F494302
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1485 | 438 | 2970 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300025290|Ga0207673_1009582|Ga0207673_10095822 |
| Length | 193 |
| Sequence | VGRPAAAKLVAPSGAPYLAHMSDPQISLTQNAAKRVAMFAIVLVHPEIPPNTGNVIRLTANTATDLHLVEPLGFRMDDRDLRRAGLDYHEYARVAVHRDFAACRAALDADAPRRWFAFTTQASRSAYDVAYRPGDVLVFGSETRGLPPTILEHFPADTHLRIPMRAGVRSLNLSNAVAVAVYEAWRQQRFSGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 133 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 204 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 210 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 211 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 212 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 215 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 216 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 219 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 225 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 232 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 234 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 244 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 249 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 255 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 259 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 261 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 264 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 265 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 266 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 267 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 268 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 274 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 275 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 276 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 277 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 278 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 279 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 280 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 281 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 336 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 337 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 338 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 339 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 340 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 341 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 344 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 345 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 346 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 347 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 348 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 349 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 350 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 351 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 352 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 353 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 354 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 355 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 356 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 357 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 358 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 359 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 360 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 361 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 362 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 367 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 368 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 369 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 370 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 371 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 372 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 373 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 374 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 375 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 376 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 377 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 378 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 379 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 380 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 381 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 382 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 383 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 384 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 385 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 386 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 387 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 388 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 389 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 390 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 391 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 392 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 393 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 394 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 395 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 396 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 397 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 398 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 399 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 400 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 402 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 403 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 404 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 405 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 406 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 407 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 408 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 409 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 410 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 411 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 412 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 413 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 414 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 415 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 416 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 417 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 418 | 3300049849 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought | Metagenome | Rhizosphere |
| 419 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 420 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 421 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 422 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 423 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 434 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 435 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 436 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 437 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 438 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.2 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.28 |
| Nodule | 0.13 |
| Rhizoplane | 3.57 |
| Rhizosphere | 94.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207673_1009582 | 3300025290 | Bacteria | 1239 |
| 2 | JGI24751J29686_10046467 | 3300002459 | Bacteria | 897 |
| 3 | rootL2_10073240 | 3300003322 | Bacteria | 4164 |
| 4 | Ga0055524_1000146 | 3300003775 | Bacteria | 84190 |
| 5 | Ga0055530_10009559 | 3300003791 | Bacteria | 3707 |
| 6 | Ga0055531_10004965 | 3300003794 | Bacteria | 7899 |
| 7 | Ga0065712_10235339 | 3300005290 | Bacteria | 995 |
| 8 | Ga0065715_10274079 | 3300005293 | Bacteria | 1103 |
| 9 | Ga0065715_10612704 | 3300005293 | Bacteria | 700 |
| 10 | Ga0070658_10005980 | 3300005327 | Bacteria | 9863 |
| 11 | Ga0070658_10103749 | 3300005327 | Bacteria | 2352 |
| 12 | Ga0070658_10141199 | 3300005327 | Bacteria | 2012 |
| 13 | Ga0070658_10218690 | 3300005327 | Bacteria | 1610 |
| 14 | Ga0070658_10287816 | 3300005327 | Bacteria | 1400 |
| 15 | Ga0070658_10324897 | 3300005327 | Bacteria | 1314 |
| 16 | Ga0070658_10390331 | 3300005327 | Bacteria | 1195 |
| 17 | Ga0070658_11103298 | 3300005327 | Bacteria | 690 |
| 18 | Ga0070676_10000267 | 3300005328 | Bacteria | 22827 |
| 19 | Ga0070676_10009436 | 3300005328 | Bacteria | 5272 |
| 20 | Ga0070676_10074109 | 3300005328 | Bacteria | 2049 |
| 21 | Ga0070676_10083232 | 3300005328 | Bacteria | 1946 |
| 22 | Ga0070683_100006762 | 3300005329 | Bacteria | 9634 |
| 23 | Ga0070683_100014268 | 3300005329 | Bacteria | 6945 |
| 24 | Ga0070683_100167950 | 3300005329 | Bacteria | 2082 |
| 25 | Ga0070683_100257060 | 3300005329 | Bacteria | 1661 |
| 26 | Ga0070683_101497725 | 3300005329 | Bacteria | 649 |
| 27 | Ga0070683_101847100 | 3300005329 | Bacteria | 581 |
| 28 | Ga0070690_100003078 | 3300005330 | Bacteria | 9067 |
| 29 | Ga0070690_100010609 | 3300005330 | Bacteria | 5366 |
| 30 | Ga0070690_100107454 | 3300005330 | Bacteria | 1857 |
| 31 | Ga0070690_100374995 | 3300005330 | Bacteria | 1039 |
| 32 | Ga0070670_100011670 | 3300005331 | Bacteria | 7515 |
| 33 | Ga0070670_100016497 | 3300005331 | Bacteria | 6341 |
| 34 | Ga0070670_100020490 | 3300005331 | Bacteria | 5685 |
| 35 | Ga0070670_100049106 | 3300005331 | Bacteria | 3629 |
| 36 | Ga0070670_100110464 | 3300005331 | Bacteria | 2369 |
| 37 | Ga0070670_100143121 | 3300005331 | Bacteria | 2068 |
| 38 | Ga0070670_100367407 | 3300005331 | Bacteria | 1266 |
| 39 | Ga0070670_100512593 | 3300005331 | Bacteria | 1067 |
| 40 | Ga0070670_100958521 | 3300005331 | Bacteria | 777 |
| 41 | Ga0070677_10000642 | 3300005333 | Bacteria | 11722 |
| 42 | Ga0070677_10010485 | 3300005333 | Bacteria | 3171 |
| 43 | Ga0068869_100008109 | 3300005334 | Bacteria | 6756 |
| 44 | Ga0068869_100009367 | 3300005334 | Bacteria | 6355 |
| 45 | Ga0068869_100023785 | 3300005334 | Bacteria | 4238 |
| 46 | Ga0068869_100036679 | 3300005334 | Bacteria | 3482 |
| 47 | Ga0068869_100130351 | 3300005334 | Bacteria | 1932 |
| 48 | Ga0068869_100144121 | 3300005334 | Bacteria | 1842 |
| 49 | Ga0068869_100464197 | 3300005334 | Bacteria | 1052 |
| 50 | Ga0070666_10004334 | 3300005335 | Bacteria | 8636 |
| 51 | Ga0070666_10004746 | 3300005335 | Bacteria | 8304 |
| 52 | Ga0070666_10017791 | 3300005335 | Bacteria | 4561 |
| 53 | Ga0070666_10124836 | 3300005335 | Bacteria | 1786 |
| 54 | Ga0070666_10166275 | 3300005335 | Bacteria | 1543 |
| 55 | Ga0070666_11018123 | 3300005335 | Bacteria | 615 |
| 56 | Ga0070680_100028407 | 3300005336 | Bacteria | 4486 |
| 57 | Ga0070680_100034253 | 3300005336 | Bacteria | 4094 |
| 58 | Ga0070682_100100175 | 3300005337 | Bacteria | 1912 |
| 59 | Ga0070682_100708485 | 3300005337 | Bacteria | 808 |
| 60 | Ga0068868_100015847 | 3300005338 | Bacteria | 5585 |
| 61 | Ga0068868_100033124 | 3300005338 | Bacteria | 3981 |
| 62 | Ga0068868_100034949 | 3300005338 | Bacteria | 3883 |
| 63 | Ga0068868_100036210 | 3300005338 | Bacteria | 3818 |
| 64 | Ga0068868_100038640 | 3300005338 | Bacteria | 3705 |
| 65 | Ga0068868_100182700 | 3300005338 | Bacteria | 1741 |
| 66 | Ga0068868_100371236 | 3300005338 | Bacteria | 1229 |
| 67 | Ga0068868_100395511 | 3300005338 | Bacteria | 1192 |
| 68 | Ga0068868_100427836 | 3300005338 | Bacteria | 1147 |
| 69 | Ga0070660_100022673 | 3300005339 | Bacteria | 4647 |
| 70 | Ga0070660_100031136 | 3300005339 | Bacteria | 4004 |
| 71 | Ga0070660_100097177 | 3300005339 | Bacteria | 2330 |
| 72 | Ga0070660_100662776 | 3300005339 | Bacteria | 874 |
| 73 | Ga0070660_100943809 | 3300005339 | Bacteria | 728 |
| 74 | Ga0070689_100019016 | 3300005340 | Bacteria | 5074 |
| 75 | Ga0070689_100019090 | 3300005340 | Bacteria | 5063 |
| 76 | Ga0070689_100044593 | 3300005340 | Bacteria | 3412 |
| 77 | Ga0070689_100055757 | 3300005340 | Bacteria | 3063 |
| 78 | Ga0070689_100163692 | 3300005340 | Bacteria | 1800 |
| 79 | Ga0070689_101076455 | 3300005340 | Bacteria | 718 |
| 80 | Ga0070691_10172697 | 3300005341 | Bacteria | 1121 |
| 81 | Ga0070687_100039542 | 3300005343 | Bacteria | 2371 |
| 82 | Ga0070687_100082039 | 3300005343 | Bacteria | 1762 |
| 83 | Ga0070661_100006131 | 3300005344 | Bacteria | 8276 |
| 84 | Ga0070661_100015813 | 3300005344 | Bacteria | 5326 |
| 85 | Ga0070661_100015818 | 3300005344 | Bacteria | 5325 |
| 86 | Ga0070661_100046937 | 3300005344 | Bacteria | 3160 |
| 87 | Ga0070661_100700056 | 3300005344 | Bacteria | 825 |
| 88 | Ga0070661_100793527 | 3300005344 | Bacteria | 777 |
| 89 | Ga0070692_10004689 | 3300005345 | Bacteria | 5731 |
| 90 | Ga0070692_10040008 | 3300005345 | Bacteria | 2396 |
| 91 | Ga0070668_100006650 | 3300005347 | Bacteria | 8571 |
| 92 | Ga0070668_100019549 | 3300005347 | Bacteria | 5098 |
| 93 | Ga0070668_100022057 | 3300005347 | Bacteria | 4814 |
| 94 | Ga0070668_100022437 | 3300005347 | Bacteria | 4772 |
| 95 | Ga0070668_100060746 | 3300005347 | Bacteria | 2928 |
| 96 | Ga0070668_100184173 | 3300005347 | Bacteria | 1707 |
| 97 | Ga0070668_100256206 | 3300005347 | Bacteria | 1454 |
| 98 | Ga0070668_100617455 | 3300005347 | Bacteria | 950 |
| 99 | Ga0070669_100011261 | 3300005353 | Bacteria | 6350 |
| 100 | Ga0070669_100072484 | 3300005353 | Bacteria | 2550 |
| 101 | Ga0070669_100089829 | 3300005353 | Bacteria | 2302 |
| 102 | Ga0070669_100116999 | 3300005353 | Bacteria | 2029 |
| 103 | Ga0070669_100129232 | 3300005353 | Bacteria | 1936 |
| 104 | Ga0070669_100302554 | 3300005353 | Bacteria | 1287 |
| 105 | Ga0070675_100003343 | 3300005354 | Bacteria | 12143 |
| 106 | Ga0070675_100016616 | 3300005354 | Bacteria | 5842 |
| 107 | Ga0070675_100032389 | 3300005354 | Bacteria | 4231 |
| 108 | Ga0070675_100035125 | 3300005354 | Bacteria | 4072 |
| 109 | Ga0070675_100203583 | 3300005354 | Bacteria | 1718 |
| 110 | Ga0070675_100205734 | 3300005354 | Bacteria | 1709 |
| 111 | Ga0070675_100416372 | 3300005354 | Bacteria | 1201 |
| 112 | Ga0070675_100771843 | 3300005354 | Bacteria | 878 |
| 113 | Ga0070671_100000803 | 3300005355 | Bacteria | 22698 |
| 114 | Ga0070671_100001991 | 3300005355 | Bacteria | 15686 |
| 115 | Ga0070671_100024095 | 3300005355 | Bacteria | 4981 |
| 116 | Ga0070671_100051913 | 3300005355 | Bacteria | 3410 |
| 117 | Ga0070671_100054588 | 3300005355 | Bacteria | 3322 |
| 118 | Ga0070671_100059511 | 3300005355 | Bacteria | 3179 |
| 119 | Ga0070671_100223880 | 3300005355 | Bacteria | 1596 |
| 120 | Ga0070671_100573648 | 3300005355 | Bacteria | 974 |
| 121 | Ga0070671_100612033 | 3300005355 | Bacteria | 942 |
| 122 | Ga0070671_100664302 | 3300005355 | Bacteria | 903 |
| 123 | Ga0070671_100794183 | 3300005355 | Bacteria | 824 |
| 124 | Ga0070674_100000274 | 3300005356 | Bacteria | 25095 |
| 125 | Ga0070674_100013078 | 3300005356 | Bacteria | 5118 |
| 126 | Ga0070674_100021899 | 3300005356 | Bacteria | 4113 |
| 127 | Ga0070674_100070026 | 3300005356 | Bacteria | 2476 |
| 128 | Ga0070674_100082737 | 3300005356 | Bacteria | 2297 |
| 129 | Ga0070674_100109817 | 3300005356 | Bacteria | 2023 |
| 130 | Ga0070674_100139100 | 3300005356 | Bacteria | 1820 |
| 131 | Ga0070673_100000502 | 3300005364 | Bacteria | 20926 |
| 132 | Ga0070673_100002265 | 3300005364 | Bacteria | 11663 |
| 133 | Ga0070673_100031683 | 3300005364 | Bacteria | 3971 |
| 134 | Ga0070673_100038486 | 3300005364 | Bacteria | 3653 |
| 135 | Ga0070673_100040894 | 3300005364 | Bacteria | 3560 |
| 136 | Ga0070673_100080038 | 3300005364 | Bacteria | 2646 |
| 137 | Ga0070673_100090223 | 3300005364 | Bacteria | 2503 |
| 138 | Ga0070673_100506297 | 3300005364 | Bacteria | 1093 |
| 139 | Ga0070688_100011938 | 3300005365 | Bacteria | 4850 |
| 140 | Ga0070688_100012315 | 3300005365 | Bacteria | 4789 |
| 141 | Ga0070688_100015734 | 3300005365 | Bacteria | 4311 |
| 142 | Ga0070688_100196730 | 3300005365 | Bacteria | 1408 |
| 143 | Ga0070659_100001726 | 3300005366 | Bacteria | 15700 |
| 144 | Ga0070659_100017311 | 3300005366 | Bacteria | 5420 |
| 145 | Ga0070659_100029734 | 3300005366 | Bacteria | 4223 |
| 146 | Ga0070659_100048701 | 3300005366 | Bacteria | 3330 |
| 147 | Ga0070659_100065437 | 3300005366 | Bacteria | 2879 |
| 148 | Ga0070659_100066089 | 3300005366 | Bacteria | 2865 |
| 149 | Ga0070659_100117998 | 3300005366 | Bacteria | 2146 |
| 150 | Ga0070659_100132111 | 3300005366 | Bacteria | 2028 |
| 151 | Ga0070659_100377555 | 3300005366 | Bacteria | 1193 |
| 152 | Ga0070659_100516245 | 3300005366 | Bacteria | 1020 |
| 153 | Ga0070659_101544051 | 3300005366 | Bacteria | 592 |
| 154 | Ga0070667_100011152 | 3300005367 | Bacteria | 7433 |
| 155 | Ga0070667_100014378 | 3300005367 | Bacteria | 6540 |
| 156 | Ga0070667_100018913 | 3300005367 | Bacteria | 5712 |
| 157 | Ga0070667_100044618 | 3300005367 | Bacteria | 3724 |
| 158 | Ga0070667_100096867 | 3300005367 | Bacteria | 2545 |
| 159 | Ga0070667_100287679 | 3300005367 | Bacteria | 1477 |
| 160 | Ga0070667_100305114 | 3300005367 | Bacteria | 1434 |
| 161 | Ga0070667_100395130 | 3300005367 | Bacteria | 1258 |
| 162 | Ga0070667_100986338 | 3300005367 | Bacteria | 786 |
| 163 | Ga0070667_101809902 | 3300005367 | Bacteria | 575 |
| 164 | Ga0070667_101823240 | 3300005367 | Bacteria | 572 |
| 165 | Ga0070709_10008299 | 3300005434 | Bacteria | 5702 |
| 166 | Ga0070709_10012962 | 3300005434 | Bacteria | 4676 |
| 167 | Ga0070709_10028106 | 3300005434 | Bacteria | 3351 |
| 168 | Ga0070709_10060724 | 3300005434 | Bacteria | 2404 |
| 169 | Ga0070709_10233450 | 3300005434 | Bacteria | 1317 |
| 170 | Ga0070709_10553675 | 3300005434 | Bacteria | 880 |
| 171 | Ga0070709_10862396 | 3300005434 | Bacteria | 714 |
| 172 | Ga0070714_100017248 | 3300005435 | Bacteria | 5847 |
| 173 | Ga0070714_100029515 | 3300005435 | Bacteria | 4559 |
| 174 | Ga0070714_100125104 | 3300005435 | Bacteria | 2291 |
| 175 | Ga0070714_100383712 | 3300005435 | Bacteria | 1325 |
| 176 | Ga0070714_101151357 | 3300005435 | Bacteria | 756 |
| 177 | Ga0070714_101198294 | 3300005435 | Bacteria | 741 |
| 178 | Ga0070714_101336626 | 3300005435 | Bacteria | 700 |
| 179 | Ga0070713_100000621 | 3300005436 | Bacteria | 22637 |
| 180 | Ga0070713_100009875 | 3300005436 | Bacteria | 6867 |
| 181 | Ga0070713_100173718 | 3300005436 | Bacteria | 1932 |
| 182 | Ga0070713_100256006 | 3300005436 | Bacteria | 1598 |
| 183 | Ga0070713_100489612 | 3300005436 | Bacteria | 1159 |
| 184 | Ga0070713_100565560 | 3300005436 | Bacteria | 1078 |
| 185 | Ga0070713_101505457 | 3300005436 | Bacteria | 653 |
| 186 | Ga0070710_10006664 | 3300005437 | Bacteria | 5559 |
| 187 | Ga0070710_10446092 | 3300005437 | Bacteria | 876 |
| 188 | Ga0070710_10582498 | 3300005437 | Bacteria | 777 |
| 189 | Ga0070701_10037705 | 3300005438 | Bacteria | 2442 |
| 190 | Ga0070701_10110108 | 3300005438 | Bacteria | 1538 |
| 191 | Ga0070701_10800546 | 3300005438 | Bacteria | 643 |
| 192 | Ga0070711_100000562 | 3300005439 | Bacteria | 19387 |
| 193 | Ga0070711_100015057 | 3300005439 | Bacteria | 4887 |
| 194 | Ga0070711_100290769 | 3300005439 | Bacteria | 1296 |
| 195 | Ga0070711_100345369 | 3300005439 | Bacteria | 1195 |
| 196 | Ga0070711_100538655 | 3300005439 | Bacteria | 967 |
| 197 | Ga0070705_100002681 | 3300005440 | Bacteria | 8900 |
| 198 | Ga0070705_100004688 | 3300005440 | Bacteria | 6659 |
| 199 | Ga0070705_100111127 | 3300005440 | Bacteria | 1751 |
| 200 | Ga0070700_100282541 | 3300005441 | Bacteria | 1204 |
| 201 | Ga0070700_100515347 | 3300005441 | Bacteria | 923 |
| 202 | Ga0070700_100627673 | 3300005441 | Bacteria | 845 |
| 203 | Ga0070700_100665984 | 3300005441 | Bacteria | 823 |
| 204 | Ga0070700_100827078 | 3300005441 | Bacteria | 748 |
| 205 | Ga0070694_100003055 | 3300005444 | Bacteria | 9963 |
| 206 | Ga0070694_100198333 | 3300005444 | Bacteria | 1495 |
| 207 | Ga0070694_100365659 | 3300005444 | Bacteria | 1121 |
| 208 | Ga0070708_100000961 | 3300005445 | Bacteria | 21881 |
| 209 | Ga0070708_100039815 | 3300005445 | Bacteria | 4114 |
| 210 | Ga0070663_100000226 | 3300005455 | Bacteria | 28442 |
| 211 | Ga0070663_100049234 | 3300005455 | Bacteria | 2991 |
| 212 | Ga0070663_100126042 | 3300005455 | Bacteria | 1940 |
| 213 | Ga0070663_100170808 | 3300005455 | Bacteria | 1681 |
| 214 | Ga0070663_100286692 | 3300005455 | Bacteria | 1314 |
| 215 | Ga0070663_100458338 | 3300005455 | Bacteria | 1052 |
| 216 | Ga0070663_100467398 | 3300005455 | Bacteria | 1042 |
| 217 | Ga0070663_100731111 | 3300005455 | Bacteria | 843 |
| 218 | Ga0070678_100002036 | 3300005456 | Bacteria | 10931 |
| 219 | Ga0070678_100003054 | 3300005456 | Bacteria | 9278 |
| 220 | Ga0070678_100006079 | 3300005456 | Bacteria | 7045 |
| 221 | Ga0070678_100086342 | 3300005456 | Bacteria | 2393 |
| 222 | Ga0070678_100166747 | 3300005456 | Bacteria | 1790 |
| 223 | Ga0070678_100628410 | 3300005456 | Bacteria | 961 |
| 224 | Ga0070662_100000111 | 3300005457 | Bacteria | 45577 |
| 225 | Ga0070662_100015044 | 3300005457 | Bacteria | 5176 |
| 226 | Ga0070662_100099703 | 3300005457 | Bacteria | 2196 |
| 227 | Ga0070662_100214297 | 3300005457 | Bacteria | 1534 |
| 228 | Ga0070662_100316909 | 3300005457 | Bacteria | 1271 |
| 229 | Ga0070681_10026543 | 3300005458 | Bacteria | 5821 |
| 230 | Ga0070681_10053935 | 3300005458 | Bacteria | 4006 |
| 231 | Ga0070681_10790647 | 3300005458 | Bacteria | 866 |
| 232 | Ga0068867_100004886 | 3300005459 | Bacteria | 9434 |
| 233 | Ga0068867_100009782 | 3300005459 | Bacteria | 6757 |
| 234 | Ga0068867_100022311 | 3300005459 | Bacteria | 4526 |
| 235 | Ga0068867_100259632 | 3300005459 | Bacteria | 1416 |
| 236 | Ga0068867_100669553 | 3300005459 | Bacteria | 913 |
| 237 | Ga0070685_10001706 | 3300005466 | Bacteria | 11541 |
| 238 | Ga0070685_10012009 | 3300005466 | Bacteria | 4541 |
| 239 | Ga0070685_10062991 | 3300005466 | Bacteria | 2176 |
| 240 | Ga0070706_100584167 | 3300005467 | Bacteria | 1038 |
| 241 | Ga0070707_100078238 | 3300005468 | Bacteria | 3190 |
| 242 | Ga0070699_100003739 | 3300005518 | Bacteria | 13438 |
| 243 | Ga0070699_100016433 | 3300005518 | Bacteria | 6356 |
| 244 | Ga0070699_100027824 | 3300005518 | Bacteria | 4876 |
| 245 | Ga0070679_100228271 | 3300005530 | Bacteria | 1821 |
| 246 | Ga0070679_100316192 | 3300005530 | Bacteria | 1511 |
| 247 | Ga0070679_100321563 | 3300005530 | Bacteria | 1496 |
| 248 | Ga0070679_100843137 | 3300005530 | Bacteria | 860 |
| 249 | Ga0070684_100001117 | 3300005535 | Bacteria | 19263 |
| 250 | Ga0070684_100053565 | 3300005535 | Bacteria | 3513 |
| 251 | Ga0070684_100054153 | 3300005535 | Bacteria | 3495 |
| 252 | Ga0070684_100119191 | 3300005535 | Bacteria | 2373 |
| 253 | Ga0070684_100240883 | 3300005535 | Bacteria | 1652 |
| 254 | Ga0070684_100616206 | 3300005535 | Bacteria | 1009 |
| 255 | Ga0070697_100011036 | 3300005536 | Bacteria | 7058 |
| 256 | Ga0070697_100057369 | 3300005536 | Bacteria | 3168 |
| 257 | Ga0070697_100146517 | 3300005536 | Bacteria | 1988 |
| 258 | Ga0068853_100005294 | 3300005539 | Bacteria | 10101 |
| 259 | Ga0068853_100012925 | 3300005539 | Bacteria | 6805 |
| 260 | Ga0068853_100083415 | 3300005539 | Bacteria | 2800 |
| 261 | Ga0068853_100156536 | 3300005539 | Bacteria | 2053 |
| 262 | Ga0068853_100230938 | 3300005539 | Bacteria | 1693 |
| 263 | Ga0068853_100281602 | 3300005539 | Bacteria | 1533 |
| 264 | Ga0068853_100328122 | 3300005539 | Bacteria | 1420 |
| 265 | Ga0068853_100492048 | 3300005539 | Bacteria | 1157 |
| 266 | Ga0068853_100793635 | 3300005539 | Bacteria | 906 |
| 267 | Ga0070672_100001773 | 3300005543 | Bacteria | 13493 |
| 268 | Ga0070672_100008494 | 3300005543 | Bacteria | 7031 |
| 269 | Ga0070672_100014344 | 3300005543 | Bacteria | 5615 |
| 270 | Ga0070672_100026516 | 3300005543 | Bacteria | 4314 |
| 271 | Ga0070672_100035407 | 3300005543 | Bacteria | 3795 |
| 272 | Ga0070672_100049647 | 3300005543 | Bacteria | 3266 |
| 273 | Ga0070672_100128039 | 3300005543 | Bacteria | 2084 |
| 274 | Ga0070672_100202101 | 3300005543 | Bacteria | 1662 |
| 275 | Ga0070672_100329371 | 3300005543 | Bacteria | 1299 |
| 276 | Ga0070672_100429191 | 3300005543 | Bacteria | 1136 |
| 277 | Ga0070686_100027477 | 3300005544 | Bacteria | 3444 |
| 278 | Ga0070686_100053216 | 3300005544 | Bacteria | 2584 |
| 279 | Ga0070686_100061297 | 3300005544 | Bacteria | 2430 |
| 280 | Ga0070686_100120908 | 3300005544 | Bacteria | 1798 |
| 281 | Ga0070686_100303239 | 3300005544 | Bacteria | 1185 |
| 282 | Ga0070686_100346621 | 3300005544 | Bacteria | 1115 |
| 283 | Ga0070695_100007268 | 3300005545 | Bacteria | 6564 |
| 284 | Ga0070695_100010123 | 3300005545 | Bacteria | 5622 |
| 285 | Ga0070695_100046302 | 3300005545 | Bacteria | 2775 |
| 286 | Ga0070695_100199059 | 3300005545 | Bacteria | 1430 |
| 287 | Ga0070695_100342034 | 3300005545 | Bacteria | 1118 |
| 288 | Ga0070696_100012043 | 3300005546 | Bacteria | 5794 |
| 289 | Ga0070696_100016947 | 3300005546 | Bacteria | 4914 |
| 290 | Ga0070696_100047956 | 3300005546 | Bacteria | 2965 |
| 291 | Ga0070696_100072589 | 3300005546 | Bacteria | 2424 |
| 292 | Ga0070696_100222503 | 3300005546 | Bacteria | 1417 |
| 293 | Ga0070693_100010776 | 3300005547 | Bacteria | 4586 |
| 294 | Ga0070693_100065531 | 3300005547 | Bacteria | 2123 |
| 295 | Ga0070693_100077819 | 3300005547 | Bacteria | 1969 |
| 296 | Ga0070693_100090605 | 3300005547 | Bacteria | 1842 |
| 297 | Ga0070665_100010727 | 3300005548 | Bacteria | 9272 |
| 298 | Ga0070665_100014147 | 3300005548 | Bacteria | 8017 |
| 299 | Ga0070665_100082703 | 3300005548 | Bacteria | 3216 |
| 300 | Ga0070665_100084751 | 3300005548 | Bacteria | 3174 |
| 301 | Ga0070665_100147841 | 3300005548 | Bacteria | 2352 |
| 302 | Ga0070665_100237044 | 3300005548 | Bacteria | 1825 |
| 303 | Ga0070665_100423992 | 3300005548 | Bacteria | 1339 |
| 304 | Ga0070665_100529066 | 3300005548 | Unclassified | 1191 |
| 305 | Ga0070665_100781205 | 3300005548 | Bacteria | 968 |
| 306 | Ga0070704_100113532 | 3300005549 | Bacteria | 2066 |
| 307 | Ga0070704_100124348 | 3300005549 | Bacteria | 1987 |
| 308 | Ga0070704_100878593 | 3300005549 | Bacteria | 805 |
| 309 | Ga0068855_100000450 | 3300005563 | Bacteria | 50828 |
| 310 | Ga0068855_100005788 | 3300005563 | Bacteria | 15089 |
| 311 | Ga0068855_100007194 | 3300005563 | Bacteria | 13506 |
| 312 | Ga0068855_100025363 | 3300005563 | Bacteria | 7093 |
| 313 | Ga0068855_100134541 | 3300005563 | Bacteria | 2821 |
| 314 | Ga0068855_100243201 | 3300005563 | Bacteria | 2010 |
| 315 | Ga0068855_100285704 | 3300005563 | Bacteria | 1830 |
| 316 | Ga0068855_100399376 | 3300005563 | Bacteria | 1506 |
| 317 | Ga0068855_100437942 | 3300005563 | Bacteria | 1428 |
| 318 | Ga0068855_101358125 | 3300005563 | Bacteria | 734 |
| 319 | Ga0070664_100000658 | 3300005564 | Bacteria | 26393 |
| 320 | Ga0070664_100002704 | 3300005564 | Bacteria | 14316 |
| 321 | Ga0070664_100019104 | 3300005564 | Bacteria | 5635 |
| 322 | Ga0070664_100041993 | 3300005564 | Bacteria | 3861 |
| 323 | Ga0070664_100083651 | 3300005564 | Bacteria | 2753 |
| 324 | Ga0070664_100261851 | 3300005564 | Bacteria | 1556 |
| 325 | Ga0070664_100309288 | 3300005564 | Bacteria | 1430 |
| 326 | Ga0070664_100452004 | 3300005564 | Bacteria | 1180 |
| 327 | Ga0070664_100492939 | 3300005564 | Bacteria | 1129 |
| 328 | Ga0070664_100729429 | 3300005564 | Bacteria | 924 |
| 329 | Ga0070664_101202464 | 3300005564 | Bacteria | 715 |
| 330 | Ga0068857_100005799 | 3300005577 | Bacteria | 10556 |
| 331 | Ga0068857_100086667 | 3300005577 | Bacteria | 2800 |
| 332 | Ga0068857_100098008 | 3300005577 | Bacteria | 2629 |
| 333 | Ga0068857_100128153 | 3300005577 | Bacteria | 2287 |
| 334 | Ga0068857_100594720 | 3300005577 | Bacteria | 1045 |
| 335 | Ga0068857_100687870 | 3300005577 | Bacteria | 971 |
| 336 | Ga0068857_100815666 | 3300005577 | Bacteria | 891 |
| 337 | Ga0068854_100013441 | 3300005578 | Bacteria | 5374 |
| 338 | Ga0068854_100030042 | 3300005578 | Bacteria | 3766 |
| 339 | Ga0068854_100041866 | 3300005578 | Bacteria | 3238 |
| 340 | Ga0068854_100050573 | 3300005578 | Bacteria | 2974 |
| 341 | Ga0068854_100113282 | 3300005578 | Bacteria | 2049 |
| 342 | Ga0068854_100266585 | 3300005578 | Bacteria | 1373 |
| 343 | Ga0068856_100000350 | 3300005614 | Bacteria | 50393 |
| 344 | Ga0068856_100006095 | 3300005614 | Bacteria | 11842 |
| 345 | Ga0068856_100021309 | 3300005614 | Bacteria | 6298 |
| 346 | Ga0068856_100032074 | 3300005614 | Bacteria | 5142 |
| 347 | Ga0068856_100074182 | 3300005614 | Bacteria | 3368 |
| 348 | Ga0070702_100014764 | 3300005615 | Bacteria | 3970 |
| 349 | Ga0070702_100428814 | 3300005615 | Bacteria | 954 |
| 350 | Ga0070702_100610941 | 3300005615 | Bacteria | 819 |
| 351 | Ga0070702_100724592 | 3300005615 | Bacteria | 761 |
| 352 | Ga0070702_100774019 | 3300005615 | Bacteria | 739 |
| 353 | Ga0068852_100000823 | 3300005616 | Bacteria | 20478 |
| 354 | Ga0068852_100000940 | 3300005616 | Bacteria | 19237 |
| 355 | Ga0068852_100006323 | 3300005616 | Bacteria | 8545 |
| 356 | Ga0068852_100008545 | 3300005616 | Bacteria | 7552 |
| 357 | Ga0068852_100032464 | 3300005616 | Bacteria | 4324 |
| 358 | Ga0068852_100035269 | 3300005616 | Bacteria | 4171 |
| 359 | Ga0068852_100101705 | 3300005616 | Bacteria | 2596 |
| 360 | Ga0068852_100129902 | 3300005616 | Bacteria | 2319 |
| 361 | Ga0068852_100225160 | 3300005616 | Bacteria | 1785 |
| 362 | Ga0068859_100001741 | 3300005617 | Bacteria | 22164 |
| 363 | Ga0068859_100006755 | 3300005617 | Bacteria | 11649 |
| 364 | Ga0068859_100013682 | 3300005617 | Bacteria | 8133 |
| 365 | Ga0068859_100015466 | 3300005617 | Bacteria | 7665 |
| 366 | Ga0068859_100018437 | 3300005617 | Bacteria | 7015 |
| 367 | Ga0068859_100146194 | 3300005617 | Bacteria | 2439 |
| 368 | Ga0068859_100241082 | 3300005617 | Bacteria | 1897 |
| 369 | Ga0068859_100437758 | 3300005617 | Bacteria | 1403 |
| 370 | Ga0068859_100692971 | 3300005617 | Bacteria | 1110 |
| 371 | Ga0068864_100004626 | 3300005618 | Bacteria | 11286 |
| 372 | Ga0068864_100008845 | 3300005618 | Bacteria | 8303 |
| 373 | Ga0068864_100040417 | 3300005618 | Bacteria | 3990 |
| 374 | Ga0068864_100079555 | 3300005618 | Bacteria | 2870 |
| 375 | Ga0068864_100182425 | 3300005618 | Bacteria | 1920 |
| 376 | Ga0068864_100366211 | 3300005618 | Bacteria | 1363 |
| 377 | Ga0068864_100527486 | 3300005618 | Bacteria | 1139 |
| 378 | Ga0068864_100665022 | 3300005618 | Bacteria | 1015 |
| 379 | Ga0068864_100713124 | 3300005618 | Bacteria | 981 |
| 380 | Ga0068864_100904203 | 3300005618 | Bacteria | 872 |
| 381 | Ga0068864_101182483 | 3300005618 | Bacteria | 763 |
| 382 | Ga0068864_101335995 | 3300005618 | Bacteria | 718 |
| 383 | Ga0068866_10001140 | 3300005718 | Bacteria | 11673 |
| 384 | Ga0068866_10142945 | 3300005718 | Bacteria | 1376 |
| 385 | Ga0068866_10914367 | 3300005718 | Bacteria | 618 |
| 386 | Ga0068861_100020343 | 3300005719 | Bacteria | 4752 |
| 387 | Ga0068861_100021902 | 3300005719 | Bacteria | 4597 |
| 388 | Ga0068861_100133909 | 3300005719 | Bacteria | 2014 |
| 389 | Ga0068861_100538340 | 3300005719 | Bacteria | 1062 |
| 390 | Ga0068861_100830338 | 3300005719 | Unclassified | 870 |
| 391 | Ga0068861_101114476 | 3300005719 | Bacteria | 759 |
| 392 | Ga0068861_101217472 | 3300005719 | Bacteria | 729 |
| 393 | Ga0068851_10002888 | 3300005834 | Bacteria | 7590 |
| 394 | Ga0068851_10010098 | 3300005834 | Bacteria | 4398 |
| 395 | Ga0068851_10015536 | 3300005834 | Bacteria | 3629 |
| 396 | Ga0068851_10017493 | 3300005834 | Bacteria | 3444 |
| 397 | Ga0068851_10045665 | 3300005834 | Bacteria | 2214 |
| 398 | Ga0068851_10102684 | 3300005834 | Bacteria | 1519 |
| 399 | Ga0068851_10462328 | 3300005834 | Bacteria | 756 |
| 400 | Ga0068870_10011295 | 3300005840 | Bacteria | 4136 |
| 401 | Ga0068870_10013697 | 3300005840 | Bacteria | 3818 |
| 402 | Ga0068870_10024771 | 3300005840 | Bacteria | 2971 |
| 403 | Ga0068870_10146490 | 3300005840 | Bacteria | 1387 |
| 404 | Ga0068870_10155989 | 3300005840 | Bacteria | 1349 |
| 405 | Ga0068870_10427668 | 3300005840 | Bacteria | 868 |
| 406 | Ga0068870_10434541 | 3300005840 | Bacteria | 862 |
| 407 | Ga0068863_100007778 | 3300005841 | Bacteria | 10479 |
| 408 | Ga0068863_100010341 | 3300005841 | Bacteria | 9063 |
| 409 | Ga0068863_100017079 | 3300005841 | Bacteria | 6959 |
| 410 | Ga0068863_100017142 | 3300005841 | Bacteria | 6946 |
| 411 | Ga0068863_100089280 | 3300005841 | Bacteria | 2922 |
| 412 | Ga0068863_100089474 | 3300005841 | Bacteria | 2919 |
| 413 | Ga0068863_100152609 | 3300005841 | Bacteria | 2211 |
| 414 | Ga0068863_100381561 | 3300005841 | Bacteria | 1376 |
| 415 | Ga0068863_100410416 | 3300005841 | Bacteria | 1326 |
| 416 | Ga0068863_100462731 | 3300005841 | Bacteria | 1246 |
| 417 | Ga0068863_100503377 | 3300005841 | Bacteria | 1193 |
| 418 | Ga0068863_100717650 | 3300005841 | Bacteria | 994 |
| 419 | Ga0068858_100005201 | 3300005842 | Bacteria | 12750 |
| 420 | Ga0068858_100007116 | 3300005842 | Bacteria | 10863 |
| 421 | Ga0068858_100008383 | 3300005842 | Bacteria | 9942 |
| 422 | Ga0068858_100025618 | 3300005842 | Bacteria | 5488 |
| 423 | Ga0068858_100031012 | 3300005842 | Bacteria | 4965 |
| 424 | Ga0068858_100038624 | 3300005842 | Bacteria | 4429 |
| 425 | Ga0068858_100097462 | 3300005842 | Bacteria | 2741 |
| 426 | Ga0068858_100112030 | 3300005842 | Bacteria | 2548 |
| 427 | Ga0068858_100248656 | 3300005842 | Bacteria | 1689 |
| 428 | Ga0068858_100554054 | 3300005842 | Bacteria | 1113 |
| 429 | Ga0068858_101128837 | 3300005842 | Bacteria | 770 |
| 430 | Ga0068860_100003853 | 3300005843 | Bacteria | 15413 |
| 431 | Ga0068860_100006923 | 3300005843 | Bacteria | 11363 |
| 432 | Ga0068860_100028491 | 3300005843 | Bacteria | 5376 |
| 433 | Ga0068860_100049948 | 3300005843 | Bacteria | 3983 |
| 434 | Ga0068860_100058629 | 3300005843 | Bacteria | 3660 |
| 435 | Ga0068860_100103036 | 3300005843 | Bacteria | 2724 |
| 436 | Ga0068860_100118186 | 3300005843 | Bacteria | 2537 |
| 437 | Ga0068860_100142833 | 3300005843 | Bacteria | 2302 |
| 438 | Ga0068860_100272969 | 3300005843 | Bacteria | 1651 |
| 439 | Ga0068860_100289383 | 3300005843 | Bacteria | 1603 |
| 440 | Ga0068860_100438342 | 3300005843 | Bacteria | 1297 |
| 441 | Ga0068860_100466196 | 3300005843 | Bacteria | 1257 |
| 442 | Ga0068860_100640400 | 3300005843 | Bacteria | 1070 |
| 443 | Ga0068862_100007988 | 3300005844 | Bacteria | 8753 |
| 444 | Ga0068862_100016343 | 3300005844 | Bacteria | 6176 |
| 445 | Ga0068862_100022934 | 3300005844 | Bacteria | 5226 |
| 446 | Ga0068862_100045373 | 3300005844 | Bacteria | 3750 |
| 447 | Ga0068862_100206038 | 3300005844 | Bacteria | 1775 |
| 448 | Ga0070715_10497504 | 3300006163 | Bacteria | 697 |
| 449 | Ga0070716_100016651 | 3300006173 | Bacteria | 3799 |
| 450 | Ga0070716_100301596 | 3300006173 | Bacteria | 1115 |
| 451 | Ga0070716_101018324 | 3300006173 | Bacteria | 656 |
| 452 | Ga0070712_100003612 | 3300006175 | Bacteria | 9538 |
| 453 | Ga0070712_100004881 | 3300006175 | Bacteria | 8295 |
| 454 | Ga0070712_100635049 | 3300006175 | Bacteria | 906 |
| 455 | Ga0070712_100911020 | 3300006175 | Bacteria | 758 |
| 456 | Ga0075362_10059457 | 3300006177 | Bacteria | 1726 |
| 457 | Ga0075367_10389397 | 3300006178 | Bacteria | 881 |
| 458 | Ga0075366_10161046 | 3300006195 | Bacteria | 1360 |
| 459 | Ga0075366_10223903 | 3300006195 | Bacteria | 1146 |
| 460 | Ga0075366_10569283 | 3300006195 | Bacteria | 702 |
| 461 | Ga0097621_100005070 | 3300006237 | Bacteria | 9257 |
| 462 | Ga0097621_100011618 | 3300006237 | Bacteria | 6493 |
| 463 | Ga0097621_100014528 | 3300006237 | Bacteria | 5896 |
| 464 | Ga0097621_100059433 | 3300006237 | Bacteria | 3130 |
| 465 | Ga0097621_100085160 | 3300006237 | Bacteria | 2636 |
| 466 | Ga0097621_100112531 | 3300006237 | Bacteria | 2302 |
| 467 | Ga0097621_100175283 | 3300006237 | Bacteria | 1851 |
| 468 | Ga0097621_100206410 | 3300006237 | Bacteria | 1707 |
| 469 | Ga0097621_100211255 | 3300006237 | Bacteria | 1688 |
| 470 | Ga0097621_100213448 | 3300006237 | Bacteria | 1679 |
| 471 | Ga0097621_100970915 | 3300006237 | Bacteria | 794 |
| 472 | Ga0097621_101005143 | 3300006237 | Bacteria | 780 |
| 473 | Ga0097621_101014047 | 3300006237 | Bacteria | 777 |
| 474 | Ga0075370_10007832 | 3300006353 | Bacteria | 5464 |
| 475 | Ga0075370_10301590 | 3300006353 | Bacteria | 953 |
| 476 | Ga0068871_100004840 | 3300006358 | Bacteria | 9410 |
| 477 | Ga0068871_100009792 | 3300006358 | Bacteria | 6954 |
| 478 | Ga0068871_100032204 | 3300006358 | Bacteria | 4140 |
| 479 | Ga0068871_100111440 | 3300006358 | Bacteria | 2302 |
| 480 | Ga0068871_100223181 | 3300006358 | Bacteria | 1633 |
| 481 | Ga0068871_100228649 | 3300006358 | Bacteria | 1614 |
| 482 | Ga0068871_100275257 | 3300006358 | Bacteria | 1471 |
| 483 | Ga0075428_100027531 | 3300006844 | Bacteria | 6290 |
| 484 | Ga0075428_101296960 | 3300006844 | Bacteria | 766 |
| 485 | Ga0075434_100007245 | 3300006871 | Bacteria | 10262 |
| 486 | Ga0075434_100336236 | 3300006871 | Bacteria | 1531 |
| 487 | Ga0075429_100001051 | 3300006880 | Bacteria | 22037 |
| 488 | Ga0075429_100414980 | 3300006880 | Bacteria | 1179 |
| 489 | Ga0068865_100006023 | 3300006881 | Bacteria | 7387 |
| 490 | Ga0068865_100017868 | 3300006881 | Bacteria | 4568 |
| 491 | Ga0068865_100144694 | 3300006881 | Bacteria | 1796 |
| 492 | Ga0068865_100204565 | 3300006881 | Bacteria | 1535 |
| 493 | Ga0068865_101512517 | 3300006881 | Bacteria | 602 |
| 494 | Ga0075436_100189631 | 3300006914 | Bacteria | 1454 |
| 495 | Ga0075436_100299875 | 3300006914 | Bacteria | 1152 |
| 496 | Ga0097620_100001741 | 3300006931 | Bacteria | 22164 |
| 497 | Ga0097620_100006755 | 3300006931 | Bacteria | 11649 |
| 498 | Ga0097620_100013682 | 3300006931 | Bacteria | 8133 |
| 499 | Ga0097620_100015466 | 3300006931 | Bacteria | 7665 |
| 500 | Ga0097620_100018437 | 3300006931 | Bacteria | 7015 |
| 501 | Ga0097620_100146188 | 3300006931 | Bacteria | 2439 |
| 502 | Ga0097620_100241073 | 3300006931 | Bacteria | 1897 |
| 503 | Ga0097620_100437775 | 3300006931 | Bacteria | 1403 |
| 504 | Ga0097620_100693026 | 3300006931 | Bacteria | 1110 |
| 505 | Ga0079104_1000001 | 3300006946 | Bacteria | 521847 |
| 506 | Ga0075435_100091917 | 3300007076 | Bacteria | 2505 |
| 507 | Ga0099794_10014365 | 3300007265 | Bacteria | 3469 |
| 508 | Ga0099794_10019347 | 3300007265 | Bacteria | 3066 |
| 509 | Ga0099794_10030122 | 3300007265 | Bacteria | 2532 |
| 510 | Ga0105240_10001889 | 3300009093 | Bacteria | 34824 |
| 511 | Ga0105240_10008787 | 3300009093 | Bacteria | 14390 |
| 512 | Ga0105240_10013727 | 3300009093 | Bacteria | 11102 |
| 513 | Ga0105240_10022316 | 3300009093 | Bacteria | 8396 |
| 514 | Ga0105240_11738242 | 3300009093 | Bacteria | 651 |
| 515 | Ga0111539_10077714 | 3300009094 | Bacteria | 3906 |
| 516 | Ga0111539_10868363 | 3300009094 | Bacteria | 1049 |
| 517 | Ga0105245_10009343 | 3300009098 | Bacteria | 8553 |
| 518 | Ga0105245_10009415 | 3300009098 | Bacteria | 8519 |
| 519 | Ga0105245_10035818 | 3300009098 | Bacteria | 4406 |
| 520 | Ga0105245_10082944 | 3300009098 | Bacteria | 2933 |
| 521 | Ga0105245_10492541 | 3300009098 | Bacteria | 1241 |
| 522 | Ga0105245_10932365 | 3300009098 | Bacteria | 911 |
| 523 | Ga0105245_11873599 | 3300009098 | Bacteria | 653 |
| 524 | Ga0105247_10018997 | 3300009101 | Bacteria | 4128 |
| 525 | Ga0105247_10072757 | 3300009101 | Bacteria | 2152 |
| 526 | Ga0114129_10272777 | 3300009147 | Bacteria | 2263 |
| 527 | Ga0105243_11837791 | 3300009148 | Bacteria | 637 |
| 528 | Ga0105241_10006963 | 3300009174 | Bacteria | 8316 |
| 529 | Ga0105241_10011046 | 3300009174 | Bacteria | 6625 |
| 530 | Ga0105241_10063871 | 3300009174 | Bacteria | 2842 |
| 531 | Ga0105241_10692202 | 3300009174 | Bacteria | 930 |
| 532 | Ga0105241_11250830 | 3300009174 | Bacteria | 705 |
| 533 | Ga0105241_11337483 | 3300009174 | Bacteria | 684 |
| 534 | Ga0105242_10008131 | 3300009176 | Bacteria | 8072 |
| 535 | Ga0105242_10077721 | 3300009176 | Bacteria | 2769 |
| 536 | Ga0105242_10258737 | 3300009176 | Bacteria | 1571 |
| 537 | Ga0105248_10000878 | 3300009177 | Bacteria | 33719 |
| 538 | Ga0105248_10003568 | 3300009177 | Bacteria | 17250 |
| 539 | Ga0105248_10013308 | 3300009177 | Bacteria | 9056 |
| 540 | Ga0105248_10057367 | 3300009177 | Bacteria | 4371 |
| 541 | Ga0105248_10081931 | 3300009177 | Bacteria | 3628 |
| 542 | Ga0105248_10101263 | 3300009177 | Bacteria | 3247 |
| 543 | Ga0105248_10276297 | 3300009177 | Bacteria | 1891 |
| 544 | Ga0105248_10759452 | 3300009177 | Bacteria | 1094 |
| 545 | Ga0105248_11098406 | 3300009177 | Bacteria | 899 |
| 546 | Ga0105237_10024857 | 3300009545 | Bacteria | 6128 |
| 547 | Ga0105237_10053862 | 3300009545 | Bacteria | 4034 |
| 548 | Ga0105237_10078968 | 3300009545 | Bacteria | 3281 |
| 549 | Ga0105237_10114390 | 3300009545 | Bacteria | 2691 |
| 550 | Ga0105237_10300962 | 3300009545 | Bacteria | 1607 |
| 551 | Ga0105237_11011002 | 3300009545 | Bacteria | 838 |
| 552 | Ga0105237_11911226 | 3300009545 | Bacteria | 602 |
| 553 | Ga0105238_10009503 | 3300009551 | Bacteria | 9731 |
| 554 | Ga0105238_10035807 | 3300009551 | Bacteria | 5045 |
| 555 | Ga0105238_10331229 | 3300009551 | Bacteria | 1509 |
| 556 | Ga0105238_11640935 | 3300009551 | Bacteria | 673 |
| 557 | Ga0105238_12411654 | 3300009551 | Bacteria | 562 |
| 558 | Ga0105249_10140898 | 3300009553 | Bacteria | 2312 |
| 559 | Ga0105249_10157207 | 3300009553 | Bacteria | 2194 |
| 560 | Ga0105249_10188866 | 3300009553 | Bacteria | 2010 |
| 561 | Ga0105249_10317138 | 3300009553 | Bacteria | 1569 |
| 562 | Ga0105249_10669218 | 3300009553 | Bacteria | 1097 |
| 563 | Ga0105249_11075945 | 3300009553 | Bacteria | 874 |
| 564 | Ga0105239_10170886 | 3300010375 | Bacteria | 2431 |
| 565 | Ga0105239_10696001 | 3300010375 | Bacteria | 1162 |
| 566 | Ga0105239_10932774 | 3300010375 | Bacteria | 997 |
| 567 | Ga0105239_11507199 | 3300010375 | Bacteria | 777 |
| 568 | Ga0105246_10023747 | 3300011119 | Bacteria | 3971 |
| 569 | Ga0105246_10145440 | 3300011119 | Bacteria | 1788 |
| 570 | Ga0157373_10001063 | 3300013100 | Bacteria | 21146 |
| 571 | Ga0157373_10013745 | 3300013100 | Bacteria | 5935 |
| 572 | Ga0157373_10170001 | 3300013100 | Bacteria | 1534 |
| 573 | Ga0157371_10001162 | 3300013102 | Bacteria | 28274 |
| 574 | Ga0157371_10695242 | 3300013102 | Bacteria | 761 |
| 575 | Ga0157371_10703964 | 3300013102 | Bacteria | 756 |
| 576 | Ga0157371_10804122 | 3300013102 | Bacteria | 709 |
| 577 | Ga0157370_10018289 | 3300013104 | Bacteria | 7050 |
| 578 | Ga0157370_10042167 | 3300013104 | Bacteria | 4399 |
| 579 | Ga0157370_10046754 | 3300013104 | Bacteria | 4150 |
| 580 | Ga0157370_10114567 | 3300013104 | Bacteria | 2518 |
| 581 | Ga0157370_10361564 | 3300013104 | Bacteria | 1337 |
| 582 | Ga0157370_10683768 | 3300013104 | Bacteria | 937 |
| 583 | Ga0157370_10734214 | 3300013104 | Bacteria | 900 |
| 584 | Ga0157369_10002639 | 3300013105 | Bacteria | 21418 |
| 585 | Ga0157369_10054350 | 3300013105 | Bacteria | 4325 |
| 586 | Ga0157369_10203685 | 3300013105 | Bacteria | 2076 |
| 587 | Ga0157369_10229695 | 3300013105 | Bacteria | 1940 |
| 588 | Ga0157369_10275373 | 3300013105 | Bacteria | 1753 |
| 589 | Ga0157369_10412080 | 3300013105 | Bacteria | 1401 |
| 590 | Ga0157369_10442483 | 3300013105 | Bacteria | 1346 |
| 591 | Ga0157369_11160926 | 3300013105 | Bacteria | 789 |
| 592 | Ga0157374_10001809 | 3300013296 | Bacteria | 18004 |
| 593 | Ga0157374_10035751 | 3300013296 | Bacteria | 4546 |
| 594 | Ga0157374_10035915 | 3300013296 | Bacteria | 4537 |
| 595 | Ga0157374_10133566 | 3300013296 | Bacteria | 2404 |
| 596 | Ga0157374_10215766 | 3300013296 | Bacteria | 1882 |
| 597 | Ga0157374_10659770 | 3300013296 | Bacteria | 1058 |
| 598 | Ga0157374_10700986 | 3300013296 | Bacteria | 1025 |
| 599 | Ga0157374_11543223 | 3300013296 | Bacteria | 688 |
| 600 | Ga0157378_10009283 | 3300013297 | Bacteria | 8568 |
| 601 | Ga0157378_10009954 | 3300013297 | Bacteria | 8288 |
| 602 | Ga0157378_10030000 | 3300013297 | Bacteria | 4803 |
| 603 | Ga0157378_10401907 | 3300013297 | Bacteria | 1350 |
| 604 | Ga0157378_10654335 | 3300013297 | Bacteria | 1067 |
| 605 | Ga0163162_10001211 | 3300013306 | Bacteria | 24106 |
| 606 | Ga0163162_10011811 | 3300013306 | Bacteria | 8518 |
| 607 | Ga0163162_10096594 | 3300013306 | Bacteria | 3043 |
| 608 | Ga0163162_10201399 | 3300013306 | Bacteria | 2119 |
| 609 | Ga0163162_10328857 | 3300013306 | Bacteria | 1661 |
| 610 | Ga0163162_10617676 | 3300013306 | Bacteria | 1209 |
| 611 | Ga0163162_10717152 | 3300013306 | Bacteria | 1121 |
| 612 | Ga0163162_10934839 | 3300013306 | Bacteria | 979 |
| 613 | Ga0157372_10001523 | 3300013307 | Bacteria | 25194 |
| 614 | Ga0157372_10001692 | 3300013307 | Bacteria | 23859 |
| 615 | Ga0157372_10006706 | 3300013307 | Bacteria | 12248 |
| 616 | Ga0157372_10021790 | 3300013307 | Bacteria | 6926 |
| 617 | Ga0157372_10038529 | 3300013307 | Bacteria | 5275 |
| 618 | Ga0157372_10057008 | 3300013307 | Bacteria | 4366 |
| 619 | Ga0157372_10125179 | 3300013307 | Bacteria | 2955 |
| 620 | Ga0157372_10127426 | 3300013307 | Bacteria | 2927 |
| 621 | Ga0157372_10235050 | 3300013307 | Bacteria | 2125 |
| 622 | Ga0157372_10342593 | 3300013307 | Bacteria | 1741 |
| 623 | Ga0157372_10611369 | 3300013307 | Bacteria | 1270 |
| 624 | Ga0157372_10653370 | 3300013307 | Bacteria | 1225 |
| 625 | Ga0157372_11040013 | 3300013307 | Bacteria | 948 |
| 626 | Ga0157372_11081066 | 3300013307 | Bacteria | 928 |
| 627 | Ga0157372_11268004 | 3300013307 | Bacteria | 851 |
| 628 | Ga0157375_10005469 | 3300013308 | Bacteria | 11045 |
| 629 | Ga0157375_10008616 | 3300013308 | Bacteria | 8929 |
| 630 | Ga0157375_10009546 | 3300013308 | Bacteria | 8518 |
| 631 | Ga0157375_10030473 | 3300013308 | Bacteria | 5087 |
| 632 | Ga0157375_10139594 | 3300013308 | Bacteria | 2549 |
| 633 | Ga0157375_10160405 | 3300013308 | Bacteria | 2390 |
| 634 | Ga0157375_10192365 | 3300013308 | Bacteria | 2195 |
| 635 | Ga0157375_10341164 | 3300013308 | Bacteria | 1664 |
| 636 | Ga0157375_11331140 | 3300013308 | Bacteria | 845 |
| 637 | Ga0163163_10001352 | 3300014325 | Bacteria | 20693 |
| 638 | Ga0163163_10005124 | 3300014325 | Bacteria | 11296 |
| 639 | Ga0163163_10017644 | 3300014325 | Bacteria | 6662 |
| 640 | Ga0163163_10116185 | 3300014325 | Bacteria | 2707 |
| 641 | Ga0163163_10129546 | 3300014325 | Bacteria | 2563 |
| 642 | Ga0163163_10277309 | 3300014325 | Bacteria | 1728 |
| 643 | Ga0163163_10788761 | 3300014325 | Bacteria | 1013 |
| 644 | Ga0163163_11206576 | 3300014325 | Bacteria | 819 |
| 645 | Ga0157380_10075229 | 3300014326 | Bacteria | 2744 |
| 646 | Ga0157380_10127469 | 3300014326 | Bacteria | 2166 |
| 647 | Ga0157380_10183319 | 3300014326 | Bacteria | 1841 |
| 648 | Ga0157380_10323229 | 3300014326 | Bacteria | 1431 |
| 649 | Ga0157380_10406241 | 3300014326 | Bacteria | 1294 |
| 650 | Ga0157380_11896899 | 3300014326 | Bacteria | 656 |
| 651 | Ga0157377_10005762 | 3300014745 | Bacteria | 5846 |
| 652 | Ga0157377_10020805 | 3300014745 | Bacteria | 3442 |
| 653 | Ga0157377_10192613 | 3300014745 | Bacteria | 1289 |
| 654 | Ga0157377_10354686 | 3300014745 | Bacteria | 985 |
| 655 | Ga0157379_10003084 | 3300014968 | Bacteria | 14092 |
| 656 | Ga0157379_10006078 | 3300014968 | Bacteria | 10396 |
| 657 | Ga0157379_10014992 | 3300014968 | Bacteria | 6798 |
| 658 | Ga0157379_10044107 | 3300014968 | Bacteria | 3981 |
| 659 | Ga0157379_10094110 | 3300014968 | Bacteria | 2688 |
| 660 | Ga0157379_10177073 | 3300014968 | Bacteria | 1926 |
| 661 | Ga0157379_10290174 | 3300014968 | Bacteria | 1490 |
| 662 | Ga0157379_10295756 | 3300014968 | Bacteria | 1475 |
| 663 | Ga0157379_10877914 | 3300014968 | Bacteria | 850 |
| 664 | Ga0157376_10005980 | 3300014969 | Bacteria | 8550 |
| 665 | Ga0157376_10006034 | 3300014969 | Bacteria | 8519 |
| 666 | Ga0157376_10008657 | 3300014969 | Bacteria | 7355 |
| 667 | Ga0157376_10021115 | 3300014969 | Bacteria | 5053 |
| 668 | Ga0157376_10056422 | 3300014969 | Bacteria | 3281 |
| 669 | Ga0157376_10108541 | 3300014969 | Bacteria | 2438 |
| 670 | Ga0157376_10156469 | 3300014969 | Bacteria | 2061 |
| 671 | Ga0157376_10216043 | 3300014969 | Bacteria | 1773 |
| 672 | Ga0157376_10268444 | 3300014969 | Bacteria | 1602 |
| 673 | Ga0157376_10329577 | 3300014969 | Bacteria | 1454 |
| 674 | Ga0157376_10432172 | 3300014969 | Bacteria | 1280 |
| 675 | Ga0163161_10091924 | 3300017792 | Bacteria | 2246 |
| 676 | Ga0163161_10292088 | 3300017792 | Bacteria | 1281 |
| 677 | Ga0206356_10378156 | 3300020070 | Bacteria | 879 |
| 678 | Ga0206354_10831956 | 3300020081 | Bacteria | 2348 |
| 679 | Ga0206353_10348253 | 3300020082 | Bacteria | 1932 |
| 680 | Ga0213872_10010960 | 3300021361 | Bacteria | 4300 |
| 681 | Ga0209565_1008854 | 3300025263 | Bacteria | 2605 |
| 682 | Ga0209050_1000118 | 3300025298 | Bacteria | 202586 |
| 683 | Ga0209256_1000015 | 3300025299 | Bacteria | 622953 |
| 684 | Ga0209051_1048365 | 3300025303 | Bacteria | 1443 |
| 685 | Ga0207697_10001322 | 3300025315 | Bacteria | 13639 |
| 686 | Ga0207697_10006351 | 3300025315 | Bacteria | 5356 |
| 687 | Ga0207697_10064319 | 3300025315 | Bacteria | 1530 |
| 688 | Ga0207656_10021638 | 3300025321 | Bacteria | 2572 |
| 689 | Ga0207656_10040066 | 3300025321 | Bacteria | 1985 |
| 690 | Ga0207656_10110599 | 3300025321 | Bacteria | 1269 |
| 691 | Ga0207656_10436309 | 3300025321 | Bacteria | 661 |
| 692 | Ga0207682_10001314 | 3300025893 | Bacteria | 11425 |
| 693 | Ga0207682_10066945 | 3300025893 | Bacteria | 1514 |
| 694 | Ga0207692_10151398 | 3300025898 | Bacteria | 1329 |
| 695 | Ga0207692_10243228 | 3300025898 | Bacteria | 1075 |
| 696 | Ga0207692_10742301 | 3300025898 | Bacteria | 639 |
| 697 | Ga0207642_10049883 | 3300025899 | Bacteria | 1884 |
| 698 | Ga0207642_10059991 | 3300025899 | Bacteria | 1762 |
| 699 | Ga0207642_10086113 | 3300025899 | Bacteria | 1539 |
| 700 | Ga0207642_10228143 | 3300025899 | Bacteria | 1045 |
| 701 | Ga0207710_10224370 | 3300025900 | Bacteria | 934 |
| 702 | Ga0207710_10274693 | 3300025900 | Bacteria | 847 |
| 703 | Ga0207688_10040755 | 3300025901 | Bacteria | 2581 |
| 704 | Ga0207688_10137724 | 3300025901 | Bacteria | 1435 |
| 705 | Ga0207680_10002102 | 3300025903 | Bacteria | 9324 |
| 706 | Ga0207680_10002576 | 3300025903 | Bacteria | 8460 |
| 707 | Ga0207680_10006510 | 3300025903 | Bacteria | 5654 |
| 708 | Ga0207680_10130197 | 3300025903 | Bacteria | 1657 |
| 709 | Ga0207680_10778992 | 3300025903 | Unclassified | 686 |
| 710 | Ga0207685_10052916 | 3300025905 | Bacteria | 1574 |
| 711 | Ga0207699_10020977 | 3300025906 | Bacteria | 3512 |
| 712 | Ga0207699_10045839 | 3300025906 | Bacteria | 2554 |
| 713 | Ga0207699_10156363 | 3300025906 | Bacteria | 1513 |
| 714 | Ga0207699_10542025 | 3300025906 | Bacteria | 843 |
| 715 | Ga0207699_10891022 | 3300025906 | Bacteria | 656 |
| 716 | Ga0207645_10000214 | 3300025907 | Bacteria | 48041 |
| 717 | Ga0207645_10000421 | 3300025907 | Bacteria | 35045 |
| 718 | Ga0207645_10000695 | 3300025907 | Bacteria | 27978 |
| 719 | Ga0207645_10051776 | 3300025907 | Bacteria | 2623 |
| 720 | Ga0207645_10221952 | 3300025907 | Bacteria | 1246 |
| 721 | Ga0207643_10000537 | 3300025908 | Bacteria | 24350 |
| 722 | Ga0207643_10006837 | 3300025908 | Bacteria | 6123 |
| 723 | Ga0207643_10031135 | 3300025908 | Bacteria | 2972 |
| 724 | Ga0207643_10190696 | 3300025908 | Bacteria | 1244 |
| 725 | Ga0207705_10029140 | 3300025909 | Bacteria | 3935 |
| 726 | Ga0207705_10046332 | 3300025909 | Bacteria | 3125 |
| 727 | Ga0207705_10125004 | 3300025909 | Bacteria | 1911 |
| 728 | Ga0207705_10251199 | 3300025909 | Bacteria | 1349 |
| 729 | Ga0207705_10347690 | 3300025909 | Bacteria | 1142 |
| 730 | Ga0207705_10430450 | 3300025909 | Bacteria | 1022 |
| 731 | Ga0207684_10062559 | 3300025910 | Bacteria | 3160 |
| 732 | Ga0207654_10030084 | 3300025911 | Bacteria | 2978 |
| 733 | Ga0207654_10046536 | 3300025911 | Bacteria | 2474 |
| 734 | Ga0207654_10761391 | 3300025911 | Bacteria | 698 |
| 735 | Ga0207707_10002896 | 3300025912 | Bacteria | 15301 |
| 736 | Ga0207707_10012845 | 3300025912 | Bacteria | 7286 |
| 737 | Ga0207707_10741698 | 3300025912 | Bacteria | 822 |
| 738 | Ga0207695_10053255 | 3300025913 | Bacteria | 4233 |
| 739 | Ga0207695_10460568 | 3300025913 | Bacteria | 1155 |
| 740 | Ga0207695_11164634 | 3300025913 | Bacteria | 651 |
| 741 | Ga0207671_10053265 | 3300025914 | Bacteria | 2998 |
| 742 | Ga0207671_10333599 | 3300025914 | Bacteria | 1201 |
| 743 | Ga0207693_10000652 | 3300025915 | Bacteria | 31091 |
| 744 | Ga0207693_10257300 | 3300025915 | Bacteria | 1369 |
| 745 | Ga0207693_10465167 | 3300025915 | Bacteria | 988 |
| 746 | Ga0207663_10002608 | 3300025916 | Bacteria | 8679 |
| 747 | Ga0207663_10080045 | 3300025916 | Bacteria | 2135 |
| 748 | Ga0207660_10040475 | 3300025917 | Bacteria | 3263 |
| 749 | Ga0207660_10239956 | 3300025917 | Bacteria | 1428 |
| 750 | Ga0207662_10045518 | 3300025918 | Bacteria | 2594 |
| 751 | Ga0207662_10260182 | 3300025918 | Bacteria | 1142 |
| 752 | Ga0207657_10000750 | 3300025919 | Bacteria | 34395 |
| 753 | Ga0207657_10002560 | 3300025919 | Bacteria | 19672 |
| 754 | Ga0207657_10007901 | 3300025919 | Bacteria | 10850 |
| 755 | Ga0207657_10024835 | 3300025919 | Bacteria | 5539 |
| 756 | Ga0207657_10032956 | 3300025919 | Bacteria | 4674 |
| 757 | Ga0207649_10004987 | 3300025920 | Bacteria | 7171 |
| 758 | Ga0207649_10011486 | 3300025920 | Bacteria | 4884 |
| 759 | Ga0207649_10053399 | 3300025920 | Bacteria | 2511 |
| 760 | Ga0207649_10162744 | 3300025920 | Bacteria | 1547 |
| 761 | Ga0207649_10732780 | 3300025920 | Bacteria | 768 |
| 762 | Ga0207649_10918792 | 3300025920 | Bacteria | 687 |
| 763 | Ga0207652_10114356 | 3300025921 | Bacteria | 2396 |
| 764 | Ga0207652_10235188 | 3300025921 | Bacteria | 1651 |
| 765 | Ga0207652_10523802 | 3300025921 | Bacteria | 1066 |
| 766 | Ga0207646_10014581 | 3300025922 | Bacteria | 7454 |
| 767 | Ga0207646_11206169 | 3300025922 | Bacteria | 663 |
| 768 | Ga0207681_10029078 | 3300025923 | Bacteria | 3584 |
| 769 | Ga0207681_10062396 | 3300025923 | Bacteria | 2566 |
| 770 | Ga0207681_10200987 | 3300025923 | Bacteria | 1530 |
| 771 | Ga0207681_10301407 | 3300025923 | Bacteria | 1268 |
| 772 | Ga0207681_10318132 | 3300025923 | Bacteria | 1237 |
| 773 | Ga0207694_10005853 | 3300025924 | Bacteria | 9423 |
| 774 | Ga0207694_10016726 | 3300025924 | Bacteria | 5544 |
| 775 | Ga0207694_10041190 | 3300025924 | Bacteria | 3558 |
| 776 | Ga0207694_10323906 | 3300025924 | Bacteria | 1272 |
| 777 | Ga0207694_10498964 | 3300025924 | Bacteria | 1019 |
| 778 | Ga0207694_11520836 | 3300025924 | Bacteria | 565 |
| 779 | Ga0207650_10008724 | 3300025925 | Bacteria | 6923 |
| 780 | Ga0207650_10017230 | 3300025925 | Bacteria | 5056 |
| 781 | Ga0207650_10020685 | 3300025925 | Bacteria | 4644 |
| 782 | Ga0207650_10032090 | 3300025925 | Bacteria | 3799 |
| 783 | Ga0207650_10044419 | 3300025925 | Bacteria | 3265 |
| 784 | Ga0207650_10094251 | 3300025925 | Bacteria | 2293 |
| 785 | Ga0207650_10116313 | 3300025925 | Bacteria | 2076 |
| 786 | Ga0207650_10177971 | 3300025925 | Bacteria | 1694 |
| 787 | Ga0207650_10895675 | 3300025925 | Bacteria | 753 |
| 788 | Ga0207650_11345727 | 3300025925 | Bacteria | 608 |
| 789 | Ga0207659_10002136 | 3300025926 | Bacteria | 11725 |
| 790 | Ga0207659_10012703 | 3300025926 | Bacteria | 5372 |
| 791 | Ga0207659_10017200 | 3300025926 | Bacteria | 4719 |
| 792 | Ga0207659_10041351 | 3300025926 | Bacteria | 3228 |
| 793 | Ga0207659_10074554 | 3300025926 | Bacteria | 2487 |
| 794 | Ga0207659_10377670 | 3300025926 | Bacteria | 1181 |
| 795 | Ga0207687_10002403 | 3300025927 | Bacteria | 12697 |
| 796 | Ga0207687_10009624 | 3300025927 | Bacteria | 6317 |
| 797 | Ga0207687_10089592 | 3300025927 | Bacteria | 2240 |
| 798 | Ga0207687_11428951 | 3300025927 | Bacteria | 594 |
| 799 | Ga0207700_10006059 | 3300025928 | Bacteria | 7282 |
| 800 | Ga0207700_10006798 | 3300025928 | Bacteria | 6950 |
| 801 | Ga0207700_10061260 | 3300025928 | Bacteria | 2853 |
| 802 | Ga0207700_10302396 | 3300025928 | Bacteria | 1382 |
| 803 | Ga0207700_10386787 | 3300025928 | Bacteria | 1224 |
| 804 | Ga0207700_10742649 | 3300025928 | Bacteria | 877 |
| 805 | Ga0207700_11277872 | 3300025928 | Bacteria | 654 |
| 806 | Ga0207664_10000912 | 3300025929 | Bacteria | 19958 |
| 807 | Ga0207664_10055495 | 3300025929 | Bacteria | 3144 |
| 808 | Ga0207664_10462445 | 3300025929 | Bacteria | 1133 |
| 809 | Ga0207664_10534050 | 3300025929 | Bacteria | 1052 |
| 810 | Ga0207664_11133358 | 3300025929 | Bacteria | 699 |
| 811 | Ga0207644_10001317 | 3300025931 | Bacteria | 15943 |
| 812 | Ga0207644_10001544 | 3300025931 | Bacteria | 14840 |
| 813 | Ga0207644_10007546 | 3300025931 | Bacteria | 7092 |
| 814 | Ga0207644_10010859 | 3300025931 | Bacteria | 6012 |
| 815 | Ga0207644_10039904 | 3300025931 | Bacteria | 3316 |
| 816 | Ga0207644_10044769 | 3300025931 | Bacteria | 3146 |
| 817 | Ga0207644_10111826 | 3300025931 | Bacteria | 2066 |
| 818 | Ga0207644_10151743 | 3300025931 | Bacteria | 1793 |
| 819 | Ga0207644_10263945 | 3300025931 | Bacteria | 1378 |
| 820 | Ga0207644_10392191 | 3300025931 | Bacteria | 1133 |
| 821 | Ga0207644_10504612 | 3300025931 | Bacteria | 998 |
| 822 | Ga0207690_10000826 | 3300025932 | Bacteria | 19864 |
| 823 | Ga0207690_10018363 | 3300025932 | Bacteria | 4289 |
| 824 | Ga0207690_10024622 | 3300025932 | Bacteria | 3771 |
| 825 | Ga0207690_10028312 | 3300025932 | Bacteria | 3551 |
| 826 | Ga0207690_10265877 | 3300025932 | Bacteria | 1330 |
| 827 | Ga0207690_10273017 | 3300025932 | Bacteria | 1314 |
| 828 | Ga0207706_10000465 | 3300025933 | Bacteria | 43279 |
| 829 | Ga0207706_10004984 | 3300025933 | Bacteria | 12403 |
| 830 | Ga0207706_10008050 | 3300025933 | Bacteria | 9728 |
| 831 | Ga0207706_10013535 | 3300025933 | Bacteria | 7414 |
| 832 | Ga0207706_10141051 | 3300025933 | Bacteria | 2120 |
| 833 | Ga0207706_10219105 | 3300025933 | Bacteria | 1667 |
| 834 | Ga0207706_10228234 | 3300025933 | Bacteria | 1629 |
| 835 | Ga0207686_10016224 | 3300025934 | Bacteria | 4176 |
| 836 | Ga0207686_10081829 | 3300025934 | Bacteria | 2109 |
| 837 | Ga0207709_10193197 | 3300025935 | Bacteria | 1448 |
| 838 | Ga0207709_10226720 | 3300025935 | Bacteria | 1351 |
| 839 | Ga0207670_10008447 | 3300025936 | Bacteria | 5817 |
| 840 | Ga0207670_10028643 | 3300025936 | Bacteria | 3540 |
| 841 | Ga0207670_10041928 | 3300025936 | Bacteria | 3013 |
| 842 | Ga0207670_10122272 | 3300025936 | Bacteria | 1894 |
| 843 | Ga0207670_10226472 | 3300025936 | Bacteria | 1434 |
| 844 | Ga0207670_10644180 | 3300025936 | Bacteria | 873 |
| 845 | Ga0207670_10912645 | 3300025936 | Bacteria | 736 |
| 846 | Ga0207669_10016731 | 3300025937 | Bacteria | 3737 |
| 847 | Ga0207669_10049351 | 3300025937 | Bacteria | 2508 |
| 848 | Ga0207669_10062316 | 3300025937 | Bacteria | 2296 |
| 849 | Ga0207669_10168199 | 3300025937 | Bacteria | 1557 |
| 850 | Ga0207669_10219510 | 3300025937 | Bacteria | 1394 |
| 851 | Ga0207669_10349222 | 3300025937 | Bacteria | 1142 |
| 852 | Ga0207704_10003217 | 3300025938 | Bacteria | 7394 |
| 853 | Ga0207704_10051971 | 3300025938 | Bacteria | 2482 |
| 854 | Ga0207704_10089364 | 3300025938 | Bacteria | 2018 |
| 855 | Ga0207704_10159849 | 3300025938 | Bacteria | 1602 |
| 856 | Ga0207704_10514262 | 3300025938 | Bacteria | 967 |
| 857 | Ga0207704_10934686 | 3300025938 | Bacteria | 731 |
| 858 | Ga0207665_10006908 | 3300025939 | Bacteria | 7511 |
| 859 | Ga0207665_10439099 | 3300025939 | Bacteria | 1000 |
| 860 | Ga0207691_10000084 | 3300025940 | Bacteria | 80075 |
| 861 | Ga0207691_10000577 | 3300025940 | Bacteria | 36651 |
| 862 | Ga0207691_10001328 | 3300025940 | Bacteria | 24681 |
| 863 | Ga0207691_10007830 | 3300025940 | Bacteria | 10292 |
| 864 | Ga0207691_10009589 | 3300025940 | Bacteria | 9292 |
| 865 | Ga0207691_10024667 | 3300025940 | Bacteria | 5655 |
| 866 | Ga0207691_10050830 | 3300025940 | Bacteria | 3793 |
| 867 | Ga0207691_10133319 | 3300025940 | Bacteria | 2193 |
| 868 | Ga0207691_10168116 | 3300025940 | Bacteria | 1921 |
| 869 | Ga0207691_10277792 | 3300025940 | Bacteria | 1441 |
| 870 | Ga0207691_10304882 | 3300025940 | Bacteria | 1367 |
| 871 | Ga0207711_10000087 | 3300025941 | Bacteria | 98302 |
| 872 | Ga0207711_10068506 | 3300025941 | Bacteria | 3074 |
| 873 | Ga0207711_10079464 | 3300025941 | Bacteria | 2863 |
| 874 | Ga0207711_10554326 | 3300025941 | Bacteria | 1072 |
| 875 | Ga0207711_11864467 | 3300025941 | Bacteria | 544 |
| 876 | Ga0207689_10000069 | 3300025942 | Bacteria | 83053 |
| 877 | Ga0207689_10001822 | 3300025942 | Bacteria | 20138 |
| 878 | Ga0207689_10004226 | 3300025942 | Bacteria | 13059 |
| 879 | Ga0207689_10014272 | 3300025942 | Bacteria | 6760 |
| 880 | Ga0207689_10020777 | 3300025942 | Bacteria | 5522 |
| 881 | Ga0207689_10127315 | 3300025942 | Bacteria | 2095 |
| 882 | Ga0207689_10392687 | 3300025942 | Bacteria | 1156 |
| 883 | Ga0207661_10009752 | 3300025944 | Bacteria | 6897 |
| 884 | Ga0207661_10068005 | 3300025944 | Bacteria | 2899 |
| 885 | Ga0207661_10081925 | 3300025944 | Bacteria | 2667 |
| 886 | Ga0207661_10139313 | 3300025944 | Bacteria | 2086 |
| 887 | Ga0207661_10307273 | 3300025944 | Bacteria | 1423 |
| 888 | Ga0207661_10495668 | 3300025944 | Bacteria | 1116 |
| 889 | Ga0207661_11402725 | 3300025944 | Bacteria | 641 |
| 890 | Ga0207679_10002617 | 3300025945 | Bacteria | 11097 |
| 891 | Ga0207679_10003953 | 3300025945 | Bacteria | 9205 |
| 892 | Ga0207679_10009503 | 3300025945 | Bacteria | 6234 |
| 893 | Ga0207679_10018509 | 3300025945 | Bacteria | 4668 |
| 894 | Ga0207679_10024164 | 3300025945 | Bacteria | 4164 |
| 895 | Ga0207679_10033839 | 3300025945 | Bacteria | 3600 |
| 896 | Ga0207679_10224474 | 3300025945 | Bacteria | 1582 |
| 897 | Ga0207679_10328735 | 3300025945 | Bacteria | 1326 |
| 898 | Ga0207679_10353045 | 3300025945 | Bacteria | 1282 |
| 899 | Ga0207679_10655101 | 3300025945 | Bacteria | 950 |
| 900 | Ga0207667_10000490 | 3300025949 | Bacteria | 52292 |
| 901 | Ga0207667_10001200 | 3300025949 | Bacteria | 32473 |
| 902 | Ga0207667_10020237 | 3300025949 | Bacteria | 7405 |
| 903 | Ga0207667_10034332 | 3300025949 | Bacteria | 5448 |
| 904 | Ga0207667_10049680 | 3300025949 | Bacteria | 4429 |
| 905 | Ga0207667_10230511 | 3300025949 | Bacteria | 1896 |
| 906 | Ga0207667_10754105 | 3300025949 | Bacteria | 972 |
| 907 | Ga0207651_10034097 | 3300025960 | Bacteria | 3292 |
| 908 | Ga0207651_10058537 | 3300025960 | Bacteria | 2663 |
| 909 | Ga0207651_10076025 | 3300025960 | Bacteria | 2399 |
| 910 | Ga0207651_10098714 | 3300025960 | Bacteria | 2160 |
| 911 | Ga0207651_10412067 | 3300025960 | Bacteria | 1152 |
| 912 | Ga0207651_10896648 | 3300025960 | Bacteria | 790 |
| 913 | Ga0207712_10169501 | 3300025961 | Bacteria | 1705 |
| 914 | Ga0207712_10588000 | 3300025961 | Bacteria | 961 |
| 915 | Ga0207712_10598117 | 3300025961 | Bacteria | 954 |
| 916 | Ga0207668_10002833 | 3300025972 | Bacteria | 10154 |
| 917 | Ga0207668_10020812 | 3300025972 | Bacteria | 4175 |
| 918 | Ga0207668_10072731 | 3300025972 | Bacteria | 2461 |
| 919 | Ga0207668_10082765 | 3300025972 | Bacteria | 2333 |
| 920 | Ga0207668_10096561 | 3300025972 | Bacteria | 2185 |
| 921 | Ga0207668_10139413 | 3300025972 | Bacteria | 1862 |
| 922 | Ga0207668_10184349 | 3300025972 | Bacteria | 1649 |
| 923 | Ga0207668_10264603 | 3300025972 | Bacteria | 1403 |
| 924 | Ga0207640_10004420 | 3300025981 | Bacteria | 7627 |
| 925 | Ga0207640_10196228 | 3300025981 | Bacteria | 1526 |
| 926 | Ga0207640_10322519 | 3300025981 | Bacteria | 1230 |
| 927 | Ga0207640_10381345 | 3300025981 | Bacteria | 1142 |
| 928 | Ga0207640_10836124 | 3300025981 | Bacteria | 800 |
| 929 | Ga0207640_10877677 | 3300025981 | Bacteria | 782 |
| 930 | Ga0207658_10004792 | 3300025986 | Bacteria | 9360 |
| 931 | Ga0207658_10015419 | 3300025986 | Bacteria | 5242 |
| 932 | Ga0207658_10030693 | 3300025986 | Bacteria | 3808 |
| 933 | Ga0207658_10034077 | 3300025986 | Bacteria | 3636 |
| 934 | Ga0207658_10040854 | 3300025986 | Bacteria | 3356 |
| 935 | Ga0207658_10131100 | 3300025986 | Bacteria | 2014 |
| 936 | Ga0207658_10385542 | 3300025986 | Bacteria | 1228 |
| 937 | Ga0207658_10836479 | 3300025986 | Bacteria | 837 |
| 938 | Ga0207677_10002351 | 3300026023 | Bacteria | 9910 |
| 939 | Ga0207677_10003281 | 3300026023 | Bacteria | 8554 |
| 940 | Ga0207677_10013587 | 3300026023 | Bacteria | 4725 |
| 941 | Ga0207677_10096955 | 3300026023 | Bacteria | 2159 |
| 942 | Ga0207677_10205834 | 3300026023 | Bacteria | 1567 |
| 943 | Ga0207677_10258002 | 3300026023 | Bacteria | 1419 |
| 944 | Ga0207677_10315814 | 3300026023 | Bacteria | 1296 |
| 945 | Ga0207677_10387167 | 3300026023 | Bacteria | 1182 |
| 946 | Ga0207677_11023988 | 3300026023 | Bacteria | 750 |
| 947 | Ga0207703_10003435 | 3300026035 | Bacteria | 13293 |
| 948 | Ga0207703_10020784 | 3300026035 | Bacteria | 5136 |
| 949 | Ga0207703_10047877 | 3300026035 | Bacteria | 3448 |
| 950 | Ga0207703_10097054 | 3300026035 | Bacteria | 2489 |
| 951 | Ga0207703_10099385 | 3300026035 | Bacteria | 2463 |
| 952 | Ga0207703_10234858 | 3300026035 | Bacteria | 1645 |
| 953 | Ga0207703_10535412 | 3300026035 | Bacteria | 1103 |
| 954 | Ga0207703_10927693 | 3300026035 | Bacteria | 834 |
| 955 | Ga0207703_11135969 | 3300026035 | Bacteria | 751 |
| 956 | Ga0207703_11166214 | 3300026035 | Bacteria | 740 |
| 957 | Ga0207639_10002729 | 3300026041 | Bacteria | 11845 |
| 958 | Ga0207639_10085045 | 3300026041 | Bacteria | 2515 |
| 959 | Ga0207639_10115683 | 3300026041 | Bacteria | 2194 |
| 960 | Ga0207639_10206423 | 3300026041 | Bacteria | 1688 |
| 961 | Ga0207639_10225232 | 3300026041 | Bacteria | 1622 |
| 962 | Ga0207639_10590504 | 3300026041 | Bacteria | 1023 |
| 963 | Ga0207639_10845258 | 3300026041 | Bacteria | 854 |
| 964 | Ga0207678_10000429 | 3300026067 | Bacteria | 38134 |
| 965 | Ga0207678_10024896 | 3300026067 | Bacteria | 5226 |
| 966 | Ga0207678_10063616 | 3300026067 | Bacteria | 3170 |
| 967 | Ga0207678_10257659 | 3300026067 | Bacteria | 1495 |
| 968 | Ga0207678_10433641 | 3300026067 | Bacteria | 1141 |
| 969 | Ga0207678_10483840 | 3300026067 | Bacteria | 1078 |
| 970 | Ga0207678_10955631 | 3300026067 | Bacteria | 758 |
| 971 | Ga0207708_10000710 | 3300026075 | Bacteria | 25096 |
| 972 | Ga0207708_10070723 | 3300026075 | Bacteria | 2672 |
| 973 | Ga0207708_10609583 | 3300026075 | Bacteria | 926 |
| 974 | Ga0207708_10728229 | 3300026075 | Bacteria | 850 |
| 975 | Ga0207702_10000635 | 3300026078 | Bacteria | 38453 |
| 976 | Ga0207702_10007712 | 3300026078 | Bacteria | 9141 |
| 977 | Ga0207702_10555710 | 3300026078 | Bacteria | 1123 |
| 978 | Ga0207702_10741525 | 3300026078 | Bacteria | 969 |
| 979 | Ga0207641_10000832 | 3300026088 | Bacteria | 32828 |
| 980 | Ga0207641_10008086 | 3300026088 | Bacteria | 8714 |
| 981 | Ga0207641_10028936 | 3300026088 | Bacteria | 4581 |
| 982 | Ga0207641_10046362 | 3300026088 | Bacteria | 3663 |
| 983 | Ga0207641_10074523 | 3300026088 | Bacteria | 2928 |
| 984 | Ga0207641_10091874 | 3300026088 | Bacteria | 2657 |
| 985 | Ga0207641_10252563 | 3300026088 | Bacteria | 1647 |
| 986 | Ga0207641_10430200 | 3300026088 | Bacteria | 1272 |
| 987 | Ga0207641_10484223 | 3300026088 | Bacteria | 1199 |
| 988 | Ga0207641_10623493 | 3300026088 | Bacteria | 1057 |
| 989 | Ga0207641_10848422 | 3300026088 | Bacteria | 905 |
| 990 | Ga0207648_10001494 | 3300026089 | Bacteria | 25761 |
| 991 | Ga0207648_10002166 | 3300026089 | Bacteria | 21346 |
| 992 | Ga0207648_10005304 | 3300026089 | Bacteria | 13008 |
| 993 | Ga0207648_10007639 | 3300026089 | Bacteria | 10594 |
| 994 | Ga0207648_10010002 | 3300026089 | Bacteria | 9024 |
| 995 | Ga0207648_10258076 | 3300026089 | Bacteria | 1555 |
| 996 | Ga0207648_10314828 | 3300026089 | Bacteria | 1405 |
| 997 | Ga0207648_10823879 | 3300026089 | Bacteria | 865 |
| 998 | Ga0207676_10000294 | 3300026095 | Bacteria | 43081 |
| 999 | Ga0207676_10010977 | 3300026095 | Bacteria | 6467 |
| 1000 | Ga0207676_10031242 | 3300026095 | Bacteria | 4004 |
| 1001 | Ga0207676_10034632 | 3300026095 | Bacteria | 3824 |
| 1002 | Ga0207676_10087407 | 3300026095 | Bacteria | 2549 |
| 1003 | Ga0207676_10117327 | 3300026095 | Bacteria | 2238 |
| 1004 | Ga0207676_10157544 | 3300026095 | Bacteria | 1963 |
| 1005 | Ga0207676_10636366 | 3300026095 | Bacteria | 1028 |
| 1006 | Ga0207676_11009222 | 3300026095 | Bacteria | 820 |
| 1007 | Ga0207676_11097917 | 3300026095 | Bacteria | 786 |
| 1008 | Ga0207676_11373440 | 3300026095 | Bacteria | 702 |
| 1009 | Ga0207674_10000140 | 3300026116 | Bacteria | 84173 |
| 1010 | Ga0207674_10001268 | 3300026116 | Bacteria | 32991 |
| 1011 | Ga0207674_10002122 | 3300026116 | Bacteria | 25063 |
| 1012 | Ga0207674_10008483 | 3300026116 | Bacteria | 11866 |
| 1013 | Ga0207674_10066352 | 3300026116 | Bacteria | 3635 |
| 1014 | Ga0207674_10126579 | 3300026116 | Bacteria | 2520 |
| 1015 | Ga0207675_100003688 | 3300026118 | Bacteria | 14923 |
| 1016 | Ga0207675_100024173 | 3300026118 | Bacteria | 5650 |
| 1017 | Ga0207675_100133130 | 3300026118 | Bacteria | 2357 |
| 1018 | Ga0207675_100258972 | 3300026118 | Bacteria | 1685 |
| 1019 | Ga0207675_100621877 | 3300026118 | Bacteria | 1084 |
| 1020 | Ga0207675_100754562 | 3300026118 | Bacteria | 984 |
| 1021 | Ga0207683_10000003 | 3300026121 | Bacteria | 191866 |
| 1022 | Ga0207683_10000355 | 3300026121 | Bacteria | 42024 |
| 1023 | Ga0207683_10004640 | 3300026121 | Bacteria | 11848 |
| 1024 | Ga0207683_10013734 | 3300026121 | Bacteria | 6904 |
| 1025 | Ga0207683_10038235 | 3300026121 | Bacteria | 4181 |
| 1026 | Ga0207683_10041228 | 3300026121 | Bacteria | 4030 |
| 1027 | Ga0207683_10244960 | 3300026121 | Bacteria | 1635 |
| 1028 | Ga0207683_11224833 | 3300026121 | Bacteria | 695 |
| 1029 | Ga0207683_11269342 | 3300026121 | Bacteria | 682 |
| 1030 | Ga0207698_10001629 | 3300026142 | Bacteria | 13078 |
| 1031 | Ga0207698_10016336 | 3300026142 | Bacteria | 5000 |
| 1032 | Ga0207698_10026907 | 3300026142 | Bacteria | 4075 |
| 1033 | Ga0207698_10098460 | 3300026142 | Bacteria | 2417 |
| 1034 | Ga0207698_10140919 | 3300026142 | Bacteria | 2077 |
| 1035 | Ga0207698_10331444 | 3300026142 | Bacteria | 1430 |
| 1036 | Ga0207698_10500209 | 3300026142 | Bacteria | 1183 |
| 1037 | Ga0207698_10694092 | 3300026142 | Bacteria | 1012 |
| 1038 | Ga0207698_12038168 | 3300026142 | Bacteria | 588 |
| 1039 | Ga0209281_1000151 | 3300027111 | Bacteria | 167268 |
| 1040 | Ga0209998_10063347 | 3300027717 | Bacteria | 874 |
| 1041 | Ga0207428_10459083 | 3300027907 | Bacteria | 928 |
| 1042 | Ga0268266_10098208 | 3300028379 | Bacteria | 2576 |
| 1043 | Ga0268266_10398746 | 3300028379 | Bacteria | 1300 |
| 1044 | Ga0268266_10448216 | 3300028379 | Bacteria | 1226 |
| 1045 | Ga0268266_10469980 | 3300028379 | Bacteria | 1197 |
| 1046 | Ga0268266_10507024 | 3300028379 | Bacteria | 1153 |
| 1047 | Ga0268266_11906427 | 3300028379 | Bacteria | 568 |
| 1048 | Ga0268265_10055502 | 3300028380 | Bacteria | 3010 |
| 1049 | Ga0268265_10151504 | 3300028380 | Bacteria | 1956 |
| 1050 | Ga0268265_10171615 | 3300028380 | Bacteria | 1854 |
| 1051 | Ga0268265_10326190 | 3300028380 | Bacteria | 1393 |
| 1052 | Ga0268264_10007174 | 3300028381 | Bacteria | 9334 |
| 1053 | Ga0268264_10007222 | 3300028381 | Bacteria | 9303 |
| 1054 | Ga0268264_10014173 | 3300028381 | Bacteria | 6556 |
| 1055 | Ga0268264_10027411 | 3300028381 | Bacteria | 4654 |
| 1056 | Ga0268264_10072575 | 3300028381 | Bacteria | 2919 |
| 1057 | Ga0268264_10172961 | 3300028381 | Bacteria | 1955 |
| 1058 | Ga0268264_10317376 | 3300028381 | Bacteria | 1472 |
| 1059 | Ga0268264_10469749 | 3300028381 | Bacteria | 1222 |
| 1060 | Ga0268264_10522120 | 3300028381 | Bacteria | 1161 |
| 1061 | Ga0307515_10104002 | 3300028794 | Bacteria | 3398 |
| 1062 | Ga0265328_10010415 | 3300031239 | Bacteria | 3745 |
| 1063 | Ga0265325_10005542 | 3300031241 | Bacteria | 7791 |
| 1064 | Ga0265329_10001188 | 3300031242 | Bacteria | 12768 |
| 1065 | Ga0265331_10000588 | 3300031250 | Bacteria | 32461 |
| 1066 | Ga0265327_10001246 | 3300031251 | Bacteria | 33969 |
| 1067 | Ga0265316_10003969 | 3300031344 | Bacteria | 14815 |
| 1068 | Ga0307513_10039326 | 3300031456 | Bacteria | 5244 |
| 1069 | Ga0307408_100056526 | 3300031548 | Bacteria | 2846 |
| 1070 | Ga0307508_10291073 | 3300031616 | Bacteria | 1226 |
| 1071 | Ga0307508_10303334 | 3300031616 | Bacteria | 1189 |
| 1072 | Ga0265342_10035908 | 3300031712 | Bacteria | 3030 |
| 1073 | Ga0307405_10006897 | 3300031731 | Bacteria | 5635 |
| 1074 | Ga0307405_10150781 | 3300031731 | Bacteria | 1634 |
| 1075 | Ga0307405_10441964 | 3300031731 | Bacteria | 1029 |
| 1076 | Ga0307413_10258834 | 3300031824 | Bacteria | 1296 |
| 1077 | Ga0307413_10272077 | 3300031824 | Bacteria | 1269 |
| 1078 | Ga0307410_10001643 | 3300031852 | Bacteria | 10280 |
| 1079 | Ga0307410_10347028 | 3300031852 | Bacteria | 1185 |
| 1080 | Ga0307406_10002738 | 3300031901 | Bacteria | 9617 |
| 1081 | Ga0307406_10011363 | 3300031901 | Bacteria | 5051 |
| 1082 | Ga0307406_11119924 | 3300031901 | Bacteria | 680 |
| 1083 | Ga0307407_10006893 | 3300031903 | Bacteria | 5100 |
| 1084 | Ga0307407_10082475 | 3300031903 | Bacteria | 1949 |
| 1085 | Ga0307407_10194948 | 3300031903 | Bacteria | 1353 |
| 1086 | Ga0307407_10504138 | 3300031903 | Bacteria | 888 |
| 1087 | Ga0307412_10022675 | 3300031911 | Bacteria | 3853 |
| 1088 | Ga0307412_10072937 | 3300031911 | Unclassified | 2347 |
| 1089 | Ga0307412_10252357 | 3300031911 | Bacteria | 1370 |
| 1090 | Ga0307412_10742330 | 3300031911 | Bacteria | 847 |
| 1091 | Ga0307409_100072777 | 3300031995 | Unclassified | 2738 |
| 1092 | Ga0307409_100343701 | 3300031995 | Bacteria | 1405 |
| 1093 | Ga0307409_100618660 | 3300031995 | Bacteria | 1073 |
| 1094 | Ga0307416_100287861 | 3300032002 | Bacteria | 1624 |
| 1095 | Ga0307416_100581064 | 3300032002 | Bacteria | 1198 |
| 1096 | Ga0307416_100881466 | 3300032002 | Bacteria | 994 |
| 1097 | Ga0307414_10008851 | 3300032004 | Bacteria | 5745 |
| 1098 | Ga0307414_10031387 | 3300032004 | Bacteria | 3485 |
| 1099 | Ga0307414_10407716 | 3300032004 | Bacteria | 1182 |
| 1100 | Ga0307411_10008275 | 3300032005 | Bacteria | 5373 |
| 1101 | Ga0307415_100003530 | 3300032126 | Bacteria | 7971 |
| 1102 | Ga0307415_100013901 | 3300032126 | Bacteria | 4714 |
| 1103 | Ga0307415_100300861 | 3300032126 | Bacteria | 1329 |
| 1104 | Ga0307510_10145803 | 3300033180 | Bacteria | 1999 |
| 1105 | Ga0373950_0025484 | 3300034818 | Bacteria | 1068 |
| 1106 | Ga0373926_0023656 | 3300035083 | Bacteria | 2135 |
| 1107 | Ga0373926_0063682 | 3300035083 | Bacteria | 1347 |
| 1108 | Ga0373926_0187788 | 3300035083 | Bacteria | 793 |
| 1109 | Ga0373934_0001028 | 3300035086 | Bacteria | 10066 |
| 1110 | Ga0373934_0028705 | 3300035086 | Bacteria | 2170 |
| 1111 | Ga0373940_0006679 | 3300035088 | Bacteria | 2572 |
| 1112 | Ga0373944_0095052 | 3300035089 | Bacteria | 1001 |
| 1113 | Ga0373944_0220730 | 3300035089 | Bacteria | 692 |
| 1114 | Ga0373949_0033605 | 3300035090 | Bacteria | 1233 |
| 1115 | Ga0373951_0005905 | 3300035091 | Bacteria | 2828 |
| 1116 | Ga0373951_0197114 | 3300035091 | Bacteria | 585 |
| 1117 | Ga0373952_0020617 | 3300035092 | Bacteria | 1383 |
| 1118 | Ga0373923_0000349 | 3300035111 | Bacteria | 10443 |
| 1119 | Ga0373923_0234089 | 3300035111 | Bacteria | 856 |
| 1120 | Ga0373932_0127581 | 3300035112 | Bacteria | 854 |
| 1121 | Ga0373936_0085339 | 3300035113 | Bacteria | 1318 |
| 1122 | Ga0373939_0000181 | 3300035114 | Bacteria | 17462 |
| 1123 | Ga0373945_0022054 | 3300035116 | Bacteria | 2191 |
| 1124 | Ga0373945_0055004 | 3300035116 | Bacteria | 1472 |
| 1125 | Ga0373945_0116426 | 3300035116 | Bacteria | 1059 |
| 1126 | Ga0373953_0011995 | 3300035117 | Bacteria | 3057 |
| 1127 | Ga0373954_0000014 | 3300035118 | Bacteria | 71012 |
| 1128 | Ga0373954_0001030 | 3300035118 | Bacteria | 11058 |
| 1129 | Ga0373954_0088249 | 3300035118 | Bacteria | 1487 |
| 1130 | Ga0373954_0350248 | 3300035118 | Bacteria | 729 |
| 1131 | Ga0373954_0370139 | 3300035118 | Bacteria | 708 |
| 1132 | Ga0373956_0002915 | 3300035119 | Bacteria | 6921 |
| 1133 | Ga0373957_0000571 | 3300035120 | Bacteria | 9332 |
| 1134 | Ga0373957_0020193 | 3300035120 | Bacteria | 2352 |
| 1135 | Ga0373957_0066703 | 3300035120 | Bacteria | 1402 |
| 1136 | Ga0373957_0409280 | 3300035120 | Bacteria | 584 |
| 1137 | Ga0373960_0001830 | 3300035121 | Bacteria | 4758 |
| 1138 | Ga0373960_0021540 | 3300035121 | Bacteria | 1715 |
| 1139 | Ga0373943_0006181 | 3300035170 | Bacteria | 5374 |
| 1140 | Ga0373943_0020255 | 3300035170 | Bacteria | 3065 |
| 1141 | Ga0373943_0093965 | 3300035170 | Bacteria | 1557 |
| 1142 | Ga0373943_0319466 | 3300035170 | Bacteria | 885 |
| 1143 | Ga0373946_0019765 | 3300035171 | Bacteria | 2598 |
| 1144 | Ga0373946_0134764 | 3300035171 | Bacteria | 1140 |
| 1145 | Ga0373955_0007208 | 3300035172 | Bacteria | 5099 |
| 1146 | Ga0373955_0009860 | 3300035172 | Bacteria | 4493 |
| 1147 | Ga0373955_0021182 | 3300035172 | Bacteria | 3278 |
| 1148 | Ga0373955_0040880 | 3300035172 | Bacteria | 2483 |
| 1149 | Ga0373955_0086287 | 3300035172 | Bacteria | 1783 |
| 1150 | Ga0373955_0433414 | 3300035172 | Bacteria | 800 |
| 1151 | Ga0373961_0201507 | 3300035241 | Bacteria | 702 |
| 1152 | Ga0373962_0025391 | 3300035242 | Bacteria | 1591 |
| 1153 | Ga0373924_0052026 | 3300035410 | Bacteria | 1699 |
| 1154 | Ga0373924_0220160 | 3300035410 | Bacteria | 839 |
| 1155 | Ga0373931_0000400 | 3300035691 | Bacteria | 17756 |
| 1156 | Ga0373931_0006244 | 3300035691 | Bacteria | 5558 |
| 1157 | Ga0373931_0324949 | 3300035691 | Bacteria | 957 |
| 1158 | Ga0373931_0499369 | 3300035691 | Bacteria | 784 |
| 1159 | Ga0373931_0618554 | 3300035691 | Bacteria | 709 |
| 1160 | Ga0373935_0001974 | 3300035692 | Bacteria | 11546 |
| 1161 | Ga0373935_0008949 | 3300035692 | Bacteria | 5993 |
| 1162 | Ga0373935_0060731 | 3300035692 | Bacteria | 2418 |
| 1163 | Ga0373935_0146577 | 3300035692 | Bacteria | 1598 |
| 1164 | Ga0373935_0884709 | 3300035692 | Bacteria | 661 |
| 1165 | Ga0373927_0012584 | 3300035695 | Bacteria | 5631 |
| 1166 | Ga0373927_0027951 | 3300035695 | Bacteria | 3681 |
| 1167 | Ga0373927_0052206 | 3300035695 | Bacteria | 2645 |
| 1168 | Ga0373927_0176704 | 3300035695 | Bacteria | 1400 |
| 1169 | Ga0373927_0419486 | 3300035695 | Bacteria | 883 |
| 1170 | Ga0373933_0020603 | 3300035724 | Bacteria | 3739 |
| 1171 | Ga0373933_0206472 | 3300035724 | Bacteria | 1258 |
| 1172 | Ga0373933_0381085 | 3300035724 | Bacteria | 918 |
| 1173 | Ga0373947_0037034 | 3300035725 | Bacteria | 2894 |
| 1174 | Ga0373947_0072873 | 3300035725 | Bacteria | 2110 |
| 1175 | Ga0373947_0078718 | 3300035725 | Bacteria | 2035 |
| 1176 | Ga0373937_0001093 | 3300036401 | Bacteria | 22840 |
| 1177 | Ga0373937_0006625 | 3300036401 | Bacteria | 10000 |
| 1178 | Ga0373937_0014281 | 3300036401 | Bacteria | 7008 |
| 1179 | Ga0373937_0016376 | 3300036401 | Bacteria | 6582 |
| 1180 | Ga0373937_0029114 | 3300036401 | Bacteria | 5001 |
| 1181 | Ga0373937_0039190 | 3300036401 | Bacteria | 4319 |
| 1182 | Ga0373937_0223074 | 3300036401 | Bacteria | 1774 |
| 1183 | Ga0373937_0297402 | 3300036401 | Bacteria | 1525 |
| 1184 | Ga0373937_0370279 | 3300036401 | Bacteria | 1358 |
| 1185 | Ga0373937_0398840 | 3300036401 | Bacteria | 1305 |
| 1186 | Ga0373937_1076454 | 3300036401 | Bacteria | 753 |
| 1187 | Ga0373925_0013167 | 3300037068 | Bacteria | 5987 |
| 1188 | Ga0373925_0031283 | 3300037068 | Bacteria | 3910 |
| 1189 | Ga0373925_0033878 | 3300037068 | Bacteria | 3763 |
| 1190 | Ga0373925_0161591 | 3300037068 | Bacteria | 1764 |
| 1191 | Ga0373925_0218196 | 3300037068 | Bacteria | 1521 |
| 1192 | Ga0373925_0409949 | 3300037068 | Bacteria | 1106 |
| 1193 | Ga0373925_0513838 | 3300037068 | Bacteria | 984 |
| 1194 | Ga0373925_0714276 | 3300037068 | Bacteria | 826 |
| 1195 | Ga0395899_0298613 | 3300037312 | Bacteria | 1091 |
| 1196 | Ga0395900_0000058 | 3300037418 | Bacteria | 206785 |
| 1197 | Ga0395905_0020330 | 3300037471 | Bacteria | 6289 |
| 1198 | Ga0395905_0057608 | 3300037471 | Bacteria | 3634 |
| 1199 | Ga0395905_0674301 | 3300037471 | Bacteria | 936 |
| 1200 | Ga0395905_0685052 | 3300037471 | Bacteria | 927 |
| 1201 | Ga0436365_0267431 | 3300039437 | Bacteria | 547 |
| 1202 | Ga0436365_0612874 | 3300039437 | Bacteria | 2493 |
| 1203 | Ga0436361_0550950 | 3300039447 | Bacteria | 3681 |
| 1204 | Ga0436361_0610301 | 3300039447 | Bacteria | 1158 |
| 1205 | Ga0436361_1181538 | 3300039447 | Bacteria | 5470 |
| 1206 | Ga0451787_067562 | 3300041441 | Bacteria | 684 |
| 1207 | Ga0451791_1059383 | 3300041451 | Bacteria | 719 |
| 1208 | Ga0451793_0982348 | 3300041452 | Bacteria | 814 |
| 1209 | Ga0451793_1844437 | 3300041452 | Bacteria | 528 |
| 1210 | Ga0451802_0395932 | 3300041460 | Bacteria | 908 |
| 1211 | Ga0451807_1126674 | 3300041486 | Bacteria | 819 |
| 1212 | Ga0451807_1466985 | 3300041486 | Bacteria | 1832 |
| 1213 | Ga0451853_2209825 | 3300041512 | Bacteria | 697 |
| 1214 | Ga0451853_3563638 | 3300041512 | Bacteria | 665 |
| 1215 | Ga0450888_017070 | 3300042126 | Bacteria | 899 |
| 1216 | Ga0450898_094800 | 3300042134 | Bacteria | 619 |
| 1217 | Ga0439444_0069724 | 3300042437 | Bacteria | 750 |
| 1218 | Ga0439460_0132680 | 3300042461 | Bacteria | 822 |
| 1219 | Ga0451577_0000166 | 3300042876 | Bacteria | 145166 |
| 1220 | Ga0451577_0011347 | 3300042876 | Bacteria | 8436 |
| 1221 | Ga0451577_0041533 | 3300042876 | Bacteria | 4128 |
| 1222 | Ga0451577_0089006 | 3300042876 | Bacteria | 2755 |
| 1223 | Ga0451577_0196562 | 3300042876 | Bacteria | 1820 |
| 1224 | Ga0451577_0319536 | 3300042876 | Bacteria | 1408 |
| 1225 | Ga0451577_0478437 | 3300042876 | Bacteria | 1131 |
| 1226 | Ga0451577_0819077 | 3300042876 | Bacteria | 840 |
| 1227 | Ga0453684_0000187 | 3300044712 | Bacteria | 272378 |
| 1228 | Ga0453684_0326016 | 3300044712 | Bacteria | 1738 |
| 1229 | Ga0453684_0459968 | 3300044712 | Bacteria | 1415 |
| 1230 | Ga0453684_0595395 | 3300044712 | Bacteria | 1212 |
| 1231 | Ga0453684_0747795 | 3300044712 | Bacteria | 1059 |
| 1232 | Ga0453684_1674208 | 3300044712 | Bacteria | 651 |
| 1233 | Ga0451576_0004563 | 3300045051 | Bacteria | 17903 |
| 1234 | Ga0451576_0066511 | 3300045051 | Bacteria | 3752 |
| 1235 | Ga0451576_0078737 | 3300045051 | Bacteria | 3430 |
| 1236 | Ga0451576_0088289 | 3300045051 | Bacteria | 3225 |
| 1237 | Ga0451576_0109010 | 3300045051 | Bacteria | 2881 |
| 1238 | Ga0451576_0144474 | 3300045051 | Bacteria | 2481 |
| 1239 | Ga0451576_0378520 | 3300045051 | Bacteria | 1484 |
| 1240 | Ga0451576_0771342 | 3300045051 | Bacteria | 1010 |
| 1241 | Ga0451576_1283296 | 3300045051 | Bacteria | 763 |
| 1242 | Ga0451576_1868636 | 3300045051 | Bacteria | 620 |
| 1243 | Ga0495592_0000306 | 3300046454 | Bacteria | 41265 |
| 1244 | Ga0495592_0033331 | 3300046454 | Bacteria | 3885 |
| 1245 | Ga0495603_0055973 | 3300046455 | Bacteria | 2336 |
| 1246 | Ga0495603_0233658 | 3300046455 | Bacteria | 1060 |
| 1247 | Ga0495590_0006658 | 3300046457 | Bacteria | 4503 |
| 1248 | Ga0495629_0122985 | 3300046459 | Bacteria | 1807 |
| 1249 | Ga0495629_0377754 | 3300046459 | Bacteria | 964 |
| 1250 | Ga0495629_0451808 | 3300046459 | Bacteria | 870 |
| 1251 | Ga0495651_0120855 | 3300046462 | Bacteria | 1925 |
| 1252 | Ga0495653_0061608 | 3300046463 | Bacteria | 2838 |
| 1253 | Ga0495653_0435556 | 3300046463 | Bacteria | 827 |
| 1254 | Ga0495580_0035274 | 3300046472 | Bacteria | 3597 |
| 1255 | Ga0495580_0155868 | 3300046472 | Bacteria | 1581 |
| 1256 | Ga0495580_0837688 | 3300046472 | Bacteria | 594 |
| 1257 | Ga0495639_0477521 | 3300046475 | Bacteria | 635 |
| 1258 | Ga0495662_0014882 | 3300046476 | Bacteria | 3780 |
| 1259 | Ga0495662_0097628 | 3300046476 | Bacteria | 1436 |
| 1260 | Ga0495664_0136347 | 3300046477 | Bacteria | 1487 |
| 1261 | Ga0495594_0033790 | 3300046499 | Bacteria | 2782 |
| 1262 | Ga0495606_0323201 | 3300046507 | Bacteria | 828 |
| 1263 | Ga0495608_0000439 | 3300046511 | Bacteria | 29042 |
| 1264 | Ga0495608_0005328 | 3300046511 | Bacteria | 9189 |
| 1265 | Ga0495628_0001253 | 3300046516 | Bacteria | 23229 |
| 1266 | Ga0495628_0073905 | 3300046516 | Bacteria | 2656 |
| 1267 | Ga0495628_0172955 | 3300046516 | Bacteria | 1637 |
| 1268 | Ga0495628_0199969 | 3300046516 | Bacteria | 1506 |
| 1269 | Ga0495630_0003035 | 3300046517 | Bacteria | 11651 |
| 1270 | Ga0495630_0105486 | 3300046517 | Bacteria | 2134 |
| 1271 | Ga0495630_0222128 | 3300046517 | Bacteria | 1442 |
| 1272 | Ga0495630_0618217 | 3300046517 | Bacteria | 830 |
| 1273 | Ga0495630_1439012 | 3300046517 | Bacteria | 518 |
| 1274 | Ga0495644_0157003 | 3300046523 | Bacteria | 872 |
| 1275 | Ga0495666_0012180 | 3300046526 | Bacteria | 4293 |
| 1276 | Ga0495652_0031405 | 3300046529 | Bacteria | 4652 |
| 1277 | Ga0495652_0065732 | 3300046529 | Bacteria | 3046 |
| 1278 | Ga0495640_0000418 | 3300046533 | Bacteria | 30693 |
| 1279 | Ga0495640_0076952 | 3300046533 | Bacteria | 2225 |
| 1280 | Ga0495640_0531035 | 3300046533 | Bacteria | 714 |
| 1281 | Ga0495586_0001587 | 3300046535 | Bacteria | 12505 |
| 1282 | Ga0495586_0264459 | 3300046535 | Bacteria | 982 |
| 1283 | Ga0495587_0004909 | 3300046536 | Bacteria | 8772 |
| 1284 | Ga0495587_0010361 | 3300046536 | Bacteria | 5938 |
| 1285 | Ga0495598_0087349 | 3300046537 | Bacteria | 1011 |
| 1286 | Ga0495621_0032710 | 3300046539 | Bacteria | 1790 |
| 1287 | Ga0495645_0000490 | 3300046543 | Bacteria | 27455 |
| 1288 | Ga0495645_0026388 | 3300046543 | Bacteria | 4217 |
| 1289 | Ga0495645_0078524 | 3300046543 | Bacteria | 2372 |
| 1290 | Ga0495645_0458000 | 3300046543 | Bacteria | 803 |
| 1291 | Ga0495622_0139844 | 3300046557 | Bacteria | 1100 |
| 1292 | Ga0495667_0003624 | 3300046559 | Bacteria | 10384 |
| 1293 | Ga0495667_0010719 | 3300046559 | Bacteria | 6198 |
| 1294 | Ga0495634_0003074 | 3300046642 | Bacteria | 13580 |
| 1295 | Ga0495635_0012559 | 3300046663 | Bacteria | 5935 |
| 1296 | Ga0495635_0028372 | 3300046663 | Bacteria | 3890 |
| 1297 | Ga0495635_0061638 | 3300046663 | Bacteria | 2576 |
| 1298 | Ga0495635_0569354 | 3300046663 | Bacteria | 741 |
| 1299 | Ga0495659_0220722 | 3300046664 | Bacteria | 783 |
| 1300 | Ga0495657_0053644 | 3300046675 | Bacteria | 2697 |
| 1301 | Ga0495657_0252240 | 3300046675 | Bacteria | 1062 |
| 1302 | Ga0495599_0030882 | 3300046678 | Bacteria | 3363 |
| 1303 | Ga0495623_0016103 | 3300046679 | Bacteria | 4831 |
| 1304 | Ga0495623_0016408 | 3300046679 | Bacteria | 4785 |
| 1305 | Ga0495646_0161500 | 3300046680 | Bacteria | 1240 |
| 1306 | Ga0495646_0267894 | 3300046680 | Bacteria | 911 |
| 1307 | Ga0495647_0006266 | 3300046681 | Bacteria | 3932 |
| 1308 | Ga0495647_0410149 | 3300046681 | Bacteria | 623 |
| 1309 | Ga0495658_0001390 | 3300046683 | Bacteria | 12703 |
| 1310 | Ga0495658_0051443 | 3300046683 | Bacteria | 2334 |
| 1311 | Ga0495658_0405231 | 3300046683 | Bacteria | 869 |
| 1312 | Ga0495658_0425095 | 3300046683 | Bacteria | 848 |
| 1313 | Ga0495669_0154193 | 3300046684 | Bacteria | 1088 |
| 1314 | Ga0495613_0003181 | 3300046689 | Bacteria | 12293 |
| 1315 | Ga0495624_0086555 | 3300046690 | Bacteria | 1935 |
| 1316 | Ga0495600_0010182 | 3300046809 | Bacteria | 5827 |
| 1317 | Ga0495660_0175115 | 3300046810 | Bacteria | 1042 |
| 1318 | Ga0495581_0007795 | 3300047315 | Bacteria | 6200 |
| 1319 | Ga0495581_0236104 | 3300047315 | Bacteria | 1069 |
| 1320 | Ga0495581_0360171 | 3300047315 | Bacteria | 849 |
| 1321 | Ga0495604_0001668 | 3300047317 | Bacteria | 18261 |
| 1322 | Ga0495604_0036725 | 3300047317 | Bacteria | 3862 |
| 1323 | Ga0495604_0091377 | 3300047317 | Bacteria | 2258 |
| 1324 | Ga0495636_0008982 | 3300047318 | Bacteria | 3932 |
| 1325 | Ga0495674_0157845 | 3300047319 | Bacteria | 1899 |
| 1326 | Ga0495676_0118717 | 3300047321 | Bacteria | 1928 |
| 1327 | Ga0495680_0003157 | 3300047322 | Bacteria | 16416 |
| 1328 | Ga0495680_0221855 | 3300047322 | Bacteria | 1349 |
| 1329 | Ga0495680_1073305 | 3300047322 | Bacteria | 510 |
| 1330 | Ga0495675_0032340 | 3300047444 | Bacteria | 3338 |
| 1331 | Ga0495684_0033460 | 3300047471 | Bacteria | 3942 |
| 1332 | Ga0495684_0108494 | 3300047471 | Bacteria | 2096 |
| 1333 | Ga0495684_0229618 | 3300047471 | Bacteria | 1358 |
| 1334 | Ga0495684_0254489 | 3300047471 | Bacteria | 1276 |
| 1335 | Ga0495686_0007201 | 3300047472 | Bacteria | 8376 |
| 1336 | Ga0495593_0062059 | 3300047673 | Bacteria | 1954 |
| 1337 | Ga0495593_0254632 | 3300047673 | Bacteria | 879 |
| 1338 | Ga0495593_0547638 | 3300047673 | Bacteria | 580 |
| 1339 | Ga0495602_0088274 | 3300048088 | Bacteria | 2582 |
| 1340 | Ga0495602_0267579 | 3300048088 | Bacteria | 1265 |
| 1341 | Ga0495602_0592727 | 3300048088 | Bacteria | 763 |
| 1342 | Ga0495614_0189555 | 3300048089 | Bacteria | 927 |
| 1343 | Ga0496100_0148853 | 3300048903 | Bacteria | 1667 |
| 1344 | Ga0496100_0275800 | 3300048903 | Bacteria | 1252 |
| 1345 | Ga0496101_0111777 | 3300048904 | Bacteria | 2057 |
| 1346 | Ga0496101_0373198 | 3300048904 | Bacteria | 1122 |
| 1347 | Ga0496102_0011222 | 3300048905 | Bacteria | 7719 |
| 1348 | Ga0496102_0028779 | 3300048905 | Bacteria | 4967 |
| 1349 | Ga0496102_0068326 | 3300048905 | Bacteria | 3260 |
| 1350 | Ga0496102_0181835 | 3300048905 | Bacteria | 1981 |
| 1351 | Ga0496102_0637073 | 3300048905 | Bacteria | 989 |
| 1352 | Ga0496102_1112387 | 3300048905 | Bacteria | 710 |
| 1353 | Ga0496103_0082550 | 3300048906 | Bacteria | 2023 |
| 1354 | Ga0496104_0015746 | 3300048907 | Bacteria | 6859 |
| 1355 | Ga0496104_0047473 | 3300048907 | Bacteria | 4047 |
| 1356 | Ga0496104_0190240 | 3300048907 | Bacteria | 1964 |
| 1357 | Ga0496104_1132789 | 3300048907 | Bacteria | 686 |
| 1358 | Ga0496105_0004395 | 3300048908 | Bacteria | 10614 |
| 1359 | Ga0496105_1323374 | 3300048908 | Bacteria | 525 |
| 1360 | Ga0496106_0002520 | 3300048909 | Bacteria | 13644 |
| 1361 | Ga0496106_0412147 | 3300048909 | Bacteria | 1086 |
| 1362 | Ga0496106_1084368 | 3300048909 | Bacteria | 628 |
| 1363 | Ga0496107_0025820 | 3300048910 | Bacteria | 4162 |
| 1364 | Ga0496107_0041380 | 3300048910 | Bacteria | 3308 |
| 1365 | Ga0496107_0203866 | 3300048910 | Bacteria | 1470 |
| 1366 | Ga0496108_0044550 | 3300048911 | Bacteria | 3703 |
| 1367 | Ga0496108_0159103 | 3300048911 | Bacteria | 1951 |
| 1368 | Ga0496108_0215054 | 3300048911 | Bacteria | 1669 |
| 1369 | Ga0496108_0516898 | 3300048911 | Bacteria | 1042 |
| 1370 | Ga0496109_0004450 | 3300048912 | Bacteria | 11702 |
| 1371 | Ga0496109_0105832 | 3300048912 | Bacteria | 2613 |
| 1372 | Ga0496109_0212835 | 3300048912 | Bacteria | 1818 |
| 1373 | Ga0496110_0091381 | 3300048913 | Bacteria | 2723 |
| 1374 | Ga0496110_0149406 | 3300048913 | Bacteria | 2115 |
| 1375 | Ga0496110_0286969 | 3300048913 | Bacteria | 1499 |
| 1376 | Ga0496110_1090073 | 3300048913 | Bacteria | 707 |
| 1377 | Ga0496111_0176743 | 3300048914 | Bacteria | 1587 |
| 1378 | Ga0496111_0613467 | 3300048914 | Bacteria | 796 |
| 1379 | Ga0496112_0000349 | 3300048915 | Bacteria | 30137 |
| 1380 | Ga0496112_0003789 | 3300048915 | Bacteria | 12634 |
| 1381 | Ga0496112_0073785 | 3300048915 | Bacteria | 3373 |
| 1382 | Ga0496113_0071646 | 3300048916 | Bacteria | 2636 |
| 1383 | Ga0496113_0245005 | 3300048916 | Bacteria | 1430 |
| 1384 | Ga0496113_0320863 | 3300048916 | Bacteria | 1242 |
| 1385 | Ga0496113_0562266 | 3300048916 | Bacteria | 914 |
| 1386 | Ga0496114_0021666 | 3300048917 | Bacteria | 5229 |
| 1387 | Ga0496114_0620088 | 3300048917 | Bacteria | 953 |
| 1388 | Ga0496115_0892985 | 3300048918 | Bacteria | 686 |
| 1389 | Ga0496124_0001001 | 3300048927 | Bacteria | 44775 |
| 1390 | Ga0501290_000024 | 3300049513 | Bacteria | 20106 |
| 1391 | Ga0501291_000039 | 3300049514 | Bacteria | 16775 |
| 1392 | Ga0501292_000069 | 3300049515 | Bacteria | 20733 |
| 1393 | Ga0501294_000192 | 3300049517 | Bacteria | 7491 |
| 1394 | Ga0501295_000183 | 3300049518 | Bacteria | 6307 |
| 1395 | Ga0501296_000176 | 3300049519 | Bacteria | 6824 |
| 1396 | Ga0501297_000004 | 3300049520 | Bacteria | 22617 |
| 1397 | Ga0501298_000124 | 3300049521 | Bacteria | 9227 |
| 1398 | Ga0501299_000282 | 3300049522 | Bacteria | 5815 |
| 1399 | Ga0501300_000132 | 3300049523 | Bacteria | 11104 |
| 1400 | Ga0501301_000026 | 3300049524 | Bacteria | 6740 |
| 1401 | Ga0501303_000147 | 3300049526 | Bacteria | 6111 |
| 1402 | Ga0501070_1203259 | 3300049586 | Bacteria | 581 |
| 1403 | Ga0501072_0343786 | 3300049588 | Bacteria | 1185 |
| 1404 | Ga0501073_0283398 | 3300049589 | Bacteria | 1143 |
| 1405 | Ga0501076_0116726 | 3300049592 | Bacteria | 2160 |
| 1406 | Ga0501198_000280 | 3300049649 | Bacteria | 6481 |
| 1407 | Ga0501199_005334 | 3300049650 | Bacteria | 1289 |
| 1408 | Ga0501201_000014 | 3300049651 | Bacteria | 10935 |
| 1409 | Ga0501202_000015 | 3300049652 | Bacteria | 19511 |
| 1410 | Ga0501206_000010 | 3300049653 | Bacteria | 18339 |
| 1411 | Ga0501207_000613 | 3300049654 | Unclassified | 4117 |
| 1412 | Ga0501208_004334 | 3300049655 | Unclassified | 1664 |
| 1413 | Ga0501211_000610 | 3300049658 | Unclassified | 3578 |
| 1414 | Ga0501214_005204 | 3300049659 | Unclassified | 1241 |
| 1415 | Ga0501216_000112 | 3300049660 | Bacteria | 7859 |
| 1416 | Ga0501223_010883 | 3300049663 | Unclassified | 1826 |
| 1417 | Ga0501227_001636 | 3300049665 | Unclassified | 4994 |
| 1418 | Ga0501228_003108 | 3300049666 | Unclassified | 1346 |
| 1419 | Ga0501230_000274 | 3300049667 | Unclassified | 4756 |
| 1420 | Ga0501233_000058 | 3300049668 | Bacteria | 14525 |
| 1421 | Ga0501235_000042 | 3300049669 | Bacteria | 20584 |
| 1422 | Ga0501236_000929 | 3300049670 | Unclassified | 3295 |
| 1423 | Ga0501239_004284 | 3300049672 | Unclassified | 1393 |
| 1424 | Ga0501243_000440 | 3300049675 | Bacteria | 5523 |
| 1425 | Ga0501246_000059 | 3300049676 | Bacteria | 6119 |
| 1426 | Ga0501248_000300 | 3300049678 | Unclassified | 2557 |
| 1427 | Ga0501249_000123 | 3300049679 | Bacteria | 23882 |
| 1428 | Ga0501251_000033 | 3300049681 | Bacteria | 10069 |
| 1429 | Ga0501255_000822 | 3300049684 | Unclassified | 2282 |
| 1430 | Ga0501256_000952 | 3300049685 | Unclassified | 2022 |
| 1431 | Ga0501257_016794 | 3300049686 | Unclassified | 1699 |
| 1432 | Ga0501259_001098 | 3300049688 | Unclassified | 4527 |
| 1433 | Ga0501260_000011 | 3300049689 | Bacteria | 13212 |
| 1434 | Ga0501261_000100 | 3300049690 | Bacteria | 12946 |
| 1435 | Ga0501219_001625 | 3300049703 | Unclassified | 2022 |
| 1436 | Ga0501221_000074 | 3300049704 | Bacteria | 11102 |
| 1437 | Ga0501225_0000250 | 3300049705 | Bacteria | 16815 |
| 1438 | Ga0501229_000218 | 3300049706 | Bacteria | 6344 |
| 1439 | Ga0501234_000065 | 3300049707 | Bacteria | 12750 |
| 1440 | Ga0501080_0861603 | 3300049742 | Bacteria | 791 |
| 1441 | Ga0501232_007375 | 3300049757 | Bacteria | 1158 |
| 1442 | Ga0501263_039330 | 3300049760 | Bacteria | 691 |
| 1443 | Ga0501264_000438 | 3300049761 | Bacteria | 6431 |
| 1444 | Ga0501265_000143 | 3300049762 | Bacteria | 6663 |
| 1445 | Ga0501266_008958 | 3300049763 | Bacteria | 1262 |
| 1446 | Ga0501268_002618 | 3300049765 | Unclassified | 2385 |
| 1447 | Ga0501269_008319 | 3300049766 | Bacteria | 1253 |
| 1448 | Ga0501270_000408 | 3300049767 | Unclassified | 3680 |
| 1449 | Ga0501271_001648 | 3300049768 | Unclassified | 1930 |
| 1450 | Ga0501272_000128 | 3300049769 | Bacteria | 5931 |
| 1451 | Ga0501274_000535 | 3300049771 | Unclassified | 2732 |
| 1452 | Ga0501276_002219 | 3300049773 | Bacteria | 1363 |
| 1453 | Ga0501278_001279 | 3300049774 | Unclassified | 1808 |
| 1454 | Ga0501279_000130 | 3300049775 | Bacteria | 10801 |
| 1455 | Ga0501280_004263 | 3300049776 | Unclassified | 2113 |
| 1456 | Ga0501281_00749 | 3300049777 | Unclassified | 2802 |
| 1457 | Ga0501283_000044 | 3300049779 | Bacteria | 15150 |
| 1458 | Ga0501200_00096 | 3300049849 | Unclassified | 2117 |
| 1459 | Ga0501226_002204 | 3300049853 | Unclassified | 2404 |
| 1460 | nmdc:mga03683_46821_c1 | 3300050489 | Bacteria | 1793 |
| 1461 | nmdc:mga0k408_239696_c1 | 3300050493 | Bacteria | 1083 |
| 1462 | nmdc:mga07m45_1390_c1 | 3300050496 | Bacteria | 11048 |
| 1463 | nmdc:mga05p37_41232_c1 | 3300050507 | Bacteria | 5668 |
| 1464 | nmdc:mga09592_544091_c1 | 3300050508 | Bacteria | 997 |
| 1465 | nmdc:mga09592_8709_c1 | 3300050508 | Bacteria | 8255 |
| 1466 | nmdc:mga0qj67_17879_c1 | 3300050509 | Bacteria | 5396 |
| 1467 | nmdc:mga08y16_368861_c1 | 3300050511 | Bacteria | 1473 |
| 1468 | nmdc:mga08y16_79846_c1 | 3300050511 | Bacteria | 3410 |
| 1469 | nmdc:mga0n895_3063_c1 | 3300050512 | Bacteria | 13289 |
| 1470 | nmdc:mga0n895_593505_c1 | 3300050512 | Bacteria | 1110 |
| 1471 | nmdc:mga0rr50_154529_c1 | 3300050513 | Bacteria | 1857 |
| 1472 | Ga0495601_0003644 | 3300053077 | Bacteria | 8857 |
| 1473 | Ga0495612_0163011 | 3300053078 | Bacteria | 974 |
| 1474 | Ga0495612_0288231 | 3300053078 | Bacteria | 735 |
| 1475 | Ga0495595_0130017 | 3300053084 | Bacteria | 1230 |
| 1476 | Ga0495595_0134453 | 3300053084 | Bacteria | 1211 |
| 1477 | Ga0495619_0005553 | 3300053085 | Bacteria | 8000 |
| 1478 | Ga0495619_0024756 | 3300053085 | Bacteria | 3851 |
| 1479 | Ga0495619_0844092 | 3300053085 | Bacteria | 618 |
| 1480 | Ga0500651_0457437 | 3300053093 | Bacteria | 709 |
| 1481 | Ga0500593_008110 | 3300053117 | Bacteria | 4305 |
| 1482 | Ga0530510_0107075 | 3300061734 | Bacteria | 2046 |
| 1483 | 2644217166 | 2643221639 | Bacteria | 6649903 |
| 1484 | 2644303004 | 2643221654 | Bacteria | 5273570 |
| 1485 | 2644338610 | 2643221660 | Bacteria | 4208257 |
| 1486 | Ga0207673_1009582 | |||
| 1487 | JGI24751J29686_10046467 | |||
| 1488 | rootL2_10073240 | |||
| 1489 | Ga0055524_1000146 | |||
| 1490 | Ga0055530_10009559 | |||
| 1491 | Ga0055531_10004965 | |||
| 1492 | Ga0065712_10235339 | |||
| 1493 | Ga0065715_10274079 | |||
| 1494 | Ga0065715_10612704 | |||
| 1495 | Ga0070658_10005980 | |||
| 1496 | Ga0070658_10103749 | |||
| 1497 | Ga0070658_10141199 | |||
| 1498 | Ga0070658_10218690 | |||
| 1499 | Ga0070658_10287816 | |||
| 1500 | Ga0070658_10324897 | |||
| 1501 | Ga0070658_10390331 | |||
| 1502 | Ga0070658_11103298 | |||
| 1503 | Ga0070676_10000267 | |||
| 1504 | Ga0070676_10009436 | |||
| 1505 | Ga0070676_10074109 | |||
| 1506 | Ga0070676_10083232 | |||
| 1507 | Ga0070683_100006762 | |||
| 1508 | Ga0070683_100014268 | |||
| 1509 | Ga0070683_100167950 | |||
| 1510 | Ga0070683_100257060 | |||
| 1511 | Ga0070683_101497725 | |||
| 1512 | Ga0070683_101847100 | |||
| 1513 | Ga0070690_100003078 | |||
| 1514 | Ga0070690_100010609 | |||
| 1515 | Ga0070690_100107454 | |||
| 1516 | Ga0070690_100374995 | |||
| 1517 | Ga0070670_100011670 | |||
| 1518 | Ga0070670_100016497 | |||
| 1519 | Ga0070670_100020490 | |||
| 1520 | Ga0070670_100049106 | |||
| 1521 | Ga0070670_100110464 | |||
| 1522 | Ga0070670_100143121 | |||
| 1523 | Ga0070670_100367407 | |||
| 1524 | Ga0070670_100512593 | |||
| 1525 | Ga0070670_100958521 | |||
| 1526 | Ga0070677_10000642 | |||
| 1527 | Ga0070677_10010485 | |||
| 1528 | Ga0068869_100008109 | |||
| 1529 | Ga0068869_100009367 | |||
| 1530 | Ga0068869_100023785 | |||
| 1531 | Ga0068869_100036679 | |||
| 1532 | Ga0068869_100130351 | |||
| 1533 | Ga0068869_100144121 | |||
| 1534 | Ga0068869_100464197 | |||
| 1535 | Ga0070666_10004334 | |||
| 1536 | Ga0070666_10004746 | |||
| 1537 | Ga0070666_10017791 | |||
| 1538 | Ga0070666_10124836 | |||
| 1539 | Ga0070666_10166275 | |||
| 1540 | Ga0070666_11018123 | |||
| 1541 | Ga0070680_100028407 | |||
| 1542 | Ga0070680_100034253 | |||
| 1543 | Ga0070682_100100175 | |||
| 1544 | Ga0070682_100708485 | |||
| 1545 | Ga0068868_100015847 | |||
| 1546 | Ga0068868_100033124 | |||
| 1547 | Ga0068868_100034949 | |||
| 1548 | Ga0068868_100036210 | |||
| 1549 | Ga0068868_100038640 | |||
| 1550 | Ga0068868_100182700 | |||
| 1551 | Ga0068868_100371236 | |||
| 1552 | Ga0068868_100395511 | |||
| 1553 | Ga0068868_100427836 | |||
| 1554 | Ga0070660_100022673 | |||
| 1555 | Ga0070660_100031136 | |||
| 1556 | Ga0070660_100097177 | |||
| 1557 | Ga0070660_100662776 | |||
| 1558 | Ga0070660_100943809 | |||
| 1559 | Ga0070689_100019016 | |||
| 1560 | Ga0070689_100019090 | |||
| 1561 | Ga0070689_100044593 | |||
| 1562 | Ga0070689_100055757 | |||
| 1563 | Ga0070689_100163692 | |||
| 1564 | Ga0070689_101076455 | |||
| 1565 | Ga0070691_10172697 | |||
| 1566 | Ga0070687_100039542 | |||
| 1567 | Ga0070687_100082039 | |||
| 1568 | Ga0070661_100006131 | |||
| 1569 | Ga0070661_100015813 | |||
| 1570 | Ga0070661_100015818 | |||
| 1571 | Ga0070661_100046937 | |||
| 1572 | Ga0070661_100700056 | |||
| 1573 | Ga0070661_100793527 | |||
| 1574 | Ga0070692_10004689 | |||
| 1575 | Ga0070692_10040008 | |||
| 1576 | Ga0070668_100006650 | |||
| 1577 | Ga0070668_100019549 | |||
| 1578 | Ga0070668_100022057 | |||
| 1579 | Ga0070668_100022437 | |||
| 1580 | Ga0070668_100060746 | |||
| 1581 | Ga0070668_100184173 | |||
| 1582 | Ga0070668_100256206 | |||
| 1583 | Ga0070668_100617455 | |||
| 1584 | Ga0070669_100011261 | |||
| 1585 | Ga0070669_100072484 | |||
| 1586 | Ga0070669_100089829 | |||
| 1587 | Ga0070669_100116999 | |||
| 1588 | Ga0070669_100129232 | |||
| 1589 | Ga0070669_100302554 | |||
| 1590 | Ga0070675_100003343 | |||
| 1591 | Ga0070675_100016616 | |||
| 1592 | Ga0070675_100032389 | |||
| 1593 | Ga0070675_100035125 | |||
| 1594 | Ga0070675_100203583 | |||
| 1595 | Ga0070675_100205734 | |||
| 1596 | Ga0070675_100416372 | |||
| 1597 | Ga0070675_100771843 | |||
| 1598 | Ga0070671_100000803 | |||
| 1599 | Ga0070671_100001991 | |||
| 1600 | Ga0070671_100024095 | |||
| 1601 | Ga0070671_100051913 | |||
| 1602 | Ga0070671_100054588 | |||
| 1603 | Ga0070671_100059511 | |||
| 1604 | Ga0070671_100223880 | |||
| 1605 | Ga0070671_100573648 | |||
| 1606 | Ga0070671_100612033 | |||
| 1607 | Ga0070671_100664302 | |||
| 1608 | Ga0070671_100794183 | |||
| 1609 | Ga0070674_100000274 | |||
| 1610 | Ga0070674_100013078 | |||
| 1611 | Ga0070674_100021899 | |||
| 1612 | Ga0070674_100070026 | |||
| 1613 | Ga0070674_100082737 | |||
| 1614 | Ga0070674_100109817 | |||
| 1615 | Ga0070674_100139100 | |||
| 1616 | Ga0070673_100000502 | |||
| 1617 | Ga0070673_100002265 | |||
| 1618 | Ga0070673_100031683 | |||
| 1619 | Ga0070673_100038486 | |||
| 1620 | Ga0070673_100040894 | |||
| 1621 | Ga0070673_100080038 | |||
| 1622 | Ga0070673_100090223 | |||
| 1623 | Ga0070673_100506297 | |||
| 1624 | Ga0070688_100011938 | |||
| 1625 | Ga0070688_100012315 | |||
| 1626 | Ga0070688_100015734 | |||
| 1627 | Ga0070688_100196730 | |||
| 1628 | Ga0070659_100001726 | |||
| 1629 | Ga0070659_100017311 | |||
| 1630 | Ga0070659_100029734 | |||
| 1631 | Ga0070659_100048701 | |||
| 1632 | Ga0070659_100065437 | |||
| 1633 | Ga0070659_100066089 | |||
| 1634 | Ga0070659_100117998 | |||
| 1635 | Ga0070659_100132111 | |||
| 1636 | Ga0070659_100377555 | |||
| 1637 | Ga0070659_100516245 | |||
| 1638 | Ga0070659_101544051 | |||
| 1639 | Ga0070667_100011152 | |||
| 1640 | Ga0070667_100014378 | |||
| 1641 | Ga0070667_100018913 | |||
| 1642 | Ga0070667_100044618 | |||
| 1643 | Ga0070667_100096867 | |||
| 1644 | Ga0070667_100287679 | |||
| 1645 | Ga0070667_100305114 | |||
| 1646 | Ga0070667_100395130 | |||
| 1647 | Ga0070667_100986338 | |||
| 1648 | Ga0070667_101809902 | |||
| 1649 | Ga0070667_101823240 | |||
| 1650 | Ga0070709_10008299 | |||
| 1651 | Ga0070709_10012962 | |||
| 1652 | Ga0070709_10028106 | |||
| 1653 | Ga0070709_10060724 | |||
| 1654 | Ga0070709_10233450 | |||
| 1655 | Ga0070709_10553675 | |||
| 1656 | Ga0070709_10862396 | |||
| 1657 | Ga0070714_100017248 | |||
| 1658 | Ga0070714_100029515 | |||
| 1659 | Ga0070714_100125104 | |||
| 1660 | Ga0070714_100383712 | |||
| 1661 | Ga0070714_101151357 | |||
| 1662 | Ga0070714_101198294 | |||
| 1663 | Ga0070714_101336626 | |||
| 1664 | Ga0070713_100000621 | |||
| 1665 | Ga0070713_100009875 | |||
| 1666 | Ga0070713_100173718 | |||
| 1667 | Ga0070713_100256006 | |||
| 1668 | Ga0070713_100489612 | |||
| 1669 | Ga0070713_100565560 | |||
| 1670 | Ga0070713_101505457 | |||
| 1671 | Ga0070710_10006664 | |||
| 1672 | Ga0070710_10446092 | |||
| 1673 | Ga0070710_10582498 | |||
| 1674 | Ga0070701_10037705 | |||
| 1675 | Ga0070701_10110108 | |||
| 1676 | Ga0070701_10800546 | |||
| 1677 | Ga0070711_100000562 | |||
| 1678 | Ga0070711_100015057 | |||
| 1679 | Ga0070711_100290769 | |||
| 1680 | Ga0070711_100345369 | |||
| 1681 | Ga0070711_100538655 | |||
| 1682 | Ga0070705_100002681 | |||
| 1683 | Ga0070705_100004688 | |||
| 1684 | Ga0070705_100111127 | |||
| 1685 | Ga0070700_100282541 | |||
| 1686 | Ga0070700_100515347 | |||
| 1687 | Ga0070700_100627673 | |||
| 1688 | Ga0070700_100665984 | |||
| 1689 | Ga0070700_100827078 | |||
| 1690 | Ga0070694_100003055 | |||
| 1691 | Ga0070694_100198333 | |||
| 1692 | Ga0070694_100365659 | |||
| 1693 | Ga0070708_100000961 | |||
| 1694 | Ga0070708_100039815 | |||
| 1695 | Ga0070663_100000226 | |||
| 1696 | Ga0070663_100049234 | |||
| 1697 | Ga0070663_100126042 | |||
| 1698 | Ga0070663_100170808 | |||
| 1699 | Ga0070663_100286692 | |||
| 1700 | Ga0070663_100458338 | |||
| 1701 | Ga0070663_100467398 | |||
| 1702 | Ga0070663_100731111 | |||
| 1703 | Ga0070678_100002036 | |||
| 1704 | Ga0070678_100003054 | |||
| 1705 | Ga0070678_100006079 | |||
| 1706 | Ga0070678_100086342 | |||
| 1707 | Ga0070678_100166747 | |||
| 1708 | Ga0070678_100628410 | |||
| 1709 | Ga0070662_100000111 | |||
| 1710 | Ga0070662_100015044 | |||
| 1711 | Ga0070662_100099703 | |||
| 1712 | Ga0070662_100214297 | |||
| 1713 | Ga0070662_100316909 | |||
| 1714 | Ga0070681_10026543 | |||
| 1715 | Ga0070681_10053935 | |||
| 1716 | Ga0070681_10790647 | |||
| 1717 | Ga0068867_100004886 | |||
| 1718 | Ga0068867_100009782 | |||
| 1719 | Ga0068867_100022311 | |||
| 1720 | Ga0068867_100259632 | |||
| 1721 | Ga0068867_100669553 | |||
| 1722 | Ga0070685_10001706 | |||
| 1723 | Ga0070685_10012009 | |||
| 1724 | Ga0070685_10062991 | |||
| 1725 | Ga0070706_100584167 | |||
| 1726 | Ga0070707_100078238 | |||
| 1727 | Ga0070699_100003739 | |||
| 1728 | Ga0070699_100016433 | |||
| 1729 | Ga0070699_100027824 | |||
| 1730 | Ga0070679_100228271 | |||
| 1731 | Ga0070679_100316192 | |||
| 1732 | Ga0070679_100321563 | |||
| 1733 | Ga0070679_100843137 | |||
| 1734 | Ga0070684_100001117 | |||
| 1735 | Ga0070684_100053565 | |||
| 1736 | Ga0070684_100054153 | |||
| 1737 | Ga0070684_100119191 | |||
| 1738 | Ga0070684_100240883 | |||
| 1739 | Ga0070684_100616206 | |||
| 1740 | Ga0070697_100011036 | |||
| 1741 | Ga0070697_100057369 | |||
| 1742 | Ga0070697_100146517 | |||
| 1743 | Ga0068853_100005294 | |||
| 1744 | Ga0068853_100012925 | |||
| 1745 | Ga0068853_100083415 | |||
| 1746 | Ga0068853_100156536 | |||
| 1747 | Ga0068853_100230938 | |||
| 1748 | Ga0068853_100281602 | |||
| 1749 | Ga0068853_100328122 | |||
| 1750 | Ga0068853_100492048 | |||
| 1751 | Ga0068853_100793635 | |||
| 1752 | Ga0070672_100001773 | |||
| 1753 | Ga0070672_100008494 | |||
| 1754 | Ga0070672_100014344 | |||
| 1755 | Ga0070672_100026516 | |||
| 1756 | Ga0070672_100035407 | |||
| 1757 | Ga0070672_100049647 | |||
| 1758 | Ga0070672_100128039 | |||
| 1759 | Ga0070672_100202101 | |||
| 1760 | Ga0070672_100329371 | |||
| 1761 | Ga0070672_100429191 | |||
| 1762 | Ga0070686_100027477 | |||
| 1763 | Ga0070686_100053216 | |||
| 1764 | Ga0070686_100061297 | |||
| 1765 | Ga0070686_100120908 | |||
| 1766 | Ga0070686_100303239 | |||
| 1767 | Ga0070686_100346621 | |||
| 1768 | Ga0070695_100007268 | |||
| 1769 | Ga0070695_100010123 | |||
| 1770 | Ga0070695_100046302 | |||
| 1771 | Ga0070695_100199059 | |||
| 1772 | Ga0070695_100342034 | |||
| 1773 | Ga0070696_100012043 | |||
| 1774 | Ga0070696_100016947 | |||
| 1775 | Ga0070696_100047956 | |||
| 1776 | Ga0070696_100072589 | |||
| 1777 | Ga0070696_100222503 | |||
| 1778 | Ga0070693_100010776 | |||
| 1779 | Ga0070693_100065531 | |||
| 1780 | Ga0070693_100077819 | |||
| 1781 | Ga0070693_100090605 | |||
| 1782 | Ga0070665_100010727 | |||
| 1783 | Ga0070665_100014147 | |||
| 1784 | Ga0070665_100082703 | |||
| 1785 | Ga0070665_100084751 | |||
| 1786 | Ga0070665_100147841 | |||
| 1787 | Ga0070665_100237044 | |||
| 1788 | Ga0070665_100423992 | |||
| 1789 | Ga0070665_100529066 | |||
| 1790 | Ga0070665_100781205 | |||
| 1791 | Ga0070704_100113532 | |||
| 1792 | Ga0070704_100124348 | |||
| 1793 | Ga0070704_100878593 | |||
| 1794 | Ga0068855_100000450 | |||
| 1795 | Ga0068855_100005788 | |||
| 1796 | Ga0068855_100007194 | |||
| 1797 | Ga0068855_100025363 | |||
| 1798 | Ga0068855_100134541 | |||
| 1799 | Ga0068855_100243201 | |||
| 1800 | Ga0068855_100285704 | |||
| 1801 | Ga0068855_100399376 | |||
| 1802 | Ga0068855_100437942 | |||
| 1803 | Ga0068855_101358125 | |||
| 1804 | Ga0070664_100000658 | |||
| 1805 | Ga0070664_100002704 | |||
| 1806 | Ga0070664_100019104 | |||
| 1807 | Ga0070664_100041993 | |||
| 1808 | Ga0070664_100083651 | |||
| 1809 | Ga0070664_100261851 | |||
| 1810 | Ga0070664_100309288 | |||
| 1811 | Ga0070664_100452004 | |||
| 1812 | Ga0070664_100492939 | |||
| 1813 | Ga0070664_100729429 | |||
| 1814 | Ga0070664_101202464 | |||
| 1815 | Ga0068857_100005799 | |||
| 1816 | Ga0068857_100086667 | |||
| 1817 | Ga0068857_100098008 | |||
| 1818 | Ga0068857_100128153 | |||
| 1819 | Ga0068857_100594720 | |||
| 1820 | Ga0068857_100687870 | |||
| 1821 | Ga0068857_100815666 | |||
| 1822 | Ga0068854_100013441 | |||
| 1823 | Ga0068854_100030042 | |||
| 1824 | Ga0068854_100041866 | |||
| 1825 | Ga0068854_100050573 | |||
| 1826 | Ga0068854_100113282 | |||
| 1827 | Ga0068854_100266585 | |||
| 1828 | Ga0068856_100000350 | |||
| 1829 | Ga0068856_100006095 | |||
| 1830 | Ga0068856_100021309 | |||
| 1831 | Ga0068856_100032074 | |||
| 1832 | Ga0068856_100074182 | |||
| 1833 | Ga0070702_100014764 | |||
| 1834 | Ga0070702_100428814 | |||
| 1835 | Ga0070702_100610941 | |||
| 1836 | Ga0070702_100724592 | |||
| 1837 | Ga0070702_100774019 | |||
| 1838 | Ga0068852_100000823 | |||
| 1839 | Ga0068852_100000940 | |||
| 1840 | Ga0068852_100006323 | |||
| 1841 | Ga0068852_100008545 | |||
| 1842 | Ga0068852_100032464 | |||
| 1843 | Ga0068852_100035269 | |||
| 1844 | Ga0068852_100101705 | |||
| 1845 | Ga0068852_100129902 | |||
| 1846 | Ga0068852_100225160 | |||
| 1847 | Ga0068859_100001741 | |||
| 1848 | Ga0068859_100006755 | |||
| 1849 | Ga0068859_100013682 | |||
| 1850 | Ga0068859_100015466 | |||
| 1851 | Ga0068859_100018437 | |||
| 1852 | Ga0068859_100146194 | |||
| 1853 | Ga0068859_100241082 | |||
| 1854 | Ga0068859_100437758 | |||
| 1855 | Ga0068859_100692971 | |||
| 1856 | Ga0068864_100004626 | |||
| 1857 | Ga0068864_100008845 | |||
| 1858 | Ga0068864_100040417 | |||
| 1859 | Ga0068864_100079555 | |||
| 1860 | Ga0068864_100182425 | |||
| 1861 | Ga0068864_100366211 | |||
| 1862 | Ga0068864_100527486 | |||
| 1863 | Ga0068864_100665022 | |||
| 1864 | Ga0068864_100713124 | |||
| 1865 | Ga0068864_100904203 | |||
| 1866 | Ga0068864_101182483 | |||
| 1867 | Ga0068864_101335995 | |||
| 1868 | Ga0068866_10001140 | |||
| 1869 | Ga0068866_10142945 | |||
| 1870 | Ga0068866_10914367 | |||
| 1871 | Ga0068861_100020343 | |||
| 1872 | Ga0068861_100021902 | |||
| 1873 | Ga0068861_100133909 | |||
| 1874 | Ga0068861_100538340 | |||
| 1875 | Ga0068861_100830338 | |||
| 1876 | Ga0068861_101114476 | |||
| 1877 | Ga0068861_101217472 | |||
| 1878 | Ga0068851_10002888 | |||
| 1879 | Ga0068851_10010098 | |||
| 1880 | Ga0068851_10015536 | |||
| 1881 | Ga0068851_10017493 | |||
| 1882 | Ga0068851_10045665 | |||
| 1883 | Ga0068851_10102684 | |||
| 1884 | Ga0068851_10462328 | |||
| 1885 | Ga0068870_10011295 | |||
| 1886 | Ga0068870_10013697 | |||
| 1887 | Ga0068870_10024771 | |||
| 1888 | Ga0068870_10146490 | |||
| 1889 | Ga0068870_10155989 | |||
| 1890 | Ga0068870_10427668 | |||
| 1891 | Ga0068870_10434541 | |||
| 1892 | Ga0068863_100007778 | |||
| 1893 | Ga0068863_100010341 | |||
| 1894 | Ga0068863_100017079 | |||
| 1895 | Ga0068863_100017142 | |||
| 1896 | Ga0068863_100089280 | |||
| 1897 | Ga0068863_100089474 | |||
| 1898 | Ga0068863_100152609 | |||
| 1899 | Ga0068863_100381561 | |||
| 1900 | Ga0068863_100410416 | |||
| 1901 | Ga0068863_100462731 | |||
| 1902 | Ga0068863_100503377 | |||
| 1903 | Ga0068863_100717650 | |||
| 1904 | Ga0068858_100005201 | |||
| 1905 | Ga0068858_100007116 | |||
| 1906 | Ga0068858_100008383 | |||
| 1907 | Ga0068858_100025618 | |||
| 1908 | Ga0068858_100031012 | |||
| 1909 | Ga0068858_100038624 | |||
| 1910 | Ga0068858_100097462 | |||
| 1911 | Ga0068858_100112030 | |||
| 1912 | Ga0068858_100248656 | |||
| 1913 | Ga0068858_100554054 | |||
| 1914 | Ga0068858_101128837 | |||
| 1915 | Ga0068860_100003853 | |||
| 1916 | Ga0068860_100006923 | |||
| 1917 | Ga0068860_100028491 | |||
| 1918 | Ga0068860_100049948 | |||
| 1919 | Ga0068860_100058629 | |||
| 1920 | Ga0068860_100103036 | |||
| 1921 | Ga0068860_100118186 | |||
| 1922 | Ga0068860_100142833 | |||
| 1923 | Ga0068860_100272969 | |||
| 1924 | Ga0068860_100289383 | |||
| 1925 | Ga0068860_100438342 | |||
| 1926 | Ga0068860_100466196 | |||
| 1927 | Ga0068860_100640400 | |||
| 1928 | Ga0068862_100007988 | |||
| 1929 | Ga0068862_100016343 | |||
| 1930 | Ga0068862_100022934 | |||
| 1931 | Ga0068862_100045373 | |||
| 1932 | Ga0068862_100206038 | |||
| 1933 | Ga0070715_10497504 | |||
| 1934 | Ga0070716_100016651 | |||
| 1935 | Ga0070716_100301596 | |||
| 1936 | Ga0070716_101018324 | |||
| 1937 | Ga0070712_100003612 | |||
| 1938 | Ga0070712_100004881 | |||
| 1939 | Ga0070712_100635049 | |||
| 1940 | Ga0070712_100911020 | |||
| 1941 | Ga0075362_10059457 | |||
| 1942 | Ga0075367_10389397 | |||
| 1943 | Ga0075366_10161046 | |||
| 1944 | Ga0075366_10223903 | |||
| 1945 | Ga0075366_10569283 | |||
| 1946 | Ga0097621_100005070 | |||
| 1947 | Ga0097621_100011618 | |||
| 1948 | Ga0097621_100014528 | |||
| 1949 | Ga0097621_100059433 | |||
| 1950 | Ga0097621_100085160 | |||
| 1951 | Ga0097621_100112531 | |||
| 1952 | Ga0097621_100175283 | |||
| 1953 | Ga0097621_100206410 | |||
| 1954 | Ga0097621_100211255 | |||
| 1955 | Ga0097621_100213448 | |||
| 1956 | Ga0097621_100970915 | |||
| 1957 | Ga0097621_101005143 | |||
| 1958 | Ga0097621_101014047 | |||
| 1959 | Ga0075370_10007832 | |||
| 1960 | Ga0075370_10301590 | |||
| 1961 | Ga0068871_100004840 | |||
| 1962 | Ga0068871_100009792 | |||
| 1963 | Ga0068871_100032204 | |||
| 1964 | Ga0068871_100111440 | |||
| 1965 | Ga0068871_100223181 | |||
| 1966 | Ga0068871_100228649 | |||
| 1967 | Ga0068871_100275257 | |||
| 1968 | Ga0075428_100027531 | |||
| 1969 | Ga0075428_101296960 | |||
| 1970 | Ga0075434_100007245 | |||
| 1971 | Ga0075434_100336236 | |||
| 1972 | Ga0075429_100001051 | |||
| 1973 | Ga0075429_100414980 | |||
| 1974 | Ga0068865_100006023 | |||
| 1975 | Ga0068865_100017868 | |||
| 1976 | Ga0068865_100144694 | |||
| 1977 | Ga0068865_100204565 | |||
| 1978 | Ga0068865_101512517 | |||
| 1979 | Ga0075436_100189631 | |||
| 1980 | Ga0075436_100299875 | |||
| 1981 | Ga0097620_100001741 | |||
| 1982 | Ga0097620_100006755 | |||
| 1983 | Ga0097620_100013682 | |||
| 1984 | Ga0097620_100015466 | |||
| 1985 | Ga0097620_100018437 | |||
| 1986 | Ga0097620_100146188 | |||
| 1987 | Ga0097620_100241073 | |||
| 1988 | Ga0097620_100437775 | |||
| 1989 | Ga0097620_100693026 | |||
| 1990 | Ga0079104_1000001 | |||
| 1991 | Ga0075435_100091917 | |||
| 1992 | Ga0099794_10014365 | |||
| 1993 | Ga0099794_10019347 | |||
| 1994 | Ga0099794_10030122 | |||
| 1995 | Ga0105240_10001889 | |||
| 1996 | Ga0105240_10008787 | |||
| 1997 | Ga0105240_10013727 | |||
| 1998 | Ga0105240_10022316 | |||
| 1999 | Ga0105240_11738242 | |||
| 2000 | Ga0111539_10077714 | |||
| 2001 | Ga0111539_10868363 | |||
| 2002 | Ga0105245_10009343 | |||
| 2003 | Ga0105245_10009415 | |||
| 2004 | Ga0105245_10035818 | |||
| 2005 | Ga0105245_10082944 | |||
| 2006 | Ga0105245_10492541 | |||
| 2007 | Ga0105245_10932365 | |||
| 2008 | Ga0105245_11873599 | |||
| 2009 | Ga0105247_10018997 | |||
| 2010 | Ga0105247_10072757 | |||
| 2011 | Ga0114129_10272777 | |||
| 2012 | Ga0105243_11837791 | |||
| 2013 | Ga0105241_10006963 | |||
| 2014 | Ga0105241_10011046 | |||
| 2015 | Ga0105241_10063871 | |||
| 2016 | Ga0105241_10692202 | |||
| 2017 | Ga0105241_11250830 | |||
| 2018 | Ga0105241_11337483 | |||
| 2019 | Ga0105242_10008131 | |||
| 2020 | Ga0105242_10077721 | |||
| 2021 | Ga0105242_10258737 | |||
| 2022 | Ga0105248_10000878 | |||
| 2023 | Ga0105248_10003568 | |||
| 2024 | Ga0105248_10013308 | |||
| 2025 | Ga0105248_10057367 | |||
| 2026 | Ga0105248_10081931 | |||
| 2027 | Ga0105248_10101263 | |||
| 2028 | Ga0105248_10276297 | |||
| 2029 | Ga0105248_10759452 | |||
| 2030 | Ga0105248_11098406 | |||
| 2031 | Ga0105237_10024857 | |||
| 2032 | Ga0105237_10053862 | |||
| 2033 | Ga0105237_10078968 | |||
| 2034 | Ga0105237_10114390 | |||
| 2035 | Ga0105237_10300962 | |||
| 2036 | Ga0105237_11011002 | |||
| 2037 | Ga0105237_11911226 | |||
| 2038 | Ga0105238_10009503 | |||
| 2039 | Ga0105238_10035807 | |||
| 2040 | Ga0105238_10331229 | |||
| 2041 | Ga0105238_11640935 | |||
| 2042 | Ga0105238_12411654 | |||
| 2043 | Ga0105249_10140898 | |||
| 2044 | Ga0105249_10157207 | |||
| 2045 | Ga0105249_10188866 | |||
| 2046 | Ga0105249_10317138 | |||
| 2047 | Ga0105249_10669218 | |||
| 2048 | Ga0105249_11075945 | |||
| 2049 | Ga0105239_10170886 | |||
| 2050 | Ga0105239_10696001 | |||
| 2051 | Ga0105239_10932774 | |||
| 2052 | Ga0105239_11507199 | |||
| 2053 | Ga0105246_10023747 | |||
| 2054 | Ga0105246_10145440 | |||
| 2055 | Ga0157373_10001063 | |||
| 2056 | Ga0157373_10013745 | |||
| 2057 | Ga0157373_10170001 | |||
| 2058 | Ga0157371_10001162 | |||
| 2059 | Ga0157371_10695242 | |||
| 2060 | Ga0157371_10703964 | |||
| 2061 | Ga0157371_10804122 | |||
| 2062 | Ga0157370_10018289 | |||
| 2063 | Ga0157370_10042167 | |||
| 2064 | Ga0157370_10046754 | |||
| 2065 | Ga0157370_10114567 | |||
| 2066 | Ga0157370_10361564 | |||
| 2067 | Ga0157370_10683768 | |||
| 2068 | Ga0157370_10734214 | |||
| 2069 | Ga0157369_10002639 | |||
| 2070 | Ga0157369_10054350 | |||
| 2071 | Ga0157369_10203685 | |||
| 2072 | Ga0157369_10229695 | |||
| 2073 | Ga0157369_10275373 | |||
| 2074 | Ga0157369_10412080 | |||
| 2075 | Ga0157369_10442483 | |||
| 2076 | Ga0157369_11160926 | |||
| 2077 | Ga0157374_10001809 | |||
| 2078 | Ga0157374_10035751 | |||
| 2079 | Ga0157374_10035915 | |||
| 2080 | Ga0157374_10133566 | |||
| 2081 | Ga0157374_10215766 | |||
| 2082 | Ga0157374_10659770 | |||
| 2083 | Ga0157374_10700986 | |||
| 2084 | Ga0157374_11543223 | |||
| 2085 | Ga0157378_10009283 | |||
| 2086 | Ga0157378_10009954 | |||
| 2087 | Ga0157378_10030000 | |||
| 2088 | Ga0157378_10401907 | |||
| 2089 | Ga0157378_10654335 | |||
| 2090 | Ga0163162_10001211 | |||
| 2091 | Ga0163162_10011811 | |||
| 2092 | Ga0163162_10096594 | |||
| 2093 | Ga0163162_10201399 | |||
| 2094 | Ga0163162_10328857 | |||
| 2095 | Ga0163162_10617676 | |||
| 2096 | Ga0163162_10717152 | |||
| 2097 | Ga0163162_10934839 | |||
| 2098 | Ga0157372_10001523 | |||
| 2099 | Ga0157372_10001692 | |||
| 2100 | Ga0157372_10006706 | |||
| 2101 | Ga0157372_10021790 | |||
| 2102 | Ga0157372_10038529 | |||
| 2103 | Ga0157372_10057008 | |||
| 2104 | Ga0157372_10125179 | |||
| 2105 | Ga0157372_10127426 | |||
| 2106 | Ga0157372_10235050 | |||
| 2107 | Ga0157372_10342593 | |||
| 2108 | Ga0157372_10611369 | |||
| 2109 | Ga0157372_10653370 | |||
| 2110 | Ga0157372_11040013 | |||
| 2111 | Ga0157372_11081066 | |||
| 2112 | Ga0157372_11268004 | |||
| 2113 | Ga0157375_10005469 | |||
| 2114 | Ga0157375_10008616 | |||
| 2115 | Ga0157375_10009546 | |||
| 2116 | Ga0157375_10030473 | |||
| 2117 | Ga0157375_10139594 | |||
| 2118 | Ga0157375_10160405 | |||
| 2119 | Ga0157375_10192365 | |||
| 2120 | Ga0157375_10341164 | |||
| 2121 | Ga0157375_11331140 | |||
| 2122 | Ga0163163_10001352 | |||
| 2123 | Ga0163163_10005124 | |||
| 2124 | Ga0163163_10017644 | |||
| 2125 | Ga0163163_10116185 | |||
| 2126 | Ga0163163_10129546 | |||
| 2127 | Ga0163163_10277309 | |||
| 2128 | Ga0163163_10788761 | |||
| 2129 | Ga0163163_11206576 | |||
| 2130 | Ga0157380_10075229 | |||
| 2131 | Ga0157380_10127469 | |||
| 2132 | Ga0157380_10183319 | |||
| 2133 | Ga0157380_10323229 | |||
| 2134 | Ga0157380_10406241 | |||
| 2135 | Ga0157380_11896899 | |||
| 2136 | Ga0157377_10005762 | |||
| 2137 | Ga0157377_10020805 | |||
| 2138 | Ga0157377_10192613 | |||
| 2139 | Ga0157377_10354686 | |||
| 2140 | Ga0157379_10003084 | |||
| 2141 | Ga0157379_10006078 | |||
| 2142 | Ga0157379_10014992 | |||
| 2143 | Ga0157379_10044107 | |||
| 2144 | Ga0157379_10094110 | |||
| 2145 | Ga0157379_10177073 | |||
| 2146 | Ga0157379_10290174 | |||
| 2147 | Ga0157379_10295756 | |||
| 2148 | Ga0157379_10877914 | |||
| 2149 | Ga0157376_10005980 | |||
| 2150 | Ga0157376_10006034 | |||
| 2151 | Ga0157376_10008657 | |||
| 2152 | Ga0157376_10021115 | |||
| 2153 | Ga0157376_10056422 | |||
| 2154 | Ga0157376_10108541 | |||
| 2155 | Ga0157376_10156469 | |||
| 2156 | Ga0157376_10216043 | |||
| 2157 | Ga0157376_10268444 | |||
| 2158 | Ga0157376_10329577 | |||
| 2159 | Ga0157376_10432172 | |||
| 2160 | Ga0163161_10091924 | |||
| 2161 | Ga0163161_10292088 | |||
| 2162 | Ga0206356_10378156 | |||
| 2163 | Ga0206354_10831956 | |||
| 2164 | Ga0206353_10348253 | |||
| 2165 | Ga0213872_10010960 | |||
| 2166 | Ga0209565_1008854 | |||
| 2167 | Ga0209050_1000118 | |||
| 2168 | Ga0209256_1000015 | |||
| 2169 | Ga0209051_1048365 | |||
| 2170 | Ga0207697_10001322 | |||
| 2171 | Ga0207697_10006351 | |||
| 2172 | Ga0207697_10064319 | |||
| 2173 | Ga0207656_10021638 | |||
| 2174 | Ga0207656_10040066 | |||
| 2175 | Ga0207656_10110599 | |||
| 2176 | Ga0207656_10436309 | |||
| 2177 | Ga0207682_10001314 | |||
| 2178 | Ga0207682_10066945 | |||
| 2179 | Ga0207692_10151398 | |||
| 2180 | Ga0207692_10243228 | |||
| 2181 | Ga0207692_10742301 | |||
| 2182 | Ga0207642_10049883 | |||
| 2183 | Ga0207642_10059991 | |||
| 2184 | Ga0207642_10086113 | |||
| 2185 | Ga0207642_10228143 | |||
| 2186 | Ga0207710_10224370 | |||
| 2187 | Ga0207710_10274693 | |||
| 2188 | Ga0207688_10040755 | |||
| 2189 | Ga0207688_10137724 | |||
| 2190 | Ga0207680_10002102 | |||
| 2191 | Ga0207680_10002576 | |||
| 2192 | Ga0207680_10006510 | |||
| 2193 | Ga0207680_10130197 | |||
| 2194 | Ga0207680_10778992 | |||
| 2195 | Ga0207685_10052916 | |||
| 2196 | Ga0207699_10020977 | |||
| 2197 | Ga0207699_10045839 | |||
| 2198 | Ga0207699_10156363 | |||
| 2199 | Ga0207699_10542025 | |||
| 2200 | Ga0207699_10891022 | |||
| 2201 | Ga0207645_10000214 | |||
| 2202 | Ga0207645_10000421 | |||
| 2203 | Ga0207645_10000695 | |||
| 2204 | Ga0207645_10051776 | |||
| 2205 | Ga0207645_10221952 | |||
| 2206 | Ga0207643_10000537 | |||
| 2207 | Ga0207643_10006837 | |||
| 2208 | Ga0207643_10031135 | |||
| 2209 | Ga0207643_10190696 | |||
| 2210 | Ga0207705_10029140 | |||
| 2211 | Ga0207705_10046332 | |||
| 2212 | Ga0207705_10125004 | |||
| 2213 | Ga0207705_10251199 | |||
| 2214 | Ga0207705_10347690 | |||
| 2215 | Ga0207705_10430450 | |||
| 2216 | Ga0207684_10062559 | |||
| 2217 | Ga0207654_10030084 | |||
| 2218 | Ga0207654_10046536 | |||
| 2219 | Ga0207654_10761391 | |||
| 2220 | Ga0207707_10002896 | |||
| 2221 | Ga0207707_10012845 | |||
| 2222 | Ga0207707_10741698 | |||
| 2223 | Ga0207695_10053255 | |||
| 2224 | Ga0207695_10460568 | |||
| 2225 | Ga0207695_11164634 | |||
| 2226 | Ga0207671_10053265 | |||
| 2227 | Ga0207671_10333599 | |||
| 2228 | Ga0207693_10000652 | |||
| 2229 | Ga0207693_10257300 | |||
| 2230 | Ga0207693_10465167 | |||
| 2231 | Ga0207663_10002608 | |||
| 2232 | Ga0207663_10080045 | |||
| 2233 | Ga0207660_10040475 | |||
| 2234 | Ga0207660_10239956 | |||
| 2235 | Ga0207662_10045518 | |||
| 2236 | Ga0207662_10260182 | |||
| 2237 | Ga0207657_10000750 | |||
| 2238 | Ga0207657_10002560 | |||
| 2239 | Ga0207657_10007901 | |||
| 2240 | Ga0207657_10024835 | |||
| 2241 | Ga0207657_10032956 | |||
| 2242 | Ga0207649_10004987 | |||
| 2243 | Ga0207649_10011486 | |||
| 2244 | Ga0207649_10053399 | |||
| 2245 | Ga0207649_10162744 | |||
| 2246 | Ga0207649_10732780 | |||
| 2247 | Ga0207649_10918792 | |||
| 2248 | Ga0207652_10114356 | |||
| 2249 | Ga0207652_10235188 | |||
| 2250 | Ga0207652_10523802 | |||
| 2251 | Ga0207646_10014581 | |||
| 2252 | Ga0207646_11206169 | |||
| 2253 | Ga0207681_10029078 | |||
| 2254 | Ga0207681_10062396 | |||
| 2255 | Ga0207681_10200987 | |||
| 2256 | Ga0207681_10301407 | |||
| 2257 | Ga0207681_10318132 | |||
| 2258 | Ga0207694_10005853 | |||
| 2259 | Ga0207694_10016726 | |||
| 2260 | Ga0207694_10041190 | |||
| 2261 | Ga0207694_10323906 | |||
| 2262 | Ga0207694_10498964 | |||
| 2263 | Ga0207694_11520836 | |||
| 2264 | Ga0207650_10008724 | |||
| 2265 | Ga0207650_10017230 | |||
| 2266 | Ga0207650_10020685 | |||
| 2267 | Ga0207650_10032090 | |||
| 2268 | Ga0207650_10044419 | |||
| 2269 | Ga0207650_10094251 | |||
| 2270 | Ga0207650_10116313 | |||
| 2271 | Ga0207650_10177971 | |||
| 2272 | Ga0207650_10895675 | |||
| 2273 | Ga0207650_11345727 | |||
| 2274 | Ga0207659_10002136 | |||
| 2275 | Ga0207659_10012703 | |||
| 2276 | Ga0207659_10017200 | |||
| 2277 | Ga0207659_10041351 | |||
| 2278 | Ga0207659_10074554 | |||
| 2279 | Ga0207659_10377670 | |||
| 2280 | Ga0207687_10002403 | |||
| 2281 | Ga0207687_10009624 | |||
| 2282 | Ga0207687_10089592 | |||
| 2283 | Ga0207687_11428951 | |||
| 2284 | Ga0207700_10006059 | |||
| 2285 | Ga0207700_10006798 | |||
| 2286 | Ga0207700_10061260 | |||
| 2287 | Ga0207700_10302396 | |||
| 2288 | Ga0207700_10386787 | |||
| 2289 | Ga0207700_10742649 | |||
| 2290 | Ga0207700_11277872 | |||
| 2291 | Ga0207664_10000912 | |||
| 2292 | Ga0207664_10055495 | |||
| 2293 | Ga0207664_10462445 | |||
| 2294 | Ga0207664_10534050 | |||
| 2295 | Ga0207664_11133358 | |||
| 2296 | Ga0207644_10001317 | |||
| 2297 | Ga0207644_10001544 | |||
| 2298 | Ga0207644_10007546 | |||
| 2299 | Ga0207644_10010859 | |||
| 2300 | Ga0207644_10039904 | |||
| 2301 | Ga0207644_10044769 | |||
| 2302 | Ga0207644_10111826 | |||
| 2303 | Ga0207644_10151743 | |||
| 2304 | Ga0207644_10263945 | |||
| 2305 | Ga0207644_10392191 | |||
| 2306 | Ga0207644_10504612 | |||
| 2307 | Ga0207690_10000826 | |||
| 2308 | Ga0207690_10018363 | |||
| 2309 | Ga0207690_10024622 | |||
| 2310 | Ga0207690_10028312 | |||
| 2311 | Ga0207690_10265877 | |||
| 2312 | Ga0207690_10273017 | |||
| 2313 | Ga0207706_10000465 | |||
| 2314 | Ga0207706_10004984 | |||
| 2315 | Ga0207706_10008050 | |||
| 2316 | Ga0207706_10013535 | |||
| 2317 | Ga0207706_10141051 | |||
| 2318 | Ga0207706_10219105 | |||
| 2319 | Ga0207706_10228234 | |||
| 2320 | Ga0207686_10016224 | |||
| 2321 | Ga0207686_10081829 | |||
| 2322 | Ga0207709_10193197 | |||
| 2323 | Ga0207709_10226720 | |||
| 2324 | Ga0207670_10008447 | |||
| 2325 | Ga0207670_10028643 | |||
| 2326 | Ga0207670_10041928 | |||
| 2327 | Ga0207670_10122272 | |||
| 2328 | Ga0207670_10226472 | |||
| 2329 | Ga0207670_10644180 | |||
| 2330 | Ga0207670_10912645 | |||
| 2331 | Ga0207669_10016731 | |||
| 2332 | Ga0207669_10049351 | |||
| 2333 | Ga0207669_10062316 | |||
| 2334 | Ga0207669_10168199 | |||
| 2335 | Ga0207669_10219510 | |||
| 2336 | Ga0207669_10349222 | |||
| 2337 | Ga0207704_10003217 | |||
| 2338 | Ga0207704_10051971 | |||
| 2339 | Ga0207704_10089364 | |||
| 2340 | Ga0207704_10159849 | |||
| 2341 | Ga0207704_10514262 | |||
| 2342 | Ga0207704_10934686 | |||
| 2343 | Ga0207665_10006908 | |||
| 2344 | Ga0207665_10439099 | |||
| 2345 | Ga0207691_10000084 | |||
| 2346 | Ga0207691_10000577 | |||
| 2347 | Ga0207691_10001328 | |||
| 2348 | Ga0207691_10007830 | |||
| 2349 | Ga0207691_10009589 | |||
| 2350 | Ga0207691_10024667 | |||
| 2351 | Ga0207691_10050830 | |||
| 2352 | Ga0207691_10133319 | |||
| 2353 | Ga0207691_10168116 | |||
| 2354 | Ga0207691_10277792 | |||
| 2355 | Ga0207691_10304882 | |||
| 2356 | Ga0207711_10000087 | |||
| 2357 | Ga0207711_10068506 | |||
| 2358 | Ga0207711_10079464 | |||
| 2359 | Ga0207711_10554326 | |||
| 2360 | Ga0207711_11864467 | |||
| 2361 | Ga0207689_10000069 | |||
| 2362 | Ga0207689_10001822 | |||
| 2363 | Ga0207689_10004226 | |||
| 2364 | Ga0207689_10014272 | |||
| 2365 | Ga0207689_10020777 | |||
| 2366 | Ga0207689_10127315 | |||
| 2367 | Ga0207689_10392687 | |||
| 2368 | Ga0207661_10009752 | |||
| 2369 | Ga0207661_10068005 | |||
| 2370 | Ga0207661_10081925 | |||
| 2371 | Ga0207661_10139313 | |||
| 2372 | Ga0207661_10307273 | |||
| 2373 | Ga0207661_10495668 | |||
| 2374 | Ga0207661_11402725 | |||
| 2375 | Ga0207679_10002617 | |||
| 2376 | Ga0207679_10003953 | |||
| 2377 | Ga0207679_10009503 | |||
| 2378 | Ga0207679_10018509 | |||
| 2379 | Ga0207679_10024164 | |||
| 2380 | Ga0207679_10033839 | |||
| 2381 | Ga0207679_10224474 | |||
| 2382 | Ga0207679_10328735 | |||
| 2383 | Ga0207679_10353045 | |||
| 2384 | Ga0207679_10655101 | |||
| 2385 | Ga0207667_10000490 | |||
| 2386 | Ga0207667_10001200 | |||
| 2387 | Ga0207667_10020237 | |||
| 2388 | Ga0207667_10034332 | |||
| 2389 | Ga0207667_10049680 | |||
| 2390 | Ga0207667_10230511 | |||
| 2391 | Ga0207667_10754105 | |||
| 2392 | Ga0207651_10034097 | |||
| 2393 | Ga0207651_10058537 | |||
| 2394 | Ga0207651_10076025 | |||
| 2395 | Ga0207651_10098714 | |||
| 2396 | Ga0207651_10412067 | |||
| 2397 | Ga0207651_10896648 | |||
| 2398 | Ga0207712_10169501 | |||
| 2399 | Ga0207712_10588000 | |||
| 2400 | Ga0207712_10598117 | |||
| 2401 | Ga0207668_10002833 | |||
| 2402 | Ga0207668_10020812 | |||
| 2403 | Ga0207668_10072731 | |||
| 2404 | Ga0207668_10082765 | |||
| 2405 | Ga0207668_10096561 | |||
| 2406 | Ga0207668_10139413 | |||
| 2407 | Ga0207668_10184349 | |||
| 2408 | Ga0207668_10264603 | |||
| 2409 | Ga0207640_10004420 | |||
| 2410 | Ga0207640_10196228 | |||
| 2411 | Ga0207640_10322519 | |||
| 2412 | Ga0207640_10381345 | |||
| 2413 | Ga0207640_10836124 | |||
| 2414 | Ga0207640_10877677 | |||
| 2415 | Ga0207658_10004792 | |||
| 2416 | Ga0207658_10015419 | |||
| 2417 | Ga0207658_10030693 | |||
| 2418 | Ga0207658_10034077 | |||
| 2419 | Ga0207658_10040854 | |||
| 2420 | Ga0207658_10131100 | |||
| 2421 | Ga0207658_10385542 | |||
| 2422 | Ga0207658_10836479 | |||
| 2423 | Ga0207677_10002351 | |||
| 2424 | Ga0207677_10003281 | |||
| 2425 | Ga0207677_10013587 | |||
| 2426 | Ga0207677_10096955 | |||
| 2427 | Ga0207677_10205834 | |||
| 2428 | Ga0207677_10258002 | |||
| 2429 | Ga0207677_10315814 | |||
| 2430 | Ga0207677_10387167 | |||
| 2431 | Ga0207677_11023988 | |||
| 2432 | Ga0207703_10003435 | |||
| 2433 | Ga0207703_10020784 | |||
| 2434 | Ga0207703_10047877 | |||
| 2435 | Ga0207703_10097054 | |||
| 2436 | Ga0207703_10099385 | |||
| 2437 | Ga0207703_10234858 | |||
| 2438 | Ga0207703_10535412 | |||
| 2439 | Ga0207703_10927693 | |||
| 2440 | Ga0207703_11135969 | |||
| 2441 | Ga0207703_11166214 | |||
| 2442 | Ga0207639_10002729 | |||
| 2443 | Ga0207639_10085045 | |||
| 2444 | Ga0207639_10115683 | |||
| 2445 | Ga0207639_10206423 | |||
| 2446 | Ga0207639_10225232 | |||
| 2447 | Ga0207639_10590504 | |||
| 2448 | Ga0207639_10845258 | |||
| 2449 | Ga0207678_10000429 | |||
| 2450 | Ga0207678_10024896 | |||
| 2451 | Ga0207678_10063616 | |||
| 2452 | Ga0207678_10257659 | |||
| 2453 | Ga0207678_10433641 | |||
| 2454 | Ga0207678_10483840 | |||
| 2455 | Ga0207678_10955631 | |||
| 2456 | Ga0207708_10000710 | |||
| 2457 | Ga0207708_10070723 | |||
| 2458 | Ga0207708_10609583 | |||
| 2459 | Ga0207708_10728229 | |||
| 2460 | Ga0207702_10000635 | |||
| 2461 | Ga0207702_10007712 | |||
| 2462 | Ga0207702_10555710 | |||
| 2463 | Ga0207702_10741525 | |||
| 2464 | Ga0207641_10000832 | |||
| 2465 | Ga0207641_10008086 | |||
| 2466 | Ga0207641_10028936 | |||
| 2467 | Ga0207641_10046362 | |||
| 2468 | Ga0207641_10074523 | |||
| 2469 | Ga0207641_10091874 | |||
| 2470 | Ga0207641_10252563 | |||
| 2471 | Ga0207641_10430200 | |||
| 2472 | Ga0207641_10484223 | |||
| 2473 | Ga0207641_10623493 | |||
| 2474 | Ga0207641_10848422 | |||
| 2475 | Ga0207648_10001494 | |||
| 2476 | Ga0207648_10002166 | |||
| 2477 | Ga0207648_10005304 | |||
| 2478 | Ga0207648_10007639 | |||
| 2479 | Ga0207648_10010002 | |||
| 2480 | Ga0207648_10258076 | |||
| 2481 | Ga0207648_10314828 | |||
| 2482 | Ga0207648_10823879 | |||
| 2483 | Ga0207676_10000294 | |||
| 2484 | Ga0207676_10010977 | |||
| 2485 | Ga0207676_10031242 | |||
| 2486 | Ga0207676_10034632 | |||
| 2487 | Ga0207676_10087407 | |||
| 2488 | Ga0207676_10117327 | |||
| 2489 | Ga0207676_10157544 | |||
| 2490 | Ga0207676_10636366 | |||
| 2491 | Ga0207676_11009222 | |||
| 2492 | Ga0207676_11097917 | |||
| 2493 | Ga0207676_11373440 | |||
| 2494 | Ga0207674_10000140 | |||
| 2495 | Ga0207674_10001268 | |||
| 2496 | Ga0207674_10002122 | |||
| 2497 | Ga0207674_10008483 | |||
| 2498 | Ga0207674_10066352 | |||
| 2499 | Ga0207674_10126579 | |||
| 2500 | Ga0207675_100003688 | |||
| 2501 | Ga0207675_100024173 | |||
| 2502 | Ga0207675_100133130 | |||
| 2503 | Ga0207675_100258972 | |||
| 2504 | Ga0207675_100621877 | |||
| 2505 | Ga0207675_100754562 | |||
| 2506 | Ga0207683_10000003 | |||
| 2507 | Ga0207683_10000355 | |||
| 2508 | Ga0207683_10004640 | |||
| 2509 | Ga0207683_10013734 | |||
| 2510 | Ga0207683_10038235 | |||
| 2511 | Ga0207683_10041228 | |||
| 2512 | Ga0207683_10244960 | |||
| 2513 | Ga0207683_11224833 | |||
| 2514 | Ga0207683_11269342 | |||
| 2515 | Ga0207698_10001629 | |||
| 2516 | Ga0207698_10016336 | |||
| 2517 | Ga0207698_10026907 | |||
| 2518 | Ga0207698_10098460 | |||
| 2519 | Ga0207698_10140919 | |||
| 2520 | Ga0207698_10331444 | |||
| 2521 | Ga0207698_10500209 | |||
| 2522 | Ga0207698_10694092 | |||
| 2523 | Ga0207698_12038168 | |||
| 2524 | Ga0209281_1000151 | |||
| 2525 | Ga0209998_10063347 | |||
| 2526 | Ga0207428_10459083 | |||
| 2527 | Ga0268266_10098208 | |||
| 2528 | Ga0268266_10398746 | |||
| 2529 | Ga0268266_10448216 | |||
| 2530 | Ga0268266_10469980 | |||
| 2531 | Ga0268266_10507024 | |||
| 2532 | Ga0268266_11906427 | |||
| 2533 | Ga0268265_10055502 | |||
| 2534 | Ga0268265_10151504 | |||
| 2535 | Ga0268265_10171615 | |||
| 2536 | Ga0268265_10326190 | |||
| 2537 | Ga0268264_10007174 | |||
| 2538 | Ga0268264_10007222 | |||
| 2539 | Ga0268264_10014173 | |||
| 2540 | Ga0268264_10027411 | |||
| 2541 | Ga0268264_10072575 | |||
| 2542 | Ga0268264_10172961 | |||
| 2543 | Ga0268264_10317376 | |||
| 2544 | Ga0268264_10469749 | |||
| 2545 | Ga0268264_10522120 | |||
| 2546 | Ga0307515_10104002 | |||
| 2547 | Ga0265328_10010415 | |||
| 2548 | Ga0265325_10005542 | |||
| 2549 | Ga0265329_10001188 | |||
| 2550 | Ga0265331_10000588 | |||
| 2551 | Ga0265327_10001246 | |||
| 2552 | Ga0265316_10003969 | |||
| 2553 | Ga0307513_10039326 | |||
| 2554 | Ga0307408_100056526 | |||
| 2555 | Ga0307508_10291073 | |||
| 2556 | Ga0307508_10303334 | |||
| 2557 | Ga0265342_10035908 | |||
| 2558 | Ga0307405_10006897 | |||
| 2559 | Ga0307405_10150781 | |||
| 2560 | Ga0307405_10441964 | |||
| 2561 | Ga0307413_10258834 | |||
| 2562 | Ga0307413_10272077 | |||
| 2563 | Ga0307410_10001643 | |||
| 2564 | Ga0307410_10347028 | |||
| 2565 | Ga0307406_10002738 | |||
| 2566 | Ga0307406_10011363 | |||
| 2567 | Ga0307406_11119924 | |||
| 2568 | Ga0307407_10006893 | |||
| 2569 | Ga0307407_10082475 | |||
| 2570 | Ga0307407_10194948 | |||
| 2571 | Ga0307407_10504138 | |||
| 2572 | Ga0307412_10022675 | |||
| 2573 | Ga0307412_10072937 | |||
| 2574 | Ga0307412_10252357 | |||
| 2575 | Ga0307412_10742330 | |||
| 2576 | Ga0307409_100072777 | |||
| 2577 | Ga0307409_100343701 | |||
| 2578 | Ga0307409_100618660 | |||
| 2579 | Ga0307416_100287861 | |||
| 2580 | Ga0307416_100581064 | |||
| 2581 | Ga0307416_100881466 | |||
| 2582 | Ga0307414_10008851 | |||
| 2583 | Ga0307414_10031387 | |||
| 2584 | Ga0307414_10407716 | |||
| 2585 | Ga0307411_10008275 | |||
| 2586 | Ga0307415_100003530 | |||
| 2587 | Ga0307415_100013901 | |||
| 2588 | Ga0307415_100300861 | |||
| 2589 | Ga0307510_10145803 | |||
| 2590 | Ga0373950_0025484 | |||
| 2591 | Ga0373926_0023656 | |||
| 2592 | Ga0373926_0063682 | |||
| 2593 | Ga0373926_0187788 | |||
| 2594 | Ga0373934_0001028 | |||
| 2595 | Ga0373934_0028705 | |||
| 2596 | Ga0373940_0006679 | |||
| 2597 | Ga0373944_0095052 | |||
| 2598 | Ga0373944_0220730 | |||
| 2599 | Ga0373949_0033605 | |||
| 2600 | Ga0373951_0005905 | |||
| 2601 | Ga0373951_0197114 | |||
| 2602 | Ga0373952_0020617 | |||
| 2603 | Ga0373923_0000349 | |||
| 2604 | Ga0373923_0234089 | |||
| 2605 | Ga0373932_0127581 | |||
| 2606 | Ga0373936_0085339 | |||
| 2607 | Ga0373939_0000181 | |||
| 2608 | Ga0373945_0022054 | |||
| 2609 | Ga0373945_0055004 | |||
| 2610 | Ga0373945_0116426 | |||
| 2611 | Ga0373953_0011995 | |||
| 2612 | Ga0373954_0000014 | |||
| 2613 | Ga0373954_0001030 | |||
| 2614 | Ga0373954_0088249 | |||
| 2615 | Ga0373954_0350248 | |||
| 2616 | Ga0373954_0370139 | |||
| 2617 | Ga0373956_0002915 | |||
| 2618 | Ga0373957_0000571 | |||
| 2619 | Ga0373957_0020193 | |||
| 2620 | Ga0373957_0066703 | |||
| 2621 | Ga0373957_0409280 | |||
| 2622 | Ga0373960_0001830 | |||
| 2623 | Ga0373960_0021540 | |||
| 2624 | Ga0373943_0006181 | |||
| 2625 | Ga0373943_0020255 | |||
| 2626 | Ga0373943_0093965 | |||
| 2627 | Ga0373943_0319466 | |||
| 2628 | Ga0373946_0019765 | |||
| 2629 | Ga0373946_0134764 | |||
| 2630 | Ga0373955_0007208 | |||
| 2631 | Ga0373955_0009860 | |||
| 2632 | Ga0373955_0021182 | |||
| 2633 | Ga0373955_0040880 | |||
| 2634 | Ga0373955_0086287 | |||
| 2635 | Ga0373955_0433414 | |||
| 2636 | Ga0373961_0201507 | |||
| 2637 | Ga0373962_0025391 | |||
| 2638 | Ga0373924_0052026 | |||
| 2639 | Ga0373924_0220160 | |||
| 2640 | Ga0373931_0000400 | |||
| 2641 | Ga0373931_0006244 | |||
| 2642 | Ga0373931_0324949 | |||
| 2643 | Ga0373931_0499369 | |||
| 2644 | Ga0373931_0618554 | |||
| 2645 | Ga0373935_0001974 | |||
| 2646 | Ga0373935_0008949 | |||
| 2647 | Ga0373935_0060731 | |||
| 2648 | Ga0373935_0146577 | |||
| 2649 | Ga0373935_0884709 | |||
| 2650 | Ga0373927_0012584 | |||
| 2651 | Ga0373927_0027951 | |||
| 2652 | Ga0373927_0052206 | |||
| 2653 | Ga0373927_0176704 | |||
| 2654 | Ga0373927_0419486 | |||
| 2655 | Ga0373933_0020603 | |||
| 2656 | Ga0373933_0206472 | |||
| 2657 | Ga0373933_0381085 | |||
| 2658 | Ga0373947_0037034 | |||
| 2659 | Ga0373947_0072873 | |||
| 2660 | Ga0373947_0078718 | |||
| 2661 | Ga0373937_0001093 | |||
| 2662 | Ga0373937_0006625 | |||
| 2663 | Ga0373937_0014281 | |||
| 2664 | Ga0373937_0016376 | |||
| 2665 | Ga0373937_0029114 | |||
| 2666 | Ga0373937_0039190 | |||
| 2667 | Ga0373937_0223074 | |||
| 2668 | Ga0373937_0297402 | |||
| 2669 | Ga0373937_0370279 | |||
| 2670 | Ga0373937_0398840 | |||
| 2671 | Ga0373937_1076454 | |||
| 2672 | Ga0373925_0013167 | |||
| 2673 | Ga0373925_0031283 | |||
| 2674 | Ga0373925_0033878 | |||
| 2675 | Ga0373925_0161591 | |||
| 2676 | Ga0373925_0218196 | |||
| 2677 | Ga0373925_0409949 | |||
| 2678 | Ga0373925_0513838 | |||
| 2679 | Ga0373925_0714276 | |||
| 2680 | Ga0395899_0298613 | |||
| 2681 | Ga0395900_0000058 | |||
| 2682 | Ga0395905_0020330 | |||
| 2683 | Ga0395905_0057608 | |||
| 2684 | Ga0395905_0674301 | |||
| 2685 | Ga0395905_0685052 | |||
| 2686 | Ga0436365_0267431 | |||
| 2687 | Ga0436365_0612874 | |||
| 2688 | Ga0436361_0550950 | |||
| 2689 | Ga0436361_0610301 | |||
| 2690 | Ga0436361_1181538 | |||
| 2691 | Ga0451787_067562 | |||
| 2692 | Ga0451791_1059383 | |||
| 2693 | Ga0451793_0982348 | |||
| 2694 | Ga0451793_1844437 | |||
| 2695 | Ga0451802_0395932 | |||
| 2696 | Ga0451807_1126674 | |||
| 2697 | Ga0451807_1466985 | |||
| 2698 | Ga0451853_2209825 | |||
| 2699 | Ga0451853_3563638 | |||
| 2700 | Ga0450888_017070 | |||
| 2701 | Ga0450898_094800 | |||
| 2702 | Ga0439444_0069724 | |||
| 2703 | Ga0439460_0132680 | |||
| 2704 | Ga0451577_0000166 | |||
| 2705 | Ga0451577_0011347 | |||
| 2706 | Ga0451577_0041533 | |||
| 2707 | Ga0451577_0089006 | |||
| 2708 | Ga0451577_0196562 | |||
| 2709 | Ga0451577_0319536 | |||
| 2710 | Ga0451577_0478437 | |||
| 2711 | Ga0451577_0819077 | |||
| 2712 | Ga0453684_0000187 | |||
| 2713 | Ga0453684_0326016 | |||
| 2714 | Ga0453684_0459968 | |||
| 2715 | Ga0453684_0595395 | |||
| 2716 | Ga0453684_0747795 | |||
| 2717 | Ga0453684_1674208 | |||
| 2718 | Ga0451576_0004563 | |||
| 2719 | Ga0451576_0066511 | |||
| 2720 | Ga0451576_0078737 | |||
| 2721 | Ga0451576_0088289 | |||
| 2722 | Ga0451576_0109010 | |||
| 2723 | Ga0451576_0144474 | |||
| 2724 | Ga0451576_0378520 | |||
| 2725 | Ga0451576_0771342 | |||
| 2726 | Ga0451576_1283296 | |||
| 2727 | Ga0451576_1868636 | |||
| 2728 | Ga0495592_0000306 | |||
| 2729 | Ga0495592_0033331 | |||
| 2730 | Ga0495603_0055973 | |||
| 2731 | Ga0495603_0233658 | |||
| 2732 | Ga0495590_0006658 | |||
| 2733 | Ga0495629_0122985 | |||
| 2734 | Ga0495629_0377754 | |||
| 2735 | Ga0495629_0451808 | |||
| 2736 | Ga0495651_0120855 | |||
| 2737 | Ga0495653_0061608 | |||
| 2738 | Ga0495653_0435556 | |||
| 2739 | Ga0495580_0035274 | |||
| 2740 | Ga0495580_0155868 | |||
| 2741 | Ga0495580_0837688 | |||
| 2742 | Ga0495639_0477521 | |||
| 2743 | Ga0495662_0014882 | |||
| 2744 | Ga0495662_0097628 | |||
| 2745 | Ga0495664_0136347 | |||
| 2746 | Ga0495594_0033790 | |||
| 2747 | Ga0495606_0323201 | |||
| 2748 | Ga0495608_0000439 | |||
| 2749 | Ga0495608_0005328 | |||
| 2750 | Ga0495628_0001253 | |||
| 2751 | Ga0495628_0073905 | |||
| 2752 | Ga0495628_0172955 | |||
| 2753 | Ga0495628_0199969 | |||
| 2754 | Ga0495630_0003035 | |||
| 2755 | Ga0495630_0105486 | |||
| 2756 | Ga0495630_0222128 | |||
| 2757 | Ga0495630_0618217 | |||
| 2758 | Ga0495630_1439012 | |||
| 2759 | Ga0495644_0157003 | |||
| 2760 | Ga0495666_0012180 | |||
| 2761 | Ga0495652_0031405 | |||
| 2762 | Ga0495652_0065732 | |||
| 2763 | Ga0495640_0000418 | |||
| 2764 | Ga0495640_0076952 | |||
| 2765 | Ga0495640_0531035 | |||
| 2766 | Ga0495586_0001587 | |||
| 2767 | Ga0495586_0264459 | |||
| 2768 | Ga0495587_0004909 | |||
| 2769 | Ga0495587_0010361 | |||
| 2770 | Ga0495598_0087349 | |||
| 2771 | Ga0495621_0032710 | |||
| 2772 | Ga0495645_0000490 | |||
| 2773 | Ga0495645_0026388 | |||
| 2774 | Ga0495645_0078524 | |||
| 2775 | Ga0495645_0458000 | |||
| 2776 | Ga0495622_0139844 | |||
| 2777 | Ga0495667_0003624 | |||
| 2778 | Ga0495667_0010719 | |||
| 2779 | Ga0495634_0003074 | |||
| 2780 | Ga0495635_0012559 | |||
| 2781 | Ga0495635_0028372 | |||
| 2782 | Ga0495635_0061638 | |||
| 2783 | Ga0495635_0569354 | |||
| 2784 | Ga0495659_0220722 | |||
| 2785 | Ga0495657_0053644 | |||
| 2786 | Ga0495657_0252240 | |||
| 2787 | Ga0495599_0030882 | |||
| 2788 | Ga0495623_0016103 | |||
| 2789 | Ga0495623_0016408 | |||
| 2790 | Ga0495646_0161500 | |||
| 2791 | Ga0495646_0267894 | |||
| 2792 | Ga0495647_0006266 | |||
| 2793 | Ga0495647_0410149 | |||
| 2794 | Ga0495658_0001390 | |||
| 2795 | Ga0495658_0051443 | |||
| 2796 | Ga0495658_0405231 | |||
| 2797 | Ga0495658_0425095 | |||
| 2798 | Ga0495669_0154193 | |||
| 2799 | Ga0495613_0003181 | |||
| 2800 | Ga0495624_0086555 | |||
| 2801 | Ga0495600_0010182 | |||
| 2802 | Ga0495660_0175115 | |||
| 2803 | Ga0495581_0007795 | |||
| 2804 | Ga0495581_0236104 | |||
| 2805 | Ga0495581_0360171 | |||
| 2806 | Ga0495604_0001668 | |||
| 2807 | Ga0495604_0036725 | |||
| 2808 | Ga0495604_0091377 | |||
| 2809 | Ga0495636_0008982 | |||
| 2810 | Ga0495674_0157845 | |||
| 2811 | Ga0495676_0118717 | |||
| 2812 | Ga0495680_0003157 | |||
| 2813 | Ga0495680_0221855 | |||
| 2814 | Ga0495680_1073305 | |||
| 2815 | Ga0495675_0032340 | |||
| 2816 | Ga0495684_0033460 | |||
| 2817 | Ga0495684_0108494 | |||
| 2818 | Ga0495684_0229618 | |||
| 2819 | Ga0495684_0254489 | |||
| 2820 | Ga0495686_0007201 | |||
| 2821 | Ga0495593_0062059 | |||
| 2822 | Ga0495593_0254632 | |||
| 2823 | Ga0495593_0547638 | |||
| 2824 | Ga0495602_0088274 | |||
| 2825 | Ga0495602_0267579 | |||
| 2826 | Ga0495602_0592727 | |||
| 2827 | Ga0495614_0189555 | |||
| 2828 | Ga0496100_0148853 | |||
| 2829 | Ga0496100_0275800 | |||
| 2830 | Ga0496101_0111777 | |||
| 2831 | Ga0496101_0373198 | |||
| 2832 | Ga0496102_0011222 | |||
| 2833 | Ga0496102_0028779 | |||
| 2834 | Ga0496102_0068326 | |||
| 2835 | Ga0496102_0181835 | |||
| 2836 | Ga0496102_0637073 | |||
| 2837 | Ga0496102_1112387 | |||
| 2838 | Ga0496103_0082550 | |||
| 2839 | Ga0496104_0015746 | |||
| 2840 | Ga0496104_0047473 | |||
| 2841 | Ga0496104_0190240 | |||
| 2842 | Ga0496104_1132789 | |||
| 2843 | Ga0496105_0004395 | |||
| 2844 | Ga0496105_1323374 | |||
| 2845 | Ga0496106_0002520 | |||
| 2846 | Ga0496106_0412147 | |||
| 2847 | Ga0496106_1084368 | |||
| 2848 | Ga0496107_0025820 | |||
| 2849 | Ga0496107_0041380 | |||
| 2850 | Ga0496107_0203866 | |||
| 2851 | Ga0496108_0044550 | |||
| 2852 | Ga0496108_0159103 | |||
| 2853 | Ga0496108_0215054 | |||
| 2854 | Ga0496108_0516898 | |||
| 2855 | Ga0496109_0004450 | |||
| 2856 | Ga0496109_0105832 | |||
| 2857 | Ga0496109_0212835 | |||
| 2858 | Ga0496110_0091381 | |||
| 2859 | Ga0496110_0149406 | |||
| 2860 | Ga0496110_0286969 | |||
| 2861 | Ga0496110_1090073 | |||
| 2862 | Ga0496111_0176743 | |||
| 2863 | Ga0496111_0613467 | |||
| 2864 | Ga0496112_0000349 | |||
| 2865 | Ga0496112_0003789 | |||
| 2866 | Ga0496112_0073785 | |||
| 2867 | Ga0496113_0071646 | |||
| 2868 | Ga0496113_0245005 | |||
| 2869 | Ga0496113_0320863 | |||
| 2870 | Ga0496113_0562266 | |||
| 2871 | Ga0496114_0021666 | |||
| 2872 | Ga0496114_0620088 | |||
| 2873 | Ga0496115_0892985 | |||
| 2874 | Ga0496124_0001001 | |||
| 2875 | Ga0501290_000024 | |||
| 2876 | Ga0501291_000039 | |||
| 2877 | Ga0501292_000069 | |||
| 2878 | Ga0501294_000192 | |||
| 2879 | Ga0501295_000183 | |||
| 2880 | Ga0501296_000176 | |||
| 2881 | Ga0501297_000004 | |||
| 2882 | Ga0501298_000124 | |||
| 2883 | Ga0501299_000282 | |||
| 2884 | Ga0501300_000132 | |||
| 2885 | Ga0501301_000026 | |||
| 2886 | Ga0501303_000147 | |||
| 2887 | Ga0501070_1203259 | |||
| 2888 | Ga0501072_0343786 | |||
| 2889 | Ga0501073_0283398 | |||
| 2890 | Ga0501076_0116726 | |||
| 2891 | Ga0501198_000280 | |||
| 2892 | Ga0501199_005334 | |||
| 2893 | Ga0501201_000014 | |||
| 2894 | Ga0501202_000015 | |||
| 2895 | Ga0501206_000010 | |||
| 2896 | Ga0501207_000613 | |||
| 2897 | Ga0501208_004334 | |||
| 2898 | Ga0501211_000610 | |||
| 2899 | Ga0501214_005204 | |||
| 2900 | Ga0501216_000112 | |||
| 2901 | Ga0501223_010883 | |||
| 2902 | Ga0501227_001636 | |||
| 2903 | Ga0501228_003108 | |||
| 2904 | Ga0501230_000274 | |||
| 2905 | Ga0501233_000058 | |||
| 2906 | Ga0501235_000042 | |||
| 2907 | Ga0501236_000929 | |||
| 2908 | Ga0501239_004284 | |||
| 2909 | Ga0501243_000440 | |||
| 2910 | Ga0501246_000059 | |||
| 2911 | Ga0501248_000300 | |||
| 2912 | Ga0501249_000123 | |||
| 2913 | Ga0501251_000033 | |||
| 2914 | Ga0501255_000822 | |||
| 2915 | Ga0501256_000952 | |||
| 2916 | Ga0501257_016794 | |||
| 2917 | Ga0501259_001098 | |||
| 2918 | Ga0501260_000011 | |||
| 2919 | Ga0501261_000100 | |||
| 2920 | Ga0501219_001625 | |||
| 2921 | Ga0501221_000074 | |||
| 2922 | Ga0501225_0000250 | |||
| 2923 | Ga0501229_000218 | |||
| 2924 | Ga0501234_000065 | |||
| 2925 | Ga0501080_0861603 | |||
| 2926 | Ga0501232_007375 | |||
| 2927 | Ga0501263_039330 | |||
| 2928 | Ga0501264_000438 | |||
| 2929 | Ga0501265_000143 | |||
| 2930 | Ga0501266_008958 | |||
| 2931 | Ga0501268_002618 | |||
| 2932 | Ga0501269_008319 | |||
| 2933 | Ga0501270_000408 | |||
| 2934 | Ga0501271_001648 | |||
| 2935 | Ga0501272_000128 | |||
| 2936 | Ga0501274_000535 | |||
| 2937 | Ga0501276_002219 | |||
| 2938 | Ga0501278_001279 | |||
| 2939 | Ga0501279_000130 | |||
| 2940 | Ga0501280_004263 | |||
| 2941 | Ga0501281_00749 | |||
| 2942 | Ga0501283_000044 | |||
| 2943 | Ga0501200_00096 | |||
| 2944 | Ga0501226_002204 | |||
| 2945 | nmdc:mga03683_46821_c1 | |||
| 2946 | nmdc:mga0k408_239696_c1 | |||
| 2947 | nmdc:mga07m45_1390_c1 | |||
| 2948 | nmdc:mga05p37_41232_c1 | |||
| 2949 | nmdc:mga09592_544091_c1 | |||
| 2950 | nmdc:mga09592_8709_c1 | |||
| 2951 | nmdc:mga0qj67_17879_c1 | |||
| 2952 | nmdc:mga08y16_368861_c1 | |||
| 2953 | nmdc:mga08y16_79846_c1 | |||
| 2954 | nmdc:mga0n895_3063_c1 | |||
| 2955 | nmdc:mga0n895_593505_c1 | |||
| 2956 | nmdc:mga0rr50_154529_c1 | |||
| 2957 | Ga0495601_0003644 | |||
| 2958 | Ga0495612_0163011 | |||
| 2959 | Ga0495612_0288231 | |||
| 2960 | Ga0495595_0130017 | |||
| 2961 | Ga0495595_0134453 | |||
| 2962 | Ga0495619_0005553 | |||
| 2963 | Ga0495619_0024756 | |||
| 2964 | Ga0495619_0844092 | |||
| 2965 | Ga0500651_0457437 | |||
| 2966 | Ga0500593_008110 | |||
| 2967 | Ga0530510_0107075 | |||
| 2968 | 2644217166 | |||
| 2969 | 2644303004 | |||
| 2970 | 2644338610 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6qkv-assembly1.cif.gz_B | structure of yibk from p. aeruginosa | 0.9446 | 1 | 156 |
| 6qh8-assembly2.cif.gz_B | structure of knotted yibk from p. aeruginosa | 0.944 | 1 | 156 |
| 4kdz-assembly1.cif.gz_A | crystal structure of trna/rrna methyltransferase yibk from escherichia coli (target nysgrc-012599) | 0.9435 | 1 | 155 |
| 6qh8-assembly1.cif.gz_C | structure of knotted yibk from p. aeruginosa | 0.9407 | 1 | 154 |
| 5co4-assembly1.cif.gz_A | structural insights into the 2-oh methylation of c/u34 on trna | 0.9333 | 1 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5co4A00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9333 | 1 | 156 | 3.40.1280.10 |
| af_O50394_1_154_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9304 | 1 | 156 | 3.40.1280.10 |
| af_C6TCU8_69_240_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9286 | 2 | 154 | 3.40.1280.10 |
| af_O50394_1_154_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9189 | 1 | 156 | 3.40.1280.10 |
| 5co4A00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9097 | 1 | 156 | 3.40.1280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5M4EN07-F1-model_v4 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) | 0.9607 | 3 | 156 |
GO:0002130
GO:0003723 GO:0005737 GO:0141098 GO:0141102 |
| AF-A0A4P5WXF1-F1-model_v4 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) | 0.9542 | 2 | 151 |
GO:0002130
GO:0003723 GO:0005737 GO:0141098 GO:0141102 |
| AF-N6Z7Y9-F1-model_v4 | tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) | 0.9522 | 1 | 156 |
GO:0002131
GO:0002132 GO:0003723 GO:0005737 GO:0141098 GO:0141102 |
| AF-A0A7J7B2Z1-F1-model_v4 | deleted | 0.9513 | 1 | 153 |
|
| AF-A0A0K8P130-F1-model_v4 | tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) | 0.9511 | 1 | 156 |
GO:0002131
GO:0002132 GO:0003723 GO:0005737 GO:0141098 GO:0141102 |