |
| 497 | Ga0207671_10275241 | 3300025914 | Bacteria | 1327 |
| 498 | Ga0207671_10313711 | 3300025914 | Bacteria | 1240 |
| 499 | Ga0207671_10397280 | 3300025914 | Bacteria | 1096 |
| 500 | Ga0207693_10015635 | 3300025915 | Bacteria | 6084 |
| 501 | Ga0207693_10032195 | 3300025915 | Bacteria | 4139 |
| 502 | Ga0207693_10200166 | 3300025915 | Bacteria | 1571 |
| 503 | Ga0207693_10273432 | 3300025915 | Bacteria | 1324 |
| 504 | Ga0207663_10115788 | 3300025916 | Bacteria | 1827 |
| 505 | Ga0207663_10242235 | 3300025916 | Bacteria | 1323 |
| 506 | Ga0207663_10418262 | 3300025916 | Bacteria | 1028 |
| 507 | Ga0207660_10000197 | 3300025917 | Bacteria | 38486 |
| 508 | Ga0207660_10001861 | 3300025917 | Bacteria | 14060 |
| 509 | Ga0207660_10013609 | 3300025917 | Bacteria | 5334 |
| 510 | Ga0207660_10053740 | 3300025917 | Bacteria | 2872 |
| 511 | Ga0207662_10010568 | 3300025918 | Bacteria | 5102 |
| 512 | Ga0207657_10022013 | 3300025919 | Bacteria | 5985 |
| 513 | Ga0207657_10028527 | 3300025919 | Bacteria | 5090 |
| 514 | Ga0207657_10053617 | 3300025919 | Bacteria | 3493 |
| 515 | Ga0207657_10095224 | 3300025919 | Bacteria | 2478 |
| 516 | Ga0207657_10152769 | 3300025919 | Bacteria | 1879 |
| 517 | Ga0207649_10000052 | 3300025920 | Bacteria | 106800 |
| 518 | Ga0207652_10004826 | 3300025921 | Bacteria | 10919 |
| 519 | Ga0207652_10007272 | 3300025921 | Bacteria | 8921 |
| 520 | Ga0207652_10031244 | 3300025921 | Bacteria | 4471 |
| 521 | Ga0207646_10091324 | 3300025922 | Bacteria | 2725 |
| 522 | Ga0207681_10001135 | 3300025923 | Bacteria | 17191 |
| 523 | Ga0207694_10004393 | 3300025924 | Bacteria | 11013 |
| 524 | Ga0207694_10030872 | 3300025924 | Bacteria | 4091 |
| 525 | Ga0207694_10066558 | 3300025924 | Bacteria | 2811 |
| 526 | Ga0207694_10233179 | 3300025924 | Bacteria | 1503 |
| 527 | Ga0207694_10360149 | 3300025924 | Bacteria | 1205 |
| 528 | Ga0207694_10382120 | 3300025924 | Bacteria | 1169 |
| 529 | Ga0207650_10002693 | 3300025925 | Bacteria | 12270 |
| 530 | Ga0207650_10114609 | 3300025925 | Bacteria | 2091 |
| 531 | Ga0207659_10002396 | 3300025926 | Bacteria | 11152 |
| 532 | Ga0207659_10039304 | 3300025926 | Bacteria | 3299 |
| 533 | Ga0207687_10008117 | 3300025927 | Bacteria | 6871 |
| 534 | Ga0207687_10248025 | 3300025927 | Bacteria | 1414 |
| 535 | Ga0207700_10053321 | 3300025928 | Bacteria | 3029 |
| 536 | Ga0207700_10341794 | 3300025928 | Bacteria | 1301 |
| 537 | Ga0207664_10129801 | 3300025929 | Bacteria | 2120 |
| 538 | Ga0207644_10000212 | 3300025931 | Bacteria | 40175 |
| 539 | Ga0207644_10126457 | 3300025931 | Bacteria | 1951 |
| 540 | Ga0207690_10001288 | 3300025932 | Bacteria | 15841 |
| 541 | Ga0207690_10022305 | 3300025932 | Bacteria | 3936 |
| 542 | Ga0207690_10354086 | 3300025932 | Bacteria | 1161 |
| 543 | Ga0207706_10016311 | 3300025933 | Bacteria | 6707 |
| 544 | Ga0207706_10054725 | 3300025933 | Bacteria | 3521 |
| 545 | Ga0207706_10114771 | 3300025933 | Bacteria | 2369 |
| 546 | Ga0207706_10558618 | 3300025933 | Bacteria | 985 |
| 547 | Ga0207706_10559097 | 3300025933 | Bacteria | 984 |
| 548 | Ga0207686_10002314 | 3300025934 | Bacteria | 10431 |
| 549 | Ga0207709_10000530 | 3300025935 | Bacteria | 33097 |
| 550 | Ga0207709_10143189 | 3300025935 | Bacteria | 1646 |
| 551 | Ga0207709_10309407 | 3300025935 | Bacteria | 1178 |
| 552 | Ga0207709_10337740 | 3300025935 | Bacteria | 1133 |
| 553 | Ga0207670_10011341 | 3300025936 | Bacteria | 5169 |
| 554 | Ga0207670_10015207 | 3300025936 | Bacteria | 4592 |
| 555 | Ga0207670_10426113 | 3300025936 | Bacteria | 1065 |
| 556 | Ga0207669_10000235 | 3300025937 | Bacteria | 25138 |
| 557 | Ga0207669_10500208 | 3300025937 | Bacteria | 972 |
| 558 | Ga0207669_10568876 | 3300025937 | Bacteria | 917 |
| 559 | Ga0207704_10000198 | 3300025938 | Bacteria | 31182 |
| 560 | Ga0207704_10094557 | 3300025938 | Bacteria | 1974 |
| 561 | Ga0207665_10020388 | 3300025939 | Bacteria | 4356 |
| 562 | Ga0207665_10188996 | 3300025939 | Bacteria | 1495 |
| 563 | Ga0207665_10227822 | 3300025939 | Bacteria | 1368 |
| 564 | Ga0207691_10013970 | 3300025940 | Bacteria | 7661 |
| 565 | Ga0207691_10205069 | 3300025940 | Bacteria | 1715 |
| 566 | Ga0207711_10084111 | 3300025941 | Bacteria | 2785 |
| 567 | Ga0207711_10261975 | 3300025941 | Bacteria | 1589 |
| 568 | Ga0207689_10000031 | 3300025942 | Bacteria | 97131 |
| 569 | Ga0207689_10115687 | 3300025942 | Bacteria | 2205 |
| 570 | Ga0207689_10290010 | 3300025942 | Bacteria | 1355 |
| 571 | Ga0207689_10670124 | 3300025942 | Bacteria | 874 |
| 572 | Ga0207661_10003727 | 3300025944 | Bacteria | 10622 |
| 573 | Ga0207661_10065582 | 3300025944 | Bacteria | 2948 |
| 574 | Ga0207679_10000183 | 3300025945 | Bacteria | 51645 |
| 575 | Ga0207679_10099127 | 3300025945 | Bacteria | 2274 |
| 576 | Ga0207667_10002033 | 3300025949 | Bacteria | 25353 |
| 577 | Ga0207667_10004001 | 3300025949 | Bacteria | 18104 |
| 578 | Ga0207667_10027381 | 3300025949 | Bacteria | 6205 |
| 579 | Ga0207667_10030652 | 3300025949 | Bacteria | 5815 |
| 580 | Ga0207667_10037495 | 3300025949 | Bacteria | 5180 |
| 581 | Ga0207667_10344172 | 3300025949 | Bacteria | 1521 |
| 582 | Ga0207667_10811761 | 3300025949 | Bacteria | 932 |
| 583 | Ga0207651_10000051 | 3300025960 | Bacteria | 54163 |
| 584 | Ga0207651_10146875 | 3300025960 | Bacteria | 1830 |
| 585 | Ga0207651_11032784 | 3300025960 | Bacteria | 735 |
| 586 | Ga0207712_10001703 | 3300025961 | Bacteria | 14771 |
| 587 | Ga0207712_10013885 | 3300025961 | Bacteria | 5165 |
| 588 | Ga0207712_10243402 | 3300025961 | Bacteria | 1450 |
| 589 | Ga0207712_11131360 | 3300025961 | Bacteria | 697 |
| 590 | Ga0207668_10001674 | 3300025972 | Bacteria | 12959 |
| 591 | Ga0207640_10000343 | 3300025981 | Bacteria | 30767 |
| 592 | Ga0207640_10024133 | 3300025981 | Bacteria | 3664 |
| 593 | Ga0207640_10125861 | 3300025981 | Bacteria | 1845 |
| 594 | Ga0207640_10209176 | 3300025981 | Bacteria | 1485 |
| 595 | Ga0207658_10066787 | 3300025986 | Bacteria | 2706 |
| 596 | Ga0207658_10157925 | 3300025986 | Bacteria | 1855 |
| 597 | Ga0207658_10231914 | 3300025986 | Bacteria | 1559 |
| 598 | Ga0207658_10362232 | 3300025986 | Bacteria | 1265 |
| 599 | Ga0207677_10184979 | 3300026023 | Bacteria | 1642 |
| 600 | Ga0207677_10609323 | 3300026023 | Bacteria | 959 |
| 601 | Ga0207703_10010733 | 3300026035 | Bacteria | 7151 |
| 602 | Ga0207703_10073592 | 3300026035 | Bacteria | 2827 |
| 603 | Ga0207703_10158890 | 3300026035 | Bacteria | 1978 |
| 604 | Ga0207703_10387968 | 3300026035 | Bacteria | 1293 |
| 605 | Ga0207639_10003883 | 3300026041 | Bacteria | 10074 |
| 606 | Ga0207639_10022852 | 3300026041 | Bacteria | 4509 |
| 607 | Ga0207639_10033916 | 3300026041 | Bacteria | 3769 |
| 608 | Ga0207639_10231810 | 3300026041 | Bacteria | 1601 |
| 609 | Ga0207639_10338014 | 3300026041 | Bacteria | 1342 |
| 610 | Ga0207639_10812209 | 3300026041 | Bacteria | 872 |
| 611 | Ga0207678_10000118 | 3300026067 | Bacteria | 65608 |
| 612 | Ga0207678_10005779 | 3300026067 | Bacteria | 11029 |
| 613 | Ga0207678_10024280 | 3300026067 | Bacteria | 5295 |
| 614 | Ga0207678_10043860 | 3300026067 | Bacteria | 3869 |
| 615 | Ga0207678_10100765 | 3300026067 | Bacteria | 2467 |
| 616 | Ga0207678_10276341 | 3300026067 | Bacteria | 1441 |
| 617 | Ga0207678_10322186 | 3300026067 | Bacteria | 1330 |
| 618 | Ga0207708_10014839 | 3300026075 | Bacteria | 5830 |
| 619 | Ga0207708_10156799 | 3300026075 | Bacteria | 1795 |
| 620 | Ga0207708_10444071 | 3300026075 | Bacteria | 1079 |
| 621 | Ga0207708_10504586 | 3300026075 | Bacteria | 1014 |
| 622 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 623 | Ga0207702_10004643 | 3300026078 | Bacteria | 12151 |
| 624 | Ga0207702_10117091 | 3300026078 | Bacteria | 2379 |
| 625 | Ga0207702_10229342 | 3300026078 | Bacteria | 1735 |
| 626 | Ga0207702_10298401 | 3300026078 | Bacteria | 1528 |
| 627 | Ga0207702_10634731 | 3300026078 | Bacteria | 1050 |
| 628 | Ga0207702_10937905 | 3300026078 | Bacteria | 858 |
| 629 | Ga0207641_10001831 | 3300026088 | Bacteria | 20447 |
| 630 | Ga0207641_10067271 | 3300026088 | Bacteria | 3068 |
| 631 | Ga0207641_11218845 | 3300026088 | Bacteria | 752 |
| 632 | Ga0207648_10025743 | 3300026089 | Bacteria | 5237 |
| 633 | Ga0207648_10102108 | 3300026089 | Bacteria | 2513 |
| 634 | Ga0207648_10358891 | 3300026089 | Bacteria | 1315 |
| 635 | Ga0207676_10000124 | 3300026095 | Bacteria | 67747 |
| 636 | Ga0207676_10297986 | 3300026095 | Bacteria | 1471 |
| 637 | Ga0207674_10016004 | 3300026116 | Bacteria | 8216 |
| 638 | Ga0207674_10092968 | 3300026116 | Bacteria | 3005 |
| 639 | Ga0207674_10134546 | 3300026116 | Bacteria | 2434 |
| 640 | Ga0207675_100029702 | 3300026118 | Bacteria | 5090 |
| 641 | Ga0207675_100118832 | 3300026118 | Bacteria | 2500 |
| 642 | Ga0207683_10000242 | 3300026121 | Bacteria | 48576 |
| 643 | Ga0207683_10081510 | 3300026121 | Bacteria | 2872 |
| 644 | Ga0207683_10283175 | 3300026121 | Bacteria | 1515 |
| 645 | Ga0207683_10418060 | 3300026121 | Bacteria | 1235 |
| 646 | Ga0207698_10010960 | 3300026142 | Bacteria | 5857 |
| 647 | Ga0207698_10040510 | 3300026142 | Bacteria | 3463 |
| 648 | Ga0207698_10164727 | 3300026142 | Bacteria | 1944 |
| 649 | Ga0207698_10600989 | 3300026142 | Bacteria | 1084 |
| 650 | Ga0207698_10986508 | 3300026142 | Bacteria | 853 |
| 651 | Ga0209967_1017369 | 3300027364 | Bacteria | 1038 |
| 652 | Ga0209999_1027845 | 3300027543 | Bacteria | 1047 |
| 653 | Ga0209970_1008675 | 3300027614 | Bacteria | 1665 |
| 654 | Ga0210002_1001035 | 3300027617 | Bacteria | 3838 |
| 655 | Ga0209588_1010113 | 3300027671 | Bacteria | 2831 |
| 656 | Ga0209588_1177560 | 3300027671 | Bacteria | 669 |
| 657 | Ga0209971_1020522 | 3300027682 | Bacteria | 1571 |
| 658 | Ga0209971_1056359 | 3300027682 | Bacteria | 950 |
| 659 | Ga0209966_1001282 | 3300027695 | Bacteria | 4460 |
| 660 | Ga0209966_1008822 | 3300027695 | Bacteria | 1793 |
| 661 | Ga0209998_10006463 | 3300027717 | Bacteria | 2435 |
| 662 | Ga0209998_10010491 | 3300027717 | Bacteria | 1918 |
| 663 | Ga0209813_10000406 | 3300027866 | Bacteria | 10561 |
| 664 | Ga0209974_10173950 | 3300027876 | Bacteria | 786 |
| 665 | Ga0207428_10000037 | 3300027907 | Bacteria | 218857 |
| 666 | Ga0207428_10013074 | 3300027907 | Bacteria | 7269 |
| 667 | Ga0207428_10020203 | 3300027907 | Bacteria | 5663 |
| 668 | Ga0207428_10427099 | 3300027907 | Bacteria | 968 |
| 669 | Ga0268266_10037309 | 3300028379 | Bacteria | 4141 |
| 670 | Ga0268266_10199931 | 3300028379 | Bacteria | 1828 |
| 671 | Ga0268266_10695436 | 3300028379 | Bacteria | 980 |
| 672 | Ga0268266_10746537 | 3300028379 | Bacteria | 944 |
| 673 | Ga0268265_10016165 | 3300028380 | Bacteria | 5122 |
| 674 | Ga0268265_10050585 | 3300028380 | Bacteria | 3131 |
| 675 | Ga0268265_10649900 | 3300028380 | Bacteria | 1013 |
| 676 | Ga0268264_10003234 | 3300028381 | Bacteria | 14103 |
| 677 | Ga0268264_10140651 | 3300028381 | Bacteria | 2152 |
| 678 | Ga0268264_10475709 | 3300028381 | Bacteria | 1214 |
| 679 | Ga0268264_10660566 | 3300028381 | Bacteria | 1035 |
| 680 | Ga0265330_10106794 | 3300031235 | Bacteria | 1197 |
| 681 | Ga0265332_10160585 | 3300031238 | Bacteria | 939 |
| 682 | Ga0265328_10000041 | 3300031239 | Bacteria | 89398 |
| 683 | Ga0265328_10000129 | 3300031239 | Bacteria | 36422 |
| 684 | Ga0265328_10012314 | 3300031239 | Bacteria | 3406 |
| 685 | Ga0265328_10068299 | 3300031239 | Bacteria | 1306 |
| 686 | Ga0265328_10094307 | 3300031239 | Bacteria | 1106 |
| 687 | Ga0265325_10001071 | 3300031241 | Bacteria | 19727 |
| 688 | Ga0265325_10015753 | 3300031241 | Bacteria | 4242 |
| 689 | Ga0265325_10048742 | 3300031241 | Bacteria | 2188 |
| 690 | Ga0265325_10112410 | 3300031241 | Bacteria | 1322 |
| 691 | Ga0265329_10004194 | 3300031242 | Bacteria | 6066 |
| 692 | Ga0265329_10047008 | 3300031242 | Bacteria | 1378 |
| 693 | Ga0265340_10001769 | 3300031247 | Bacteria | 12330 |
| 694 | Ga0265340_10006375 | 3300031247 | Bacteria | 6500 |
| 695 | Ga0265340_10029957 | 3300031247 | Bacteria | 2731 |
| 696 | Ga0265339_10002105 | 3300031249 | Bacteria | 14517 |
| 697 | Ga0265331_10001125 | 3300031250 | Bacteria | 20459 |
| 698 | Ga0265331_10140781 | 3300031250 | Bacteria | 1097 |
| 699 | Ga0265327_10044157 | 3300031251 | Bacteria | 2379 |
| 700 | Ga0265316_10016003 | 3300031344 | Bacteria | 6526 |
| 701 | Ga0265316_10077926 | 3300031344 | Bacteria | 2545 |
| 702 | Ga0307513_10028569 | 3300031456 | Bacteria | 6373 |
| 703 | Ga0307509_10399384 | 3300031507 | Bacteria | 1082 |
| 704 | Ga0265313_10000031 | 3300031595 | Bacteria | 128981 |
| 705 | Ga0265313_10006263 | 3300031595 | Bacteria | 8479 |
| 706 | Ga0265313_10032391 | 3300031595 | Bacteria | 2669 |
| 707 | Ga0265313_10087196 | 3300031595 | Bacteria | 1407 |
| 708 | Ga0307508_10193699 | 3300031616 | Bacteria | 1634 |
| 709 | Ga0307508_10330085 | 3300031616 | Bacteria | 1117 |
| 710 | Ga0265314_10004347 | 3300031711 | Bacteria | 13204 |
| 711 | Ga0265342_10004137 | 3300031712 | Bacteria | 11550 |
| 712 | Ga0265342_10024096 | 3300031712 | Bacteria | 3844 |
| 713 | Ga0265342_10059693 | 3300031712 | Bacteria | 2252 |
| 714 | Ga0265342_10065931 | 3300031712 | Bacteria | 2121 |
| 715 | Ga0316576_10100701 | 3300031727 | Bacteria | 2159 |
| 716 | Ga0316578_10158392 | 3300031728 | Bacteria | 1364 |
| 717 | Ga0307516_10033588 | 3300031730 | Bacteria | 5163 |
| 718 | Ga0307516_10126982 | 3300031730 | Bacteria | 2334 |
| 719 | Ga0307516_10350714 | 3300031730 | Bacteria | 1141 |
| 720 | Ga0307405_10465008 | 3300031731 | Bacteria | 1006 |
| 721 | Ga0307407_10317101 | 3300031903 | Bacteria | 1093 |
| 722 | Ga0307412_10097264 | 3300031911 | Bacteria | 2074 |
| 723 | Ga0307412_10386929 | 3300031911 | Bacteria | 1134 |
| 724 | Ga0307416_100057739 | 3300032002 | Bacteria | 3142 |
| 725 | Ga0307411_10508897 | 3300032005 | Bacteria | 1020 |
| 726 | Ga0307415_100320203 | 3300032126 | Bacteria | 1293 |
| 727 | Ga0316593_10001189 | 3300032168 | Bacteria | 5568 |
| 728 | Ga0316593_10005586 | 3300032168 | Bacteria | 3329 |
| 729 | Ga0307510_10145506 | 3300033180 | Bacteria | 2003 |
| 730 | Ga0316596_1000071 | 3300033541 | Bacteria | 11803 |
| 731 | Ga0316596_1005241 | 3300033541 | Bacteria | 2954 |
| 732 | Ga0316596_1029579 | 3300033541 | Bacteria | 1418 |
| 733 | Ga0373930_0003008 | 3300034816 | Bacteria | 2651 |
| 734 | Ga0373948_0002824 | 3300034817 | Bacteria | 2607 |
| 735 | Ga0373948_0011322 | 3300034817 | Bacteria | 1575 |
| 736 | Ga0373950_0000925 | 3300034818 | Bacteria | 3708 |
| 737 | Ga0373950_0005337 | 3300034818 | Bacteria | 1917 |
| 738 | Ga0373958_0001566 | 3300034819 | Bacteria | 3095 |
| 739 | Ga0373958_0002620 | 3300034819 | Bacteria | 2538 |
| 740 | Ga0373959_0003005 | 3300034820 | Bacteria | 2682 |
| 741 | Ga0373959_0005115 | 3300034820 | Bacteria | 2144 |
| 742 | Ga0373938_0000343 | 3300034957 | Bacteria | 7374 |
| 743 | Ga0373938_0001532 | 3300034957 | Bacteria | 3712 |
| 744 | Ga0373926_0101711 | 3300035083 | Bacteria | 1075 |
| 745 | Ga0373928_0001369 | 3300035084 | Bacteria | 4772 |
| 746 | Ga0373928_0003223 | 3300035084 | Bacteria | 3124 |
| 747 | Ga0373928_0012076 | 3300035084 | Bacteria | 1718 |
| 748 | Ga0373928_0025796 | 3300035084 | Bacteria | 1270 |
| 749 | Ga0373929_0006785 | 3300035085 | Bacteria | 2076 |
| 750 | Ga0373934_0012674 | 3300035086 | Bacteria | 3182 |
| 751 | Ga0373940_0038749 | 3300035088 | Bacteria | 1302 |
| 752 | Ga0373944_0002638 | 3300035089 | Bacteria | 4566 |
| 753 | Ga0373944_0062985 | 3300035089 | Bacteria | 1193 |
| 754 | Ga0373944_0063973 | 3300035089 | Bacteria | 1185 |
| 755 | Ga0373949_0001707 | 3300035090 | Bacteria | 6092 |
| 756 | Ga0373949_0003940 | 3300035090 | Bacteria | 3447 |
| 757 | Ga0373949_0015770 | 3300035090 | Bacteria | 1689 |
| 758 | Ga0373949_0029165 | 3300035090 | Bacteria | 1306 |
| 759 | Ga0373951_0003581 | 3300035091 | Bacteria | 3746 |
| 760 | Ga0373951_0027305 | 3300035091 | Bacteria | 1332 |
| 761 | Ga0373951_0129658 | 3300035091 | Bacteria | 692 |
| 762 | Ga0373952_0001963 | 3300035092 | Bacteria | 3719 |
| 763 | Ga0373952_0016138 | 3300035092 | Bacteria | 1514 |
| 764 | Ga0373923_0000485 | 3300035111 | Bacteria | 9534 |
| 765 | Ga0373923_0009946 | 3300035111 | Bacteria | 3444 |
| 766 | Ga0373923_0139523 | 3300035111 | Bacteria | 1095 |
| 767 | Ga0373923_0225644 | 3300035111 | Bacteria | 872 |
| 768 | Ga0373932_0002338 | 3300035112 | Bacteria | 4813 |
| 769 | Ga0373932_0004128 | 3300035112 | Bacteria | 3451 |
| 770 | Ga0373932_0007842 | 3300035112 | Bacteria | 2547 |
| 771 | Ga0373936_0025775 | 3300035113 | Bacteria | 2300 |
| 772 | Ga0373936_0072662 | 3300035113 | Bacteria | 1420 |
| 773 | Ga0373939_0000898 | 3300035114 | Bacteria | 7393 |
| 774 | Ga0373939_0001965 | 3300035114 | Bacteria | 4916 |
| 775 | Ga0373939_0055390 | 3300035114 | Bacteria | 1245 |
| 776 | Ga0373941_0012147 | 3300035115 | Bacteria | 2244 |
| 777 | Ga0373945_0012761 | 3300035116 | Bacteria | 2795 |
| 778 | Ga0373945_0034692 | 3300035116 | Bacteria | 1799 |
| 779 | Ga0373945_0087729 | 3300035116 | Bacteria | 1200 |
| 780 | Ga0373953_0000440 | 3300035117 | Bacteria | 11394 |
| 781 | Ga0373953_0000811 | 3300035117 | Bacteria | 8711 |
| 782 | Ga0373953_0106528 | 3300035117 | Bacteria | 1183 |
| 783 | Ga0373953_0156714 | 3300035117 | Bacteria | 978 |
| 784 | Ga0373954_0007130 | 3300035118 | Bacteria | 4880 |
| 785 | Ga0373954_0038249 | 3300035118 | Bacteria | 2231 |
| 786 | Ga0373954_0097397 | 3300035118 | Bacteria | 1417 |
| 787 | Ga0373956_0031577 | 3300035119 | Bacteria | 2322 |
| 788 | Ga0373957_0004663 | 3300035120 | Bacteria | 4190 |
| 789 | Ga0373957_0031280 | 3300035120 | Bacteria | 1955 |
| 790 | Ga0373957_0051619 | 3300035120 | Bacteria | 1573 |
| 791 | Ga0373960_0018316 | 3300035121 | Bacteria | 1824 |
| 792 | Ga0373960_0041334 | 3300035121 | Bacteria | 1334 |
| 793 | Ga0373943_0008959 | 3300035170 | Bacteria | 4485 |
| 794 | Ga0373943_0016248 | 3300035170 | Bacteria | 3391 |
| 795 | Ga0373943_0142479 | 3300035170 | Bacteria | 1292 |
| 796 | Ga0373946_0001178 | 3300035171 | Bacteria | 9058 |
| 797 | Ga0373946_0016833 | 3300035171 | Bacteria | 2790 |
| 798 | Ga0373946_0067138 | 3300035171 | Bacteria | 1539 |
| 799 | Ga0373946_0135921 | 3300035171 | Bacteria | 1135 |
| 800 | Ga0373955_0000473 | 3300035172 | Bacteria | 16929 |
| 801 | Ga0373955_0004283 | 3300035172 | Bacteria | 6301 |
| 802 | Ga0373955_0020793 | 3300035172 | Bacteria | 3303 |
| 803 | Ga0373955_0124738 | 3300035172 | Bacteria | 1499 |
| 804 | Ga0373955_0267380 | 3300035172 | Bacteria | 1027 |
| 805 | Ga0373955_0449672 | 3300035172 | Bacteria | 785 |
| 806 | Ga0373942_0001142 | 3300035207 | Bacteria | 7047 |
| 807 | Ga0373942_0012868 | 3300035207 | Bacteria | 2004 |
| 808 | Ga0373942_0022753 | 3300035207 | Bacteria | 1593 |
| 809 | Ga0373961_0008256 | 3300035241 | Bacteria | 2531 |
| 810 | Ga0373961_0010530 | 3300035241 | Bacteria | 2280 |
| 811 | Ga0373962_0000112 | 3300035242 | Bacteria | 16939 |
| 812 | Ga0373962_0001106 | 3300035242 | Bacteria | 6274 |
| 813 | Ga0373962_0005399 | 3300035242 | Bacteria | 3093 |
| 814 | Ga0316574_0089288 | 3300035398 | Bacteria | 1963 |
| 815 | Ga0373924_0008604 | 3300035410 | Bacteria | 3716 |
| 816 | Ga0373924_0119843 | 3300035410 | Bacteria | 1141 |
| 817 | Ga0373931_0000305 | 3300035691 | Bacteria | 20657 |
| 818 | Ga0373931_0010294 | 3300035691 | Bacteria | 4494 |
| 819 | Ga0373931_0022466 | 3300035691 | Bacteria | 3175 |
| 820 | Ga0373931_0033067 | 3300035691 | Bacteria | 2678 |
| 821 | Ga0373931_0554026 | 3300035691 | Bacteria | 747 |
| 822 | Ga0373935_0000768 | 3300035692 | Bacteria | 17055 |
| 823 | Ga0373935_0054246 | 3300035692 | Bacteria | 2551 |
| 824 | Ga0373935_0312855 | 3300035692 | Bacteria | 1112 |
| 825 | Ga0373927_0017066 | 3300035695 | Bacteria | 4783 |
| 826 | Ga0373927_0023717 | 3300035695 | Bacteria | 4016 |
| 827 | Ga0373927_0064127 | 3300035695 | Bacteria | 2376 |
| 828 | Ga0373927_0086064 | 3300035695 | Bacteria | 2040 |
| 829 | Ga0373927_0196530 | 3300035695 | Bacteria | 1323 |
| 830 | Ga0373927_0521815 | 3300035695 | Bacteria | 785 |
| 831 | Ga0373933_0073858 | 3300035724 | Bacteria | 2078 |
| 832 | Ga0373933_0093721 | 3300035724 | Bacteria | 1856 |
| 833 | Ga0373933_0143575 | 3300035724 | Bacteria | 1508 |
| 834 | Ga0373933_0318467 | 3300035724 | Bacteria | 1008 |
| 835 | Ga0373947_0002626 | 3300035725 | Bacteria | 10785 |
| 836 | Ga0373947_0009798 | 3300035725 | Bacteria | 5497 |
| 837 | Ga0373947_0012496 | 3300035725 | Bacteria | 4869 |
| 838 | Ga0373947_0052868 | 3300035725 | Bacteria | 2447 |
| 839 | Ga0373947_0304539 | 3300035725 | Bacteria | 1063 |
| 840 | Ga0373937_0011350 | 3300036401 | Bacteria | 7816 |
| 841 | Ga0373937_0092928 | 3300036401 | Bacteria | 2796 |
| 842 | Ga0373937_0098665 | 3300036401 | Bacteria | 2709 |
| 843 | Ga0373937_0126066 | 3300036401 | Bacteria | 2388 |
| 844 | Ga0373937_0247199 | 3300036401 | Bacteria | 1681 |
| 845 | Ga0373937_0608813 | 3300036401 | Bacteria | 1037 |
| 846 | Ga0373925_0000435 | 3300037068 | Bacteria | 42178 |
| 847 | Ga0373925_0051088 | 3300037068 | Bacteria | 3085 |
| 848 | Ga0373925_0111082 | 3300037068 | Bacteria | 2117 |
| 849 | Ga0395899_0035120 | 3300037312 | Bacteria | 3764 |
| 850 | Ga0395899_0053109 | 3300037312 | Bacteria | 3001 |
| 851 | Ga0395900_0309593 | 3300037418 | Bacteria | 1563 |
| 852 | Ga0395900_0312059 | 3300037418 | Bacteria | 1555 |
| 853 | Ga0395898_0007760 | 3300037466 | Bacteria | 11394 |
| 854 | Ga0395898_0021940 | 3300037466 | Bacteria | 6467 |
| 855 | Ga0395898_0066766 | 3300037466 | Bacteria | 3483 |
| 856 | Ga0436364_0868561 | 3300037853 | Bacteria | 1914 |
| 857 | Ga0395901_0105438 | 3300038443 | Bacteria | 2958 |
| 858 | Ga0395901_0237328 | 3300038443 | Bacteria | 1902 |
| 859 | Ga0400490_54834 | 3300038726 | Bacteria | 3738 |
| 860 | Ga0400486_19576 | 3300038742 | Bacteria | 2427 |
| 861 | Ga0400483_013757 | 3300039062 | Bacteria | 1278 |
| 862 | Ga0400487_43369 | 3300039110 | Unclassified | 1544 |
| 863 | Ga0436365_0697746 | 3300039437 | Bacteria | 24050 |
| 864 | Ga0436365_0886574 | 3300039437 | Bacteria | 2399 |
| 865 | Ga0436365_1438629 | 3300039437 | Bacteria | 4753 |
| 866 | Ga0436361_0963669 | 3300039447 | Bacteria | 3298 |
| 867 | Ga0436363_0362931 | 3300039450 | Bacteria | 1651 |
| 868 | Ga0436363_0499016 | 3300039450 | Bacteria | 1327 |
| 869 | Ga0436363_1678732 | 3300039450 | Bacteria | 1098 |
| 870 | Ga0439453_0025374 | 3300041408 | Bacteria | 1094 |
| 871 | Ga0439466_0068208 | 3300041411 | Bacteria | 1137 |
| 872 | Ga0439465_0027921 | 3300041413 | Bacteria | 1788 |
| 873 | Ga0439441_004739 | 3300042001 | Bacteria | 2078 |
| 874 | Ga0439448_0052922 | 3300042005 | Bacteria | 1331 |
| 875 | Ga0439450_016812 | 3300042008 | Bacteria | 1517 |
| 876 | Ga0439463_031978 | 3300042016 | Bacteria | 1329 |
| 877 | Ga0439434_0039034 | 3300042435 | Bacteria | 1456 |
| 878 | Ga0439435_0038929 | 3300042436 | Bacteria | 1323 |
| 879 | Ga0439459_0005929 | 3300042438 | Bacteria | 2022 |
| 880 | Ga0439464_0015420 | 3300042439 | Bacteria | 2062 |
| 881 | Ga0439460_0077437 | 3300042461 | Bacteria | 1039 |
| 882 | Ga0451577_0138353 | 3300042876 | Bacteria | 2187 |
| 883 | Ga0439440_0012161 | 3300042993 | Bacteria | 1826 |
| 884 | Ga0466963_0018844 | 3300044694 | Bacteria | 4322 |
| 885 | Ga0453684_0087005 | 3300044712 | Bacteria | 3875 |
| 886 | Ga0466971_0160542 | 3300044719 | Bacteria | 1052 |
| 887 | Ga0466968_0060841 | 3300044735 | Bacteria | 1628 |
| 888 | Ga0466959_0261529 | 3300045049 | Bacteria | 1191 |
| 889 | Ga0451576_0024106 | 3300045051 | Bacteria | 6574 |
| 890 | Ga0466958_0170497 | 3300045836 | Bacteria | 1378 |
| 891 | Ga0466967_0031236 | 3300045976 | Bacteria | 4481 |
| 892 | Ga0466967_0050110 | 3300045976 | Bacteria | 3655 |
| 893 | Ga0495592_0000135 | 3300046454 | Bacteria | 65590 |
| 894 | Ga0495592_0001138 | 3300046454 | Bacteria | 18507 |
| 895 | Ga0495592_0046416 | 3300046454 | Bacteria | 3238 |
| 896 | Ga0495592_0123999 | 3300046454 | Bacteria | 1814 |
| 897 | Ga0495592_0457970 | 3300046454 | Bacteria | 798 |
| 898 | Ga0495603_0012514 | 3300046455 | Bacteria | 5137 |
| 899 | Ga0495603_0040716 | 3300046455 | Bacteria | 2780 |
| 900 | Ga0495603_0192701 | 3300046455 | Bacteria | 1178 |
| 901 | Ga0495629_0000317 | 3300046459 | Bacteria | 41238 |
| 902 | Ga0495629_0010959 | 3300046459 | Bacteria | 6589 |
| 903 | Ga0495629_0033469 | 3300046459 | Bacteria | 3635 |
| 904 | Ga0495641_0011646 | 3300046461 | Bacteria | 4989 |
| 905 | Ga0495641_0035126 | 3300046461 | Bacteria | 2366 |
| 906 | Ga0495641_0191271 | 3300046461 | Bacteria | 917 |
| 907 | Ga0495651_0003008 | 3300046462 | Bacteria | 13012 |
| 908 | Ga0495651_0004850 | 3300046462 | Bacteria | 10291 |
| 909 | Ga0495651_0188274 | 3300046462 | Bacteria | 1454 |
| 910 | Ga0495651_0456701 | 3300046462 | Bacteria | 825 |
| 911 | Ga0495653_0000120 | 3300046463 | Bacteria | 65274 |
| 912 | Ga0495653_0072344 | 3300046463 | Bacteria | 2574 |
| 913 | Ga0495653_0302631 | 3300046463 | Bacteria | 1042 |
| 914 | Ga0495580_0027886 | 3300046472 | Bacteria | 4107 |
| 915 | Ga0495580_0046764 | 3300046472 | Bacteria | 3069 |
| 916 | Ga0495580_0074442 | 3300046472 | Bacteria | 2370 |
| 917 | Ga0495582_0003714 | 3300046473 | Bacteria | 8595 |
| 918 | Ga0495582_0013082 | 3300046473 | Bacteria | 4570 |
| 919 | Ga0495639_0004359 | 3300046475 | Bacteria | 6064 |
| 920 | Ga0495639_0037402 | 3300046475 | Bacteria | 2175 |
| 921 | Ga0495639_0040420 | 3300046475 | Bacteria | 2098 |
| 922 | Ga0495639_0056372 | 3300046475 | Bacteria | 1794 |
| 923 | Ga0495639_0152579 | 3300046475 | Bacteria | 1115 |
| 924 | Ga0495662_0000285 | 3300046476 | Bacteria | 21823 |
| 925 | Ga0495662_0002801 | 3300046476 | Bacteria | 8818 |
| 926 | Ga0495662_0015062 | 3300046476 | Bacteria | 3757 |
| 927 | Ga0495662_0189539 | 3300046476 | Bacteria | 1014 |
| 928 | Ga0495664_0000023 | 3300046477 | Bacteria | 126807 |
| 929 | Ga0495664_0033507 | 3300046477 | Bacteria | 3018 |
| 930 | Ga0495664_0076784 | 3300046477 | Bacteria | 1999 |
| 931 | Ga0495664_0095123 | 3300046477 | Bacteria | 1793 |
| 932 | Ga0495664_0242731 | 3300046477 | Bacteria | 1090 |
| 933 | Ga0495664_0604704 | 3300046477 | Bacteria | 651 |
| 934 | Ga0495584_0120425 | 3300046491 | Bacteria | 1329 |
| 935 | Ga0495584_0121260 | 3300046491 | Bacteria | 1324 |
| 936 | Ga0495594_0042128 | 3300046499 | Bacteria | 2500 |
| 937 | Ga0495594_0047377 | 3300046499 | Bacteria | 2360 |
| 938 | Ga0495594_0053830 | 3300046499 | Bacteria | 2217 |
| 939 | Ga0495594_0072513 | 3300046499 | Bacteria | 1916 |
| 940 | Ga0495608_0000030 | 3300046511 | Bacteria | 145828 |
| 941 | Ga0495608_0007771 | 3300046511 | Bacteria | 7551 |
| 942 | Ga0495608_0071471 | 3300046511 | Bacteria | 2264 |
| 943 | Ga0495608_0087114 | 3300046511 | Bacteria | 2023 |
| 944 | Ga0495608_0531122 | 3300046511 | Bacteria | 710 |
| 945 | Ga0495618_0000042 | 3300046514 | Bacteria | 96182 |
| 946 | Ga0495618_0086821 | 3300046514 | Bacteria | 2000 |
| 947 | Ga0495628_0000027 | 3300046516 | Bacteria | 126537 |
| 948 | Ga0495628_0002285 | 3300046516 | Bacteria | 17341 |
| 949 | Ga0495628_0005831 | 3300046516 | Bacteria | 10790 |
| 950 | Ga0495628_0121361 | 3300046516 | Bacteria | 2004 |
| 951 | Ga0495628_0368029 | 3300046516 | Bacteria | 1054 |
| 952 | Ga0495630_0055318 | 3300046517 | Bacteria | 2974 |
| 953 | Ga0495630_0167451 | 3300046517 | Bacteria | 1673 |
| 954 | Ga0495630_0181822 | 3300046517 | Bacteria | 1603 |
| 955 | Ga0495630_0292636 | 3300046517 | Bacteria | 1244 |
| 956 | Ga0495630_0487683 | 3300046517 | Bacteria | 945 |
| 957 | Ga0495666_0040333 | 3300046526 | Bacteria | 2264 |
| 958 | Ga0495666_0069855 | 3300046526 | Bacteria | 1670 |
| 959 | Ga0495652_0000041 | 3300046529 | Bacteria | 126519 |
| 960 | Ga0495652_0141136 | 3300046529 | Bacteria | 1894 |
| 961 | Ga0495652_0269064 | 3300046529 | Bacteria | 1253 |
| 962 | Ga0495665_0014231 | 3300046531 | Bacteria | 4292 |
| 963 | Ga0495665_0053773 | 3300046531 | Bacteria | 2128 |
| 964 | Ga0495665_0214508 | 3300046531 | Bacteria | 996 |
| 965 | Ga0495640_0000047 | 3300046533 | Bacteria | 64381 |
| 966 | Ga0495640_0168412 | 3300046533 | Bacteria | 1400 |
| 967 | Ga0495586_0058322 | 3300046535 | Bacteria | 2096 |
| 968 | Ga0495587_0000025 | 3300046536 | Bacteria | 147974 |
| 969 | Ga0495587_0031176 | 3300046536 | Bacteria | 3230 |
| 970 | Ga0495587_0239915 | 3300046536 | Bacteria | 1020 |
| 971 | Ga0495645_0000001 | 3300046543 | Bacteria | 657910 |
| 972 | Ga0495645_0005350 | 3300046543 | Bacteria | 8799 |
| 973 | Ga0495645_0050307 | 3300046543 | Bacteria | 3034 |
| 974 | Ga0495622_0027764 | 3300046557 | Bacteria | 2641 |
| 975 | Ga0495622_0205163 | 3300046557 | Bacteria | 877 |
| 976 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 977 | Ga0495667_0153394 | 3300046559 | Bacteria | 1483 |
| 978 | Ga0495667_0182476 | 3300046559 | Bacteria | 1346 |
| 979 | Ga0495667_0379461 | 3300046559 | Bacteria | 891 |
| 980 | Ga0495634_0001443 | 3300046642 | Bacteria | 21148 |
| 981 | Ga0495634_0002681 | 3300046642 | Bacteria | 14628 |
| 982 | Ga0495634_0126421 | 3300046642 | Bacteria | 1633 |
| 983 | Ga0495634_0138839 | 3300046642 | Bacteria | 1544 |
| 984 | Ga0495634_0209436 | 3300046642 | Bacteria | 1208 |
| 985 | Ga0495634_0250306 | 3300046642 | Bacteria | 1084 |
| 986 | Ga0495635_0000061 | 3300046663 | Bacteria | 66702 |
| 987 | Ga0495635_0011224 | 3300046663 | Bacteria | 6280 |
| 988 | Ga0495635_0023262 | 3300046663 | Bacteria | 4319 |
| 989 | Ga0495635_0179121 | 3300046663 | Bacteria | 1441 |
| 990 | Ga0495635_0260117 | 3300046663 | Bacteria | 1169 |
| 991 | Ga0495588_0027962 | 3300046674 | Bacteria | 2820 |
| 992 | Ga0495657_0003632 | 3300046675 | Bacteria | 12530 |
| 993 | Ga0495657_0037526 | 3300046675 | Bacteria | 3339 |
| 994 | Ga0495657_0297992 | 3300046675 | Bacteria | 962 |
| 995 | Ga0495599_0000021 | 3300046678 | Bacteria | 127591 |
| 996 | Ga0495599_0055692 | 3300046678 | Bacteria | 2475 |
| 997 | Ga0495599_0067022 | 3300046678 | Bacteria | 2242 |
| 998 | Ga0495623_0000858 | 3300046679 | Bacteria | 20593 |
| 999 | Ga0495623_0001924 | 3300046679 | Bacteria | 13947 |
| 1000 | Ga0495646_0000043 | 3300046680 | Bacteria | 65914 |
| 1001 | Ga0495646_0007260 | 3300046680 | Bacteria | 7040 |
| 1002 | Ga0495647_0009980 | 3300046681 | Bacteria | 3227 |
| 1003 | Ga0495647_0021288 | 3300046681 | Bacteria | 2333 |
| 1004 | Ga0495658_0001480 | 3300046683 | Bacteria | 12346 |
| 1005 | Ga0495658_0007902 | 3300046683 | Bacteria | 5265 |
| 1006 | Ga0495658_0017238 | 3300046683 | Bacteria | 3728 |
| 1007 | Ga0495658_0054652 | 3300046683 | Bacteria | 2272 |
| 1008 | Ga0495613_0016831 | 3300046689 | Bacteria | 5444 |
| 1009 | Ga0495613_0027017 | 3300046689 | Bacteria | 4272 |
| 1010 | Ga0495613_0146612 | 3300046689 | Bacteria | 1684 |
| 1011 | Ga0495613_0448282 | 3300046689 | Bacteria | 874 |
| 1012 | Ga0495624_0035194 | 3300046690 | Bacteria | 3234 |
| 1013 | Ga0495624_0048203 | 3300046690 | Bacteria | 2704 |
| 1014 | Ga0495600_0000082 | 3300046809 | Bacteria | 52098 |
| 1015 | Ga0495600_0057702 | 3300046809 | Bacteria | 2535 |
| 1016 | Ga0495600_0065991 | 3300046809 | Bacteria | 2366 |
| 1017 | Ga0495581_0007052 | 3300047315 | Bacteria | 6513 |
| 1018 | Ga0495581_0047258 | 3300047315 | Bacteria | 2488 |
| 1019 | Ga0495604_0000036 | 3300047317 | Bacteria | 126707 |
| 1020 | Ga0495604_0063825 | 3300047317 | Bacteria | 2808 |
| 1021 | Ga0495604_0083692 | 3300047317 | Bacteria | 2383 |
| 1022 | Ga0495604_0514294 | 3300047317 | Bacteria | 775 |
| 1023 | Ga0495674_0000085 | 3300047319 | Bacteria | 65389 |
| 1024 | Ga0495674_0003478 | 3300047319 | Bacteria | 15305 |
| 1025 | Ga0495674_0027562 | 3300047319 | Bacteria | 5190 |
| 1026 | Ga0495674_0051156 | 3300047319 | Bacteria | 3642 |
| 1027 | Ga0495674_0453302 | 3300047319 | Bacteria | 1030 |
| 1028 | Ga0495676_0008691 | 3300047321 | Bacteria | 9296 |
| 1029 | Ga0495676_0047228 | 3300047321 | Bacteria | 3484 |
| 1030 | Ga0495676_0148593 | 3300047321 | Bacteria | 1671 |
| 1031 | Ga0495676_0156541 | 3300047321 | Bacteria | 1616 |
| 1032 | Ga0495676_0255730 | 3300047321 | Bacteria | 1193 |
| 1033 | Ga0495680_0000201 | 3300047322 | Bacteria | 64686 |
| 1034 | Ga0495680_0058793 | 3300047322 | Bacteria | 2969 |
| 1035 | Ga0495680_0106939 | 3300047322 | Bacteria | 2078 |
| 1036 | Ga0495680_0203811 | 3300047322 | Bacteria | 1418 |
| 1037 | Ga0495675_0000203 | 3300047444 | Bacteria | 43496 |
| 1038 | Ga0495675_0006492 | 3300047444 | Bacteria | 7157 |
| 1039 | Ga0495675_0271396 | 3300047444 | Bacteria | 1014 |
| 1040 | Ga0495673_0034291 | 3300047469 | Bacteria | 2347 |
| 1041 | Ga0495673_0139960 | 3300047469 | Bacteria | 944 |
| 1042 | Ga0495684_0000025 | 3300047471 | Bacteria | 127037 |
| 1043 | Ga0495686_0000007 | 3300047472 | Bacteria | 732622 |
| 1044 | Ga0495593_0001971 | 3300047673 | Bacteria | 12228 |
| 1045 | Ga0495593_0022296 | 3300047673 | Bacteria | 3531 |
| 1046 | Ga0495593_0279736 | 3300047673 | Bacteria | 834 |
| 1047 | Ga0495602_0000097 | 3300048088 | Bacteria | 82301 |
| 1048 | Ga0495602_0073140 | 3300048088 | Bacteria | 2919 |
| 1049 | Ga0495602_0115401 | 3300048088 | Bacteria | 2172 |
| 1050 | Ga0495614_0042862 | 3300048089 | Bacteria | 1940 |
| 1051 | Ga0495614_0135429 | 3300048089 | Bacteria | 1092 |
| 1052 | Ga0496100_0067021 | 3300048903 | Bacteria | 2383 |
| 1053 | Ga0496101_0000969 | 3300048904 | Bacteria | 16936 |
| 1054 | Ga0496101_0019543 | 3300048904 | Bacteria | 4625 |
| 1055 | Ga0496101_0146063 | 3300048904 | Bacteria | 1806 |
| 1056 | Ga0496101_0397038 | 3300048904 | Bacteria | 1086 |
| 1057 | Ga0496102_0004376 | 3300048905 | Bacteria | 11928 |
| 1058 | Ga0496102_0059982 | 3300048905 | Bacteria | 3480 |
| 1059 | Ga0496102_0062325 | 3300048905 | Bacteria | 3414 |
| 1060 | Ga0496102_0210706 | 3300048905 | Bacteria | 1832 |
| 1061 | Ga0496102_0269233 | 3300048905 | Bacteria | 1606 |
| 1062 | Ga0496102_0276267 | 3300048905 | Bacteria | 1583 |
| 1063 | Ga0496102_0853770 | 3300048905 | Bacteria | 832 |
| 1064 | Ga0496102_1065769 | 3300048905 | Bacteria | 728 |
| 1065 | Ga0496103_0001732 | 3300048906 | Bacteria | 14251 |
| 1066 | Ga0496103_0023227 | 3300048906 | Bacteria | 3738 |
| 1067 | Ga0496103_0044529 | 3300048906 | Bacteria | 2734 |
| 1068 | Ga0496103_0274490 | 3300048906 | Bacteria | 1084 |
| 1069 | Ga0496104_0000399 | 3300048907 | Bacteria | 38066 |
| 1070 | Ga0496104_0001364 | 3300048907 | Bacteria | 21131 |
| 1071 | Ga0496104_0068025 | 3300048907 | Bacteria | 3384 |
| 1072 | Ga0496104_0189398 | 3300048907 | Bacteria | 1968 |
| 1073 | Ga0496104_0234765 | 3300048907 | Bacteria | 1746 |
| 1074 | Ga0496104_0274823 | 3300048907 | Bacteria | 1597 |
| 1075 | Ga0496104_0625832 | 3300048907 | Bacteria | 986 |
| 1076 | Ga0496105_0002417 | 3300048908 | Bacteria | 13529 |
| 1077 | Ga0496105_0004404 | 3300048908 | Bacteria | 10600 |
| 1078 | Ga0496105_0529086 | 3300048908 | Bacteria | 922 |
| 1079 | Ga0496105_0615898 | 3300048908 | Bacteria | 841 |
| 1080 | Ga0496106_0006762 | 3300048909 | Bacteria | 8490 |
| 1081 | Ga0496106_0014064 | 3300048909 | Bacteria | 5913 |
| 1082 | Ga0496106_0015788 | 3300048909 | Bacteria | 5584 |
| 1083 | Ga0496106_0036410 | 3300048909 | Bacteria | 3681 |
| 1084 | Ga0496106_0037188 | 3300048909 | Bacteria | 3641 |
| 1085 | Ga0496107_0005598 | 3300048910 | Bacteria | 8604 |
| 1086 | Ga0496107_0043840 | 3300048910 | Bacteria | 3214 |
| 1087 | Ga0496108_0001133 | 3300048911 | Bacteria | 20819 |
| 1088 | Ga0496108_0007368 | 3300048911 | Bacteria | 8919 |
| 1089 | Ga0496108_0021831 | 3300048911 | Bacteria | 5261 |
| 1090 | Ga0496108_0085334 | 3300048911 | Bacteria | 2680 |
| 1091 | Ga0496108_0211111 | 3300048911 | Bacteria | 1685 |
| 1092 | Ga0496109_0000583 | 3300048912 | Bacteria | 30510 |
| 1093 | Ga0496109_0005949 | 3300048912 | Bacteria | 10237 |
| 1094 | Ga0496109_0019012 | 3300048912 | Bacteria | 6051 |
| 1095 | Ga0496109_0042827 | 3300048912 | Bacteria | 4103 |
| 1096 | Ga0496109_0133489 | 3300048912 | Bacteria | 2318 |
| 1097 | Ga0496109_0182665 | 3300048912 | Bacteria | 1970 |
| 1098 | Ga0496109_0268760 | 3300048912 | Bacteria | 1606 |
| 1099 | Ga0496109_0745331 | 3300048912 | Bacteria | 917 |
| 1100 | Ga0496110_0010849 | 3300048913 | Bacteria | 7430 |
| 1101 | Ga0496110_0030562 | 3300048913 | Bacteria | 4644 |
| 1102 | Ga0496110_0106807 | 3300048913 | Bacteria | 2512 |
| 1103 | Ga0496110_0216403 | 3300048913 | Bacteria | 1742 |
| 1104 | Ga0496110_0253605 | 3300048913 | Bacteria | 1601 |
| 1105 | Ga0496110_0394985 | 3300048913 | Bacteria | 1261 |
| 1106 | Ga0496110_0596572 | 3300048913 | Bacteria | 1002 |
| 1107 | Ga0496110_0625756 | 3300048913 | Bacteria | 975 |
| 1108 | Ga0496110_0870425 | 3300048913 | Bacteria | 806 |
| 1109 | Ga0496111_0009370 | 3300048914 | Bacteria | 6529 |
| 1110 | Ga0496111_0043921 | 3300048914 | Bacteria | 3213 |
| 1111 | Ga0496111_0055522 | 3300048914 | Bacteria | 2864 |
| 1112 | Ga0496111_0098890 | 3300048914 | Bacteria | 2142 |
| 1113 | Ga0496111_0130989 | 3300048914 | Bacteria | 1856 |
| 1114 | Ga0496111_0143778 | 3300048914 | Bacteria | 1768 |
| 1115 | Ga0496111_0169975 | 3300048914 | Bacteria | 1620 |
| 1116 | Ga0496112_0000884 | 3300048915 | Bacteria | 21517 |
| 1117 | Ga0496112_0045054 | 3300048915 | Bacteria | 4323 |
| 1118 | Ga0496112_0065844 | 3300048915 | Bacteria | 3576 |
| 1119 | Ga0496112_0262667 | 3300048915 | Bacteria | 1676 |
| 1120 | Ga0496112_0273206 | 3300048915 | Bacteria | 1638 |
| 1121 | Ga0496112_0796923 | 3300048915 | Bacteria | 870 |
| 1122 | Ga0496113_0000351 | 3300048916 | Bacteria | 22021 |
| 1123 | Ga0496113_0015868 | 3300048916 | Bacteria | 5190 |
| 1124 | Ga0496113_0124793 | 3300048916 | Bacteria | 2015 |
| 1125 | Ga0496113_0129113 | 3300048916 | Bacteria | 1982 |
| 1126 | Ga0496114_0002647 | 3300048917 | Bacteria | 13668 |
| 1127 | Ga0496114_0099598 | 3300048917 | Bacteria | 2479 |
| 1128 | Ga0496114_0167404 | 3300048917 | Bacteria | 1914 |
| 1129 | Ga0496114_0235220 | 3300048917 | Bacteria | 1610 |
| 1130 | Ga0496114_0708953 | 3300048917 | Bacteria | 882 |
| 1131 | Ga0496114_0939269 | 3300048917 | Bacteria | 747 |
| 1132 | Ga0496115_0001671 | 3300048918 | Bacteria | 15949 |
| 1133 | Ga0496115_0004536 | 3300048918 | Bacteria | 10046 |
| 1134 | Ga0496115_0047461 | 3300048918 | Bacteria | 3435 |
| 1135 | Ga0496115_0082945 | 3300048918 | Bacteria | 2612 |
| 1136 | Ga0496115_0107851 | 3300048918 | Bacteria | 2286 |
| 1137 | Ga0496115_0264871 | 3300048918 | Bacteria | 1413 |
| 1138 | Ga0496115_0307943 | 3300048918 | Bacteria | 1297 |
| 1139 | Ga0496124_0152630 | 3300048927 | Bacteria | 1810 |
| 1140 | Ga0496124_0201142 | 3300048927 | Bacteria | 1515 |
| 1141 | Ga0496124_0202200 | 3300048927 | Bacteria | 1510 |
| 1142 | Ga0496125_0122311 | 3300048928 | Bacteria | 1853 |
| 1143 | Ga0496125_0159581 | 3300048928 | Bacteria | 1534 |
| 1144 | Ga0496125_0288151 | 3300048928 | Bacteria | 1013 |
| 1145 | Ga0496126_0133942 | 3300048929 | Bacteria | 2139 |
| 1146 | Ga0496126_0646935 | 3300048929 | Bacteria | 828 |
| 1147 | Ga0501031_0183604 | 3300049568 | Bacteria | 1366 |
| 1148 | Ga0501032_0001915 | 3300049569 | Bacteria | 16407 |
| 1149 | Ga0501032_0020821 | 3300049569 | Bacteria | 4565 |
| 1150 | Ga0501032_0045310 | 3300049569 | Bacteria | 2975 |
| 1151 | Ga0501032_0045571 | 3300049569 | Bacteria | 2965 |
| 1152 | Ga0501032_0046252 | 3300049569 | Bacteria | 2941 |
| 1153 | Ga0501032_0058423 | 3300049569 | Bacteria | 2589 |
| 1154 | Ga0501032_0078973 | 3300049569 | Bacteria | 2191 |
| 1155 | Ga0501033_0021359 | 3300049570 | Bacteria | 4883 |
| 1156 | Ga0501033_0023272 | 3300049570 | Bacteria | 4672 |
| 1157 | Ga0501033_0086738 | 3300049570 | Bacteria | 2291 |
| 1158 | Ga0501033_0131050 | 3300049570 | Bacteria | 1816 |
| 1159 | Ga0501033_0182706 | 3300049570 | Bacteria | 1503 |
| 1160 | Ga0501033_0361307 | 3300049570 | Bacteria | 1016 |
| 1161 | Ga0501034_0000208 | 3300049571 | Bacteria | 111739 |
| 1162 | Ga0501034_0014987 | 3300049571 | Bacteria | 7973 |
| 1163 | Ga0501034_0024772 | 3300049571 | Bacteria | 6104 |
| 1164 | Ga0501034_0032099 | 3300049571 | Bacteria | 5335 |
| 1165 | Ga0501034_0033675 | 3300049571 | Bacteria | 5195 |
| 1166 | Ga0501034_0034843 | 3300049571 | Bacteria | 5104 |
| 1167 | Ga0501034_0060811 | 3300049571 | Bacteria | 3794 |
| 1168 | Ga0501034_0063818 | 3300049571 | Bacteria | 3697 |
| 1169 | Ga0501034_0101469 | 3300049571 | Bacteria | 2871 |
| 1170 | Ga0501034_0147005 | 3300049571 | Bacteria | 2334 |
| 1171 | Ga0501034_0212658 | 3300049571 | Bacteria | 1888 |
| 1172 | Ga0501034_0235530 | 3300049571 | Bacteria | 1778 |
| 1173 | Ga0501034_0274989 | 3300049571 | Bacteria | 1624 |
| 1174 | Ga0501034_0379067 | 3300049571 | Bacteria | 1339 |
| 1175 | Ga0501034_0568476 | 3300049571 | Bacteria | 1042 |
| 1176 | Ga0501034_0579537 | 3300049571 | Bacteria | 1029 |
| 1177 | Ga0501036_0005563 | 3300049572 | Bacteria | 10220 |
| 1178 | Ga0501036_0072595 | 3300049572 | Bacteria | 2909 |
| 1179 | Ga0501036_0091111 | 3300049572 | Bacteria | 2575 |
| 1180 | Ga0501036_0093818 | 3300049572 | Bacteria | 2536 |
| 1181 | Ga0501036_0112038 | 3300049572 | Bacteria | 2306 |
| 1182 | Ga0501036_0177505 | 3300049572 | Bacteria | 1793 |
| 1183 | Ga0501036_0194851 | 3300049572 | Bacteria | 1705 |
| 1184 | Ga0501036_0258786 | 3300049572 | Bacteria | 1458 |
| 1185 | Ga0501036_0268203 | 3300049572 | Bacteria | 1429 |
| 1186 | Ga0501036_0309680 | 3300049572 | Bacteria | 1320 |
| 1187 | Ga0501036_0312106 | 3300049572 | Bacteria | 1314 |
| 1188 | Ga0501037_0012573 | 3300049573 | Bacteria | 6237 |
| 1189 | Ga0501037_0108992 | 3300049573 | Bacteria | 1995 |
| 1190 | Ga0501037_0118828 | 3300049573 | Bacteria | 1901 |
| 1191 | Ga0501037_0188156 | 3300049573 | Bacteria | 1462 |
| 1192 | Ga0501037_0333013 | 3300049573 | Bacteria | 1049 |
| 1193 | Ga0501037_0429414 | 3300049573 | Bacteria | 903 |
| 1194 | Ga0501038_0007256 | 3300049574 | Bacteria | 10233 |
| 1195 | Ga0501038_0053366 | 3300049574 | Bacteria | 3480 |
| 1196 | Ga0501038_0058047 | 3300049574 | Bacteria | 3319 |
| 1197 | Ga0501038_0071577 | 3300049574 | Bacteria | 2941 |
| 1198 | Ga0501038_0071986 | 3300049574 | Bacteria | 2930 |
| 1199 | Ga0501038_0146399 | 3300049574 | Bacteria | 1928 |
| 1200 | Ga0501038_0226017 | 3300049574 | Bacteria | 1492 |
| 1201 | Ga0501038_0237838 | 3300049574 | Bacteria | 1447 |
| 1202 | Ga0501038_0329344 | 3300049574 | Bacteria | 1193 |
| 1203 | Ga0501038_0454377 | 3300049574 | Bacteria | 984 |
| 1204 | Ga0501038_0468809 | 3300049574 | Bacteria | 966 |
| 1205 | Ga0501039_0000072 | 3300049575 | Bacteria | 76673 |
| 1206 | Ga0501039_0032222 | 3300049575 | Bacteria | 4040 |
| 1207 | Ga0501039_0101199 | 3300049575 | Bacteria | 2249 |
| 1208 | Ga0501039_0353052 | 3300049575 | Bacteria | 1155 |
| 1209 | Ga0501039_0486593 | 3300049575 | Bacteria | 969 |
| 1210 | Ga0501040_0026515 | 3300049576 | Bacteria | 3898 |
| 1211 | Ga0501040_0108093 | 3300049576 | Bacteria | 1944 |
| 1212 | Ga0501040_0120446 | 3300049576 | Bacteria | 1841 |
| 1213 | Ga0501041_0095717 | 3300049577 | Bacteria | 1835 |
| 1214 | Ga0501043_0009304 | 3300049579 | Bacteria | 7720 |
| 1215 | Ga0501043_0012919 | 3300049579 | Bacteria | 6526 |
| 1216 | Ga0501043_0012997 | 3300049579 | Bacteria | 6508 |
| 1217 | Ga0501043_0037798 | 3300049579 | Bacteria | 3797 |
| 1218 | Ga0501043_0048068 | 3300049579 | Bacteria | 3354 |
| 1219 | Ga0501043_0129223 | 3300049579 | Bacteria | 1980 |
| 1220 | Ga0501043_0162421 | 3300049579 | Bacteria | 1745 |
| 1221 | Ga0501043_0189014 | 3300049579 | Bacteria | 1602 |
| 1222 | Ga0501043_0348979 | 3300049579 | Bacteria | 1124 |
| 1223 | Ga0501043_0416287 | 3300049579 | Bacteria | 1013 |
| 1224 | Ga0501043_0774330 | 3300049579 | Bacteria | 696 |
| 1225 | Ga0501046_0000045 | 3300049580 | Bacteria | 144492 |
| 1226 | Ga0501046_0006019 | 3300049580 | Bacteria | 10788 |
| 1227 | Ga0501046_0029093 | 3300049580 | Bacteria | 4495 |
| 1228 | Ga0501046_0125633 | 3300049580 | Bacteria | 1949 |
| 1229 | Ga0501046_0154028 | 3300049580 | Bacteria | 1733 |
| 1230 | Ga0501046_0156128 | 3300049580 | Bacteria | 1718 |
| 1231 | Ga0501046_0175873 | 3300049580 | Bacteria | 1603 |
| 1232 | Ga0501046_0380932 | 3300049580 | Bacteria | 1021 |
| 1233 | Ga0501047_0000235 | 3300049581 | Bacteria | 65603 |
| 1234 | Ga0501047_0001212 | 3300049581 | Bacteria | 25586 |
| 1235 | Ga0501047_0023718 | 3300049581 | Bacteria | 5890 |
| 1236 | Ga0501047_0026121 | 3300049581 | Bacteria | 5617 |
| 1237 | Ga0501047_0063775 | 3300049581 | Bacteria | 3554 |
| 1238 | Ga0501047_0091366 | 3300049581 | Bacteria | 2922 |
| 1239 | Ga0501047_0099459 | 3300049581 | Bacteria | 2787 |
| 1240 | Ga0501047_0116738 | 3300049581 | Bacteria | 2550 |
| 1241 | Ga0501047_0117521 | 3300049581 | Bacteria | 2541 |
| 1242 | Ga0501047_0205740 | 3300049581 | Bacteria | 1827 |
| 1243 | Ga0501047_0209584 | 3300049581 | Bacteria | 1807 |
| 1244 | Ga0501047_0256824 | 3300049581 | Bacteria | 1595 |
| 1245 | Ga0501047_0371553 | 3300049581 | Bacteria | 1265 |
| 1246 | Ga0501047_0419998 | 3300049581 | Bacteria | 1169 |
| 1247 | Ga0501048_0000501 | 3300049582 | Bacteria | 27413 |
| 1248 | Ga0501048_0006738 | 3300049582 | Bacteria | 8727 |
| 1249 | Ga0501048_0159113 | 3300049582 | Bacteria | 1598 |
| 1250 | Ga0501048_0245727 | 3300049582 | Bacteria | 1270 |
| 1251 | Ga0501048_0416902 | 3300049582 | Bacteria | 960 |
| 1252 | Ga0501067_0000278 | 3300049583 | Bacteria | 27992 |
| 1253 | Ga0501067_0001590 | 3300049583 | Bacteria | 12434 |
| 1254 | Ga0501067_0016768 | 3300049583 | Bacteria | 4048 |
| 1255 | Ga0501067_0026158 | 3300049583 | Bacteria | 3233 |
| 1256 | Ga0501067_0034817 | 3300049583 | Bacteria | 2796 |
| 1257 | Ga0501067_0051199 | 3300049583 | Bacteria | 2289 |
| 1258 | Ga0501067_0212349 | 3300049583 | Bacteria | 1078 |
| 1259 | Ga0501067_0252344 | 3300049583 | Bacteria | 982 |
| 1260 | Ga0501067_0276326 | 3300049583 | Bacteria | 935 |
| 1261 | Ga0501068_0015296 | 3300049584 | Bacteria | 4404 |
| 1262 | Ga0501068_0057493 | 3300049584 | Bacteria | 2358 |
| 1263 | Ga0501068_0111569 | 3300049584 | Bacteria | 1700 |
| 1264 | Ga0501069_0004122 | 3300049585 | Bacteria | 7502 |
| 1265 | Ga0501069_0030545 | 3300049585 | Bacteria | 2959 |
| 1266 | Ga0501069_0143465 | 3300049585 | Bacteria | 1370 |
| 1267 | Ga0501069_0194241 | 3300049585 | Bacteria | 1175 |
| 1268 | Ga0501069_0290519 | 3300049585 | Bacteria | 958 |
| 1269 | Ga0501070_0004020 | 3300049586 | Bacteria | 12633 |
| 1270 | Ga0501070_0067473 | 3300049586 | Bacteria | 2962 |
| 1271 | Ga0501070_0069151 | 3300049586 | Bacteria | 2923 |
| 1272 | Ga0501070_0080884 | 3300049586 | Bacteria | 2688 |
| 1273 | Ga0501070_0082865 | 3300049586 | Bacteria | 2654 |
| 1274 | Ga0501070_0083561 | 3300049586 | Bacteria | 2643 |
| 1275 | Ga0501070_0154978 | 3300049586 | Bacteria | 1889 |
| 1276 | Ga0501070_0223775 | 3300049586 | Bacteria | 1543 |
| 1277 | Ga0501070_0270302 | 3300049586 | Bacteria | 1388 |
| 1278 | Ga0501070_0750285 | 3300049586 | Bacteria | 769 |
| 1279 | Ga0501071_0063412 | 3300049587 | Bacteria | 2679 |
| 1280 | Ga0501071_0357403 | 3300049587 | Bacteria | 1112 |
| 1281 | Ga0501072_0019266 | 3300049588 | Bacteria | 5272 |
| 1282 | Ga0501072_0053259 | 3300049588 | Bacteria | 3187 |
| 1283 | Ga0501072_0067263 | 3300049588 | Bacteria | 2827 |
| 1284 | Ga0501072_0321624 | 3300049588 | Bacteria | 1229 |
| 1285 | Ga0501072_0628172 | 3300049588 | Bacteria | 846 |
| 1286 | Ga0501073_0000083 | 3300049589 | Bacteria | 59733 |
| 1287 | Ga0501073_0096053 | 3300049589 | Bacteria | 2058 |
| 1288 | Ga0501073_0160719 | 3300049589 | Bacteria | 1556 |
| 1289 | Ga0501073_0180275 | 3300049589 | Bacteria | 1462 |
| 1290 | Ga0501073_0190442 | 3300049589 | Bacteria | 1419 |
| 1291 | Ga0501073_0204900 | 3300049589 | Bacteria | 1363 |
| 1292 | Ga0501073_0491464 | 3300049589 | Bacteria | 849 |
| 1293 | Ga0501074_0002757 | 3300049590 | Bacteria | 12304 |
| 1294 | Ga0501074_0021566 | 3300049590 | Bacteria | 4677 |
| 1295 | Ga0501074_0029786 | 3300049590 | Bacteria | 3955 |
| 1296 | Ga0501074_0049622 | 3300049590 | Bacteria | 3030 |
| 1297 | Ga0501074_0146813 | 3300049590 | Bacteria | 1686 |
| 1298 | Ga0501074_0166845 | 3300049590 | Bacteria | 1572 |
| 1299 | Ga0501074_0287420 | 3300049590 | Bacteria | 1169 |
| 1300 | Ga0501074_0556012 | 3300049590 | Bacteria | 812 |
| 1301 | Ga0501076_0094419 | 3300049592 | Bacteria | 2408 |
| 1302 | Ga0501076_0208033 | 3300049592 | Bacteria | 1598 |
| 1303 | Ga0501076_0291179 | 3300049592 | Bacteria | 1338 |
| 1304 | Ga0501076_0621881 | 3300049592 | Bacteria | 891 |
| 1305 | Ga0501077_0000088 | 3300049593 | Bacteria | 46551 |
| 1306 | Ga0501077_0088504 | 3300049593 | Bacteria | 1962 |
| 1307 | Ga0501079_0032435 | 3300049741 | Bacteria | 4016 |
| 1308 | Ga0501079_0063030 | 3300049741 | Bacteria | 2860 |
| 1309 | Ga0501079_0403214 | 3300049741 | Bacteria | 1072 |
| 1310 | Ga0501079_0432268 | 3300049741 | Bacteria | 1033 |
| 1311 | Ga0501079_0808280 | 3300049741 | Bacteria | 738 |
| 1312 | Ga0501080_0000005 | 3300049742 | Bacteria | 176271 |
| 1313 | Ga0501080_0003162 | 3300049742 | Bacteria | 14508 |
| 1314 | Ga0501080_0006111 | 3300049742 | Bacteria | 10795 |
| 1315 | Ga0501080_0033886 | 3300049742 | Bacteria | 4767 |
| 1316 | Ga0501080_0064957 | 3300049742 | Bacteria | 3395 |
| 1317 | Ga0501080_0075103 | 3300049742 | Bacteria | 3144 |
| 1318 | Ga0501080_0103620 | 3300049742 | Bacteria | 2638 |
| 1319 | Ga0501080_0120697 | 3300049742 | Bacteria | 2429 |
| 1320 | Ga0501080_0141304 | 3300049742 | Bacteria | 2225 |
| 1321 | Ga0501080_0192858 | 3300049742 | Bacteria | 1872 |
| 1322 | Ga0501080_0195626 | 3300049742 | Bacteria | 1857 |
| 1323 | Ga0501080_0252355 | 3300049742 | Bacteria | 1608 |
| 1324 | Ga0501081_0037837 | 3300049743 | Bacteria | 3293 |
| 1325 | Ga0501081_0340171 | 3300049743 | Bacteria | 1105 |
| 1326 | Ga0501083_0005155 | 3300049744 | Bacteria | 9248 |
| 1327 | Ga0501083_0007861 | 3300049744 | Bacteria | 7555 |
| 1328 | Ga0501083_0069494 | 3300049744 | Bacteria | 2343 |
| 1329 | Ga0501083_0089375 | 3300049744 | Bacteria | 2035 |
| 1330 | Ga0501083_0153487 | 3300049744 | Bacteria | 1507 |
| 1331 | Ga0501083_0173655 | 3300049744 | Bacteria | 1408 |
| 1332 | Ga0501083_0189767 | 3300049744 | Bacteria | 1341 |
| 1333 | Ga0501035_0000049 | 3300049822 | Bacteria | 145684 |
| 1334 | Ga0501035_0009112 | 3300049822 | Bacteria | 9229 |
| 1335 | Ga0501035_0066191 | 3300049822 | Bacteria | 3207 |
| 1336 | Ga0501035_0114320 | 3300049822 | Bacteria | 2364 |
| 1337 | Ga0501035_0154350 | 3300049822 | Bacteria | 1990 |
| 1338 | Ga0501035_0308204 | 3300049822 | Bacteria | 1332 |
| 1339 | Ga0501035_0319945 | 3300049822 | Bacteria | 1303 |
| 1340 | Ga0501035_0364767 | 3300049822 | Bacteria | 1207 |
| 1341 | Ga0501035_0395512 | 3300049822 | Bacteria | 1150 |
| 1342 | Ga0501035_0515190 | 3300049822 | Bacteria | 983 |
| 1343 | Ga0501044_0000030 | 3300049823 | Bacteria | 173442 |
| 1344 | Ga0501044_0009814 | 3300049823 | Bacteria | 10410 |
| 1345 | Ga0501044_0012437 | 3300049823 | Bacteria | 9216 |
| 1346 | Ga0501044_0025827 | 3300049823 | Bacteria | 6226 |
| 1347 | Ga0501044_0038683 | 3300049823 | Bacteria | 4980 |
| 1348 | Ga0501044_0047781 | 3300049823 | Bacteria | 4425 |
| 1349 | Ga0501044_0105973 | 3300049823 | Bacteria | 2823 |
| 1350 | Ga0501044_0112290 | 3300049823 | Bacteria | 2732 |
| 1351 | Ga0501044_0134695 | 3300049823 | Bacteria | 2462 |
| 1352 | Ga0501044_0221588 | 3300049823 | Bacteria | 1842 |
| 1353 | Ga0501044_0240549 | 3300049823 | Bacteria | 1754 |
| 1354 | Ga0501044_0270613 | 3300049823 | Bacteria | 1634 |
| 1355 | Ga0501044_0270633 | 3300049823 | Bacteria | 1634 |
| 1356 | Ga0501044_0319912 | 3300049823 | Bacteria | 1476 |
| 1357 | Ga0501044_0567542 | 3300049823 | Bacteria | 1030 |
| 1358 | Ga0501044_0606765 | 3300049823 | Bacteria | 987 |
| 1359 | Ga0501044_0670392 | 3300049823 | Bacteria | 925 |
| 1360 | Ga0501044_0958395 | 3300049823 | Bacteria | 728 |
| 1361 | Ga0501045_0279644 | 3300049824 | Bacteria | 1242 |
| 1362 | Ga0501045_0313307 | 3300049824 | Bacteria | 1168 |
| 1363 | nmdc:mga03683_48038_c1 | 3300050489 | Bacteria | 1773 |
| 1364 | nmdc:mga03683_75618_c1 | 3300050489 | Bacteria | 1446 |
| 1365 | nmdc:mga03683_82571_c1 | 3300050489 | Bacteria | 1390 |
| 1366 | nmdc:mga03n38_254379_c1 | 3300050490 | Bacteria | 929 |
| 1367 | nmdc:mga03n38_49750_c1 | 3300050490 | Bacteria | 1865 |
| 1368 | nmdc:mga03n38_54352_c1 | 3300050490 | Bacteria | 1799 |
| 1369 | nmdc:mga00v17_378837_c1 | 3300050491 | Bacteria | 920 |
| 1370 | nmdc:mga0yw44_154723_c1 | 3300050492 | Bacteria | 1498 |
| 1371 | nmdc:mga0yw44_548616_c1 | 3300050492 | Bacteria | 785 |
| 1372 | nmdc:mga0k408_184073_c1 | 3300050493 | Bacteria | 1038 |
| 1373 | nmdc:mga0k408_438662_c1 | 3300050493 | Bacteria | 776 |
| 1374 | nmdc:mga0k408_64856_c1 | 3300050493 | Bacteria | 2125 |
| 1375 | nmdc:mga06z11_11573_c1 | 3300050494 | Bacteria | 3810 |
| 1376 | nmdc:mga06z11_172515_c1 | 3300050494 | Bacteria | 1243 |
| 1377 | nmdc:mga06z11_193635_c1 | 3300050494 | Bacteria | 1178 |
| 1378 | nmdc:mga06z11_7800_c1 | 3300050494 | Bacteria | 4425 |
| 1379 | nmdc:mga06z11_88861_c1 | 3300050494 | Bacteria | 1674 |
| 1380 | nmdc:mga04h51_228231_c1 | 3300050495 | Bacteria | 740 |
| 1381 | nmdc:mga04h51_2557_c1 | 3300050495 | Bacteria | 4330 |
| 1382 | nmdc:mga04h51_39200_c1 | 3300050495 | Bacteria | 1538 |
| 1383 | nmdc:mga07m45_293771_c1 | 3300050496 | Bacteria | 945 |
| 1384 | nmdc:mga07m45_46066_c1 | 3300050496 | Bacteria | 2449 |
| 1385 | nmdc:mga05p37_302707_c1 | 3300050507 | Bacteria | 1899 |
| 1386 | nmdc:mga05p37_45327_c1 | 3300050507 | Bacteria | 5409 |
| 1387 | nmdc:mga09592_127947_c1 | 3300050508 | Bacteria | 2184 |
| 1388 | nmdc:mga09592_515874_c1 | 3300050508 | Bacteria | 1028 |
| 1389 | nmdc:mga0qj67_256212_c1 | 3300050509 | Bacteria | 1420 |
| 1390 | nmdc:mga0qj67_409668_c1 | 3300050509 | Bacteria | 1094 |
| 1391 | nmdc:mga0qj67_556764_c1 | 3300050509 | Bacteria | 919 |
| 1392 | nmdc:mga06r32_308819_c1 | 3300050510 | Bacteria | 1567 |
| 1393 | nmdc:mga06r32_319636_c1 | 3300050510 | Bacteria | 1538 |
| 1394 | nmdc:mga06r32_660_c1 | 3300050510 | Bacteria | 30156 |
| 1395 | nmdc:mga08y16_44765_c1 | 3300050511 | Bacteria | 4639 |
| 1396 | nmdc:mga08y16_48086_c1 | 3300050511 | Bacteria | 4464 |
| 1397 | nmdc:mga08y16_95891_c1 | 3300050511 | Bacteria | 3089 |
| 1398 | nmdc:mga08y16_9879_c2 | 3300050511 | Bacteria | 6288 |
| 1399 | nmdc:mga0n895_108252_c1 | 3300050512 | Bacteria | 2793 |
| 1400 | nmdc:mga0n895_256768_c1 | 3300050512 | Bacteria | 1774 |
| 1401 | nmdc:mga0n895_6552_c1 | 3300050512 | Bacteria | 9908 |
| 1402 | nmdc:mga0rr50_142937_c1 | 3300050513 | Bacteria | 1926 |
| 1403 | nmdc:mga0rr50_906157_c1 | 3300050513 | Bacteria | 752 |
| 1404 | nmdc:mga08x19_659813_c1 | 3300050514 | Bacteria | 742 |
| 1405 | nmdc:mga08x19_67568_c1 | 3300050514 | Bacteria | 2325 |
| 1406 | nmdc:mga0a205_19999_c1 | 3300050515 | Bacteria | 6316 |
| 1407 | nmdc:mga0a205_309643_c1 | 3300050515 | Bacteria | 1451 |
| 1408 | nmdc:mga0a205_359137_c1 | 3300050515 | Bacteria | 1323 |
| 1409 | Ga0495601_0000025 | 3300053077 | Bacteria | 127736 |
| 1410 | Ga0495601_0004742 | 3300053077 | Bacteria | 7882 |
| 1411 | Ga0495601_0007365 | 3300053077 | Bacteria | 6453 |
| 1412 | Ga0495601_0571614 | 3300053077 | Bacteria | 726 |
| 1413 | Ga0495612_0000570 | 3300053078 | Bacteria | 14844 |
| 1414 | Ga0495612_0065130 | 3300053078 | Bacteria | 1513 |
| 1415 | Ga0495595_0000041 | 3300053084 | Bacteria | 67592 |
| 1416 | Ga0495595_0000532 | 3300053084 | Bacteria | 14535 |
| 1417 | Ga0495595_0050071 | 3300053084 | Bacteria | 1933 |
| 1418 | Ga0495619_0000035 | 3300053085 | Bacteria | 126262 |
| 1419 | Ga0495619_0015650 | 3300053085 | Bacteria | 4801 |
| 1420 | Ga0495619_0023651 | 3300053085 | Bacteria | 3940 |
| 1421 | Ga0495619_0043000 | 3300053085 | Bacteria | 2960 |
| 1422 | Ga0495619_0102264 | 3300053085 | Bacteria | 1951 |
| 1423 | Ga0495619_0164189 | 3300053085 | Bacteria | 1534 |
| 1424 | Ga0500644_0051127 | 3300053088 | Bacteria | 1418 |
| 1425 | Ga0500646_0015556 | 3300053090 | Bacteria | 1982 |
| 1426 | Ga0500651_0106102 | 3300053093 | Bacteria | 1718 |
| 1427 | Ga0500651_0480787 | 3300053093 | Bacteria | 687 |
| 1428 | Ga0500566_0118293 | 3300053094 | Bacteria | 1432 |
| 1429 | Ga0500650_0090052 | 3300053098 | Bacteria | 1436 |
| 1430 | Ga0500660_119651 | 3300053100 | Bacteria | 1100 |
| 1431 | Ga0500556_0004256 | 3300053104 | Bacteria | 4087 |
| 1432 | Ga0500556_0080600 | 3300053104 | Bacteria | 1230 |
| 1433 | Ga0500562_067283 | 3300053108 | Bacteria | 966 |
| 1434 | Ga0500595_012563 | 3300053119 | Bacteria | 3271 |
| 1435 | Ga0500595_037259 | 3300053119 | Bacteria | 1587 |
| 1436 | Ga0500642_0123679 | 3300053130 | Bacteria | 1211 |
| 1437 | Ga0500642_0149283 | 3300053130 | Bacteria | 1097 |
| 1438 | Ga0500652_077263 | 3300053131 | Bacteria | 1384 |
| 1439 | Ga0500559_0093124 | 3300053136 | Bacteria | 1381 |
| 1440 | Ga0500568_0005226 | 3300053139 | Bacteria | 6757 |
| 1441 | Ga0500568_0069253 | 3300053139 | Bacteria | 1353 |
| 1442 | Ga0500616_0006596 | 3300053153 | Bacteria | 7567 |
| 1443 | Ga0500616_0008552 | 3300053153 | Bacteria | 6340 |
| 1444 | Ga0500636_0009188 | 3300053177 | Bacteria | 5746 |
| 1445 | Ga0500636_0104324 | 3300053177 | Bacteria | 1608 |
| 1446 | Ga0501084_0030403 | 3300054114 | Bacteria | 4516 |
| 1447 | Ga0501084_0056561 | 3300054114 | Bacteria | 3282 |
| 1448 | Ga0501084_0127379 | 3300054114 | Bacteria | 2143 |
| 1449 | Ga0501084_0384940 | 3300054114 | Bacteria | 1185 |
| 1450 | Ga0501084_0456416 | 3300054114 | Bacteria | 1080 |
| 1451 | Ga0501084_0526693 | 3300054114 | Bacteria | 999 |
| 1452 | Ga0501084_0552116 | 3300054114 | Bacteria | 973 |
| 1453 | Ga0501084_1046184 | 3300054114 | Bacteria | 686 |
| 1454 | Ga0501082_0016074 | 3300060353 | Bacteria | 6437 |
| 1455 | Ga0501082_0029096 | 3300060353 | Bacteria | 4759 |
| 1456 | Ga0501082_0051771 | 3300060353 | Bacteria | 3539 |
| 1457 | Ga0501082_0108726 | 3300060353 | Bacteria | 2400 |
| 1458 | Ga0501082_0121530 | 3300060353 | Bacteria | 2263 |
| 1459 | Ga0501082_0144090 | 3300060353 | Bacteria | 2068 |
| 1460 | Ga0501082_0398918 | 3300060353 | Bacteria | 1200 |
| 1461 | Ga0501082_0453223 | 3300060353 | Bacteria | 1121 |
| 1462 | Ga0501082_0527424 | 3300060353 | Bacteria | 1032 |
| 1463 | Ga0501082_0696047 | 3300060353 | Bacteria | 889 |
| 1464 | Ga0501082_0800181 | 3300060353 | Bacteria | 825 |
| 1465 | Ga0501082_1070944 | 3300060353 | Bacteria | 705 |
| 1466 | Ga0501082_1191963 | 3300060353 | Bacteria | 665 |
| 1467 | Ga0530510_0110704 | 3300061734 | Bacteria | 2011 |
| 1468 | Ga0530510_0231465 | 3300061734 | Bacteria | 1375 |
| 1469 | 2513594051 | 2513237087 | Bacteria | 5817514 |
| 1470 | 2643755780 | 2643221547 | Bacteria | 4740017 |
| 1471 | 2643963619 | 2643221591 | Bacteria | 4397626 |
| 1472 | 2644165902 | 2643221629 | Bacteria | 5850260 |
| 1473 | 2644287953 | 2643221651 | Bacteria | 4798932 |
| 1474 | 2644347088 | 2643221662 | Bacteria | 5851492 |
| 1475 | 2644747757 | 2643221736 | Bacteria | 6608466 |
| 1476 | 2671694507 | 2671180139 | Bacteria | 4196045 |
| 1477 | 2828310147 | 2828305725 | Bacteria | 4916900 |
| 1478 | 2889311570 | 2889306138 | Bacteria | 6358934 |
| 1479 | 2902411803 | 2902405164 | Bacteria | 6784948 |
| 1480 | 2909043597 | 2909042592 | Bacteria | 6499737 |
| 1481 | 2917699266 | 2917699015 | Bacteria | 7043791 |
| 1482 | 2939671392 | 2939669807 | Bacteria | 5028511 |
| 1483 | 8002061398 | 8002060224 | Bacteria | 4026565 |
| 1484 | Ga0105247_10072723 | |||
| 1485 | 2214820216 | |||
| 1486 | ARcpr5oldR_c000035 | |||
| 1487 | ARcpr5oldR_c003327 | |||
| 1488 | ARSoilYngRDRAFT_c00061 | |||
| 1489 | ARcpr5yngRDRAFT_c000212 | |||
| 1490 | ARcpr5yngRDRAFT_c001457 | |||
| 1491 | ARSoilOldRDRAFT_c000208 | |||
| 1492 | ARSoilOldRDRAFT_c001089 | |||
| 1493 | ARCol0oldRDRAFT_c00767 | |||
| 1494 | ARCol0yngRDRAFT_1000025 | |||
| 1495 | JGI24752J21851_1005432 | |||
| 1496 | JGI24746J21847_1000313 | |||
| 1497 | JGI24740J21852_10033527 | |||
| 1498 | JGI24739J22299_10001271 | |||
| 1499 | JGI24739J22299_10097892 | |||
| 1500 | JGI24737J22298_10002998 | |||
| 1501 | JGI24737J22298_10007299 | |||
| 1502 | JGI24737J22298_10008806 | |||
| 1503 | JGI24737J22298_10020339 | |||
| 1504 | JGI24743J22301_10002158 | |||
| 1505 | JGI24735J21928_10012540 | |||
| 1506 | JGI24750J21931_1001136 | |||
| 1507 | JGI24750J21931_1037024 | |||
| 1508 | JGI24745J21846_1000034 | |||
| 1509 | JGI24745J21846_1000277 | |||
| 1510 | JGI24748J21848_1000741 | |||
| 1511 | JGI24749J21850_1002096 | |||
| 1512 | JGI24744J21845_10000241 | |||
| 1513 | JGI24035J26624_1000089 | |||
| 1514 | JGI24034J26672_10021074 | |||
| 1515 | JGI24742J22300_10000465 | |||
| 1516 | JGI24751J29686_10015322 | |||
| 1517 | JGI24751J29686_10056778 | |||
| 1518 | JGI25165J46597_1000961 | |||
| 1519 | Ga0055526_1033563 | |||
| 1520 | JGI25405J52794_10040823 | |||
| 1521 | Ga0065716_1002185 | |||
| 1522 | Ga0065704_10093450 | |||
| 1523 | Ga0065712_10073769 | |||
| 1524 | Ga0065712_10112498 | |||
| 1525 | Ga0065715_10002813 | |||
| 1526 | Ga0065715_10009083 | |||
| 1527 | Ga0065707_10155627 | |||
| 1528 | Ga0070676_10001242 | |||
| 1529 | Ga0070683_100002064 | |||
| 1530 | Ga0070683_100023089 | |||
| 1531 | Ga0070683_100335946 | |||
| 1532 | Ga0070683_101197940 | |||
| 1533 | Ga0070690_100013717 | |||
| 1534 | Ga0070690_100020216 | |||
| 1535 | Ga0070690_100213076 | |||
| 1536 | Ga0070670_100006103 | |||
| 1537 | Ga0070670_100036557 | |||
| 1538 | Ga0070677_10003234 | |||
| 1539 | Ga0070677_10152049 | |||
| 1540 | Ga0068869_100000755 | |||
| 1541 | Ga0068869_100786912 | |||
| 1542 | Ga0070666_10144097 | |||
| 1543 | Ga0070666_10172384 | |||
| 1544 | Ga0070666_10318343 | |||
| 1545 | Ga0070680_100013921 | |||
| 1546 | Ga0070680_100052638 | |||
| 1547 | Ga0070680_100052655 | |||
| 1548 | Ga0070680_100076449 | |||
| 1549 | Ga0070680_100084451 | |||
| 1550 | Ga0070680_100232973 | |||
| 1551 | Ga0070682_100000693 | |||
| 1552 | Ga0070682_100009142 | |||
| 1553 | Ga0070682_100067778 | |||
| 1554 | Ga0070682_100077207 | |||
| 1555 | Ga0068868_100026839 | |||
| 1556 | Ga0068868_100043374 | |||
| 1557 | Ga0068868_100262925 | |||
| 1558 | Ga0070660_100004264 | |||
| 1559 | Ga0070660_100019097 | |||
| 1560 | Ga0070660_100061814 | |||
| 1561 | Ga0070660_100194015 | |||
| 1562 | Ga0070660_100678355 | |||
| 1563 | Ga0070689_100018438 | |||
| 1564 | Ga0070689_100051585 | |||
| 1565 | Ga0070689_100643822 | |||
| 1566 | Ga0070691_10007803 | |||
| 1567 | Ga0070691_10039574 | |||
| 1568 | Ga0070691_10172836 | |||
| 1569 | Ga0070687_100000768 | |||
| 1570 | Ga0070687_100017582 | |||
| 1571 | Ga0070687_100080418 | |||
| 1572 | Ga0070661_100006236 | |||
| 1573 | Ga0070661_100224434 | |||
| 1574 | Ga0070661_100267705 | |||
| 1575 | Ga0070661_100386150 | |||
| 1576 | Ga0070692_10019783 | |||
| 1577 | Ga0070668_100002043 | |||
| 1578 | Ga0070668_100332644 | |||
| 1579 | Ga0070669_100004204 | |||
| 1580 | Ga0070669_100056953 | |||
| 1581 | Ga0070669_100523038 | |||
| 1582 | Ga0070675_100004033 | |||
| 1583 | Ga0070675_100096029 | |||
| 1584 | Ga0070675_100142778 | |||
| 1585 | Ga0070675_100371447 | |||
| 1586 | Ga0070671_100029434 | |||
| 1587 | Ga0070671_100145487 | |||
| 1588 | Ga0070671_100209226 | |||
| 1589 | Ga0070674_100001294 | |||
| 1590 | Ga0070674_100249892 | |||
| 1591 | Ga0070674_100386599 | |||
| 1592 | Ga0070673_100002364 | |||
| 1593 | Ga0070673_100175789 | |||
| 1594 | Ga0070673_100619208 | |||
| 1595 | Ga0070688_100012304 | |||
| 1596 | Ga0070688_100019070 | |||
| 1597 | Ga0070688_100447015 | |||
| 1598 | Ga0070659_100005048 | |||
| 1599 | Ga0070659_100045894 | |||
| 1600 | Ga0070659_100057149 | |||
| 1601 | Ga0070659_100175959 | |||
| 1602 | Ga0070659_100190290 | |||
| 1603 | Ga0070659_100252566 | |||
| 1604 | Ga0070659_100638282 | |||
| 1605 | Ga0070667_100010781 | |||
| 1606 | Ga0070667_100139919 | |||
| 1607 | Ga0070667_100155731 | |||
| 1608 | Ga0070667_101117153 | |||
| 1609 | Ga0070703_10045405 | |||
| 1610 | Ga0070709_10064061 | |||
| 1611 | Ga0070709_10180561 | |||
| 1612 | Ga0070714_100148074 | |||
| 1613 | Ga0070713_100051698 | |||
| 1614 | Ga0070713_100060535 | |||
| 1615 | Ga0070713_100171196 | |||
| 1616 | Ga0070710_10014954 | |||
| 1617 | Ga0070710_10052773 | |||
| 1618 | Ga0070710_10070107 | |||
| 1619 | Ga0070701_10012548 | |||
| 1620 | Ga0070701_10137536 | |||
| 1621 | Ga0070701_10227360 | |||
| 1622 | Ga0070711_100027798 | |||
| 1623 | Ga0070711_100045777 | |||
| 1624 | Ga0070711_100148495 | |||
| 1625 | Ga0070711_100256941 | |||
| 1626 | Ga0070705_100001981 | |||
| 1627 | Ga0070705_100023843 | |||
| 1628 | Ga0070705_100048908 | |||
| 1629 | Ga0070705_100266449 | |||
| 1630 | Ga0070700_100010431 | |||
| 1631 | Ga0070700_100017413 | |||
| 1632 | Ga0070694_100007138 | |||
| 1633 | Ga0070694_100010924 | |||
| 1634 | Ga0070694_100013142 | |||
| 1635 | Ga0070663_100010153 | |||
| 1636 | Ga0070663_100028446 | |||
| 1637 | Ga0070663_100050961 | |||
| 1638 | Ga0070663_100271074 | |||
| 1639 | Ga0070663_100509440 | |||
| 1640 | Ga0070663_100511528 | |||
| 1641 | Ga0070678_100004700 | |||
| 1642 | Ga0070678_100010048 | |||
| 1643 | Ga0070678_100237716 | |||
| 1644 | Ga0070678_100301998 | |||
| 1645 | Ga0070678_100375070 | |||
| 1646 | Ga0070662_100007011 | |||
| 1647 | Ga0070662_100024005 | |||
| 1648 | Ga0070662_100135464 | |||
| 1649 | Ga0070662_100145370 | |||
| 1650 | Ga0070681_10010029 | |||
| 1651 | Ga0070681_10029025 | |||
| 1652 | Ga0070681_10078949 | |||
| 1653 | Ga0070681_10079820 | |||
| 1654 | Ga0070681_10183807 | |||
| 1655 | Ga0070681_10394065 | |||
| 1656 | Ga0068867_100003543 | |||
| 1657 | Ga0068867_100037405 | |||
| 1658 | Ga0068867_100077308 | |||
| 1659 | Ga0070685_10005750 | |||
| 1660 | Ga0070685_10086009 | |||
| 1661 | Ga0070706_100100968 | |||
| 1662 | Ga0070698_100149346 | |||
| 1663 | Ga0070679_100049456 | |||
| 1664 | Ga0070679_100058331 | |||
| 1665 | Ga0070679_100069873 | |||
| 1666 | Ga0070679_100155434 | |||
| 1667 | Ga0070679_100239219 | |||
| 1668 | Ga0070684_100007624 | |||
| 1669 | Ga0070684_100309342 | |||
| 1670 | Ga0070697_100058906 | |||
| 1671 | Ga0070697_100597675 | |||
| 1672 | Ga0068853_100006917 | |||
| 1673 | Ga0068853_100023191 | |||
| 1674 | Ga0068853_100026550 | |||
| 1675 | Ga0068853_100089524 | |||
| 1676 | Ga0068853_100117767 | |||
| 1677 | Ga0068853_100289310 | |||
| 1678 | Ga0068853_100316564 | |||
| 1679 | Ga0070672_100002637 | |||
| 1680 | Ga0070672_100687094 | |||
| 1681 | Ga0070672_100792201 | |||
| 1682 | Ga0070672_100807708 | |||
| 1683 | Ga0070686_100004029 | |||
| 1684 | Ga0070686_100109614 | |||
| 1685 | Ga0070686_100212365 | |||
| 1686 | Ga0070686_100365633 | |||
| 1687 | Ga0070686_100398877 | |||
| 1688 | Ga0070695_100014423 | |||
| 1689 | Ga0070695_100039405 | |||
| 1690 | Ga0070695_100869083 | |||
| 1691 | Ga0070696_100010916 | |||
| 1692 | Ga0070696_100062849 | |||
| 1693 | Ga0070696_100134946 | |||
| 1694 | Ga0070696_100233202 | |||
| 1695 | Ga0070696_100667072 | |||
| 1696 | Ga0070693_100010280 | |||
| 1697 | Ga0070693_100112590 | |||
| 1698 | Ga0070693_100283061 | |||
| 1699 | Ga0070665_100054832 | |||
| 1700 | Ga0070665_100128255 | |||
| 1701 | Ga0070665_100576621 | |||
| 1702 | Ga0070704_100004936 | |||
| 1703 | Ga0070704_100044766 | |||
| 1704 | Ga0070704_100174040 | |||
| 1705 | Ga0068855_100041438 | |||
| 1706 | Ga0068855_100076631 | |||
| 1707 | Ga0068855_100093513 | |||
| 1708 | Ga0068855_100209628 | |||
| 1709 | Ga0068855_100399007 | |||
| 1710 | Ga0068855_100791206 | |||
| 1711 | Ga0070664_100004534 | |||
| 1712 | Ga0070664_100066218 | |||
| 1713 | Ga0070664_100153248 | |||
| 1714 | Ga0070664_100376882 | |||
| 1715 | Ga0070664_100583807 | |||
| 1716 | Ga0068857_100006037 | |||
| 1717 | Ga0068857_100099806 | |||
| 1718 | Ga0068857_100171780 | |||
| 1719 | Ga0068857_100175405 | |||
| 1720 | Ga0068857_100209278 | |||
| 1721 | Ga0068854_100006037 | |||
| 1722 | Ga0068854_100076978 | |||
| 1723 | Ga0068854_100281861 | |||
| 1724 | Ga0068854_100520613 | |||
| 1725 | Ga0068854_100930728 | |||
| 1726 | Ga0068856_100008706 | |||
| 1727 | Ga0068856_100105907 | |||
| 1728 | Ga0068856_100106131 | |||
| 1729 | Ga0068856_100165589 | |||
| 1730 | Ga0068856_100605523 | |||
| 1731 | Ga0068856_100731067 | |||
| 1732 | Ga0070702_100000378 | |||
| 1733 | Ga0070702_100009357 | |||
| 1734 | Ga0070702_100334133 | |||
| 1735 | Ga0068852_100017082 | |||
| 1736 | Ga0068852_100141603 | |||
| 1737 | Ga0068852_100264197 | |||
| 1738 | Ga0068852_100372300 | |||
| 1739 | Ga0068859_100007402 | |||
| 1740 | Ga0068859_100029393 | |||
| 1741 | Ga0068859_100120397 | |||
| 1742 | Ga0068864_100000595 | |||
| 1743 | Ga0068864_100274594 | |||
| 1744 | Ga0068864_100327081 | |||
| 1745 | Ga0068866_10000834 | |||
| 1746 | Ga0068866_10512607 | |||
| 1747 | Ga0068861_100002973 | |||
| 1748 | Ga0068861_100189622 | |||
| 1749 | Ga0068861_100587738 | |||
| 1750 | Ga0068861_100610490 | |||
| 1751 | Ga0068851_10037994 | |||
| 1752 | Ga0068851_10052847 | |||
| 1753 | Ga0068851_10263122 | |||
| 1754 | Ga0068870_10000216 | |||
| 1755 | Ga0068870_10728866 | |||
| 1756 | Ga0068863_100022557 | |||
| 1757 | Ga0068863_101462135 | |||
| 1758 | Ga0068858_100024760 | |||
| 1759 | Ga0068858_100153137 | |||
| 1760 | Ga0068858_100177076 | |||
| 1761 | Ga0068858_100254749 | |||
| 1762 | Ga0068860_100007174 | |||
| 1763 | Ga0068860_100274265 | |||
| 1764 | Ga0068860_100672172 | |||
| 1765 | Ga0068862_100017504 | |||
| 1766 | Ga0068862_100018639 | |||
| 1767 | Ga0068862_100875688 | |||
| 1768 | Ga0081455_10000048 | |||
| 1769 | Ga0081540_1007553 | |||
| 1770 | Ga0070717_10130640 | |||
| 1771 | Ga0070717_10527301 | |||
| 1772 | Ga0070717_10838447 | |||
| 1773 | Ga0075365_10377161 | |||
| 1774 | Ga0075363_100033628 | |||
| 1775 | Ga0075364_10028265 | |||
| 1776 | Ga0070715_10011926 | |||
| 1777 | Ga0070715_10050851 | |||
| 1778 | Ga0070715_10086181 | |||
| 1779 | Ga0070712_100052884 | |||
| 1780 | Ga0070712_100092034 | |||
| 1781 | Ga0070712_100127948 | |||
| 1782 | Ga0070712_100472287 | |||
| 1783 | Ga0075362_10056472 | |||
| 1784 | Ga0075367_10028327 | |||
| 1785 | Ga0075367_10068874 | |||
| 1786 | Ga0075367_10224145 | |||
| 1787 | Ga0075367_10224329 | |||
| 1788 | Ga0075369_10015315 | |||
| 1789 | Ga0075369_10147796 | |||
| 1790 | Ga0075366_10029773 | |||
| 1791 | Ga0075366_10168285 | |||
| 1792 | Ga0075366_10234544 | |||
| 1793 | Ga0097621_100000600 | |||
| 1794 | Ga0097621_100042187 | |||
| 1795 | Ga0097621_100892556 | |||
| 1796 | Ga0075370_10046577 | |||
| 1797 | Ga0075370_10240538 | |||
| 1798 | Ga0068871_100000118 | |||
| 1799 | Ga0068871_100181189 | |||
| 1800 | Ga0068871_100182502 | |||
| 1801 | Ga0075428_100161072 | |||
| 1802 | Ga0075430_100102806 | |||
| 1803 | Ga0075431_100004125 | |||
| 1804 | Ga0075431_100123156 | |||
| 1805 | Ga0075431_100180851 | |||
| 1806 | Ga0075431_100453776 | |||
| 1807 | Ga0075433_10104991 | |||
| 1808 | Ga0075434_100051111 | |||
| 1809 | Ga0075434_100620498 | |||
| 1810 | Ga0075429_100065551 | |||
| 1811 | Ga0068865_100007181 | |||
| 1812 | Ga0068865_100062519 | |||
| 1813 | Ga0068865_100212159 | |||
| 1814 | Ga0068865_100410156 | |||
| 1815 | Ga0075436_100289370 | |||
| 1816 | Ga0097620_100007402 | |||
| 1817 | Ga0097620_100029394 | |||
| 1818 | Ga0097620_100120404 | |||
| 1819 | Ga0097620_100298643 | |||
| 1820 | Ga0099794_10277287 | |||
| 1821 | Ga0099794_10291468 | |||
| 1822 | Ga0099795_10216884 | |||
| 1823 | Ga0105251_10011425 | |||
| 1824 | Ga0105244_10037290 | |||
| 1825 | Ga0105250_10022202 | |||
| 1826 | Ga0105250_10111300 | |||
| 1827 | Ga0105240_10011051 | |||
| 1828 | Ga0105240_10133003 | |||
| 1829 | Ga0105240_10328274 | |||
| 1830 | Ga0105240_10685963 | |||
| 1831 | Ga0105240_10808535 | |||
| 1832 | Ga0105240_10818346 | |||
| 1833 | Ga0111539_10010079 | |||
| 1834 | Ga0111539_10080440 | |||
| 1835 | Ga0111539_10119168 | |||
| 1836 | Ga0105245_10017665 | |||
| 1837 | Ga0105245_10072236 | |||
| 1838 | Ga0105245_11016557 | |||
| 1839 | Ga0105245_11109512 | |||
| 1840 | Ga0105247_10156301 | |||
| 1841 | Ga0105247_10173630 | |||
| 1842 | Ga0114129_10366058 | |||
| 1843 | Ga0105243_10009969 | |||
| 1844 | Ga0105243_10068588 | |||
| 1845 | Ga0105243_10348654 | |||
| 1846 | Ga0105243_10799371 | |||
| 1847 | Ga0105241_10064717 | |||
| 1848 | Ga0105241_10079658 | |||
| 1849 | Ga0105241_10142659 | |||
| 1850 | Ga0105241_10211682 | |||
| 1851 | Ga0105241_10326504 | |||
| 1852 | Ga0105242_10016828 | |||
| 1853 | Ga0105242_10078822 | |||
| 1854 | Ga0105248_10114304 | |||
| 1855 | Ga0105248_10243143 | |||
| 1856 | Ga0105237_10027530 | |||
| 1857 | Ga0105237_10041848 | |||
| 1858 | Ga0105237_10066669 | |||
| 1859 | Ga0105237_10355757 | |||
| 1860 | Ga0105237_10394223 | |||
| 1861 | Ga0105238_10025155 | |||
| 1862 | Ga0105238_10070568 | |||
| 1863 | Ga0105238_10110641 | |||
| 1864 | Ga0105238_10286485 | |||
| 1865 | Ga0105238_10641453 | |||
| 1866 | Ga0105249_10023350 | |||
| 1867 | Ga0105249_11544874 | |||
| 1868 | Ga0105035_101192 | |||
| 1869 | Ga0099796_10209839 | |||
| 1870 | Ga0105239_10052904 | |||
| 1871 | Ga0105239_10057391 | |||
| 1872 | Ga0105239_10090514 | |||
| 1873 | Ga0105239_10162528 | |||
| 1874 | Ga0105239_10408427 | |||
| 1875 | Ga0105239_10572363 | |||
| 1876 | Ga0105239_11658294 | |||
| 1877 | Ga0105246_10002558 | |||
| 1878 | Ga0105246_10004854 | |||
| 1879 | Ga0105246_10045899 | |||
| 1880 | Ga0105246_10479733 | |||
| 1881 | Ga0105246_11112431 | |||
| 1882 | Ga0157342_1021460 | |||
| 1883 | Ga0157338_1002157 | |||
| 1884 | Ga0157371_10057710 | |||
| 1885 | Ga0157370_10089027 | |||
| 1886 | Ga0157370_10093542 | |||
| 1887 | Ga0157370_10140549 | |||
| 1888 | Ga0157370_10302071 | |||
| 1889 | Ga0157369_10153459 | |||
| 1890 | Ga0157369_10388377 | |||
| 1891 | Ga0157374_10018401 | |||
| 1892 | Ga0157374_10115150 | |||
| 1893 | Ga0157378_10015153 | |||
| 1894 | Ga0157378_10165874 | |||
| 1895 | Ga0157378_10182088 | |||
| 1896 | Ga0157378_10183754 | |||
| 1897 | Ga0163162_10028695 | |||
| 1898 | Ga0163162_10289023 | |||
| 1899 | Ga0157372_10790476 | |||
| 1900 | Ga0157375_10007178 | |||
| 1901 | Ga0157375_10020813 | |||
| 1902 | Ga0163163_10002129 | |||
| 1903 | Ga0163163_10113766 | |||
| 1904 | Ga0163163_10240369 | |||
| 1905 | Ga0163163_10886414 | |||
| 1906 | Ga0157380_10021174 | |||
| 1907 | Ga0157380_11012547 | |||
| 1908 | Ga0157380_11679675 | |||
| 1909 | Ga0157377_10000628 | |||
| 1910 | Ga0157377_10292657 | |||
| 1911 | Ga0157377_10639224 | |||
| 1912 | Ga0157377_10727893 | |||
| 1913 | Ga0157379_10021324 | |||
| 1914 | Ga0157379_10085756 | |||
| 1915 | Ga0157379_10209261 | |||
| 1916 | Ga0157379_10610794 | |||
| 1917 | Ga0157376_10006966 | |||
| 1918 | Ga0182005_1006944 | |||
| 1919 | Ga0163161_10009359 | |||
| 1920 | Ga0163161_10224666 | |||
| 1921 | Ga0206354_10419390 | |||
| 1922 | Ga0206353_10593523 | |||
| 1923 | Ga0206353_11417346 | |||
| 1924 | Ga0213872_10023323 | |||
| 1925 | Ga0213874_10010979 | |||
| 1926 | Ga0213876_10019675 | |||
| 1927 | Ga0213875_10269195 | |||
| 1928 | Ga0207427_101449 | |||
| 1929 | Ga0209233_1000293 | |||
| 1930 | Ga0207666_1000185 | |||
| 1931 | Ga0207666_1004262 | |||
| 1932 | Ga0209564_1009622 | |||
| 1933 | Ga0209758_1006193 | |||
| 1934 | Ga0207697_10003861 | |||
| 1935 | Ga0207697_10018234 | |||
| 1936 | Ga0207656_10025078 | |||
| 1937 | Ga0207656_10365593 | |||
| 1938 | Ga0207713_1060865 | |||
| 1939 | Ga0207653_10200022 | |||
| 1940 | Ga0207682_10000350 | |||
| 1941 | Ga0207692_10043759 | |||
| 1942 | Ga0207642_10001478 | |||
| 1943 | Ga0207642_10047526 | |||
| 1944 | Ga0207710_10010087 | |||
| 1945 | Ga0207710_10118871 | |||
| 1946 | Ga0207688_10007287 | |||
| 1947 | Ga0207688_10020869 | |||
| 1948 | Ga0207688_10074491 | |||
| 1949 | Ga0207680_10293343 | |||
| 1950 | Ga0207680_10408714 | |||
| 1951 | Ga0207647_10030675 | |||
| 1952 | Ga0207647_10033853 | |||
| 1953 | Ga0207647_10055947 | |||
| 1954 | Ga0207647_10504708 | |||
| 1955 | Ga0207685_10006758 | |||
| 1956 | Ga0207699_10181090 | |||
| 1957 | Ga0207699_10339908 | |||
| 1958 | Ga0207645_10091158 | |||
| 1959 | Ga0207645_10111940 | |||
| 1960 | Ga0207645_10512605 | |||
| 1961 | Ga0207643_10000009 | |||
| 1962 | Ga0207705_10034426 | |||
| 1963 | Ga0207684_10583174 | |||
| 1964 | Ga0207654_10048041 | |||
| 1965 | Ga0207654_10074102 | |||
| 1966 | Ga0207654_10077388 | |||
| 1967 | Ga0207654_10222073 | |||
| 1968 | Ga0207707_10002337 | |||
| 1969 | Ga0207707_10004335 | |||
| 1970 | Ga0207707_10006091 | |||
| 1971 | Ga0207707_10022768 | |||
| 1972 | Ga0207707_10094574 | |||
| 1973 | Ga0207707_10188949 | |||
| 1974 | Ga0207695_10001032 | |||
| 1975 | Ga0207695_10063576 | |||
| 1976 | Ga0207695_10231339 | |||
| 1977 | Ga0207671_10050006 | |||
| 1978 | Ga0207671_10050376 | |||
| 1979 | Ga0207671_10063751 | |||
| 1980 | Ga0207671_10275241 | |||
| 1981 | Ga0207671_10313711 | |||
| 1982 | Ga0207671_10397280 | |||
| 1983 | Ga0207693_10015635 | |||
| 1984 | Ga0207693_10032195 | |||
| 1985 | Ga0207693_10200166 | |||
| 1986 | Ga0207693_10273432 | |||
| 1987 | Ga0207663_10115788 | |||
| 1988 | Ga0207663_10242235 | |||
| 1989 | Ga0207663_10418262 | |||
| 1990 | Ga0207660_10000197 | |||
| 1991 | Ga0207660_10001861 | |||
| 1992 | Ga0207660_10013609 | |||
| 1993 | Ga0207660_10053740 | |||
| 1994 | Ga0207662_10010568 | |||
| 1995 | Ga0207657_10022013 | |||
| 1996 | Ga0207657_10028527 | |||
| 1997 | Ga0207657_10053617 | |||
| 1998 | Ga0207657_10095224 | |||
| 1999 | Ga0207657_10152769 | |||
| 2000 | Ga0207649_10000052 | |||
| 2001 | Ga0207652_10004826 | |||
| 2002 | Ga0207652_10007272 | |||
| 2003 | Ga0207652_10031244 | |||
| 2004 | Ga0207646_10091324 | |||
| 2005 | Ga0207681_10001135 | |||
| 2006 | Ga0207694_10004393 | |||
| 2007 | Ga0207694_10030872 | |||
| 2008 | Ga0207694_10066558 | |||
| 2009 | Ga0207694_10233179 | |||
| 2010 | Ga0207694_10360149 | |||
| 2011 | Ga0207694_10382120 | |||
| 2012 | Ga0207650_10002693 | |||
| 2013 | Ga0207650_10114609 | |||
| 2014 | Ga0207659_10002396 | |||
| 2015 | Ga0207659_10039304 | |||
| 2016 | Ga0207687_10008117 | |||
| 2017 | Ga0207687_10248025 | |||
| 2018 | Ga0207700_10053321 | |||
| 2019 | Ga0207700_10341794 | |||
| 2020 | Ga0207664_10129801 | |||
| 2021 | Ga0207644_10000212 | |||
| 2022 | Ga0207644_10126457 | |||
| 2023 | Ga0207690_10001288 | |||
| 2024 | Ga0207690_10022305 | |||
| 2025 | Ga0207690_10354086 | |||
| 2026 | Ga0207706_10016311 | |||
| 2027 | Ga0207706_10054725 | |||
| 2028 | Ga0207706_10114771 | |||
| 2029 | Ga0207706_10558618 | |||
| 2030 | Ga0207706_10559097 | |||
| 2031 | Ga0207686_10002314 | |||
| 2032 | Ga0207709_10000530 | |||
| 2033 | Ga0207709_10143189 | |||
| 2034 | Ga0207709_10309407 | |||
| 2035 | Ga0207709_10337740 | |||
| 2036 | Ga0207670_10011341 | |||
| 2037 | Ga0207670_10015207 | |||
| 2038 | Ga0207670_10426113 | |||
| 2039 | Ga0207669_10000235 | |||
| 2040 | Ga0207669_10500208 | |||
| 2041 | Ga0207669_10568876 | |||
| 2042 | Ga0207704_10000198 | |||
| 2043 | Ga0207704_10094557 | |||
| 2044 | Ga0207665_10020388 | |||
| 2045 | Ga0207665_10188996 | |||
| 2046 | Ga0207665_10227822 | |||
| 2047 | Ga0207691_10013970 | |||
| 2048 | Ga0207691_10205069 | |||
| 2049 | Ga0207711_10084111 | |||
| 2050 | Ga0207711_10261975 | |||
| 2051 | Ga0207689_10000031 | |||
| 2052 | Ga0207689_10115687 | |||
| 2053 | Ga0207689_10290010 | |||
| 2054 | Ga0207689_10670124 | |||
| 2055 | Ga0207661_10003727 | |||
| 2056 | Ga0207661_10065582 | |||
| 2057 | Ga0207679_10000183 | |||
| 2058 | Ga0207679_10099127 | |||
| 2059 | Ga0207667_10002033 | |||
| 2060 | Ga0207667_10004001 | |||
| 2061 | Ga0207667_10027381 | |||
| 2062 | Ga0207667_10030652 | |||
| 2063 | Ga0207667_10037495 | |||
| 2064 | Ga0207667_10344172 | |||
| 2065 | Ga0207667_10811761 | |||
| 2066 | Ga0207651_10000051 | |||
| 2067 | Ga0207651_10146875 | |||
| 2068 | Ga0207651_11032784 | |||
| 2069 | Ga0207712_10001703 | |||
| 2070 | Ga0207712_10013885 | |||
| 2071 | Ga0207712_10243402 | |||
| 2072 | Ga0207712_11131360 | |||
| 2073 | Ga0207668_10001674 | |||
| 2074 | Ga0207640_10000343 | |||
| 2075 | Ga0207640_10024133 | |||
| 2076 | Ga0207640_10125861 | |||
| 2077 | Ga0207640_10209176 | |||
| 2078 | Ga0207658_10066787 | |||
| 2079 | Ga0207658_10157925 | |||
| 2080 | Ga0207658_10231914 | |||
| 2081 | Ga0207658_10362232 | |||
| 2082 | Ga0207677_10184979 | |||
| 2083 | Ga0207677_10609323 | |||
| 2084 | Ga0207703_10010733 | |||
| 2085 | Ga0207703_10073592 | |||
| 2086 | Ga0207703_10158890 | |||
| 2087 | Ga0207703_10387968 | |||
| 2088 | Ga0207639_10003883 | |||
| 2089 | Ga0207639_10022852 | |||
| 2090 | Ga0207639_10033916 | |||
| 2091 | Ga0207639_10231810 | |||
| 2092 | Ga0207639_10338014 | |||
| 2093 | Ga0207639_10812209 | |||
| 2094 | Ga0207678_10000118 | |||
| 2095 | Ga0207678_10005779 | |||
| 2096 | Ga0207678_10024280 | |||
| 2097 | Ga0207678_10043860 | |||
| 2098 | Ga0207678_10100765 | |||
| 2099 | Ga0207678_10276341 | |||
| 2100 | Ga0207678_10322186 | |||
| 2101 | Ga0207708_10014839 | |||
| 2102 | Ga0207708_10156799 | |||
| 2103 | Ga0207708_10444071 | |||
| 2104 | Ga0207708_10504586 | |||
| 2105 | Ga0207702_10000005 | |||
| 2106 | Ga0207702_10004643 | |||
| 2107 | Ga0207702_10117091 | |||
| 2108 | Ga0207702_10229342 | |||
| 2109 | Ga0207702_10298401 | |||
| 2110 | Ga0207702_10634731 | |||
| 2111 | Ga0207702_10937905 | |||
| 2112 | Ga0207641_10001831 | |||
| 2113 | Ga0207641_10067271 | |||
| 2114 | Ga0207641_11218845 | |||
| 2115 | Ga0207648_10025743 | |||
| 2116 | Ga0207648_10102108 | |||
| 2117 | Ga0207648_10358891 | |||
| 2118 | Ga0207676_10000124 | |||
| 2119 | Ga0207676_10297986 | |||
| 2120 | Ga0207674_10016004 | |||
| 2121 | Ga0207674_10092968 | |||
| 2122 | Ga0207674_10134546 | |||
| 2123 | Ga0207675_100029702 | |||
| 2124 | Ga0207675_100118832 | |||
| 2125 | Ga0207683_10000242 | |||
| 2126 | Ga0207683_10081510 | |||
| 2127 | Ga0207683_10283175 | |||
| 2128 | Ga0207683_10418060 | |||
| 2129 | Ga0207698_10010960 | |||
| 2130 | Ga0207698_10040510 | |||
| 2131 | Ga0207698_10164727 | |||
| 2132 | Ga0207698_10600989 | |||
| 2133 | Ga0207698_10986508 | |||
| 2134 | Ga0209967_1017369 | |||
| 2135 | Ga0209999_1027845 | |||
| 2136 | Ga0209970_1008675 | |||
| 2137 | Ga0210002_1001035 | |||
| 2138 | Ga0209588_1010113 | |||
| 2139 | Ga0209588_1177560 | |||
| 2140 | Ga0209971_1020522 | |||
| 2141 | Ga0209971_1056359 | |||
| 2142 | Ga0209966_1001282 | |||
| 2143 | Ga0209966_1008822 | |||
| 2144 | Ga0209998_10006463 | |||
| 2145 | Ga0209998_10010491 | |||
| 2146 | Ga0209813_10000406 | |||
| 2147 | Ga0209974_10173950 | |||
| 2148 | Ga0207428_10000037 | |||
| 2149 | Ga0207428_10013074 | |||
| 2150 | Ga0207428_10020203 | |||
| 2151 | Ga0207428_10427099 | |||
| 2152 | Ga0268266_10037309 | |||
| 2153 | Ga0268266_10199931 | |||
| 2154 | Ga0268266_10695436 | |||
| 2155 | Ga0268266_10746537 | |||
| 2156 | Ga0268265_10016165 | |||
| 2157 | Ga0268265_10050585 | |||
| 2158 | Ga0268265_10649900 | |||
| 2159 | Ga0268264_10003234 | |||
| 2160 | Ga0268264_10140651 | |||
| 2161 | Ga0268264_10475709 | |||
| 2162 | Ga0268264_10660566 | |||
| 2163 | Ga0265330_10106794 | |||
| 2164 | Ga0265332_10160585 | |||
| 2165 | Ga0265328_10000041 | |||
| 2166 | Ga0265328_10000129 | |||
| 2167 | Ga0265328_10012314 | |||
| 2168 | Ga0265328_10068299 | |||
| 2169 | Ga0265328_10094307 | |||
| 2170 | Ga0265325_10001071 | |||
| 2171 | Ga0265325_10015753 | |||
| 2172 | Ga0265325_10048742 | |||
| 2173 | Ga0265325_10112410 | |||
| 2174 | Ga0265329_10004194 | |||
| 2175 | Ga0265329_10047008 | |||
| 2176 | Ga0265340_10001769 | |||
| 2177 | Ga0265340_10006375 | |||
| 2178 | Ga0265340_10029957 | |||
| 2179 | Ga0265339_10002105 | |||
| 2180 | Ga0265331_10001125 | |||
| 2181 | Ga0265331_10140781 | |||
| 2182 | Ga0265327_10044157 | |||
| 2183 | Ga0265316_10016003 | |||
| 2184 | Ga0265316_10077926 | |||
| 2185 | Ga0307513_10028569 | |||
| 2186 | Ga0307509_10399384 | |||
| 2187 | Ga0265313_10000031 | |||
| 2188 | Ga0265313_10006263 | |||
| 2189 | Ga0265313_10032391 | |||
| 2190 | Ga0265313_10087196 | |||
| 2191 | Ga0307508_10193699 | |||
| 2192 | Ga0307508_10330085 | |||
| 2193 | Ga0265314_10004347 | |||
| 2194 | Ga0265342_10004137 | |||
| 2195 | Ga0265342_10024096 | |||
| 2196 | Ga0265342_10059693 | |||
| 2197 | Ga0265342_10065931 | |||
| 2198 | Ga0316576_10100701 | |||
| 2199 | Ga0316578_10158392 | |||
| 2200 | Ga0307516_10033588 | |||
| 2201 | Ga0307516_10126982 | |||
| 2202 | Ga0307516_10350714 | |||
| 2203 | Ga0307405_10465008 | |||
| 2204 | Ga0307407_10317101 | |||
| 2205 | Ga0307412_10097264 | |||
| 2206 | Ga0307412_10386929 | |||
| 2207 | Ga0307416_100057739 | |||
| 2208 | Ga0307411_10508897 | |||
| 2209 | Ga0307415_100320203 | |||
| 2210 | Ga0316593_10001189 | |||
| 2211 | Ga0316593_10005586 | |||
| 2212 | Ga0307510_10145506 | |||
| 2213 | Ga0316596_1000071 | |||
| 2214 | Ga0316596_1005241 | |||
| 2215 | Ga0316596_1029579 | |||
| 2216 | Ga0373930_0003008 | |||
| 2217 | Ga0373948_0002824 | |||
| 2218 | Ga0373948_0011322 | |||
| 2219 | Ga0373950_0000925 | |||
| 2220 | Ga0373950_0005337 | |||
| 2221 | Ga0373958_0001566 | |||
| 2222 | Ga0373958_0002620 | |||
| 2223 | Ga0373959_0003005 | |||
| 2224 | Ga0373959_0005115 | |||
| 2225 | Ga0373938_0000343 | |||
| 2226 | Ga0373938_0001532 | |||
| 2227 | Ga0373926_0101711 | |||
| 2228 | Ga0373928_0001369 | |||
| 2229 | Ga0373928_0003223 | |||
| 2230 | Ga0373928_0012076 | |||
| 2231 | Ga0373928_0025796 | |||
| 2232 | Ga0373929_0006785 | |||
| 2233 | Ga0373934_0012674 | |||
| 2234 | Ga0373940_0038749 | |||
| 2235 | Ga0373944_0002638 | |||
| 2236 | Ga0373944_0062985 | |||
| 2237 | Ga0373944_0063973 | |||
| 2238 | Ga0373949_0001707 | |||
| 2239 | Ga0373949_0003940 | |||
| 2240 | Ga0373949_0015770 | |||
| 2241 | Ga0373949_0029165 | |||
| 2242 | Ga0373951_0003581 | |||
| 2243 | Ga0373951_0027305 | |||
| 2244 | Ga0373951_0129658 | |||
| 2245 | Ga0373952_0001963 | |||
| 2246 | Ga0373952_0016138 | |||
| 2247 | Ga0373923_0000485 | |||
| 2248 | Ga0373923_0009946 | |||
| 2249 | Ga0373923_0139523 | |||
| 2250 | Ga0373923_0225644 | |||
| 2251 | Ga0373932_0002338 | |||
| 2252 | Ga0373932_0004128 | |||
| 2253 | Ga0373932_0007842 | |||
| 2254 | Ga0373936_0025775 | |||
| 2255 | Ga0373936_0072662 | |||
| 2256 | Ga0373939_0000898 | |||
| 2257 | Ga0373939_0001965 | |||
| 2258 | Ga0373939_0055390 | |||
| 2259 | Ga0373941_0012147 | |||
| 2260 | Ga0373945_0012761 | |||
| 2261 | Ga0373945_0034692 | |||
| 2262 | Ga0373945_0087729 | |||
| 2263 | Ga0373953_0000440 | |||
| 2264 | Ga0373953_0000811 | |||
| 2265 | Ga0373953_0106528 | |||
| 2266 | Ga0373953_0156714 | |||
| 2267 | Ga0373954_0007130 | |||
| 2268 | Ga0373954_0038249 | |||
| 2269 | Ga0373954_0097397 | |||
| 2270 | Ga0373956_0031577 | |||
| 2271 | Ga0373957_0004663 | |||
| 2272 | Ga0373957_0031280 | |||
| 2273 | Ga0373957_0051619 | |||
| 2274 | Ga0373960_0018316 | |||
| 2275 | Ga0373960_0041334 | |||
| 2276 | Ga0373943_0008959 | |||
| 2277 | Ga0373943_0016248 | |||
| 2278 | Ga0373943_0142479 | |||
| 2279 | Ga0373946_0001178 | |||
| 2280 | Ga0373946_0016833 | |||
| 2281 | Ga0373946_0067138 | |||
| 2282 | Ga0373946_0135921 | |||
| 2283 | Ga0373955_0000473 | |||
| 2284 | Ga0373955_0004283 | |||
| 2285 | Ga0373955_0020793 | |||
| 2286 | Ga0373955_0124738 | |||
| 2287 | Ga0373955_0267380 | |||
| 2288 | Ga0373955_0449672 | |||
| 2289 | Ga0373942_0001142 | |||
| 2290 | Ga0373942_0012868 | |||
| 2291 | Ga0373942_0022753 | |||
| 2292 | Ga0373961_0008256 | |||
| 2293 | Ga0373961_0010530 | |||
| 2294 | Ga0373962_0000112 | |||
| 2295 | Ga0373962_0001106 | |||
| 2296 | Ga0373962_0005399 | |||
| 2297 | Ga0316574_0089288 | |||
| 2298 | Ga0373924_0008604 | |||
| 2299 | Ga0373924_0119843 | |||
| 2300 | Ga0373931_0000305 | |||
| 2301 | Ga0373931_0010294 | |||
| 2302 | Ga0373931_0022466 | |||
| 2303 | Ga0373931_0033067 | |||
| 2304 | Ga0373931_0554026 | |||
| 2305 | Ga0373935_0000768 | |||
| 2306 | Ga0373935_0054246 | |||
| 2307 | Ga0373935_0312855 | |||
| 2308 | Ga0373927_0017066 | |||
| 2309 | Ga0373927_0023717 | |||
| 2310 | Ga0373927_0064127 | |||
| 2311 | Ga0373927_0086064 | |||
| 2312 | Ga0373927_0196530 | |||
| 2313 | Ga0373927_0521815 | |||
| 2314 | Ga0373933_0073858 | |||
| 2315 | Ga0373933_0093721 | |||
| 2316 | Ga0373933_0143575 | |||
| 2317 | Ga0373933_0318467 | |||
| 2318 | Ga0373947_0002626 | |||
| 2319 | Ga0373947_0009798 | |||
| 2320 | Ga0373947_0012496 | |||
| 2321 | Ga0373947_0052868 | |||
| 2322 | Ga0373947_0304539 | |||
| 2323 | Ga0373937_0011350 | |||
| 2324 | Ga0373937_0092928 | |||
| 2325 | Ga0373937_0098665 | |||
| 2326 | Ga0373937_0126066 | |||
| 2327 | Ga0373937_0247199 | |||
| 2328 | Ga0373937_0608813 | |||
| 2329 | Ga0373925_0000435 | |||
| 2330 | Ga0373925_0051088 | |||
| 2331 | Ga0373925_0111082 | |||
| 2332 | Ga0395899_0035120 | |||
| 2333 | Ga0395899_0053109 | |||
| 2334 | Ga0395900_0309593 | |||
| 2335 | Ga0395900_0312059 | |||
| 2336 | Ga0395898_0007760 | |||
| 2337 | Ga0395898_0021940 | |||
| 2338 | Ga0395898_0066766 | |||
| 2339 | Ga0436364_0868561 | |||
| 2340 | Ga0395901_0105438 | |||
| 2341 | Ga0395901_0237328 | |||
| 2342 | Ga0400490_54834 | |||
| 2343 | Ga0400486_19576 | |||
| 2344 | Ga0400483_013757 | |||
| 2345 | Ga0400487_43369 | |||
| 2346 | Ga0436365_0697746 | |||
| 2347 | Ga0436365_0886574 | |||
| 2348 | Ga0436365_1438629 | |||
| 2349 | Ga0436361_0963669 | |||
| 2350 | Ga0436363_0362931 | |||
| 2351 | Ga0436363_0499016 | |||
| 2352 | Ga0436363_1678732 | |||
| 2353 | Ga0439453_0025374 | |||
| 2354 | Ga0439466_0068208 | |||
| 2355 | Ga0439465_0027921 | |||
| 2356 | Ga0439441_004739 | |||
| 2357 | Ga0439448_0052922 | |||
| 2358 | Ga0439450_016812 | |||
| 2359 | Ga0439463_031978 | |||
| 2360 | Ga0439434_0039034 | |||
| 2361 | Ga0439435_0038929 | |||
| 2362 | Ga0439459_0005929 | |||
| 2363 | Ga0439464_0015420 | |||
| 2364 | Ga0439460_0077437 | |||
| 2365 | Ga0451577_0138353 | |||
| 2366 | Ga0439440_0012161 | |||
| 2367 | Ga0466963_0018844 | |||
| 2368 | Ga0453684_0087005 | |||
| 2369 | Ga0466971_0160542 | |||
| 2370 | Ga0466968_0060841 | |||
| 2371 | Ga0466959_0261529 | |||
| 2372 | Ga0451576_0024106 | |||
| 2373 | Ga0466958_0170497 | |||
| 2374 | Ga0466967_0031236 | |||
| 2375 | Ga0466967_0050110 | |||
| 2376 | Ga0495592_0000135 | |||
| 2377 | Ga0495592_0001138 | |||
| 2378 | Ga0495592_0046416 | |||
| 2379 | Ga0495592_0123999 | |||
| 2380 | Ga0495592_0457970 | |||
| 2381 | Ga0495603_0012514 | |||
| 2382 | Ga0495603_0040716 | |||
| 2383 | Ga0495603_0192701 | |||
| 2384 | Ga0495629_0000317 | |||
| 2385 | Ga0495629_0010959 | |||
| 2386 | Ga0495629_0033469 | |||
| 2387 | Ga0495641_0011646 | |||
| 2388 | Ga0495641_0035126 | |||
| 2389 | Ga0495641_0191271 | |||
| 2390 | Ga0495651_0003008 | |||
| 2391 | Ga0495651_0004850 | |||
| 2392 | Ga0495651_0188274 | |||
| 2393 | Ga0495651_0456701 | |||
| 2394 | Ga0495653_0000120 | |||
| 2395 | Ga0495653_0072344 | |||
| 2396 | Ga0495653_0302631 | |||
| 2397 | Ga0495580_0027886 | |||
| 2398 | Ga0495580_0046764 | |||
| 2399 | Ga0495580_0074442 | |||
| 2400 | Ga0495582_0003714 | |||
| 2401 | Ga0495582_0013082 | |||
| 2402 | Ga0495639_0004359 | |||
| 2403 | Ga0495639_0037402 | |||
| 2404 | Ga0495639_0040420 | |||
| 2405 | Ga0495639_0056372 | |||
| 2406 | Ga0495639_0152579 | |||
| 2407 | Ga0495662_0000285 | |||
| 2408 | Ga0495662_0002801 | |||
| 2409 | Ga0495662_0015062 | |||
| 2410 | Ga0495662_0189539 | |||
| 2411 | Ga0495664_0000023 | |||
| 2412 | Ga0495664_0033507 | |||
| 2413 | Ga0495664_0076784 | |||
| 2414 | Ga0495664_0095123 | |||
| 2415 | Ga0495664_0242731 | |||
| 2416 | Ga0495664_0604704 | |||
| 2417 | Ga0495584_0120425 | |||
| 2418 | Ga0495584_0121260 | |||
| 2419 | Ga0495594_0042128 | |||
| 2420 | Ga0495594_0047377 | |||
| 2421 | Ga0495594_0053830 | |||
| 2422 | Ga0495594_0072513 | |||
| 2423 | Ga0495608_0000030 | |||
| 2424 | Ga0495608_0007771 | |||
| 2425 | Ga0495608_0071471 | |||
| 2426 | Ga0495608_0087114 | |||
| 2427 | Ga0495608_0531122 | |||
| 2428 | Ga0495618_0000042 | |||
| 2429 | Ga0495618_0086821 | |||
| 2430 | Ga0495628_0000027 | |||
| 2431 | Ga0495628_0002285 | |||
| 2432 | Ga0495628_0005831 | |||
| 2433 | Ga0495628_0121361 | |||
| 2434 | Ga0495628_0368029 | |||
| 2435 | Ga0495630_0055318 | |||
| 2436 | Ga0495630_0167451 | |||
| 2437 | Ga0495630_0181822 | |||
| 2438 | Ga0495630_0292636 | |||
| 2439 | Ga0495630_0487683 | |||
| 2440 | Ga0495666_0040333 | |||
| 2441 | Ga0495666_0069855 | |||
| 2442 | Ga0495652_0000041 | |||
| 2443 | Ga0495652_0141136 | |||
| 2444 | Ga0495652_0269064 | |||
| 2445 | Ga0495665_0014231 | |||
| 2446 | Ga0495665_0053773 | |||
| 2447 | Ga0495665_0214508 | |||
| 2448 | Ga0495640_0000047 | |||
| 2449 | Ga0495640_0168412 | |||
| 2450 | Ga0495586_0058322 | |||
| 2451 | Ga0495587_0000025 | |||
| 2452 | Ga0495587_0031176 | |||
| 2453 | Ga0495587_0239915 | |||
| 2454 | Ga0495645_0000001 | |||
| 2455 | Ga0495645_0005350 | |||
| 2456 | Ga0495645_0050307 | |||
| 2457 | Ga0495622_0027764 | |||
| 2458 | Ga0495622_0205163 | |||
| 2459 | Ga0495667_0000001 | |||
| 2460 | Ga0495667_0153394 | |||
| 2461 | Ga0495667_0182476 | |||
| 2462 | Ga0495667_0379461 | |||
| 2463 | Ga0495634_0001443 | |||
| 2464 | Ga0495634_0002681 | |||
| 2465 | Ga0495634_0126421 | |||
| 2466 | Ga0495634_0138839 | |||
| 2467 | Ga0495634_0209436 | |||
| 2468 | Ga0495634_0250306 | |||
| 2469 | Ga0495635_0000061 | |||
| 2470 | Ga0495635_0011224 | |||
| 2471 | Ga0495635_0023262 | |||
| 2472 | Ga0495635_0179121 | |||
| 2473 | Ga0495635_0260117 | |||
| 2474 | Ga0495588_0027962 | |||
| 2475 | Ga0495657_0003632 | |||
| 2476 | Ga0495657_0037526 | |||
| 2477 | Ga0495657_0297992 | |||
| 2478 | Ga0495599_0000021 | |||
| 2479 | Ga0495599_0055692 | |||
| 2480 | Ga0495599_0067022 | |||
| 2481 | Ga0495623_0000858 | |||
| 2482 | Ga0495623_0001924 | |||
| 2483 | Ga0495646_0000043 | |||
| 2484 | Ga0495646_0007260 | |||
| 2485 | Ga0495647_0009980 | |||
| 2486 | Ga0495647_0021288 | |||
| 2487 | Ga0495658_0001480 | |||
| 2488 | Ga0495658_0007902 | |||
| 2489 | Ga0495658_0017238 | |||
| 2490 | Ga0495658_0054652 | |||
| 2491 | Ga0495613_0016831 | |||
| 2492 | Ga0495613_0027017 | |||
| 2493 | Ga0495613_0146612 | |||
| 2494 | Ga0495613_0448282 | |||
| 2495 | Ga0495624_0035194 | |||
| 2496 | Ga0495624_0048203 | |||
| 2497 | Ga0495600_0000082 | |||
| 2498 | Ga0495600_0057702 | |||
| 2499 | Ga0495600_0065991 | |||
| 2500 | Ga0495581_0007052 | |||
| 2501 | Ga0495581_0047258 | |||
| 2502 | Ga0495604_0000036 | |||
| 2503 | Ga0495604_0063825 | |||
| 2504 | Ga0495604_0083692 | |||
| 2505 | Ga0495604_0514294 | |||
| 2506 | Ga0495674_0000085 | |||
| 2507 | Ga0495674_0003478 | |||
| 2508 | Ga0495674_0027562 | |||
| 2509 | Ga0495674_0051156 | |||
| 2510 | Ga0495674_0453302 | |||
| 2511 | Ga0495676_0008691 | |||
| 2512 | Ga0495676_0047228 | |||
| 2513 | Ga0495676_0148593 | |||
| 2514 | Ga0495676_0156541 | |||
| 2515 | Ga0495676_0255730 | |||
| 2516 | Ga0495680_0000201 | |||
| 2517 | Ga0495680_0058793 | |||
| 2518 | Ga0495680_0106939 | |||
| 2519 | Ga0495680_0203811 | |||
| 2520 | Ga0495675_0000203 | |||
| 2521 | Ga0495675_0006492 | |||
| 2522 | Ga0495675_0271396 | |||
| 2523 | Ga0495673_0034291 | |||
| 2524 | Ga0495673_0139960 | |||
| 2525 | Ga0495684_0000025 | |||
| 2526 | Ga0495686_0000007 | |||
| 2527 | Ga0495593_0001971 | |||
| 2528 | Ga0495593_0022296 | |||
| 2529 | Ga0495593_0279736 | |||
| 2530 | Ga0495602_0000097 | |||
| 2531 | Ga0495602_0073140 | |||
| 2532 | Ga0495602_0115401 | |||
| 2533 | Ga0495614_0042862 | |||
| 2534 | Ga0495614_0135429 | |||
| 2535 | Ga0496100_0067021 | |||
| 2536 | Ga0496101_0000969 | |||
| 2537 | Ga0496101_0019543 | |||
| 2538 | Ga0496101_0146063 | |||
| 2539 | Ga0496101_0397038 | |||
| 2540 | Ga0496102_0004376 | |||
| 2541 | Ga0496102_0059982 | |||
| 2542 | Ga0496102_0062325 | |||
| 2543 | Ga0496102_0210706 | |||
| 2544 | Ga0496102_0269233 | |||
| 2545 | Ga0496102_0276267 | |||
| 2546 | Ga0496102_0853770 | |||
| 2547 | Ga0496102_1065769 | |||
| 2548 | Ga0496103_0001732 | |||
| 2549 | Ga0496103_0023227 | |||
| 2550 | Ga0496103_0044529 | |||
| 2551 | Ga0496103_0274490 | |||
| 2552 | Ga0496104_0000399 | |||
| 2553 | Ga0496104_0001364 | |||
| 2554 | Ga0496104_0068025 | |||
| 2555 | Ga0496104_0189398 | |||
| 2556 | Ga0496104_0234765 | |||
| 2557 | Ga0496104_0274823 | |||
| 2558 | Ga0496104_0625832 | |||
| 2559 | Ga0496105_0002417 | |||
| 2560 | Ga0496105_0004404 | |||
| 2561 | Ga0496105_0529086 | |||
| 2562 | Ga0496105_0615898 | |||
| 2563 | Ga0496106_0006762 | |||
| 2564 | Ga0496106_0014064 | |||
| 2565 | Ga0496106_0015788 | |||
| 2566 | Ga0496106_0036410 | |||
| 2567 | Ga0496106_0037188 | |||
| 2568 | Ga0496107_0005598 | |||
| 2569 | Ga0496107_0043840 | |||
| 2570 | Ga0496108_0001133 | |||
| 2571 | Ga0496108_0007368 | |||
| 2572 | Ga0496108_0021831 | |||
| 2573 | Ga0496108_0085334 | |||
| 2574 | Ga0496108_0211111 | |||
| 2575 | Ga0496109_0000583 | |||
| 2576 | Ga0496109_0005949 | |||
| 2577 | Ga0496109_0019012 | |||
| 2578 | Ga0496109_0042827 | |||
| 2579 | Ga0496109_0133489 | |||
| 2580 | Ga0496109_0182665 | |||
| 2581 | Ga0496109_0268760 | |||
| 2582 | Ga0496109_0745331 | |||
| 2583 | Ga0496110_0010849 | |||
| 2584 | Ga0496110_0030562 | |||
| 2585 | Ga0496110_0106807 | |||
| 2586 | Ga0496110_0216403 | |||
| 2587 | Ga0496110_0253605 | |||
| 2588 | Ga0496110_0394985 | |||
| 2589 | Ga0496110_0596572 | |||
| 2590 | Ga0496110_0625756 | |||
| 2591 | Ga0496110_0870425 | |||
| 2592 | Ga0496111_0009370 | |||
| 2593 | Ga0496111_0043921 | |||
| 2594 | Ga0496111_0055522 | |||
| 2595 | Ga0496111_0098890 | |||
| 2596 | Ga0496111_0130989 | |||
| 2597 | Ga0496111_0143778 | |||
| 2598 | Ga0496111_0169975 | |||
| 2599 | Ga0496112_0000884 | |||
| 2600 | Ga0496112_0045054 | |||
| 2601 | Ga0496112_0065844 | |||
| 2602 | Ga0496112_0262667 | |||
| 2603 | Ga0496112_0273206 | |||
| 2604 | Ga0496112_0796923 | |||
| 2605 | Ga0496113_0000351 | |||
| 2606 | Ga0496113_0015868 | |||
| 2607 | Ga0496113_0124793 | |||
| 2608 | Ga0496113_0129113 | |||
| 2609 | Ga0496114_0002647 | |||
| 2610 | Ga0496114_0099598 | |||
| 2611 | Ga0496114_0167404 | |||
| 2612 | Ga0496114_0235220 | |||
| 2613 | Ga0496114_0708953 | |||
| 2614 | Ga0496114_0939269 | |||
| 2615 | Ga0496115_0001671 | |||
| 2616 | Ga0496115_0004536 | |||
| 2617 | Ga0496115_0047461 | |||
| 2618 | Ga0496115_0082945 | |||
| 2619 | Ga0496115_0107851 | |||
| 2620 | Ga0496115_0264871 | |||
| 2621 | Ga0496115_0307943 | |||
| 2622 | Ga0496124_0152630 | |||
| 2623 | Ga0496124_0201142 | |||
| 2624 | Ga0496124_0202200 | |||
| 2625 | Ga0496125_0122311 | |||
| 2626 | Ga0496125_0159581 | |||
| 2627 | Ga0496125_0288151 | |||
| 2628 | Ga0496126_0133942 | |||
| 2629 | Ga0496126_0646935 | |||
| 2630 | Ga0501031_0183604 | |||
| 2631 | Ga0501032_0001915 | |||
| 2632 | Ga0501032_0020821 | |||
| 2633 | Ga0501032_0045310 | |||
| 2634 | Ga0501032_0045571 | |||
| 2635 | Ga0501032_0046252 | |||
| 2636 | Ga0501032_0058423 | |||
| 2637 | Ga0501032_0078973 | |||
| 2638 | Ga0501033_0021359 | |||
| 2639 | Ga0501033_0023272 | |||
| 2640 | Ga0501033_0086738 | |||
| 2641 | Ga0501033_0131050 | |||
| 2642 | Ga0501033_0182706 | |||
| 2643 | Ga0501033_0361307 | |||
| 2644 | Ga0501034_0000208 | |||
| 2645 | Ga0501034_0014987 | |||
| 2646 | Ga0501034_0024772 | |||
| 2647 | Ga0501034_0032099 | |||
| 2648 | Ga0501034_0033675 | |||
| 2649 | Ga0501034_0034843 | |||
| 2650 | Ga0501034_0060811 | |||
| 2651 | Ga0501034_0063818 | |||
| 2652 | Ga0501034_0101469 | |||
| 2653 | Ga0501034_0147005 | |||
| 2654 | Ga0501034_0212658 | |||
| 2655 | Ga0501034_0235530 | |||
| 2656 | Ga0501034_0274989 | |||
| 2657 | Ga0501034_0379067 | |||
| 2658 | Ga0501034_0568476 | |||
| 2659 | Ga0501034_0579537 | |||
| 2660 | Ga0501036_0005563 | |||
| 2661 | Ga0501036_0072595 | |||
| 2662 | Ga0501036_0091111 | |||
| 2663 | Ga0501036_0093818 | |||
| 2664 | Ga0501036_0112038 | |||
| 2665 | Ga0501036_0177505 | |||
| 2666 | Ga0501036_0194851 | |||
| 2667 | Ga0501036_0258786 | |||
| 2668 | Ga0501036_0268203 | |||
| 2669 | Ga0501036_0309680 | |||
| 2670 | Ga0501036_0312106 | |||
| 2671 | Ga0501037_0012573 | |||
| 2672 | Ga0501037_0108992 | |||
| 2673 | Ga0501037_0118828 | |||
| 2674 | Ga0501037_0188156 | |||
| 2675 | Ga0501037_0333013 | |||
| 2676 | Ga0501037_0429414 | |||
| 2677 | Ga0501038_0007256 | |||
| 2678 | Ga0501038_0053366 | |||
| 2679 | Ga0501038_0058047 | |||
| 2680 | Ga0501038_0071577 | |||
| 2681 | Ga0501038_0071986 | |||
| 2682 | Ga0501038_0146399 | |||
| 2683 | Ga0501038_0226017 | |||
| 2684 | Ga0501038_0237838 | |||
| 2685 | Ga0501038_0329344 | |||
| 2686 | Ga0501038_0454377 | |||
| 2687 | Ga0501038_0468809 | |||
| 2688 | Ga0501039_0000072 | |||
| 2689 | Ga0501039_0032222 | |||
| 2690 | Ga0501039_0101199 | |||
| 2691 | Ga0501039_0353052 | |||
| 2692 | Ga0501039_0486593 | |||
| 2693 | Ga0501040_0026515 | |||
| 2694 | Ga0501040_0108093 | |||
| 2695 | Ga0501040_0120446 | |||
| 2696 | Ga0501041_0095717 | |||
| 2697 | Ga0501043_0009304 | |||
| 2698 | Ga0501043_0012919 | |||
| 2699 | Ga0501043_0012997 | |||
| 2700 | Ga0501043_0037798 | |||
| 2701 | Ga0501043_0048068 | |||
| 2702 | Ga0501043_0129223 | |||
| 2703 | Ga0501043_0162421 | |||
| 2704 | Ga0501043_0189014 | |||
| 2705 | Ga0501043_0348979 | |||
| 2706 | Ga0501043_0416287 | |||
| 2707 | Ga0501043_0774330 | |||
| 2708 | Ga0501046_0000045 | |||
| 2709 | Ga0501046_0006019 | |||
| 2710 | Ga0501046_0029093 | |||
| 2711 | Ga0501046_0125633 | |||
| 2712 | Ga0501046_0154028 | |||
| 2713 | Ga0501046_0156128 | |||
| 2714 | Ga0501046_0175873 | |||
| 2715 | Ga0501046_0380932 | |||
| 2716 | Ga0501047_0000235 | |||
| 2717 | Ga0501047_0001212 | |||
| 2718 | Ga0501047_0023718 | |||
| 2719 | Ga0501047_0026121 | |||
| 2720 | Ga0501047_0063775 | |||
| 2721 | Ga0501047_0091366 | |||
| 2722 | Ga0501047_0099459 | |||
| 2723 | Ga0501047_0116738 | |||
| 2724 | Ga0501047_0117521 | |||
| 2725 | Ga0501047_0205740 | |||
| 2726 | Ga0501047_0209584 | |||
| 2727 | Ga0501047_0256824 | |||
| 2728 | Ga0501047_0371553 | |||
| 2729 | Ga0501047_0419998 | |||
| 2730 | Ga0501048_0000501 | |||
| 2731 | Ga0501048_0006738 | |||
| 2732 | Ga0501048_0159113 | |||
| 2733 | Ga0501048_0245727 | |||
| 2734 | Ga0501048_0416902 | |||
| 2735 | Ga0501067_0000278 | |||
| 2736 | Ga0501067_0001590 | |||
| 2737 | Ga0501067_0016768 | |||
| 2738 | Ga0501067_0026158 | |||
| 2739 | Ga0501067_0034817 | |||
| 2740 | Ga0501067_0051199 | |||
| 2741 | Ga0501067_0212349 | |||
| 2742 | Ga0501067_0252344 | |||
| 2743 | Ga0501067_0276326 | |||
| 2744 | Ga0501068_0015296 | |||
| 2745 | Ga0501068_0057493 | |||
| 2746 | Ga0501068_0111569 | |||
| 2747 | Ga0501069_0004122 | |||
| 2748 | Ga0501069_0030545 | |||
| 2749 | Ga0501069_0143465 | |||
| 2750 | Ga0501069_0194241 | |||
| 2751 | Ga0501069_0290519 | |||
| 2752 | Ga0501070_0004020 | |||
| 2753 | Ga0501070_0067473 | |||
| 2754 | Ga0501070_0069151 | |||
| 2755 | Ga0501070_0080884 | |||
| 2756 | Ga0501070_0082865 | |||
| 2757 | Ga0501070_0083561 | |||
| 2758 | Ga0501070_0154978 | |||
| 2759 | Ga0501070_0223775 | |||
| 2760 | Ga0501070_0270302 | |||
| 2761 | Ga0501070_0750285 | |||
| 2762 | Ga0501071_0063412 | |||
| 2763 | Ga0501071_0357403 | |||
| 2764 | Ga0501072_0019266 | |||
| 2765 | Ga0501072_0053259 | |||
| 2766 | Ga0501072_0067263 | |||
| 2767 | Ga0501072_0321624 | |||
| 2768 | Ga0501072_0628172 | |||
| 2769 | Ga0501073_0000083 | |||
| 2770 | Ga0501073_0096053 | |||
| 2771 | Ga0501073_0160719 | |||
| 2772 | Ga0501073_0180275 | |||
| 2773 | Ga0501073_0190442 | |||
| 2774 | Ga0501073_0204900 | |||
| 2775 | Ga0501073_0491464 | |||
| 2776 | Ga0501074_0002757 | |||
| 2777 | Ga0501074_0021566 | |||
| 2778 | Ga0501074_0029786 | |||
| 2779 | Ga0501074_0049622 | |||
| 2780 | Ga0501074_0146813 | |||
| 2781 | Ga0501074_0166845 | |||
| 2782 | Ga0501074_0287420 | |||
| 2783 | Ga0501074_0556012 | |||
| 2784 | Ga0501076_0094419 | |||
| 2785 | Ga0501076_0208033 | |||
| 2786 | Ga0501076_0291179 | |||
| 2787 | Ga0501076_0621881 | |||
| 2788 | Ga0501077_0000088 | |||
| 2789 | Ga0501077_0088504 | |||
| 2790 | Ga0501079_0032435 | |||
| 2791 | Ga0501079_0063030 | |||
| 2792 | Ga0501079_0403214 | |||
| 2793 | Ga0501079_0432268 | |||
| 2794 | Ga0501079_0808280 | |||
| 2795 | Ga0501080_0000005 | |||
| 2796 | Ga0501080_0003162 | |||
| 2797 | Ga0501080_0006111 | |||
| 2798 | Ga0501080_0033886 | |||
| 2799 | Ga0501080_0064957 | |||
| 2800 | Ga0501080_0075103 | |||
| 2801 | Ga0501080_0103620 | |||
| 2802 | Ga0501080_0120697 | |||
| 2803 | Ga0501080_0141304 | |||
| 2804 | Ga0501080_0192858 | |||
| 2805 | Ga0501080_0195626 | |||
| 2806 | Ga0501080_0252355 | |||
| 2807 | Ga0501081_0037837 | |||
| 2808 | Ga0501081_0340171 | |||
| 2809 | Ga0501083_0005155 | |||
| 2810 | Ga0501083_0007861 | |||
| 2811 | Ga0501083_0069494 | |||
| 2812 | Ga0501083_0089375 | |||
| 2813 | Ga0501083_0153487 | |||
| 2814 | Ga0501083_0173655 | |||
| 2815 | Ga0501083_0189767 | |||
| 2816 | Ga0501035_0000049 | |||
| 2817 | Ga0501035_0009112 | |||
| 2818 | Ga0501035_0066191 | |||
| 2819 | Ga0501035_0114320 | |||
| 2820 | Ga0501035_0154350 | |||
| 2821 | Ga0501035_0308204 | |||
| 2822 | Ga0501035_0319945 | |||
| 2823 | Ga0501035_0364767 | |||
| 2824 | Ga0501035_0395512 | |||
| 2825 | Ga0501035_0515190 | |||
| 2826 | Ga0501044_0000030 | |||
| 2827 | Ga0501044_0009814 | |||
| 2828 | Ga0501044_0012437 | |||
| 2829 | Ga0501044_0025827 | |||
| 2830 | Ga0501044_0038683 | |||
| 2831 | Ga0501044_0047781 | |||
| 2832 | Ga0501044_0105973 | |||
| 2833 | Ga0501044_0112290 | |||
| 2834 | Ga0501044_0134695 | |||
| 2835 | Ga0501044_0221588 | |||
| 2836 | Ga0501044_0240549 | |||
| 2837 | Ga0501044_0270613 | |||
| 2838 | Ga0501044_0270633 | |||
| 2839 | Ga0501044_0319912 | |||
| 2840 | Ga0501044_0567542 | |||
| 2841 | Ga0501044_0606765 | |||
| 2842 | Ga0501044_0670392 | |||
| 2843 | Ga0501044_0958395 | |||
| 2844 | Ga0501045_0279644 | |||
| 2845 | Ga0501045_0313307 | |||
| 2846 | nmdc:mga03683_48038_c1 | |||
| 2847 | nmdc:mga03683_75618_c1 | |||
| 2848 | nmdc:mga03683_82571_c1 | |||
| 2849 | nmdc:mga03n38_254379_c1 | |||
| 2850 | nmdc:mga03n38_49750_c1 | |||
| 2851 | nmdc:mga03n38_54352_c1 | |||
| 2852 | nmdc:mga00v17_378837_c1 | |||
| 2853 | nmdc:mga0yw44_154723_c1 | |||
| 2854 | nmdc:mga0yw44_548616_c1 | |||
| 2855 | nmdc:mga0k408_184073_c1 | |||
| 2856 | nmdc:mga0k408_438662_c1 | |||
| 2857 | nmdc:mga0k408_64856_c1 | |||
| 2858 | nmdc:mga06z11_11573_c1 | |||
| 2859 | nmdc:mga06z11_172515_c1 | |||
| 2860 | nmdc:mga06z11_193635_c1 | |||
| 2861 | nmdc:mga06z11_7800_c1 | |||
| 2862 | nmdc:mga06z11_88861_c1 | |||
| 2863 | nmdc:mga04h51_228231_c1 | |||
| 2864 | nmdc:mga04h51_2557_c1 | |||
| 2865 | nmdc:mga04h51_39200_c1 | |||
| 2866 | nmdc:mga07m45_293771_c1 | |||
| 2867 | nmdc:mga07m45_46066_c1 | |||
| 2868 | nmdc:mga05p37_302707_c1 | |||
| 2869 | nmdc:mga05p37_45327_c1 | |||
| 2870 | nmdc:mga09592_127947_c1 | |||
| 2871 | nmdc:mga09592_515874_c1 | |||
| 2872 | nmdc:mga0qj67_256212_c1 | |||
| 2873 | nmdc:mga0qj67_409668_c1 | |||
| 2874 | nmdc:mga0qj67_556764_c1 | |||
| 2875 | nmdc:mga06r32_308819_c1 | |||
| 2876 | nmdc:mga06r32_319636_c1 | |||
| 2877 | nmdc:mga06r32_660_c1 | |||
| 2878 | nmdc:mga08y16_44765_c1 | |||
| 2879 | nmdc:mga08y16_48086_c1 | |||
| 2880 | nmdc:mga08y16_95891_c1 | |||
| 2881 | nmdc:mga08y16_9879_c2 | |||
| 2882 | nmdc:mga0n895_108252_c1 | |||
| 2883 | nmdc:mga0n895_256768_c1 | |||
| 2884 | nmdc:mga0n895_6552_c1 | |||
| 2885 | nmdc:mga0rr50_142937_c1 | |||
| 2886 | nmdc:mga0rr50_906157_c1 | |||
| 2887 | nmdc:mga08x19_659813_c1 | |||
| 2888 | nmdc:mga08x19_67568_c1 | |||
| 2889 | nmdc:mga0a205_19999_c1 | |||
| 2890 | nmdc:mga0a205_309643_c1 | |||
| 2891 | nmdc:mga0a205_359137_c1 | |||
| 2892 | Ga0495601_0000025 | |||
| 2893 | Ga0495601_0004742 | |||
| 2894 | Ga0495601_0007365 | |||
| 2895 | Ga0495601_0571614 | |||
| 2896 | Ga0495612_0000570 | |||
| 2897 | Ga0495612_0065130 | |||
| 2898 | Ga0495595_0000041 | |||
| 2899 | Ga0495595_0000532 | |||
| 2900 | Ga0495595_0050071 | |||
| 2901 | Ga0495619_0000035 | |||
| 2902 | Ga0495619_0015650 | |||
| 2903 | Ga0495619_0023651 | |||
| 2904 | Ga0495619_0043000 | |||
| 2905 | Ga0495619_0102264 | |||
| 2906 | Ga0495619_0164189 | |||
| 2907 | Ga0500644_0051127 | |||
| 2908 | Ga0500646_0015556 | |||
| 2909 | Ga0500651_0106102 | |||
| 2910 | Ga0500651_0480787 | |||
| 2911 | Ga0500566_0118293 | |||
| 2912 | Ga0500650_0090052 | |||
| 2913 | Ga0500660_119651 | |||
| 2914 | Ga0500556_0004256 | |||
| 2915 | Ga0500556_0080600 | |||
| 2916 | Ga0500562_067283 | |||
| 2917 | Ga0500595_012563 | |||
| 2918 | Ga0500595_037259 | |||
| 2919 | Ga0500642_0123679 | |||
| 2920 | Ga0500642_0149283 | |||
| 2921 | Ga0500652_077263 | |||
| 2922 | Ga0500559_0093124 | |||
| 2923 | Ga0500568_0005226 | |||
| 2924 | Ga0500568_0069253 | |||
| 2925 | Ga0500616_0006596 | |||
| 2926 | Ga0500616_0008552 | |||
| 2927 | Ga0500636_0009188 | |||
| 2928 | Ga0500636_0104324 | |||
| 2929 | Ga0501084_0030403 | |||
| 2930 | Ga0501084_0056561 | |||
| 2931 | Ga0501084_0127379 | |||
| 2932 | Ga0501084_0384940 | |||
| 2933 | Ga0501084_0456416 | |||
| 2934 | Ga0501084_0526693 | |||
| 2935 | Ga0501084_0552116 | |||
| 2936 | Ga0501084_1046184 | |||
| 2937 | Ga0501082_0016074 | |||
| 2938 | Ga0501082_0029096 | |||
| 2939 | Ga0501082_0051771 | |||
| 2940 | Ga0501082_0108726 | |||
| 2941 | Ga0501082_0121530 | |||
| 2942 | Ga0501082_0144090 | |||
| 2943 | Ga0501082_0398918 | |||
| 2944 | Ga0501082_0453223 | |||
| 2945 | Ga0501082_0527424 | |||
| 2946 | Ga0501082_0696047 | |||
| 2947 | Ga0501082_0800181 | |||
| 2948 | Ga0501082_1070944 | |||
| 2949 | Ga0501082_1191963 | |||
| 2950 | Ga0530510_0110704 | |||
| 2951 | Ga0530510_0231465 | |||
| 2952 | 2513594051 | |||
| 2953 | 2643755780 | |||
| 2954 | 2643963619 | |||
| 2955 | 2644165902 | |||
| 2956 | 2644287953 | |||
| 2957 | 2644347088 | |||
| 2958 | 2644747757 | |||
| 2959 | 2671694507 | |||
| 2960 | 2828310147 | |||
| 2961 | 2889311570 | |||
| 2962 | 2902411803 | |||
| 2963 | 2909043597 | |||
| 2964 | 2917699266 | |||
| 2965 | 2939671392 | |||
| 2966 | 8002061398 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c9a-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9017 | 13 | 206 |
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8939 | 3 | 206 |
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8882 | 3 | 206 |
| 8c97-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8811 | 3 | 206 |
| 8c97-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8755 | 3 | 206 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dmgA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7885 | 1 | 206 | 3.40.1370.10 |
| 1dmgA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7842 | 1 | 206 | 3.40.1370.10 |
| af_K7MAT5_102_317_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7414 | 1 | 204 | 3.40.1370.10 |
| af_Q2FW07_2_206_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7371 | 1 | 204 | 3.40.1370.10 |
| af_P60723_1_201_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7354 | 1 | 206 | 3.40.1370.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A434FBH1-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9922 | 109 | 206 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A537R4I8-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9809 | 109 | 206 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A434FBH1-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9725 | 109 | 206 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A537R4I8-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9523 | 109 | 206 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A380DTQ1-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.933 | 100 | 206 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |