F494302

General Info

Members Datasets Scaffolds Average Seq Length
1485 438 2970 159

Family's Representative Sequence

Representative Sequence 3300025290|Ga0207673_1009582|Ga0207673_10095822
Length 193
Sequence VGRPAAAKLVAPSGAPYLAHMSDPQISLTQNAAKRVAMFAIVLVHPEIPPNTGNVIRLTANTATDLHLVEPLGFRMDDRDLRRAGLDYHEYARVAVHRDFAACRAALDADAPRRWFAFTTQASRSAYDVAYRPGDVLVFGSETRGLPPTILEHFPADTHLRIPMRAGVRSLNLSNAVAVAVYEAWRQQRFSGR

Samples

Sample ID Description Type Environment
1 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
133 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
204 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
210 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
211 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
212 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
213 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
214 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
215 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
219 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
224 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
232 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
233 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
234 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
235 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
236 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
237 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
238 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
239 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
240 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
242 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
244 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
245 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
246 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
247 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
248 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
249 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
254 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
255 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
260 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
261 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
267 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
268 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
269 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
270 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
271 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
272 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
273 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
274 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
275 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
276 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
277 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
278 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
279 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
280 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
283 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
288 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
289 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
290 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
291 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
292 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
297 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
300 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
301 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
302 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
303 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
304 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
305 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
309 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
310 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
311 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
312 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
313 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
314 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
315 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
316 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
317 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
318 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
319 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
320 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
323 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
324 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
325 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
326 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
327 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
328 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
329 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
330 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
331 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
332 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
333 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
334 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
335 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
336 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
337 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
338 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
342 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
343 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
344 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
345 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
346 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
347 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
348 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
349 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
350 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
351 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
352 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
353 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
354 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
355 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
356 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
357 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
358 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
359 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
360 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
361 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
362 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
363 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
364 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
365 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
366 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
367 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
368 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
369 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
370 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
371 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
372 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
373 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
374 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
375 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
376 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
377 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
378 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
379 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
380 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
381 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
382 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
383 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
384 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
385 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
386 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
387 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
388 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
389 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
390 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
391 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
392 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
393 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
394 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
395 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
396 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
397 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
398 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
399 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
400 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
401 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
402 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
403 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
404 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
405 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
406 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
407 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
408 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
409 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
410 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
411 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
412 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
413 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
414 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
415 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
416 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
417 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
418 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
419 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
420 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
421 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
422 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
423 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
424 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
425 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
426 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
427 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
428 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
429 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
430 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
431 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
432 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
433 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
434 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
435 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
436 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
437 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
438 2643221660 Methylibium sp. Root1272 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.2
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0.13
Rhizoplane 3.57
Rhizosphere 94.07
Stem 0
Stem Tuber 0
Unclassified 2.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207673_1009582 3300025290 Bacteria 1239
2 JGI24751J29686_10046467 3300002459 Bacteria 897
3 rootL2_10073240 3300003322 Bacteria 4164
4 Ga0055524_1000146 3300003775 Bacteria 84190
5 Ga0055530_10009559 3300003791 Bacteria 3707
6 Ga0055531_10004965 3300003794 Bacteria 7899
7 Ga0065712_10235339 3300005290 Bacteria 995
8 Ga0065715_10274079 3300005293 Bacteria 1103
9 Ga0065715_10612704 3300005293 Bacteria 700
10 Ga0070658_10005980 3300005327 Bacteria 9863
11 Ga0070658_10103749 3300005327 Bacteria 2352
12 Ga0070658_10141199 3300005327 Bacteria 2012
13 Ga0070658_10218690 3300005327 Bacteria 1610
14 Ga0070658_10287816 3300005327 Bacteria 1400
15 Ga0070658_10324897 3300005327 Bacteria 1314
16 Ga0070658_10390331 3300005327 Bacteria 1195
17 Ga0070658_11103298 3300005327 Bacteria 690
18 Ga0070676_10000267 3300005328 Bacteria 22827
19 Ga0070676_10009436 3300005328 Bacteria 5272
20 Ga0070676_10074109 3300005328 Bacteria 2049
21 Ga0070676_10083232 3300005328 Bacteria 1946
22 Ga0070683_100006762 3300005329 Bacteria 9634
23 Ga0070683_100014268 3300005329 Bacteria 6945
24 Ga0070683_100167950 3300005329 Bacteria 2082
25 Ga0070683_100257060 3300005329 Bacteria 1661
26 Ga0070683_101497725 3300005329 Bacteria 649
27 Ga0070683_101847100 3300005329 Bacteria 581
28 Ga0070690_100003078 3300005330 Bacteria 9067
29 Ga0070690_100010609 3300005330 Bacteria 5366
30 Ga0070690_100107454 3300005330 Bacteria 1857
31 Ga0070690_100374995 3300005330 Bacteria 1039
32 Ga0070670_100011670 3300005331 Bacteria 7515
33 Ga0070670_100016497 3300005331 Bacteria 6341
34 Ga0070670_100020490 3300005331 Bacteria 5685
35 Ga0070670_100049106 3300005331 Bacteria 3629
36 Ga0070670_100110464 3300005331 Bacteria 2369
37 Ga0070670_100143121 3300005331 Bacteria 2068
38 Ga0070670_100367407 3300005331 Bacteria 1266
39 Ga0070670_100512593 3300005331 Bacteria 1067
40 Ga0070670_100958521 3300005331 Bacteria 777
41 Ga0070677_10000642 3300005333 Bacteria 11722
42 Ga0070677_10010485 3300005333 Bacteria 3171
43 Ga0068869_100008109 3300005334 Bacteria 6756
44 Ga0068869_100009367 3300005334 Bacteria 6355
45 Ga0068869_100023785 3300005334 Bacteria 4238
46 Ga0068869_100036679 3300005334 Bacteria 3482
47 Ga0068869_100130351 3300005334 Bacteria 1932
48 Ga0068869_100144121 3300005334 Bacteria 1842
49 Ga0068869_100464197 3300005334 Bacteria 1052
50 Ga0070666_10004334 3300005335 Bacteria 8636
51 Ga0070666_10004746 3300005335 Bacteria 8304
52 Ga0070666_10017791 3300005335 Bacteria 4561
53 Ga0070666_10124836 3300005335 Bacteria 1786
54 Ga0070666_10166275 3300005335 Bacteria 1543
55 Ga0070666_11018123 3300005335 Bacteria 615
56 Ga0070680_100028407 3300005336 Bacteria 4486
57 Ga0070680_100034253 3300005336 Bacteria 4094
58 Ga0070682_100100175 3300005337 Bacteria 1912
59 Ga0070682_100708485 3300005337 Bacteria 808
60 Ga0068868_100015847 3300005338 Bacteria 5585
61 Ga0068868_100033124 3300005338 Bacteria 3981
62 Ga0068868_100034949 3300005338 Bacteria 3883
63 Ga0068868_100036210 3300005338 Bacteria 3818
64 Ga0068868_100038640 3300005338 Bacteria 3705
65 Ga0068868_100182700 3300005338 Bacteria 1741
66 Ga0068868_100371236 3300005338 Bacteria 1229
67 Ga0068868_100395511 3300005338 Bacteria 1192
68 Ga0068868_100427836 3300005338 Bacteria 1147
69 Ga0070660_100022673 3300005339 Bacteria 4647
70 Ga0070660_100031136 3300005339 Bacteria 4004
71 Ga0070660_100097177 3300005339 Bacteria 2330
72 Ga0070660_100662776 3300005339 Bacteria 874
73 Ga0070660_100943809 3300005339 Bacteria 728
74 Ga0070689_100019016 3300005340 Bacteria 5074
75 Ga0070689_100019090 3300005340 Bacteria 5063
76 Ga0070689_100044593 3300005340 Bacteria 3412
77 Ga0070689_100055757 3300005340 Bacteria 3063
78 Ga0070689_100163692 3300005340 Bacteria 1800
79 Ga0070689_101076455 3300005340 Bacteria 718
80 Ga0070691_10172697 3300005341 Bacteria 1121
81 Ga0070687_100039542 3300005343 Bacteria 2371
82 Ga0070687_100082039 3300005343 Bacteria 1762
83 Ga0070661_100006131 3300005344 Bacteria 8276
84 Ga0070661_100015813 3300005344 Bacteria 5326
85 Ga0070661_100015818 3300005344 Bacteria 5325
86 Ga0070661_100046937 3300005344 Bacteria 3160
87 Ga0070661_100700056 3300005344 Bacteria 825
88 Ga0070661_100793527 3300005344 Bacteria 777
89 Ga0070692_10004689 3300005345 Bacteria 5731
90 Ga0070692_10040008 3300005345 Bacteria 2396
91 Ga0070668_100006650 3300005347 Bacteria 8571
92 Ga0070668_100019549 3300005347 Bacteria 5098
93 Ga0070668_100022057 3300005347 Bacteria 4814
94 Ga0070668_100022437 3300005347 Bacteria 4772
95 Ga0070668_100060746 3300005347 Bacteria 2928
96 Ga0070668_100184173 3300005347 Bacteria 1707
97 Ga0070668_100256206 3300005347 Bacteria 1454
98 Ga0070668_100617455 3300005347 Bacteria 950
99 Ga0070669_100011261 3300005353 Bacteria 6350
100 Ga0070669_100072484 3300005353 Bacteria 2550
101 Ga0070669_100089829 3300005353 Bacteria 2302
102 Ga0070669_100116999 3300005353 Bacteria 2029
103 Ga0070669_100129232 3300005353 Bacteria 1936
104 Ga0070669_100302554 3300005353 Bacteria 1287
105 Ga0070675_100003343 3300005354 Bacteria 12143
106 Ga0070675_100016616 3300005354 Bacteria 5842
107 Ga0070675_100032389 3300005354 Bacteria 4231
108 Ga0070675_100035125 3300005354 Bacteria 4072
109 Ga0070675_100203583 3300005354 Bacteria 1718
110 Ga0070675_100205734 3300005354 Bacteria 1709
111 Ga0070675_100416372 3300005354 Bacteria 1201
112 Ga0070675_100771843 3300005354 Bacteria 878
113 Ga0070671_100000803 3300005355 Bacteria 22698
114 Ga0070671_100001991 3300005355 Bacteria 15686
115 Ga0070671_100024095 3300005355 Bacteria 4981
116 Ga0070671_100051913 3300005355 Bacteria 3410
117 Ga0070671_100054588 3300005355 Bacteria 3322
118 Ga0070671_100059511 3300005355 Bacteria 3179
119 Ga0070671_100223880 3300005355 Bacteria 1596
120 Ga0070671_100573648 3300005355 Bacteria 974
121 Ga0070671_100612033 3300005355 Bacteria 942
122 Ga0070671_100664302 3300005355 Bacteria 903
123 Ga0070671_100794183 3300005355 Bacteria 824
124 Ga0070674_100000274 3300005356 Bacteria 25095
125 Ga0070674_100013078 3300005356 Bacteria 5118
126 Ga0070674_100021899 3300005356 Bacteria 4113
127 Ga0070674_100070026 3300005356 Bacteria 2476
128 Ga0070674_100082737 3300005356 Bacteria 2297
129 Ga0070674_100109817 3300005356 Bacteria 2023
130 Ga0070674_100139100 3300005356 Bacteria 1820
131 Ga0070673_100000502 3300005364 Bacteria 20926
132 Ga0070673_100002265 3300005364 Bacteria 11663
133 Ga0070673_100031683 3300005364 Bacteria 3971
134 Ga0070673_100038486 3300005364 Bacteria 3653
135 Ga0070673_100040894 3300005364 Bacteria 3560
136 Ga0070673_100080038 3300005364 Bacteria 2646
137 Ga0070673_100090223 3300005364 Bacteria 2503
138 Ga0070673_100506297 3300005364 Bacteria 1093
139 Ga0070688_100011938 3300005365 Bacteria 4850
140 Ga0070688_100012315 3300005365 Bacteria 4789
141 Ga0070688_100015734 3300005365 Bacteria 4311
142 Ga0070688_100196730 3300005365 Bacteria 1408
143 Ga0070659_100001726 3300005366 Bacteria 15700
144 Ga0070659_100017311 3300005366 Bacteria 5420
145 Ga0070659_100029734 3300005366 Bacteria 4223
146 Ga0070659_100048701 3300005366 Bacteria 3330
147 Ga0070659_100065437 3300005366 Bacteria 2879
148 Ga0070659_100066089 3300005366 Bacteria 2865
149 Ga0070659_100117998 3300005366 Bacteria 2146
150 Ga0070659_100132111 3300005366 Bacteria 2028
151 Ga0070659_100377555 3300005366 Bacteria 1193
152 Ga0070659_100516245 3300005366 Bacteria 1020
153 Ga0070659_101544051 3300005366 Bacteria 592
154 Ga0070667_100011152 3300005367 Bacteria 7433
155 Ga0070667_100014378 3300005367 Bacteria 6540
156 Ga0070667_100018913 3300005367 Bacteria 5712
157 Ga0070667_100044618 3300005367 Bacteria 3724
158 Ga0070667_100096867 3300005367 Bacteria 2545
159 Ga0070667_100287679 3300005367 Bacteria 1477
160 Ga0070667_100305114 3300005367 Bacteria 1434
161 Ga0070667_100395130 3300005367 Bacteria 1258
162 Ga0070667_100986338 3300005367 Bacteria 786
163 Ga0070667_101809902 3300005367 Bacteria 575
164 Ga0070667_101823240 3300005367 Bacteria 572
165 Ga0070709_10008299 3300005434 Bacteria 5702
166 Ga0070709_10012962 3300005434 Bacteria 4676
167 Ga0070709_10028106 3300005434 Bacteria 3351
168 Ga0070709_10060724 3300005434 Bacteria 2404
169 Ga0070709_10233450 3300005434 Bacteria 1317
170 Ga0070709_10553675 3300005434 Bacteria 880
171 Ga0070709_10862396 3300005434 Bacteria 714
172 Ga0070714_100017248 3300005435 Bacteria 5847
173 Ga0070714_100029515 3300005435 Bacteria 4559
174 Ga0070714_100125104 3300005435 Bacteria 2291
175 Ga0070714_100383712 3300005435 Bacteria 1325
176 Ga0070714_101151357 3300005435 Bacteria 756
177 Ga0070714_101198294 3300005435 Bacteria 741
178 Ga0070714_101336626 3300005435 Bacteria 700
179 Ga0070713_100000621 3300005436 Bacteria 22637
180 Ga0070713_100009875 3300005436 Bacteria 6867
181 Ga0070713_100173718 3300005436 Bacteria 1932
182 Ga0070713_100256006 3300005436 Bacteria 1598
183 Ga0070713_100489612 3300005436 Bacteria 1159
184 Ga0070713_100565560 3300005436 Bacteria 1078
185 Ga0070713_101505457 3300005436 Bacteria 653
186 Ga0070710_10006664 3300005437 Bacteria 5559
187 Ga0070710_10446092 3300005437 Bacteria 876
188 Ga0070710_10582498 3300005437 Bacteria 777
189 Ga0070701_10037705 3300005438 Bacteria 2442
190 Ga0070701_10110108 3300005438 Bacteria 1538
191 Ga0070701_10800546 3300005438 Bacteria 643
192 Ga0070711_100000562 3300005439 Bacteria 19387
193 Ga0070711_100015057 3300005439 Bacteria 4887
194 Ga0070711_100290769 3300005439 Bacteria 1296
195 Ga0070711_100345369 3300005439 Bacteria 1195
196 Ga0070711_100538655 3300005439 Bacteria 967
197 Ga0070705_100002681 3300005440 Bacteria 8900
198 Ga0070705_100004688 3300005440 Bacteria 6659
199 Ga0070705_100111127 3300005440 Bacteria 1751
200 Ga0070700_100282541 3300005441 Bacteria 1204
201 Ga0070700_100515347 3300005441 Bacteria 923
202 Ga0070700_100627673 3300005441 Bacteria 845
203 Ga0070700_100665984 3300005441 Bacteria 823
204 Ga0070700_100827078 3300005441 Bacteria 748
205 Ga0070694_100003055 3300005444 Bacteria 9963
206 Ga0070694_100198333 3300005444 Bacteria 1495
207 Ga0070694_100365659 3300005444 Bacteria 1121
208 Ga0070708_100000961 3300005445 Bacteria 21881
209 Ga0070708_100039815 3300005445 Bacteria 4114
210 Ga0070663_100000226 3300005455 Bacteria 28442
211 Ga0070663_100049234 3300005455 Bacteria 2991
212 Ga0070663_100126042 3300005455 Bacteria 1940
213 Ga0070663_100170808 3300005455 Bacteria 1681
214 Ga0070663_100286692 3300005455 Bacteria 1314
215 Ga0070663_100458338 3300005455 Bacteria 1052
216 Ga0070663_100467398 3300005455 Bacteria 1042
217 Ga0070663_100731111 3300005455 Bacteria 843
218 Ga0070678_100002036 3300005456 Bacteria 10931
219 Ga0070678_100003054 3300005456 Bacteria 9278
220 Ga0070678_100006079 3300005456 Bacteria 7045
221 Ga0070678_100086342 3300005456 Bacteria 2393
222 Ga0070678_100166747 3300005456 Bacteria 1790
223 Ga0070678_100628410 3300005456 Bacteria 961
224 Ga0070662_100000111 3300005457 Bacteria 45577
225 Ga0070662_100015044 3300005457 Bacteria 5176
226 Ga0070662_100099703 3300005457 Bacteria 2196
227 Ga0070662_100214297 3300005457 Bacteria 1534
228 Ga0070662_100316909 3300005457 Bacteria 1271
229 Ga0070681_10026543 3300005458 Bacteria 5821
230 Ga0070681_10053935 3300005458 Bacteria 4006
231 Ga0070681_10790647 3300005458 Bacteria 866
232 Ga0068867_100004886 3300005459 Bacteria 9434
233 Ga0068867_100009782 3300005459 Bacteria 6757
234 Ga0068867_100022311 3300005459 Bacteria 4526
235 Ga0068867_100259632 3300005459 Bacteria 1416
236 Ga0068867_100669553 3300005459 Bacteria 913
237 Ga0070685_10001706 3300005466 Bacteria 11541
238 Ga0070685_10012009 3300005466 Bacteria 4541
239 Ga0070685_10062991 3300005466 Bacteria 2176
240 Ga0070706_100584167 3300005467 Bacteria 1038
241 Ga0070707_100078238 3300005468 Bacteria 3190
242 Ga0070699_100003739 3300005518 Bacteria 13438
243 Ga0070699_100016433 3300005518 Bacteria 6356
244 Ga0070699_100027824 3300005518 Bacteria 4876
245 Ga0070679_100228271 3300005530 Bacteria 1821
246 Ga0070679_100316192 3300005530 Bacteria 1511
247 Ga0070679_100321563 3300005530 Bacteria 1496
248 Ga0070679_100843137 3300005530 Bacteria 860
249 Ga0070684_100001117 3300005535 Bacteria 19263
250 Ga0070684_100053565 3300005535 Bacteria 3513
251 Ga0070684_100054153 3300005535 Bacteria 3495
252 Ga0070684_100119191 3300005535 Bacteria 2373
253 Ga0070684_100240883 3300005535 Bacteria 1652
254 Ga0070684_100616206 3300005535 Bacteria 1009
255 Ga0070697_100011036 3300005536 Bacteria 7058
256 Ga0070697_100057369 3300005536 Bacteria 3168
257 Ga0070697_100146517 3300005536 Bacteria 1988
258 Ga0068853_100005294 3300005539 Bacteria 10101
259 Ga0068853_100012925 3300005539 Bacteria 6805
260 Ga0068853_100083415 3300005539 Bacteria 2800
261 Ga0068853_100156536 3300005539 Bacteria 2053
262 Ga0068853_100230938 3300005539 Bacteria 1693
263 Ga0068853_100281602 3300005539 Bacteria 1533
264 Ga0068853_100328122 3300005539 Bacteria 1420
265 Ga0068853_100492048 3300005539 Bacteria 1157
266 Ga0068853_100793635 3300005539 Bacteria 906
267 Ga0070672_100001773 3300005543 Bacteria 13493
268 Ga0070672_100008494 3300005543 Bacteria 7031
269 Ga0070672_100014344 3300005543 Bacteria 5615
270 Ga0070672_100026516 3300005543 Bacteria 4314
271 Ga0070672_100035407 3300005543 Bacteria 3795
272 Ga0070672_100049647 3300005543 Bacteria 3266
273 Ga0070672_100128039 3300005543 Bacteria 2084
274 Ga0070672_100202101 3300005543 Bacteria 1662
275 Ga0070672_100329371 3300005543 Bacteria 1299
276 Ga0070672_100429191 3300005543 Bacteria 1136
277 Ga0070686_100027477 3300005544 Bacteria 3444
278 Ga0070686_100053216 3300005544 Bacteria 2584
279 Ga0070686_100061297 3300005544 Bacteria 2430
280 Ga0070686_100120908 3300005544 Bacteria 1798
281 Ga0070686_100303239 3300005544 Bacteria 1185
282 Ga0070686_100346621 3300005544 Bacteria 1115
283 Ga0070695_100007268 3300005545 Bacteria 6564
284 Ga0070695_100010123 3300005545 Bacteria 5622
285 Ga0070695_100046302 3300005545 Bacteria 2775
286 Ga0070695_100199059 3300005545 Bacteria 1430
287 Ga0070695_100342034 3300005545 Bacteria 1118
288 Ga0070696_100012043 3300005546 Bacteria 5794
289 Ga0070696_100016947 3300005546 Bacteria 4914
290 Ga0070696_100047956 3300005546 Bacteria 2965
291 Ga0070696_100072589 3300005546 Bacteria 2424
292 Ga0070696_100222503 3300005546 Bacteria 1417
293 Ga0070693_100010776 3300005547 Bacteria 4586
294 Ga0070693_100065531 3300005547 Bacteria 2123
295 Ga0070693_100077819 3300005547 Bacteria 1969
296 Ga0070693_100090605 3300005547 Bacteria 1842
297 Ga0070665_100010727 3300005548 Bacteria 9272
298 Ga0070665_100014147 3300005548 Bacteria 8017
299 Ga0070665_100082703 3300005548 Bacteria 3216
300 Ga0070665_100084751 3300005548 Bacteria 3174
301 Ga0070665_100147841 3300005548 Bacteria 2352
302 Ga0070665_100237044 3300005548 Bacteria 1825
303 Ga0070665_100423992 3300005548 Bacteria 1339
304 Ga0070665_100529066 3300005548 Unclassified 1191
305 Ga0070665_100781205 3300005548 Bacteria 968
306 Ga0070704_100113532 3300005549 Bacteria 2066
307 Ga0070704_100124348 3300005549 Bacteria 1987
308 Ga0070704_100878593 3300005549 Bacteria 805
309 Ga0068855_100000450 3300005563 Bacteria 50828
310 Ga0068855_100005788 3300005563 Bacteria 15089
311 Ga0068855_100007194 3300005563 Bacteria 13506
312 Ga0068855_100025363 3300005563 Bacteria 7093
313 Ga0068855_100134541 3300005563 Bacteria 2821
314 Ga0068855_100243201 3300005563 Bacteria 2010
315 Ga0068855_100285704 3300005563 Bacteria 1830
316 Ga0068855_100399376 3300005563 Bacteria 1506
317 Ga0068855_100437942 3300005563 Bacteria 1428
318 Ga0068855_101358125 3300005563 Bacteria 734
319 Ga0070664_100000658 3300005564 Bacteria 26393
320 Ga0070664_100002704 3300005564 Bacteria 14316
321 Ga0070664_100019104 3300005564 Bacteria 5635
322 Ga0070664_100041993 3300005564 Bacteria 3861
323 Ga0070664_100083651 3300005564 Bacteria 2753
324 Ga0070664_100261851 3300005564 Bacteria 1556
325 Ga0070664_100309288 3300005564 Bacteria 1430
326 Ga0070664_100452004 3300005564 Bacteria 1180
327 Ga0070664_100492939 3300005564 Bacteria 1129
328 Ga0070664_100729429 3300005564 Bacteria 924
329 Ga0070664_101202464 3300005564 Bacteria 715
330 Ga0068857_100005799 3300005577 Bacteria 10556
331 Ga0068857_100086667 3300005577 Bacteria 2800
332 Ga0068857_100098008 3300005577 Bacteria 2629
333 Ga0068857_100128153 3300005577 Bacteria 2287
334 Ga0068857_100594720 3300005577 Bacteria 1045
335 Ga0068857_100687870 3300005577 Bacteria 971
336 Ga0068857_100815666 3300005577 Bacteria 891
337 Ga0068854_100013441 3300005578 Bacteria 5374
338 Ga0068854_100030042 3300005578 Bacteria 3766
339 Ga0068854_100041866 3300005578 Bacteria 3238
340 Ga0068854_100050573 3300005578 Bacteria 2974
341 Ga0068854_100113282 3300005578 Bacteria 2049
342 Ga0068854_100266585 3300005578 Bacteria 1373
343 Ga0068856_100000350 3300005614 Bacteria 50393
344 Ga0068856_100006095 3300005614 Bacteria 11842
345 Ga0068856_100021309 3300005614 Bacteria 6298
346 Ga0068856_100032074 3300005614 Bacteria 5142
347 Ga0068856_100074182 3300005614 Bacteria 3368
348 Ga0070702_100014764 3300005615 Bacteria 3970
349 Ga0070702_100428814 3300005615 Bacteria 954
350 Ga0070702_100610941 3300005615 Bacteria 819
351 Ga0070702_100724592 3300005615 Bacteria 761
352 Ga0070702_100774019 3300005615 Bacteria 739
353 Ga0068852_100000823 3300005616 Bacteria 20478
354 Ga0068852_100000940 3300005616 Bacteria 19237
355 Ga0068852_100006323 3300005616 Bacteria 8545
356 Ga0068852_100008545 3300005616 Bacteria 7552
357 Ga0068852_100032464 3300005616 Bacteria 4324
358 Ga0068852_100035269 3300005616 Bacteria 4171
359 Ga0068852_100101705 3300005616 Bacteria 2596
360 Ga0068852_100129902 3300005616 Bacteria 2319
361 Ga0068852_100225160 3300005616 Bacteria 1785
362 Ga0068859_100001741 3300005617 Bacteria 22164
363 Ga0068859_100006755 3300005617 Bacteria 11649
364 Ga0068859_100013682 3300005617 Bacteria 8133
365 Ga0068859_100015466 3300005617 Bacteria 7665
366 Ga0068859_100018437 3300005617 Bacteria 7015
367 Ga0068859_100146194 3300005617 Bacteria 2439
368 Ga0068859_100241082 3300005617 Bacteria 1897
369 Ga0068859_100437758 3300005617 Bacteria 1403
370 Ga0068859_100692971 3300005617 Bacteria 1110
371 Ga0068864_100004626 3300005618 Bacteria 11286
372 Ga0068864_100008845 3300005618 Bacteria 8303
373 Ga0068864_100040417 3300005618 Bacteria 3990
374 Ga0068864_100079555 3300005618 Bacteria 2870
375 Ga0068864_100182425 3300005618 Bacteria 1920
376 Ga0068864_100366211 3300005618 Bacteria 1363
377 Ga0068864_100527486 3300005618 Bacteria 1139
378 Ga0068864_100665022 3300005618 Bacteria 1015
379 Ga0068864_100713124 3300005618 Bacteria 981
380 Ga0068864_100904203 3300005618 Bacteria 872
381 Ga0068864_101182483 3300005618 Bacteria 763
382 Ga0068864_101335995 3300005618 Bacteria 718
383 Ga0068866_10001140 3300005718 Bacteria 11673
384 Ga0068866_10142945 3300005718 Bacteria 1376
385 Ga0068866_10914367 3300005718 Bacteria 618
386 Ga0068861_100020343 3300005719 Bacteria 4752
387 Ga0068861_100021902 3300005719 Bacteria 4597
388 Ga0068861_100133909 3300005719 Bacteria 2014
389 Ga0068861_100538340 3300005719 Bacteria 1062
390 Ga0068861_100830338 3300005719 Unclassified 870
391 Ga0068861_101114476 3300005719 Bacteria 759
392 Ga0068861_101217472 3300005719 Bacteria 729
393 Ga0068851_10002888 3300005834 Bacteria 7590
394 Ga0068851_10010098 3300005834 Bacteria 4398
395 Ga0068851_10015536 3300005834 Bacteria 3629
396 Ga0068851_10017493 3300005834 Bacteria 3444
397 Ga0068851_10045665 3300005834 Bacteria 2214
398 Ga0068851_10102684 3300005834 Bacteria 1519
399 Ga0068851_10462328 3300005834 Bacteria 756
400 Ga0068870_10011295 3300005840 Bacteria 4136
401 Ga0068870_10013697 3300005840 Bacteria 3818
402 Ga0068870_10024771 3300005840 Bacteria 2971
403 Ga0068870_10146490 3300005840 Bacteria 1387
404 Ga0068870_10155989 3300005840 Bacteria 1349
405 Ga0068870_10427668 3300005840 Bacteria 868
406 Ga0068870_10434541 3300005840 Bacteria 862
407 Ga0068863_100007778 3300005841 Bacteria 10479
408 Ga0068863_100010341 3300005841 Bacteria 9063
409 Ga0068863_100017079 3300005841 Bacteria 6959
410 Ga0068863_100017142 3300005841 Bacteria 6946
411 Ga0068863_100089280 3300005841 Bacteria 2922
412 Ga0068863_100089474 3300005841 Bacteria 2919
413 Ga0068863_100152609 3300005841 Bacteria 2211
414 Ga0068863_100381561 3300005841 Bacteria 1376
415 Ga0068863_100410416 3300005841 Bacteria 1326
416 Ga0068863_100462731 3300005841 Bacteria 1246
417 Ga0068863_100503377 3300005841 Bacteria 1193
418 Ga0068863_100717650 3300005841 Bacteria 994
419 Ga0068858_100005201 3300005842 Bacteria 12750
420 Ga0068858_100007116 3300005842 Bacteria 10863
421 Ga0068858_100008383 3300005842 Bacteria 9942
422 Ga0068858_100025618 3300005842 Bacteria 5488
423 Ga0068858_100031012 3300005842 Bacteria 4965
424 Ga0068858_100038624 3300005842 Bacteria 4429
425 Ga0068858_100097462 3300005842 Bacteria 2741
426 Ga0068858_100112030 3300005842 Bacteria 2548
427 Ga0068858_100248656 3300005842 Bacteria 1689
428 Ga0068858_100554054 3300005842 Bacteria 1113
429 Ga0068858_101128837 3300005842 Bacteria 770
430 Ga0068860_100003853 3300005843 Bacteria 15413
431 Ga0068860_100006923 3300005843 Bacteria 11363
432 Ga0068860_100028491 3300005843 Bacteria 5376
433 Ga0068860_100049948 3300005843 Bacteria 3983
434 Ga0068860_100058629 3300005843 Bacteria 3660
435 Ga0068860_100103036 3300005843 Bacteria 2724
436 Ga0068860_100118186 3300005843 Bacteria 2537
437 Ga0068860_100142833 3300005843 Bacteria 2302
438 Ga0068860_100272969 3300005843 Bacteria 1651
439 Ga0068860_100289383 3300005843 Bacteria 1603
440 Ga0068860_100438342 3300005843 Bacteria 1297
441 Ga0068860_100466196 3300005843 Bacteria 1257
442 Ga0068860_100640400 3300005843 Bacteria 1070
443 Ga0068862_100007988 3300005844 Bacteria 8753
444 Ga0068862_100016343 3300005844 Bacteria 6176
445 Ga0068862_100022934 3300005844 Bacteria 5226
446 Ga0068862_100045373 3300005844 Bacteria 3750
447 Ga0068862_100206038 3300005844 Bacteria 1775
448 Ga0070715_10497504 3300006163 Bacteria 697
449 Ga0070716_100016651 3300006173 Bacteria 3799
450 Ga0070716_100301596 3300006173 Bacteria 1115
451 Ga0070716_101018324 3300006173 Bacteria 656
452 Ga0070712_100003612 3300006175 Bacteria 9538
453 Ga0070712_100004881 3300006175 Bacteria 8295
454 Ga0070712_100635049 3300006175 Bacteria 906
455 Ga0070712_100911020 3300006175 Bacteria 758
456 Ga0075362_10059457 3300006177 Bacteria 1726
457 Ga0075367_10389397 3300006178 Bacteria 881
458 Ga0075366_10161046 3300006195 Bacteria 1360
459 Ga0075366_10223903 3300006195 Bacteria 1146
460 Ga0075366_10569283 3300006195 Bacteria 702
461 Ga0097621_100005070 3300006237 Bacteria 9257
462 Ga0097621_100011618 3300006237 Bacteria 6493
463 Ga0097621_100014528 3300006237 Bacteria 5896
464 Ga0097621_100059433 3300006237 Bacteria 3130
465 Ga0097621_100085160 3300006237 Bacteria 2636
466 Ga0097621_100112531 3300006237 Bacteria 2302
467 Ga0097621_100175283 3300006237 Bacteria 1851
468 Ga0097621_100206410 3300006237 Bacteria 1707
469 Ga0097621_100211255 3300006237 Bacteria 1688
470 Ga0097621_100213448 3300006237 Bacteria 1679
471 Ga0097621_100970915 3300006237 Bacteria 794
472 Ga0097621_101005143 3300006237 Bacteria 780
473 Ga0097621_101014047 3300006237 Bacteria 777
474 Ga0075370_10007832 3300006353 Bacteria 5464
475 Ga0075370_10301590 3300006353 Bacteria 953
476 Ga0068871_100004840 3300006358 Bacteria 9410
477 Ga0068871_100009792 3300006358 Bacteria 6954
478 Ga0068871_100032204 3300006358 Bacteria 4140
479 Ga0068871_100111440 3300006358 Bacteria 2302
480 Ga0068871_100223181 3300006358 Bacteria 1633
481 Ga0068871_100228649 3300006358 Bacteria 1614
482 Ga0068871_100275257 3300006358 Bacteria 1471
483 Ga0075428_100027531 3300006844 Bacteria 6290
484 Ga0075428_101296960 3300006844 Bacteria 766
485 Ga0075434_100007245 3300006871 Bacteria 10262
486 Ga0075434_100336236 3300006871 Bacteria 1531
487 Ga0075429_100001051 3300006880 Bacteria 22037
488 Ga0075429_100414980 3300006880 Bacteria 1179
489 Ga0068865_100006023 3300006881 Bacteria 7387
490 Ga0068865_100017868 3300006881 Bacteria 4568
491 Ga0068865_100144694 3300006881 Bacteria 1796
492 Ga0068865_100204565 3300006881 Bacteria 1535
493 Ga0068865_101512517 3300006881 Bacteria 602
494 Ga0075436_100189631 3300006914 Bacteria 1454
495 Ga0075436_100299875 3300006914 Bacteria 1152
496 Ga0097620_100001741 3300006931 Bacteria 22164
497 Ga0097620_100006755 3300006931 Bacteria 11649
498 Ga0097620_100013682 3300006931 Bacteria 8133
499 Ga0097620_100015466 3300006931 Bacteria 7665
500 Ga0097620_100018437 3300006931 Bacteria 7015
501 Ga0097620_100146188 3300006931 Bacteria 2439
502 Ga0097620_100241073 3300006931 Bacteria 1897
503 Ga0097620_100437775 3300006931 Bacteria 1403
504 Ga0097620_100693026 3300006931 Bacteria 1110
505 Ga0079104_1000001 3300006946 Bacteria 521847
506 Ga0075435_100091917 3300007076 Bacteria 2505
507 Ga0099794_10014365 3300007265 Bacteria 3469
508 Ga0099794_10019347 3300007265 Bacteria 3066
509 Ga0099794_10030122 3300007265 Bacteria 2532
510 Ga0105240_10001889 3300009093 Bacteria 34824
511 Ga0105240_10008787 3300009093 Bacteria 14390
512 Ga0105240_10013727 3300009093 Bacteria 11102
513 Ga0105240_10022316 3300009093 Bacteria 8396
514 Ga0105240_11738242 3300009093 Bacteria 651
515 Ga0111539_10077714 3300009094 Bacteria 3906
516 Ga0111539_10868363 3300009094 Bacteria 1049
517 Ga0105245_10009343 3300009098 Bacteria 8553
518 Ga0105245_10009415 3300009098 Bacteria 8519
519 Ga0105245_10035818 3300009098 Bacteria 4406
520 Ga0105245_10082944 3300009098 Bacteria 2933
521 Ga0105245_10492541 3300009098 Bacteria 1241
522 Ga0105245_10932365 3300009098 Bacteria 911
523 Ga0105245_11873599 3300009098 Bacteria 653
524 Ga0105247_10018997 3300009101 Bacteria 4128
525 Ga0105247_10072757 3300009101 Bacteria 2152
526 Ga0114129_10272777 3300009147 Bacteria 2263
527 Ga0105243_11837791 3300009148 Bacteria 637
528 Ga0105241_10006963 3300009174 Bacteria 8316
529 Ga0105241_10011046 3300009174 Bacteria 6625
530 Ga0105241_10063871 3300009174 Bacteria 2842
531 Ga0105241_10692202 3300009174 Bacteria 930
532 Ga0105241_11250830 3300009174 Bacteria 705
533 Ga0105241_11337483 3300009174 Bacteria 684
534 Ga0105242_10008131 3300009176 Bacteria 8072
535 Ga0105242_10077721 3300009176 Bacteria 2769
536 Ga0105242_10258737 3300009176 Bacteria 1571
537 Ga0105248_10000878 3300009177 Bacteria 33719
538 Ga0105248_10003568 3300009177 Bacteria 17250
539 Ga0105248_10013308 3300009177 Bacteria 9056
540 Ga0105248_10057367 3300009177 Bacteria 4371
541 Ga0105248_10081931 3300009177 Bacteria 3628
542 Ga0105248_10101263 3300009177 Bacteria 3247
543 Ga0105248_10276297 3300009177 Bacteria 1891
544 Ga0105248_10759452 3300009177 Bacteria 1094
545 Ga0105248_11098406 3300009177 Bacteria 899
546 Ga0105237_10024857 3300009545 Bacteria 6128
547 Ga0105237_10053862 3300009545 Bacteria 4034
548 Ga0105237_10078968 3300009545 Bacteria 3281
549 Ga0105237_10114390 3300009545 Bacteria 2691
550 Ga0105237_10300962 3300009545 Bacteria 1607
551 Ga0105237_11011002 3300009545 Bacteria 838
552 Ga0105237_11911226 3300009545 Bacteria 602
553 Ga0105238_10009503 3300009551 Bacteria 9731
554 Ga0105238_10035807 3300009551 Bacteria 5045
555 Ga0105238_10331229 3300009551 Bacteria 1509
556 Ga0105238_11640935 3300009551 Bacteria 673
557 Ga0105238_12411654 3300009551 Bacteria 562
558 Ga0105249_10140898 3300009553 Bacteria 2312
559 Ga0105249_10157207 3300009553 Bacteria 2194
560 Ga0105249_10188866 3300009553 Bacteria 2010
561 Ga0105249_10317138 3300009553 Bacteria 1569
562 Ga0105249_10669218 3300009553 Bacteria 1097
563 Ga0105249_11075945 3300009553 Bacteria 874
564 Ga0105239_10170886 3300010375 Bacteria 2431
565 Ga0105239_10696001 3300010375 Bacteria 1162
566 Ga0105239_10932774 3300010375 Bacteria 997
567 Ga0105239_11507199 3300010375 Bacteria 777
568 Ga0105246_10023747 3300011119 Bacteria 3971
569 Ga0105246_10145440 3300011119 Bacteria 1788
570 Ga0157373_10001063 3300013100 Bacteria 21146
571 Ga0157373_10013745 3300013100 Bacteria 5935
572 Ga0157373_10170001 3300013100 Bacteria 1534
573 Ga0157371_10001162 3300013102 Bacteria 28274
574 Ga0157371_10695242 3300013102 Bacteria 761
575 Ga0157371_10703964 3300013102 Bacteria 756
576 Ga0157371_10804122 3300013102 Bacteria 709
577 Ga0157370_10018289 3300013104 Bacteria 7050
578 Ga0157370_10042167 3300013104 Bacteria 4399
579 Ga0157370_10046754 3300013104 Bacteria 4150
580 Ga0157370_10114567 3300013104 Bacteria 2518
581 Ga0157370_10361564 3300013104 Bacteria 1337
582 Ga0157370_10683768 3300013104 Bacteria 937
583 Ga0157370_10734214 3300013104 Bacteria 900
584 Ga0157369_10002639 3300013105 Bacteria 21418
585 Ga0157369_10054350 3300013105 Bacteria 4325
586 Ga0157369_10203685 3300013105 Bacteria 2076
587 Ga0157369_10229695 3300013105 Bacteria 1940
588 Ga0157369_10275373 3300013105 Bacteria 1753
589 Ga0157369_10412080 3300013105 Bacteria 1401
590 Ga0157369_10442483 3300013105 Bacteria 1346
591 Ga0157369_11160926 3300013105 Bacteria 789
592 Ga0157374_10001809 3300013296 Bacteria 18004
593 Ga0157374_10035751 3300013296 Bacteria 4546
594 Ga0157374_10035915 3300013296 Bacteria 4537
595 Ga0157374_10133566 3300013296 Bacteria 2404
596 Ga0157374_10215766 3300013296 Bacteria 1882
597 Ga0157374_10659770 3300013296 Bacteria 1058
598 Ga0157374_10700986 3300013296 Bacteria 1025
599 Ga0157374_11543223 3300013296 Bacteria 688
600 Ga0157378_10009283 3300013297 Bacteria 8568
601 Ga0157378_10009954 3300013297 Bacteria 8288
602 Ga0157378_10030000 3300013297 Bacteria 4803
603 Ga0157378_10401907 3300013297 Bacteria 1350
604 Ga0157378_10654335 3300013297 Bacteria 1067
605 Ga0163162_10001211 3300013306 Bacteria 24106
606 Ga0163162_10011811 3300013306 Bacteria 8518
607 Ga0163162_10096594 3300013306 Bacteria 3043
608 Ga0163162_10201399 3300013306 Bacteria 2119
609 Ga0163162_10328857 3300013306 Bacteria 1661
610 Ga0163162_10617676 3300013306 Bacteria 1209
611 Ga0163162_10717152 3300013306 Bacteria 1121
612 Ga0163162_10934839 3300013306 Bacteria 979
613 Ga0157372_10001523 3300013307 Bacteria 25194
614 Ga0157372_10001692 3300013307 Bacteria 23859
615 Ga0157372_10006706 3300013307 Bacteria 12248
616 Ga0157372_10021790 3300013307 Bacteria 6926
617 Ga0157372_10038529 3300013307 Bacteria 5275
618 Ga0157372_10057008 3300013307 Bacteria 4366
619 Ga0157372_10125179 3300013307 Bacteria 2955
620 Ga0157372_10127426 3300013307 Bacteria 2927
621 Ga0157372_10235050 3300013307 Bacteria 2125
622 Ga0157372_10342593 3300013307 Bacteria 1741
623 Ga0157372_10611369 3300013307 Bacteria 1270
624 Ga0157372_10653370 3300013307 Bacteria 1225
625 Ga0157372_11040013 3300013307 Bacteria 948
626 Ga0157372_11081066 3300013307 Bacteria 928
627 Ga0157372_11268004 3300013307 Bacteria 851
628 Ga0157375_10005469 3300013308 Bacteria 11045
629 Ga0157375_10008616 3300013308 Bacteria 8929
630 Ga0157375_10009546 3300013308 Bacteria 8518
631 Ga0157375_10030473 3300013308 Bacteria 5087
632 Ga0157375_10139594 3300013308 Bacteria 2549
633 Ga0157375_10160405 3300013308 Bacteria 2390
634 Ga0157375_10192365 3300013308 Bacteria 2195
635 Ga0157375_10341164 3300013308 Bacteria 1664
636 Ga0157375_11331140 3300013308 Bacteria 845
637 Ga0163163_10001352 3300014325 Bacteria 20693
638 Ga0163163_10005124 3300014325 Bacteria 11296
639 Ga0163163_10017644 3300014325 Bacteria 6662
640 Ga0163163_10116185 3300014325 Bacteria 2707
641 Ga0163163_10129546 3300014325 Bacteria 2563
642 Ga0163163_10277309 3300014325 Bacteria 1728
643 Ga0163163_10788761 3300014325 Bacteria 1013
644 Ga0163163_11206576 3300014325 Bacteria 819
645 Ga0157380_10075229 3300014326 Bacteria 2744
646 Ga0157380_10127469 3300014326 Bacteria 2166
647 Ga0157380_10183319 3300014326 Bacteria 1841
648 Ga0157380_10323229 3300014326 Bacteria 1431
649 Ga0157380_10406241 3300014326 Bacteria 1294
650 Ga0157380_11896899 3300014326 Bacteria 656
651 Ga0157377_10005762 3300014745 Bacteria 5846
652 Ga0157377_10020805 3300014745 Bacteria 3442
653 Ga0157377_10192613 3300014745 Bacteria 1289
654 Ga0157377_10354686 3300014745 Bacteria 985
655 Ga0157379_10003084 3300014968 Bacteria 14092
656 Ga0157379_10006078 3300014968 Bacteria 10396
657 Ga0157379_10014992 3300014968 Bacteria 6798
658 Ga0157379_10044107 3300014968 Bacteria 3981
659 Ga0157379_10094110 3300014968 Bacteria 2688
660 Ga0157379_10177073 3300014968 Bacteria 1926
661 Ga0157379_10290174 3300014968 Bacteria 1490
662 Ga0157379_10295756 3300014968 Bacteria 1475
663 Ga0157379_10877914 3300014968 Bacteria 850
664 Ga0157376_10005980 3300014969 Bacteria 8550
665 Ga0157376_10006034 3300014969 Bacteria 8519
666 Ga0157376_10008657 3300014969 Bacteria 7355
667 Ga0157376_10021115 3300014969 Bacteria 5053
668 Ga0157376_10056422 3300014969 Bacteria 3281
669 Ga0157376_10108541 3300014969 Bacteria 2438
670 Ga0157376_10156469 3300014969 Bacteria 2061
671 Ga0157376_10216043 3300014969 Bacteria 1773
672 Ga0157376_10268444 3300014969 Bacteria 1602
673 Ga0157376_10329577 3300014969 Bacteria 1454
674 Ga0157376_10432172 3300014969 Bacteria 1280
675 Ga0163161_10091924 3300017792 Bacteria 2246
676 Ga0163161_10292088 3300017792 Bacteria 1281
677 Ga0206356_10378156 3300020070 Bacteria 879
678 Ga0206354_10831956 3300020081 Bacteria 2348
679 Ga0206353_10348253 3300020082 Bacteria 1932
680 Ga0213872_10010960 3300021361 Bacteria 4300
681 Ga0209565_1008854 3300025263 Bacteria 2605
682 Ga0209050_1000118 3300025298 Bacteria 202586
683 Ga0209256_1000015 3300025299 Bacteria 622953
684 Ga0209051_1048365 3300025303 Bacteria 1443
685 Ga0207697_10001322 3300025315 Bacteria 13639
686 Ga0207697_10006351 3300025315 Bacteria 5356
687 Ga0207697_10064319 3300025315 Bacteria 1530
688 Ga0207656_10021638 3300025321 Bacteria 2572
689 Ga0207656_10040066 3300025321 Bacteria 1985
690 Ga0207656_10110599 3300025321 Bacteria 1269
691 Ga0207656_10436309 3300025321 Bacteria 661
692 Ga0207682_10001314 3300025893 Bacteria 11425
693 Ga0207682_10066945 3300025893 Bacteria 1514
694 Ga0207692_10151398 3300025898 Bacteria 1329
695 Ga0207692_10243228 3300025898 Bacteria 1075
696 Ga0207692_10742301 3300025898 Bacteria 639
697 Ga0207642_10049883 3300025899 Bacteria 1884
698 Ga0207642_10059991 3300025899 Bacteria 1762
699 Ga0207642_10086113 3300025899 Bacteria 1539
700 Ga0207642_10228143 3300025899 Bacteria 1045
701 Ga0207710_10224370 3300025900 Bacteria 934
702 Ga0207710_10274693 3300025900 Bacteria 847
703 Ga0207688_10040755 3300025901 Bacteria 2581
704 Ga0207688_10137724 3300025901 Bacteria 1435
705 Ga0207680_10002102 3300025903 Bacteria 9324
706 Ga0207680_10002576 3300025903 Bacteria 8460
707 Ga0207680_10006510 3300025903 Bacteria 5654
708 Ga0207680_10130197 3300025903 Bacteria 1657
709 Ga0207680_10778992 3300025903 Unclassified 686
710 Ga0207685_10052916 3300025905 Bacteria 1574
711 Ga0207699_10020977 3300025906 Bacteria 3512
712 Ga0207699_10045839 3300025906 Bacteria 2554
713 Ga0207699_10156363 3300025906 Bacteria 1513
714 Ga0207699_10542025 3300025906 Bacteria 843
715 Ga0207699_10891022 3300025906 Bacteria 656
716 Ga0207645_10000214 3300025907 Bacteria 48041
717 Ga0207645_10000421 3300025907 Bacteria 35045
718 Ga0207645_10000695 3300025907 Bacteria 27978
719 Ga0207645_10051776 3300025907 Bacteria 2623
720 Ga0207645_10221952 3300025907 Bacteria 1246
721 Ga0207643_10000537 3300025908 Bacteria 24350
722 Ga0207643_10006837 3300025908 Bacteria 6123
723 Ga0207643_10031135 3300025908 Bacteria 2972
724 Ga0207643_10190696 3300025908 Bacteria 1244
725 Ga0207705_10029140 3300025909 Bacteria 3935
726 Ga0207705_10046332 3300025909 Bacteria 3125
727 Ga0207705_10125004 3300025909 Bacteria 1911
728 Ga0207705_10251199 3300025909 Bacteria 1349
729 Ga0207705_10347690 3300025909 Bacteria 1142
730 Ga0207705_10430450 3300025909 Bacteria 1022
731 Ga0207684_10062559 3300025910 Bacteria 3160
732 Ga0207654_10030084 3300025911 Bacteria 2978
733 Ga0207654_10046536 3300025911 Bacteria 2474
734 Ga0207654_10761391 3300025911 Bacteria 698
735 Ga0207707_10002896 3300025912 Bacteria 15301
736 Ga0207707_10012845 3300025912 Bacteria 7286
737 Ga0207707_10741698 3300025912 Bacteria 822
738 Ga0207695_10053255 3300025913 Bacteria 4233
739 Ga0207695_10460568 3300025913 Bacteria 1155
740 Ga0207695_11164634 3300025913 Bacteria 651
741 Ga0207671_10053265 3300025914 Bacteria 2998
742 Ga0207671_10333599 3300025914 Bacteria 1201
743 Ga0207693_10000652 3300025915 Bacteria 31091
744 Ga0207693_10257300 3300025915 Bacteria 1369
745 Ga0207693_10465167 3300025915 Bacteria 988
746 Ga0207663_10002608 3300025916 Bacteria 8679
747 Ga0207663_10080045 3300025916 Bacteria 2135
748 Ga0207660_10040475 3300025917 Bacteria 3263
749 Ga0207660_10239956 3300025917 Bacteria 1428
750 Ga0207662_10045518 3300025918 Bacteria 2594
751 Ga0207662_10260182 3300025918 Bacteria 1142
752 Ga0207657_10000750 3300025919 Bacteria 34395
753 Ga0207657_10002560 3300025919 Bacteria 19672
754 Ga0207657_10007901 3300025919 Bacteria 10850
755 Ga0207657_10024835 3300025919 Bacteria 5539
756 Ga0207657_10032956 3300025919 Bacteria 4674
757 Ga0207649_10004987 3300025920 Bacteria 7171
758 Ga0207649_10011486 3300025920 Bacteria 4884
759 Ga0207649_10053399 3300025920 Bacteria 2511
760 Ga0207649_10162744 3300025920 Bacteria 1547
761 Ga0207649_10732780 3300025920 Bacteria 768
762 Ga0207649_10918792 3300025920 Bacteria 687
763 Ga0207652_10114356 3300025921 Bacteria 2396
764 Ga0207652_10235188 3300025921 Bacteria 1651
765 Ga0207652_10523802 3300025921 Bacteria 1066
766 Ga0207646_10014581 3300025922 Bacteria 7454
767 Ga0207646_11206169 3300025922 Bacteria 663
768 Ga0207681_10029078 3300025923 Bacteria 3584
769 Ga0207681_10062396 3300025923 Bacteria 2566
770 Ga0207681_10200987 3300025923 Bacteria 1530
771 Ga0207681_10301407 3300025923 Bacteria 1268
772 Ga0207681_10318132 3300025923 Bacteria 1237
773 Ga0207694_10005853 3300025924 Bacteria 9423
774 Ga0207694_10016726 3300025924 Bacteria 5544
775 Ga0207694_10041190 3300025924 Bacteria 3558
776 Ga0207694_10323906 3300025924 Bacteria 1272
777 Ga0207694_10498964 3300025924 Bacteria 1019
778 Ga0207694_11520836 3300025924 Bacteria 565
779 Ga0207650_10008724 3300025925 Bacteria 6923
780 Ga0207650_10017230 3300025925 Bacteria 5056
781 Ga0207650_10020685 3300025925 Bacteria 4644
782 Ga0207650_10032090 3300025925 Bacteria 3799
783 Ga0207650_10044419 3300025925 Bacteria 3265
784 Ga0207650_10094251 3300025925 Bacteria 2293
785 Ga0207650_10116313 3300025925 Bacteria 2076
786 Ga0207650_10177971 3300025925 Bacteria 1694
787 Ga0207650_10895675 3300025925 Bacteria 753
788 Ga0207650_11345727 3300025925 Bacteria 608
789 Ga0207659_10002136 3300025926 Bacteria 11725
790 Ga0207659_10012703 3300025926 Bacteria 5372
791 Ga0207659_10017200 3300025926 Bacteria 4719
792 Ga0207659_10041351 3300025926 Bacteria 3228
793 Ga0207659_10074554 3300025926 Bacteria 2487
794 Ga0207659_10377670 3300025926 Bacteria 1181
795 Ga0207687_10002403 3300025927 Bacteria 12697
796 Ga0207687_10009624 3300025927 Bacteria 6317
797 Ga0207687_10089592 3300025927 Bacteria 2240
798 Ga0207687_11428951 3300025927 Bacteria 594
799 Ga0207700_10006059 3300025928 Bacteria 7282
800 Ga0207700_10006798 3300025928 Bacteria 6950
801 Ga0207700_10061260 3300025928 Bacteria 2853
802 Ga0207700_10302396 3300025928 Bacteria 1382
803 Ga0207700_10386787 3300025928 Bacteria 1224
804 Ga0207700_10742649 3300025928 Bacteria 877
805 Ga0207700_11277872 3300025928 Bacteria 654
806 Ga0207664_10000912 3300025929 Bacteria 19958
807 Ga0207664_10055495 3300025929 Bacteria 3144
808 Ga0207664_10462445 3300025929 Bacteria 1133
809 Ga0207664_10534050 3300025929 Bacteria 1052
810 Ga0207664_11133358 3300025929 Bacteria 699
811 Ga0207644_10001317 3300025931 Bacteria 15943
812 Ga0207644_10001544 3300025931 Bacteria 14840
813 Ga0207644_10007546 3300025931 Bacteria 7092
814 Ga0207644_10010859 3300025931 Bacteria 6012
815 Ga0207644_10039904 3300025931 Bacteria 3316
816 Ga0207644_10044769 3300025931 Bacteria 3146
817 Ga0207644_10111826 3300025931 Bacteria 2066
818 Ga0207644_10151743 3300025931 Bacteria 1793
819 Ga0207644_10263945 3300025931 Bacteria 1378
820 Ga0207644_10392191 3300025931 Bacteria 1133
821 Ga0207644_10504612 3300025931 Bacteria 998
822 Ga0207690_10000826 3300025932 Bacteria 19864
823 Ga0207690_10018363 3300025932 Bacteria 4289
824 Ga0207690_10024622 3300025932 Bacteria 3771
825 Ga0207690_10028312 3300025932 Bacteria 3551
826 Ga0207690_10265877 3300025932 Bacteria 1330
827 Ga0207690_10273017 3300025932 Bacteria 1314
828 Ga0207706_10000465 3300025933 Bacteria 43279
829 Ga0207706_10004984 3300025933 Bacteria 12403
830 Ga0207706_10008050 3300025933 Bacteria 9728
831 Ga0207706_10013535 3300025933 Bacteria 7414
832 Ga0207706_10141051 3300025933 Bacteria 2120
833 Ga0207706_10219105 3300025933 Bacteria 1667
834 Ga0207706_10228234 3300025933 Bacteria 1629
835 Ga0207686_10016224 3300025934 Bacteria 4176
836 Ga0207686_10081829 3300025934 Bacteria 2109
837 Ga0207709_10193197 3300025935 Bacteria 1448
838 Ga0207709_10226720 3300025935 Bacteria 1351
839 Ga0207670_10008447 3300025936 Bacteria 5817
840 Ga0207670_10028643 3300025936 Bacteria 3540
841 Ga0207670_10041928 3300025936 Bacteria 3013
842 Ga0207670_10122272 3300025936 Bacteria 1894
843 Ga0207670_10226472 3300025936 Bacteria 1434
844 Ga0207670_10644180 3300025936 Bacteria 873
845 Ga0207670_10912645 3300025936 Bacteria 736
846 Ga0207669_10016731 3300025937 Bacteria 3737
847 Ga0207669_10049351 3300025937 Bacteria 2508
848 Ga0207669_10062316 3300025937 Bacteria 2296
849 Ga0207669_10168199 3300025937 Bacteria 1557
850 Ga0207669_10219510 3300025937 Bacteria 1394
851 Ga0207669_10349222 3300025937 Bacteria 1142
852 Ga0207704_10003217 3300025938 Bacteria 7394
853 Ga0207704_10051971 3300025938 Bacteria 2482
854 Ga0207704_10089364 3300025938 Bacteria 2018
855 Ga0207704_10159849 3300025938 Bacteria 1602
856 Ga0207704_10514262 3300025938 Bacteria 967
857 Ga0207704_10934686 3300025938 Bacteria 731
858 Ga0207665_10006908 3300025939 Bacteria 7511
859 Ga0207665_10439099 3300025939 Bacteria 1000
860 Ga0207691_10000084 3300025940 Bacteria 80075
861 Ga0207691_10000577 3300025940 Bacteria 36651
862 Ga0207691_10001328 3300025940 Bacteria 24681
863 Ga0207691_10007830 3300025940 Bacteria 10292
864 Ga0207691_10009589 3300025940 Bacteria 9292
865 Ga0207691_10024667 3300025940 Bacteria 5655
866 Ga0207691_10050830 3300025940 Bacteria 3793
867 Ga0207691_10133319 3300025940 Bacteria 2193
868 Ga0207691_10168116 3300025940 Bacteria 1921
869 Ga0207691_10277792 3300025940 Bacteria 1441
870 Ga0207691_10304882 3300025940 Bacteria 1367
871 Ga0207711_10000087 3300025941 Bacteria 98302
872 Ga0207711_10068506 3300025941 Bacteria 3074
873 Ga0207711_10079464 3300025941 Bacteria 2863
874 Ga0207711_10554326 3300025941 Bacteria 1072
875 Ga0207711_11864467 3300025941 Bacteria 544
876 Ga0207689_10000069 3300025942 Bacteria 83053
877 Ga0207689_10001822 3300025942 Bacteria 20138
878 Ga0207689_10004226 3300025942 Bacteria 13059
879 Ga0207689_10014272 3300025942 Bacteria 6760
880 Ga0207689_10020777 3300025942 Bacteria 5522
881 Ga0207689_10127315 3300025942 Bacteria 2095
882 Ga0207689_10392687 3300025942 Bacteria 1156
883 Ga0207661_10009752 3300025944 Bacteria 6897
884 Ga0207661_10068005 3300025944 Bacteria 2899
885 Ga0207661_10081925 3300025944 Bacteria 2667
886 Ga0207661_10139313 3300025944 Bacteria 2086
887 Ga0207661_10307273 3300025944 Bacteria 1423
888 Ga0207661_10495668 3300025944 Bacteria 1116
889 Ga0207661_11402725 3300025944 Bacteria 641
890 Ga0207679_10002617 3300025945 Bacteria 11097
891 Ga0207679_10003953 3300025945 Bacteria 9205
892 Ga0207679_10009503 3300025945 Bacteria 6234
893 Ga0207679_10018509 3300025945 Bacteria 4668
894 Ga0207679_10024164 3300025945 Bacteria 4164
895 Ga0207679_10033839 3300025945 Bacteria 3600
896 Ga0207679_10224474 3300025945 Bacteria 1582
897 Ga0207679_10328735 3300025945 Bacteria 1326
898 Ga0207679_10353045 3300025945 Bacteria 1282
899 Ga0207679_10655101 3300025945 Bacteria 950
900 Ga0207667_10000490 3300025949 Bacteria 52292
901 Ga0207667_10001200 3300025949 Bacteria 32473
902 Ga0207667_10020237 3300025949 Bacteria 7405
903 Ga0207667_10034332 3300025949 Bacteria 5448
904 Ga0207667_10049680 3300025949 Bacteria 4429
905 Ga0207667_10230511 3300025949 Bacteria 1896
906 Ga0207667_10754105 3300025949 Bacteria 972
907 Ga0207651_10034097 3300025960 Bacteria 3292
908 Ga0207651_10058537 3300025960 Bacteria 2663
909 Ga0207651_10076025 3300025960 Bacteria 2399
910 Ga0207651_10098714 3300025960 Bacteria 2160
911 Ga0207651_10412067 3300025960 Bacteria 1152
912 Ga0207651_10896648 3300025960 Bacteria 790
913 Ga0207712_10169501 3300025961 Bacteria 1705
914 Ga0207712_10588000 3300025961 Bacteria 961
915 Ga0207712_10598117 3300025961 Bacteria 954
916 Ga0207668_10002833 3300025972 Bacteria 10154
917 Ga0207668_10020812 3300025972 Bacteria 4175
918 Ga0207668_10072731 3300025972 Bacteria 2461
919 Ga0207668_10082765 3300025972 Bacteria 2333
920 Ga0207668_10096561 3300025972 Bacteria 2185
921 Ga0207668_10139413 3300025972 Bacteria 1862
922 Ga0207668_10184349 3300025972 Bacteria 1649
923 Ga0207668_10264603 3300025972 Bacteria 1403
924 Ga0207640_10004420 3300025981 Bacteria 7627
925 Ga0207640_10196228 3300025981 Bacteria 1526
926 Ga0207640_10322519 3300025981 Bacteria 1230
927 Ga0207640_10381345 3300025981 Bacteria 1142
928 Ga0207640_10836124 3300025981 Bacteria 800
929 Ga0207640_10877677 3300025981 Bacteria 782
930 Ga0207658_10004792 3300025986 Bacteria 9360
931 Ga0207658_10015419 3300025986 Bacteria 5242
932 Ga0207658_10030693 3300025986 Bacteria 3808
933 Ga0207658_10034077 3300025986 Bacteria 3636
934 Ga0207658_10040854 3300025986 Bacteria 3356
935 Ga0207658_10131100 3300025986 Bacteria 2014
936 Ga0207658_10385542 3300025986 Bacteria 1228
937 Ga0207658_10836479 3300025986 Bacteria 837
938 Ga0207677_10002351 3300026023 Bacteria 9910
939 Ga0207677_10003281 3300026023 Bacteria 8554
940 Ga0207677_10013587 3300026023 Bacteria 4725
941 Ga0207677_10096955 3300026023 Bacteria 2159
942 Ga0207677_10205834 3300026023 Bacteria 1567
943 Ga0207677_10258002 3300026023 Bacteria 1419
944 Ga0207677_10315814 3300026023 Bacteria 1296
945 Ga0207677_10387167 3300026023 Bacteria 1182
946 Ga0207677_11023988 3300026023 Bacteria 750
947 Ga0207703_10003435 3300026035 Bacteria 13293
948 Ga0207703_10020784 3300026035 Bacteria 5136
949 Ga0207703_10047877 3300026035 Bacteria 3448
950 Ga0207703_10097054 3300026035 Bacteria 2489
951 Ga0207703_10099385 3300026035 Bacteria 2463
952 Ga0207703_10234858 3300026035 Bacteria 1645
953 Ga0207703_10535412 3300026035 Bacteria 1103
954 Ga0207703_10927693 3300026035 Bacteria 834
955 Ga0207703_11135969 3300026035 Bacteria 751
956 Ga0207703_11166214 3300026035 Bacteria 740
957 Ga0207639_10002729 3300026041 Bacteria 11845
958 Ga0207639_10085045 3300026041 Bacteria 2515
959 Ga0207639_10115683 3300026041 Bacteria 2194
960 Ga0207639_10206423 3300026041 Bacteria 1688
961 Ga0207639_10225232 3300026041 Bacteria 1622
962 Ga0207639_10590504 3300026041 Bacteria 1023
963 Ga0207639_10845258 3300026041 Bacteria 854
964 Ga0207678_10000429 3300026067 Bacteria 38134
965 Ga0207678_10024896 3300026067 Bacteria 5226
966 Ga0207678_10063616 3300026067 Bacteria 3170
967 Ga0207678_10257659 3300026067 Bacteria 1495
968 Ga0207678_10433641 3300026067 Bacteria 1141
969 Ga0207678_10483840 3300026067 Bacteria 1078
970 Ga0207678_10955631 3300026067 Bacteria 758
971 Ga0207708_10000710 3300026075 Bacteria 25096
972 Ga0207708_10070723 3300026075 Bacteria 2672
973 Ga0207708_10609583 3300026075 Bacteria 926
974 Ga0207708_10728229 3300026075 Bacteria 850
975 Ga0207702_10000635 3300026078 Bacteria 38453
976 Ga0207702_10007712 3300026078 Bacteria 9141
977 Ga0207702_10555710 3300026078 Bacteria 1123
978 Ga0207702_10741525 3300026078 Bacteria 969
979 Ga0207641_10000832 3300026088 Bacteria 32828
980 Ga0207641_10008086 3300026088 Bacteria 8714
981 Ga0207641_10028936 3300026088 Bacteria 4581
982 Ga0207641_10046362 3300026088 Bacteria 3663
983 Ga0207641_10074523 3300026088 Bacteria 2928
984 Ga0207641_10091874 3300026088 Bacteria 2657
985 Ga0207641_10252563 3300026088 Bacteria 1647
986 Ga0207641_10430200 3300026088 Bacteria 1272
987 Ga0207641_10484223 3300026088 Bacteria 1199
988 Ga0207641_10623493 3300026088 Bacteria 1057
989 Ga0207641_10848422 3300026088 Bacteria 905
990 Ga0207648_10001494 3300026089 Bacteria 25761
991 Ga0207648_10002166 3300026089 Bacteria 21346
992 Ga0207648_10005304 3300026089 Bacteria 13008
993 Ga0207648_10007639 3300026089 Bacteria 10594
994 Ga0207648_10010002 3300026089 Bacteria 9024
995 Ga0207648_10258076 3300026089 Bacteria 1555
996 Ga0207648_10314828 3300026089 Bacteria 1405
997 Ga0207648_10823879 3300026089 Bacteria 865
998 Ga0207676_10000294 3300026095 Bacteria 43081
999 Ga0207676_10010977 3300026095 Bacteria 6467
1000 Ga0207676_10031242 3300026095 Bacteria 4004
1001 Ga0207676_10034632 3300026095 Bacteria 3824
1002 Ga0207676_10087407 3300026095 Bacteria 2549
1003 Ga0207676_10117327 3300026095 Bacteria 2238
1004 Ga0207676_10157544 3300026095 Bacteria 1963
1005 Ga0207676_10636366 3300026095 Bacteria 1028
1006 Ga0207676_11009222 3300026095 Bacteria 820
1007 Ga0207676_11097917 3300026095 Bacteria 786
1008 Ga0207676_11373440 3300026095 Bacteria 702
1009 Ga0207674_10000140 3300026116 Bacteria 84173
1010 Ga0207674_10001268 3300026116 Bacteria 32991
1011 Ga0207674_10002122 3300026116 Bacteria 25063
1012 Ga0207674_10008483 3300026116 Bacteria 11866
1013 Ga0207674_10066352 3300026116 Bacteria 3635
1014 Ga0207674_10126579 3300026116 Bacteria 2520
1015 Ga0207675_100003688 3300026118 Bacteria 14923
1016 Ga0207675_100024173 3300026118 Bacteria 5650
1017 Ga0207675_100133130 3300026118 Bacteria 2357
1018 Ga0207675_100258972 3300026118 Bacteria 1685
1019 Ga0207675_100621877 3300026118 Bacteria 1084
1020 Ga0207675_100754562 3300026118 Bacteria 984
1021 Ga0207683_10000003 3300026121 Bacteria 191866
1022 Ga0207683_10000355 3300026121 Bacteria 42024
1023 Ga0207683_10004640 3300026121 Bacteria 11848
1024 Ga0207683_10013734 3300026121 Bacteria 6904
1025 Ga0207683_10038235 3300026121 Bacteria 4181
1026 Ga0207683_10041228 3300026121 Bacteria 4030
1027 Ga0207683_10244960 3300026121 Bacteria 1635
1028 Ga0207683_11224833 3300026121 Bacteria 695
1029 Ga0207683_11269342 3300026121 Bacteria 682
1030 Ga0207698_10001629 3300026142 Bacteria 13078
1031 Ga0207698_10016336 3300026142 Bacteria 5000
1032 Ga0207698_10026907 3300026142 Bacteria 4075
1033 Ga0207698_10098460 3300026142 Bacteria 2417
1034 Ga0207698_10140919 3300026142 Bacteria 2077
1035 Ga0207698_10331444 3300026142 Bacteria 1430
1036 Ga0207698_10500209 3300026142 Bacteria 1183
1037 Ga0207698_10694092 3300026142 Bacteria 1012
1038 Ga0207698_12038168 3300026142 Bacteria 588
1039 Ga0209281_1000151 3300027111 Bacteria 167268
1040 Ga0209998_10063347 3300027717 Bacteria 874
1041 Ga0207428_10459083 3300027907 Bacteria 928
1042 Ga0268266_10098208 3300028379 Bacteria 2576
1043 Ga0268266_10398746 3300028379 Bacteria 1300
1044 Ga0268266_10448216 3300028379 Bacteria 1226
1045 Ga0268266_10469980 3300028379 Bacteria 1197
1046 Ga0268266_10507024 3300028379 Bacteria 1153
1047 Ga0268266_11906427 3300028379 Bacteria 568
1048 Ga0268265_10055502 3300028380 Bacteria 3010
1049 Ga0268265_10151504 3300028380 Bacteria 1956
1050 Ga0268265_10171615 3300028380 Bacteria 1854
1051 Ga0268265_10326190 3300028380 Bacteria 1393
1052 Ga0268264_10007174 3300028381 Bacteria 9334
1053 Ga0268264_10007222 3300028381 Bacteria 9303
1054 Ga0268264_10014173 3300028381 Bacteria 6556
1055 Ga0268264_10027411 3300028381 Bacteria 4654
1056 Ga0268264_10072575 3300028381 Bacteria 2919
1057 Ga0268264_10172961 3300028381 Bacteria 1955
1058 Ga0268264_10317376 3300028381 Bacteria 1472
1059 Ga0268264_10469749 3300028381 Bacteria 1222
1060 Ga0268264_10522120 3300028381 Bacteria 1161
1061 Ga0307515_10104002 3300028794 Bacteria 3398
1062 Ga0265328_10010415 3300031239 Bacteria 3745
1063 Ga0265325_10005542 3300031241 Bacteria 7791
1064 Ga0265329_10001188 3300031242 Bacteria 12768
1065 Ga0265331_10000588 3300031250 Bacteria 32461
1066 Ga0265327_10001246 3300031251 Bacteria 33969
1067 Ga0265316_10003969 3300031344 Bacteria 14815
1068 Ga0307513_10039326 3300031456 Bacteria 5244
1069 Ga0307408_100056526 3300031548 Bacteria 2846
1070 Ga0307508_10291073 3300031616 Bacteria 1226
1071 Ga0307508_10303334 3300031616 Bacteria 1189
1072 Ga0265342_10035908 3300031712 Bacteria 3030
1073 Ga0307405_10006897 3300031731 Bacteria 5635
1074 Ga0307405_10150781 3300031731 Bacteria 1634
1075 Ga0307405_10441964 3300031731 Bacteria 1029
1076 Ga0307413_10258834 3300031824 Bacteria 1296
1077 Ga0307413_10272077 3300031824 Bacteria 1269
1078 Ga0307410_10001643 3300031852 Bacteria 10280
1079 Ga0307410_10347028 3300031852 Bacteria 1185
1080 Ga0307406_10002738 3300031901 Bacteria 9617
1081 Ga0307406_10011363 3300031901 Bacteria 5051
1082 Ga0307406_11119924 3300031901 Bacteria 680
1083 Ga0307407_10006893 3300031903 Bacteria 5100
1084 Ga0307407_10082475 3300031903 Bacteria 1949
1085 Ga0307407_10194948 3300031903 Bacteria 1353
1086 Ga0307407_10504138 3300031903 Bacteria 888
1087 Ga0307412_10022675 3300031911 Bacteria 3853
1088 Ga0307412_10072937 3300031911 Unclassified 2347
1089 Ga0307412_10252357 3300031911 Bacteria 1370
1090 Ga0307412_10742330 3300031911 Bacteria 847
1091 Ga0307409_100072777 3300031995 Unclassified 2738
1092 Ga0307409_100343701 3300031995 Bacteria 1405
1093 Ga0307409_100618660 3300031995 Bacteria 1073
1094 Ga0307416_100287861 3300032002 Bacteria 1624
1095 Ga0307416_100581064 3300032002 Bacteria 1198
1096 Ga0307416_100881466 3300032002 Bacteria 994
1097 Ga0307414_10008851 3300032004 Bacteria 5745
1098 Ga0307414_10031387 3300032004 Bacteria 3485
1099 Ga0307414_10407716 3300032004 Bacteria 1182
1100 Ga0307411_10008275 3300032005 Bacteria 5373
1101 Ga0307415_100003530 3300032126 Bacteria 7971
1102 Ga0307415_100013901 3300032126 Bacteria 4714
1103 Ga0307415_100300861 3300032126 Bacteria 1329
1104 Ga0307510_10145803 3300033180 Bacteria 1999
1105 Ga0373950_0025484 3300034818 Bacteria 1068
1106 Ga0373926_0023656 3300035083 Bacteria 2135
1107 Ga0373926_0063682 3300035083 Bacteria 1347
1108 Ga0373926_0187788 3300035083 Bacteria 793
1109 Ga0373934_0001028 3300035086 Bacteria 10066
1110 Ga0373934_0028705 3300035086 Bacteria 2170
1111 Ga0373940_0006679 3300035088 Bacteria 2572
1112 Ga0373944_0095052 3300035089 Bacteria 1001
1113 Ga0373944_0220730 3300035089 Bacteria 692
1114 Ga0373949_0033605 3300035090 Bacteria 1233
1115 Ga0373951_0005905 3300035091 Bacteria 2828
1116 Ga0373951_0197114 3300035091 Bacteria 585
1117 Ga0373952_0020617 3300035092 Bacteria 1383
1118 Ga0373923_0000349 3300035111 Bacteria 10443
1119 Ga0373923_0234089 3300035111 Bacteria 856
1120 Ga0373932_0127581 3300035112 Bacteria 854
1121 Ga0373936_0085339 3300035113 Bacteria 1318
1122 Ga0373939_0000181 3300035114 Bacteria 17462
1123 Ga0373945_0022054 3300035116 Bacteria 2191
1124 Ga0373945_0055004 3300035116 Bacteria 1472
1125 Ga0373945_0116426 3300035116 Bacteria 1059
1126 Ga0373953_0011995 3300035117 Bacteria 3057
1127 Ga0373954_0000014 3300035118 Bacteria 71012
1128 Ga0373954_0001030 3300035118 Bacteria 11058
1129 Ga0373954_0088249 3300035118 Bacteria 1487
1130 Ga0373954_0350248 3300035118 Bacteria 729
1131 Ga0373954_0370139 3300035118 Bacteria 708
1132 Ga0373956_0002915 3300035119 Bacteria 6921
1133 Ga0373957_0000571 3300035120 Bacteria 9332
1134 Ga0373957_0020193 3300035120 Bacteria 2352
1135 Ga0373957_0066703 3300035120 Bacteria 1402
1136 Ga0373957_0409280 3300035120 Bacteria 584
1137 Ga0373960_0001830 3300035121 Bacteria 4758
1138 Ga0373960_0021540 3300035121 Bacteria 1715
1139 Ga0373943_0006181 3300035170 Bacteria 5374
1140 Ga0373943_0020255 3300035170 Bacteria 3065
1141 Ga0373943_0093965 3300035170 Bacteria 1557
1142 Ga0373943_0319466 3300035170 Bacteria 885
1143 Ga0373946_0019765 3300035171 Bacteria 2598
1144 Ga0373946_0134764 3300035171 Bacteria 1140
1145 Ga0373955_0007208 3300035172 Bacteria 5099
1146 Ga0373955_0009860 3300035172 Bacteria 4493
1147 Ga0373955_0021182 3300035172 Bacteria 3278
1148 Ga0373955_0040880 3300035172 Bacteria 2483
1149 Ga0373955_0086287 3300035172 Bacteria 1783
1150 Ga0373955_0433414 3300035172 Bacteria 800
1151 Ga0373961_0201507 3300035241 Bacteria 702
1152 Ga0373962_0025391 3300035242 Bacteria 1591
1153 Ga0373924_0052026 3300035410 Bacteria 1699
1154 Ga0373924_0220160 3300035410 Bacteria 839
1155 Ga0373931_0000400 3300035691 Bacteria 17756
1156 Ga0373931_0006244 3300035691 Bacteria 5558
1157 Ga0373931_0324949 3300035691 Bacteria 957
1158 Ga0373931_0499369 3300035691 Bacteria 784
1159 Ga0373931_0618554 3300035691 Bacteria 709
1160 Ga0373935_0001974 3300035692 Bacteria 11546
1161 Ga0373935_0008949 3300035692 Bacteria 5993
1162 Ga0373935_0060731 3300035692 Bacteria 2418
1163 Ga0373935_0146577 3300035692 Bacteria 1598
1164 Ga0373935_0884709 3300035692 Bacteria 661
1165 Ga0373927_0012584 3300035695 Bacteria 5631
1166 Ga0373927_0027951 3300035695 Bacteria 3681
1167 Ga0373927_0052206 3300035695 Bacteria 2645
1168 Ga0373927_0176704 3300035695 Bacteria 1400
1169 Ga0373927_0419486 3300035695 Bacteria 883
1170 Ga0373933_0020603 3300035724 Bacteria 3739
1171 Ga0373933_0206472 3300035724 Bacteria 1258
1172 Ga0373933_0381085 3300035724 Bacteria 918
1173 Ga0373947_0037034 3300035725 Bacteria 2894
1174 Ga0373947_0072873 3300035725 Bacteria 2110
1175 Ga0373947_0078718 3300035725 Bacteria 2035
1176 Ga0373937_0001093 3300036401 Bacteria 22840
1177 Ga0373937_0006625 3300036401 Bacteria 10000
1178 Ga0373937_0014281 3300036401 Bacteria 7008
1179 Ga0373937_0016376 3300036401 Bacteria 6582
1180 Ga0373937_0029114 3300036401 Bacteria 5001
1181 Ga0373937_0039190 3300036401 Bacteria 4319
1182 Ga0373937_0223074 3300036401 Bacteria 1774
1183 Ga0373937_0297402 3300036401 Bacteria 1525
1184 Ga0373937_0370279 3300036401 Bacteria 1358
1185 Ga0373937_0398840 3300036401 Bacteria 1305
1186 Ga0373937_1076454 3300036401 Bacteria 753
1187 Ga0373925_0013167 3300037068 Bacteria 5987
1188 Ga0373925_0031283 3300037068 Bacteria 3910
1189 Ga0373925_0033878 3300037068 Bacteria 3763
1190 Ga0373925_0161591 3300037068 Bacteria 1764
1191 Ga0373925_0218196 3300037068 Bacteria 1521
1192 Ga0373925_0409949 3300037068 Bacteria 1106
1193 Ga0373925_0513838 3300037068 Bacteria 984
1194 Ga0373925_0714276 3300037068 Bacteria 826
1195 Ga0395899_0298613 3300037312 Bacteria 1091
1196 Ga0395900_0000058 3300037418 Bacteria 206785
1197 Ga0395905_0020330 3300037471 Bacteria 6289
1198 Ga0395905_0057608 3300037471 Bacteria 3634
1199 Ga0395905_0674301 3300037471 Bacteria 936
1200 Ga0395905_0685052 3300037471 Bacteria 927
1201 Ga0436365_0267431 3300039437 Bacteria 547
1202 Ga0436365_0612874 3300039437 Bacteria 2493
1203 Ga0436361_0550950 3300039447 Bacteria 3681
1204 Ga0436361_0610301 3300039447 Bacteria 1158
1205 Ga0436361_1181538 3300039447 Bacteria 5470
1206 Ga0451787_067562 3300041441 Bacteria 684
1207 Ga0451791_1059383 3300041451 Bacteria 719
1208 Ga0451793_0982348 3300041452 Bacteria 814
1209 Ga0451793_1844437 3300041452 Bacteria 528
1210 Ga0451802_0395932 3300041460 Bacteria 908
1211 Ga0451807_1126674 3300041486 Bacteria 819
1212 Ga0451807_1466985 3300041486 Bacteria 1832
1213 Ga0451853_2209825 3300041512 Bacteria 697
1214 Ga0451853_3563638 3300041512 Bacteria 665
1215 Ga0450888_017070 3300042126 Bacteria 899
1216 Ga0450898_094800 3300042134 Bacteria 619
1217 Ga0439444_0069724 3300042437 Bacteria 750
1218 Ga0439460_0132680 3300042461 Bacteria 822
1219 Ga0451577_0000166 3300042876 Bacteria 145166
1220 Ga0451577_0011347 3300042876 Bacteria 8436
1221 Ga0451577_0041533 3300042876 Bacteria 4128
1222 Ga0451577_0089006 3300042876 Bacteria 2755
1223 Ga0451577_0196562 3300042876 Bacteria 1820
1224 Ga0451577_0319536 3300042876 Bacteria 1408
1225 Ga0451577_0478437 3300042876 Bacteria 1131
1226 Ga0451577_0819077 3300042876 Bacteria 840
1227 Ga0453684_0000187 3300044712 Bacteria 272378
1228 Ga0453684_0326016 3300044712 Bacteria 1738
1229 Ga0453684_0459968 3300044712 Bacteria 1415
1230 Ga0453684_0595395 3300044712 Bacteria 1212
1231 Ga0453684_0747795 3300044712 Bacteria 1059
1232 Ga0453684_1674208 3300044712 Bacteria 651
1233 Ga0451576_0004563 3300045051 Bacteria 17903
1234 Ga0451576_0066511 3300045051 Bacteria 3752
1235 Ga0451576_0078737 3300045051 Bacteria 3430
1236 Ga0451576_0088289 3300045051 Bacteria 3225
1237 Ga0451576_0109010 3300045051 Bacteria 2881
1238 Ga0451576_0144474 3300045051 Bacteria 2481
1239 Ga0451576_0378520 3300045051 Bacteria 1484
1240 Ga0451576_0771342 3300045051 Bacteria 1010
1241 Ga0451576_1283296 3300045051 Bacteria 763
1242 Ga0451576_1868636 3300045051 Bacteria 620
1243 Ga0495592_0000306 3300046454 Bacteria 41265
1244 Ga0495592_0033331 3300046454 Bacteria 3885
1245 Ga0495603_0055973 3300046455 Bacteria 2336
1246 Ga0495603_0233658 3300046455 Bacteria 1060
1247 Ga0495590_0006658 3300046457 Bacteria 4503
1248 Ga0495629_0122985 3300046459 Bacteria 1807
1249 Ga0495629_0377754 3300046459 Bacteria 964
1250 Ga0495629_0451808 3300046459 Bacteria 870
1251 Ga0495651_0120855 3300046462 Bacteria 1925
1252 Ga0495653_0061608 3300046463 Bacteria 2838
1253 Ga0495653_0435556 3300046463 Bacteria 827
1254 Ga0495580_0035274 3300046472 Bacteria 3597
1255 Ga0495580_0155868 3300046472 Bacteria 1581
1256 Ga0495580_0837688 3300046472 Bacteria 594
1257 Ga0495639_0477521 3300046475 Bacteria 635
1258 Ga0495662_0014882 3300046476 Bacteria 3780
1259 Ga0495662_0097628 3300046476 Bacteria 1436
1260 Ga0495664_0136347 3300046477 Bacteria 1487
1261 Ga0495594_0033790 3300046499 Bacteria 2782
1262 Ga0495606_0323201 3300046507 Bacteria 828
1263 Ga0495608_0000439 3300046511 Bacteria 29042
1264 Ga0495608_0005328 3300046511 Bacteria 9189
1265 Ga0495628_0001253 3300046516 Bacteria 23229
1266 Ga0495628_0073905 3300046516 Bacteria 2656
1267 Ga0495628_0172955 3300046516 Bacteria 1637
1268 Ga0495628_0199969 3300046516 Bacteria 1506
1269 Ga0495630_0003035 3300046517 Bacteria 11651
1270 Ga0495630_0105486 3300046517 Bacteria 2134
1271 Ga0495630_0222128 3300046517 Bacteria 1442
1272 Ga0495630_0618217 3300046517 Bacteria 830
1273 Ga0495630_1439012 3300046517 Bacteria 518
1274 Ga0495644_0157003 3300046523 Bacteria 872
1275 Ga0495666_0012180 3300046526 Bacteria 4293
1276 Ga0495652_0031405 3300046529 Bacteria 4652
1277 Ga0495652_0065732 3300046529 Bacteria 3046
1278 Ga0495640_0000418 3300046533 Bacteria 30693
1279 Ga0495640_0076952 3300046533 Bacteria 2225
1280 Ga0495640_0531035 3300046533 Bacteria 714
1281 Ga0495586_0001587 3300046535 Bacteria 12505
1282 Ga0495586_0264459 3300046535 Bacteria 982
1283 Ga0495587_0004909 3300046536 Bacteria 8772
1284 Ga0495587_0010361 3300046536 Bacteria 5938
1285 Ga0495598_0087349 3300046537 Bacteria 1011
1286 Ga0495621_0032710 3300046539 Bacteria 1790
1287 Ga0495645_0000490 3300046543 Bacteria 27455
1288 Ga0495645_0026388 3300046543 Bacteria 4217
1289 Ga0495645_0078524 3300046543 Bacteria 2372
1290 Ga0495645_0458000 3300046543 Bacteria 803
1291 Ga0495622_0139844 3300046557 Bacteria 1100
1292 Ga0495667_0003624 3300046559 Bacteria 10384
1293 Ga0495667_0010719 3300046559 Bacteria 6198
1294 Ga0495634_0003074 3300046642 Bacteria 13580
1295 Ga0495635_0012559 3300046663 Bacteria 5935
1296 Ga0495635_0028372 3300046663 Bacteria 3890
1297 Ga0495635_0061638 3300046663 Bacteria 2576
1298 Ga0495635_0569354 3300046663 Bacteria 741
1299 Ga0495659_0220722 3300046664 Bacteria 783
1300 Ga0495657_0053644 3300046675 Bacteria 2697
1301 Ga0495657_0252240 3300046675 Bacteria 1062
1302 Ga0495599_0030882 3300046678 Bacteria 3363
1303 Ga0495623_0016103 3300046679 Bacteria 4831
1304 Ga0495623_0016408 3300046679 Bacteria 4785
1305 Ga0495646_0161500 3300046680 Bacteria 1240
1306 Ga0495646_0267894 3300046680 Bacteria 911
1307 Ga0495647_0006266 3300046681 Bacteria 3932
1308 Ga0495647_0410149 3300046681 Bacteria 623
1309 Ga0495658_0001390 3300046683 Bacteria 12703
1310 Ga0495658_0051443 3300046683 Bacteria 2334
1311 Ga0495658_0405231 3300046683 Bacteria 869
1312 Ga0495658_0425095 3300046683 Bacteria 848
1313 Ga0495669_0154193 3300046684 Bacteria 1088
1314 Ga0495613_0003181 3300046689 Bacteria 12293
1315 Ga0495624_0086555 3300046690 Bacteria 1935
1316 Ga0495600_0010182 3300046809 Bacteria 5827
1317 Ga0495660_0175115 3300046810 Bacteria 1042
1318 Ga0495581_0007795 3300047315 Bacteria 6200
1319 Ga0495581_0236104 3300047315 Bacteria 1069
1320 Ga0495581_0360171 3300047315 Bacteria 849
1321 Ga0495604_0001668 3300047317 Bacteria 18261
1322 Ga0495604_0036725 3300047317 Bacteria 3862
1323 Ga0495604_0091377 3300047317 Bacteria 2258
1324 Ga0495636_0008982 3300047318 Bacteria 3932
1325 Ga0495674_0157845 3300047319 Bacteria 1899
1326 Ga0495676_0118717 3300047321 Bacteria 1928
1327 Ga0495680_0003157 3300047322 Bacteria 16416
1328 Ga0495680_0221855 3300047322 Bacteria 1349
1329 Ga0495680_1073305 3300047322 Bacteria 510
1330 Ga0495675_0032340 3300047444 Bacteria 3338
1331 Ga0495684_0033460 3300047471 Bacteria 3942
1332 Ga0495684_0108494 3300047471 Bacteria 2096
1333 Ga0495684_0229618 3300047471 Bacteria 1358
1334 Ga0495684_0254489 3300047471 Bacteria 1276
1335 Ga0495686_0007201 3300047472 Bacteria 8376
1336 Ga0495593_0062059 3300047673 Bacteria 1954
1337 Ga0495593_0254632 3300047673 Bacteria 879
1338 Ga0495593_0547638 3300047673 Bacteria 580
1339 Ga0495602_0088274 3300048088 Bacteria 2582
1340 Ga0495602_0267579 3300048088 Bacteria 1265
1341 Ga0495602_0592727 3300048088 Bacteria 763
1342 Ga0495614_0189555 3300048089 Bacteria 927
1343 Ga0496100_0148853 3300048903 Bacteria 1667
1344 Ga0496100_0275800 3300048903 Bacteria 1252
1345 Ga0496101_0111777 3300048904 Bacteria 2057
1346 Ga0496101_0373198 3300048904 Bacteria 1122
1347 Ga0496102_0011222 3300048905 Bacteria 7719
1348 Ga0496102_0028779 3300048905 Bacteria 4967
1349 Ga0496102_0068326 3300048905 Bacteria 3260
1350 Ga0496102_0181835 3300048905 Bacteria 1981
1351 Ga0496102_0637073 3300048905 Bacteria 989
1352 Ga0496102_1112387 3300048905 Bacteria 710
1353 Ga0496103_0082550 3300048906 Bacteria 2023
1354 Ga0496104_0015746 3300048907 Bacteria 6859
1355 Ga0496104_0047473 3300048907 Bacteria 4047
1356 Ga0496104_0190240 3300048907 Bacteria 1964
1357 Ga0496104_1132789 3300048907 Bacteria 686
1358 Ga0496105_0004395 3300048908 Bacteria 10614
1359 Ga0496105_1323374 3300048908 Bacteria 525
1360 Ga0496106_0002520 3300048909 Bacteria 13644
1361 Ga0496106_0412147 3300048909 Bacteria 1086
1362 Ga0496106_1084368 3300048909 Bacteria 628
1363 Ga0496107_0025820 3300048910 Bacteria 4162
1364 Ga0496107_0041380 3300048910 Bacteria 3308
1365 Ga0496107_0203866 3300048910 Bacteria 1470
1366 Ga0496108_0044550 3300048911 Bacteria 3703
1367 Ga0496108_0159103 3300048911 Bacteria 1951
1368 Ga0496108_0215054 3300048911 Bacteria 1669
1369 Ga0496108_0516898 3300048911 Bacteria 1042
1370 Ga0496109_0004450 3300048912 Bacteria 11702
1371 Ga0496109_0105832 3300048912 Bacteria 2613
1372 Ga0496109_0212835 3300048912 Bacteria 1818
1373 Ga0496110_0091381 3300048913 Bacteria 2723
1374 Ga0496110_0149406 3300048913 Bacteria 2115
1375 Ga0496110_0286969 3300048913 Bacteria 1499
1376 Ga0496110_1090073 3300048913 Bacteria 707
1377 Ga0496111_0176743 3300048914 Bacteria 1587
1378 Ga0496111_0613467 3300048914 Bacteria 796
1379 Ga0496112_0000349 3300048915 Bacteria 30137
1380 Ga0496112_0003789 3300048915 Bacteria 12634
1381 Ga0496112_0073785 3300048915 Bacteria 3373
1382 Ga0496113_0071646 3300048916 Bacteria 2636
1383 Ga0496113_0245005 3300048916 Bacteria 1430
1384 Ga0496113_0320863 3300048916 Bacteria 1242
1385 Ga0496113_0562266 3300048916 Bacteria 914
1386 Ga0496114_0021666 3300048917 Bacteria 5229
1387 Ga0496114_0620088 3300048917 Bacteria 953
1388 Ga0496115_0892985 3300048918 Bacteria 686
1389 Ga0496124_0001001 3300048927 Bacteria 44775
1390 Ga0501290_000024 3300049513 Bacteria 20106
1391 Ga0501291_000039 3300049514 Bacteria 16775
1392 Ga0501292_000069 3300049515 Bacteria 20733
1393 Ga0501294_000192 3300049517 Bacteria 7491
1394 Ga0501295_000183 3300049518 Bacteria 6307
1395 Ga0501296_000176 3300049519 Bacteria 6824
1396 Ga0501297_000004 3300049520 Bacteria 22617
1397 Ga0501298_000124 3300049521 Bacteria 9227
1398 Ga0501299_000282 3300049522 Bacteria 5815
1399 Ga0501300_000132 3300049523 Bacteria 11104
1400 Ga0501301_000026 3300049524 Bacteria 6740
1401 Ga0501303_000147 3300049526 Bacteria 6111
1402 Ga0501070_1203259 3300049586 Bacteria 581
1403 Ga0501072_0343786 3300049588 Bacteria 1185
1404 Ga0501073_0283398 3300049589 Bacteria 1143
1405 Ga0501076_0116726 3300049592 Bacteria 2160
1406 Ga0501198_000280 3300049649 Bacteria 6481
1407 Ga0501199_005334 3300049650 Bacteria 1289
1408 Ga0501201_000014 3300049651 Bacteria 10935
1409 Ga0501202_000015 3300049652 Bacteria 19511
1410 Ga0501206_000010 3300049653 Bacteria 18339
1411 Ga0501207_000613 3300049654 Unclassified 4117
1412 Ga0501208_004334 3300049655 Unclassified 1664
1413 Ga0501211_000610 3300049658 Unclassified 3578
1414 Ga0501214_005204 3300049659 Unclassified 1241
1415 Ga0501216_000112 3300049660 Bacteria 7859
1416 Ga0501223_010883 3300049663 Unclassified 1826
1417 Ga0501227_001636 3300049665 Unclassified 4994
1418 Ga0501228_003108 3300049666 Unclassified 1346
1419 Ga0501230_000274 3300049667 Unclassified 4756
1420 Ga0501233_000058 3300049668 Bacteria 14525
1421 Ga0501235_000042 3300049669 Bacteria 20584
1422 Ga0501236_000929 3300049670 Unclassified 3295
1423 Ga0501239_004284 3300049672 Unclassified 1393
1424 Ga0501243_000440 3300049675 Bacteria 5523
1425 Ga0501246_000059 3300049676 Bacteria 6119
1426 Ga0501248_000300 3300049678 Unclassified 2557
1427 Ga0501249_000123 3300049679 Bacteria 23882
1428 Ga0501251_000033 3300049681 Bacteria 10069
1429 Ga0501255_000822 3300049684 Unclassified 2282
1430 Ga0501256_000952 3300049685 Unclassified 2022
1431 Ga0501257_016794 3300049686 Unclassified 1699
1432 Ga0501259_001098 3300049688 Unclassified 4527
1433 Ga0501260_000011 3300049689 Bacteria 13212
1434 Ga0501261_000100 3300049690 Bacteria 12946
1435 Ga0501219_001625 3300049703 Unclassified 2022
1436 Ga0501221_000074 3300049704 Bacteria 11102
1437 Ga0501225_0000250 3300049705 Bacteria 16815
1438 Ga0501229_000218 3300049706 Bacteria 6344
1439 Ga0501234_000065 3300049707 Bacteria 12750
1440 Ga0501080_0861603 3300049742 Bacteria 791
1441 Ga0501232_007375 3300049757 Bacteria 1158
1442 Ga0501263_039330 3300049760 Bacteria 691
1443 Ga0501264_000438 3300049761 Bacteria 6431
1444 Ga0501265_000143 3300049762 Bacteria 6663
1445 Ga0501266_008958 3300049763 Bacteria 1262
1446 Ga0501268_002618 3300049765 Unclassified 2385
1447 Ga0501269_008319 3300049766 Bacteria 1253
1448 Ga0501270_000408 3300049767 Unclassified 3680
1449 Ga0501271_001648 3300049768 Unclassified 1930
1450 Ga0501272_000128 3300049769 Bacteria 5931
1451 Ga0501274_000535 3300049771 Unclassified 2732
1452 Ga0501276_002219 3300049773 Bacteria 1363
1453 Ga0501278_001279 3300049774 Unclassified 1808
1454 Ga0501279_000130 3300049775 Bacteria 10801
1455 Ga0501280_004263 3300049776 Unclassified 2113
1456 Ga0501281_00749 3300049777 Unclassified 2802
1457 Ga0501283_000044 3300049779 Bacteria 15150
1458 Ga0501200_00096 3300049849 Unclassified 2117
1459 Ga0501226_002204 3300049853 Unclassified 2404
1460 nmdc:mga03683_46821_c1 3300050489 Bacteria 1793
1461 nmdc:mga0k408_239696_c1 3300050493 Bacteria 1083
1462 nmdc:mga07m45_1390_c1 3300050496 Bacteria 11048
1463 nmdc:mga05p37_41232_c1 3300050507 Bacteria 5668
1464 nmdc:mga09592_544091_c1 3300050508 Bacteria 997
1465 nmdc:mga09592_8709_c1 3300050508 Bacteria 8255
1466 nmdc:mga0qj67_17879_c1 3300050509 Bacteria 5396
1467 nmdc:mga08y16_368861_c1 3300050511 Bacteria 1473
1468 nmdc:mga08y16_79846_c1 3300050511 Bacteria 3410
1469 nmdc:mga0n895_3063_c1 3300050512 Bacteria 13289
1470 nmdc:mga0n895_593505_c1 3300050512 Bacteria 1110
1471 nmdc:mga0rr50_154529_c1 3300050513 Bacteria 1857
1472 Ga0495601_0003644 3300053077 Bacteria 8857
1473 Ga0495612_0163011 3300053078 Bacteria 974
1474 Ga0495612_0288231 3300053078 Bacteria 735
1475 Ga0495595_0130017 3300053084 Bacteria 1230
1476 Ga0495595_0134453 3300053084 Bacteria 1211
1477 Ga0495619_0005553 3300053085 Bacteria 8000
1478 Ga0495619_0024756 3300053085 Bacteria 3851
1479 Ga0495619_0844092 3300053085 Bacteria 618
1480 Ga0500651_0457437 3300053093 Bacteria 709
1481 Ga0500593_008110 3300053117 Bacteria 4305
1482 Ga0530510_0107075 3300061734 Bacteria 2046
1483 2644217166 2643221639 Bacteria 6649903
1484 2644303004 2643221654 Bacteria 5273570
1485 2644338610 2643221660 Bacteria 4208257
1486 Ga0207673_1009582
1487 JGI24751J29686_10046467
1488 rootL2_10073240
1489 Ga0055524_1000146
1490 Ga0055530_10009559
1491 Ga0055531_10004965
1492 Ga0065712_10235339
1493 Ga0065715_10274079
1494 Ga0065715_10612704
1495 Ga0070658_10005980
1496 Ga0070658_10103749
1497 Ga0070658_10141199
1498 Ga0070658_10218690
1499 Ga0070658_10287816
1500 Ga0070658_10324897
1501 Ga0070658_10390331
1502 Ga0070658_11103298
1503 Ga0070676_10000267
1504 Ga0070676_10009436
1505 Ga0070676_10074109
1506 Ga0070676_10083232
1507 Ga0070683_100006762
1508 Ga0070683_100014268
1509 Ga0070683_100167950
1510 Ga0070683_100257060
1511 Ga0070683_101497725
1512 Ga0070683_101847100
1513 Ga0070690_100003078
1514 Ga0070690_100010609
1515 Ga0070690_100107454
1516 Ga0070690_100374995
1517 Ga0070670_100011670
1518 Ga0070670_100016497
1519 Ga0070670_100020490
1520 Ga0070670_100049106
1521 Ga0070670_100110464
1522 Ga0070670_100143121
1523 Ga0070670_100367407
1524 Ga0070670_100512593
1525 Ga0070670_100958521
1526 Ga0070677_10000642
1527 Ga0070677_10010485
1528 Ga0068869_100008109
1529 Ga0068869_100009367
1530 Ga0068869_100023785
1531 Ga0068869_100036679
1532 Ga0068869_100130351
1533 Ga0068869_100144121
1534 Ga0068869_100464197
1535 Ga0070666_10004334
1536 Ga0070666_10004746
1537 Ga0070666_10017791
1538 Ga0070666_10124836
1539 Ga0070666_10166275
1540 Ga0070666_11018123
1541 Ga0070680_100028407
1542 Ga0070680_100034253
1543 Ga0070682_100100175
1544 Ga0070682_100708485
1545 Ga0068868_100015847
1546 Ga0068868_100033124
1547 Ga0068868_100034949
1548 Ga0068868_100036210
1549 Ga0068868_100038640
1550 Ga0068868_100182700
1551 Ga0068868_100371236
1552 Ga0068868_100395511
1553 Ga0068868_100427836
1554 Ga0070660_100022673
1555 Ga0070660_100031136
1556 Ga0070660_100097177
1557 Ga0070660_100662776
1558 Ga0070660_100943809
1559 Ga0070689_100019016
1560 Ga0070689_100019090
1561 Ga0070689_100044593
1562 Ga0070689_100055757
1563 Ga0070689_100163692
1564 Ga0070689_101076455
1565 Ga0070691_10172697
1566 Ga0070687_100039542
1567 Ga0070687_100082039
1568 Ga0070661_100006131
1569 Ga0070661_100015813
1570 Ga0070661_100015818
1571 Ga0070661_100046937
1572 Ga0070661_100700056
1573 Ga0070661_100793527
1574 Ga0070692_10004689
1575 Ga0070692_10040008
1576 Ga0070668_100006650
1577 Ga0070668_100019549
1578 Ga0070668_100022057
1579 Ga0070668_100022437
1580 Ga0070668_100060746
1581 Ga0070668_100184173
1582 Ga0070668_100256206
1583 Ga0070668_100617455
1584 Ga0070669_100011261
1585 Ga0070669_100072484
1586 Ga0070669_100089829
1587 Ga0070669_100116999
1588 Ga0070669_100129232
1589 Ga0070669_100302554
1590 Ga0070675_100003343
1591 Ga0070675_100016616
1592 Ga0070675_100032389
1593 Ga0070675_100035125
1594 Ga0070675_100203583
1595 Ga0070675_100205734
1596 Ga0070675_100416372
1597 Ga0070675_100771843
1598 Ga0070671_100000803
1599 Ga0070671_100001991
1600 Ga0070671_100024095
1601 Ga0070671_100051913
1602 Ga0070671_100054588
1603 Ga0070671_100059511
1604 Ga0070671_100223880
1605 Ga0070671_100573648
1606 Ga0070671_100612033
1607 Ga0070671_100664302
1608 Ga0070671_100794183
1609 Ga0070674_100000274
1610 Ga0070674_100013078
1611 Ga0070674_100021899
1612 Ga0070674_100070026
1613 Ga0070674_100082737
1614 Ga0070674_100109817
1615 Ga0070674_100139100
1616 Ga0070673_100000502
1617 Ga0070673_100002265
1618 Ga0070673_100031683
1619 Ga0070673_100038486
1620 Ga0070673_100040894
1621 Ga0070673_100080038
1622 Ga0070673_100090223
1623 Ga0070673_100506297
1624 Ga0070688_100011938
1625 Ga0070688_100012315
1626 Ga0070688_100015734
1627 Ga0070688_100196730
1628 Ga0070659_100001726
1629 Ga0070659_100017311
1630 Ga0070659_100029734
1631 Ga0070659_100048701
1632 Ga0070659_100065437
1633 Ga0070659_100066089
1634 Ga0070659_100117998
1635 Ga0070659_100132111
1636 Ga0070659_100377555
1637 Ga0070659_100516245
1638 Ga0070659_101544051
1639 Ga0070667_100011152
1640 Ga0070667_100014378
1641 Ga0070667_100018913
1642 Ga0070667_100044618
1643 Ga0070667_100096867
1644 Ga0070667_100287679
1645 Ga0070667_100305114
1646 Ga0070667_100395130
1647 Ga0070667_100986338
1648 Ga0070667_101809902
1649 Ga0070667_101823240
1650 Ga0070709_10008299
1651 Ga0070709_10012962
1652 Ga0070709_10028106
1653 Ga0070709_10060724
1654 Ga0070709_10233450
1655 Ga0070709_10553675
1656 Ga0070709_10862396
1657 Ga0070714_100017248
1658 Ga0070714_100029515
1659 Ga0070714_100125104
1660 Ga0070714_100383712
1661 Ga0070714_101151357
1662 Ga0070714_101198294
1663 Ga0070714_101336626
1664 Ga0070713_100000621
1665 Ga0070713_100009875
1666 Ga0070713_100173718
1667 Ga0070713_100256006
1668 Ga0070713_100489612
1669 Ga0070713_100565560
1670 Ga0070713_101505457
1671 Ga0070710_10006664
1672 Ga0070710_10446092
1673 Ga0070710_10582498
1674 Ga0070701_10037705
1675 Ga0070701_10110108
1676 Ga0070701_10800546
1677 Ga0070711_100000562
1678 Ga0070711_100015057
1679 Ga0070711_100290769
1680 Ga0070711_100345369
1681 Ga0070711_100538655
1682 Ga0070705_100002681
1683 Ga0070705_100004688
1684 Ga0070705_100111127
1685 Ga0070700_100282541
1686 Ga0070700_100515347
1687 Ga0070700_100627673
1688 Ga0070700_100665984
1689 Ga0070700_100827078
1690 Ga0070694_100003055
1691 Ga0070694_100198333
1692 Ga0070694_100365659
1693 Ga0070708_100000961
1694 Ga0070708_100039815
1695 Ga0070663_100000226
1696 Ga0070663_100049234
1697 Ga0070663_100126042
1698 Ga0070663_100170808
1699 Ga0070663_100286692
1700 Ga0070663_100458338
1701 Ga0070663_100467398
1702 Ga0070663_100731111
1703 Ga0070678_100002036
1704 Ga0070678_100003054
1705 Ga0070678_100006079
1706 Ga0070678_100086342
1707 Ga0070678_100166747
1708 Ga0070678_100628410
1709 Ga0070662_100000111
1710 Ga0070662_100015044
1711 Ga0070662_100099703
1712 Ga0070662_100214297
1713 Ga0070662_100316909
1714 Ga0070681_10026543
1715 Ga0070681_10053935
1716 Ga0070681_10790647
1717 Ga0068867_100004886
1718 Ga0068867_100009782
1719 Ga0068867_100022311
1720 Ga0068867_100259632
1721 Ga0068867_100669553
1722 Ga0070685_10001706
1723 Ga0070685_10012009
1724 Ga0070685_10062991
1725 Ga0070706_100584167
1726 Ga0070707_100078238
1727 Ga0070699_100003739
1728 Ga0070699_100016433
1729 Ga0070699_100027824
1730 Ga0070679_100228271
1731 Ga0070679_100316192
1732 Ga0070679_100321563
1733 Ga0070679_100843137
1734 Ga0070684_100001117
1735 Ga0070684_100053565
1736 Ga0070684_100054153
1737 Ga0070684_100119191
1738 Ga0070684_100240883
1739 Ga0070684_100616206
1740 Ga0070697_100011036
1741 Ga0070697_100057369
1742 Ga0070697_100146517
1743 Ga0068853_100005294
1744 Ga0068853_100012925
1745 Ga0068853_100083415
1746 Ga0068853_100156536
1747 Ga0068853_100230938
1748 Ga0068853_100281602
1749 Ga0068853_100328122
1750 Ga0068853_100492048
1751 Ga0068853_100793635
1752 Ga0070672_100001773
1753 Ga0070672_100008494
1754 Ga0070672_100014344
1755 Ga0070672_100026516
1756 Ga0070672_100035407
1757 Ga0070672_100049647
1758 Ga0070672_100128039
1759 Ga0070672_100202101
1760 Ga0070672_100329371
1761 Ga0070672_100429191
1762 Ga0070686_100027477
1763 Ga0070686_100053216
1764 Ga0070686_100061297
1765 Ga0070686_100120908
1766 Ga0070686_100303239
1767 Ga0070686_100346621
1768 Ga0070695_100007268
1769 Ga0070695_100010123
1770 Ga0070695_100046302
1771 Ga0070695_100199059
1772 Ga0070695_100342034
1773 Ga0070696_100012043
1774 Ga0070696_100016947
1775 Ga0070696_100047956
1776 Ga0070696_100072589
1777 Ga0070696_100222503
1778 Ga0070693_100010776
1779 Ga0070693_100065531
1780 Ga0070693_100077819
1781 Ga0070693_100090605
1782 Ga0070665_100010727
1783 Ga0070665_100014147
1784 Ga0070665_100082703
1785 Ga0070665_100084751
1786 Ga0070665_100147841
1787 Ga0070665_100237044
1788 Ga0070665_100423992
1789 Ga0070665_100529066
1790 Ga0070665_100781205
1791 Ga0070704_100113532
1792 Ga0070704_100124348
1793 Ga0070704_100878593
1794 Ga0068855_100000450
1795 Ga0068855_100005788
1796 Ga0068855_100007194
1797 Ga0068855_100025363
1798 Ga0068855_100134541
1799 Ga0068855_100243201
1800 Ga0068855_100285704
1801 Ga0068855_100399376
1802 Ga0068855_100437942
1803 Ga0068855_101358125
1804 Ga0070664_100000658
1805 Ga0070664_100002704
1806 Ga0070664_100019104
1807 Ga0070664_100041993
1808 Ga0070664_100083651
1809 Ga0070664_100261851
1810 Ga0070664_100309288
1811 Ga0070664_100452004
1812 Ga0070664_100492939
1813 Ga0070664_100729429
1814 Ga0070664_101202464
1815 Ga0068857_100005799
1816 Ga0068857_100086667
1817 Ga0068857_100098008
1818 Ga0068857_100128153
1819 Ga0068857_100594720
1820 Ga0068857_100687870
1821 Ga0068857_100815666
1822 Ga0068854_100013441
1823 Ga0068854_100030042
1824 Ga0068854_100041866
1825 Ga0068854_100050573
1826 Ga0068854_100113282
1827 Ga0068854_100266585
1828 Ga0068856_100000350
1829 Ga0068856_100006095
1830 Ga0068856_100021309
1831 Ga0068856_100032074
1832 Ga0068856_100074182
1833 Ga0070702_100014764
1834 Ga0070702_100428814
1835 Ga0070702_100610941
1836 Ga0070702_100724592
1837 Ga0070702_100774019
1838 Ga0068852_100000823
1839 Ga0068852_100000940
1840 Ga0068852_100006323
1841 Ga0068852_100008545
1842 Ga0068852_100032464
1843 Ga0068852_100035269
1844 Ga0068852_100101705
1845 Ga0068852_100129902
1846 Ga0068852_100225160
1847 Ga0068859_100001741
1848 Ga0068859_100006755
1849 Ga0068859_100013682
1850 Ga0068859_100015466
1851 Ga0068859_100018437
1852 Ga0068859_100146194
1853 Ga0068859_100241082
1854 Ga0068859_100437758
1855 Ga0068859_100692971
1856 Ga0068864_100004626
1857 Ga0068864_100008845
1858 Ga0068864_100040417
1859 Ga0068864_100079555
1860 Ga0068864_100182425
1861 Ga0068864_100366211
1862 Ga0068864_100527486
1863 Ga0068864_100665022
1864 Ga0068864_100713124
1865 Ga0068864_100904203
1866 Ga0068864_101182483
1867 Ga0068864_101335995
1868 Ga0068866_10001140
1869 Ga0068866_10142945
1870 Ga0068866_10914367
1871 Ga0068861_100020343
1872 Ga0068861_100021902
1873 Ga0068861_100133909
1874 Ga0068861_100538340
1875 Ga0068861_100830338
1876 Ga0068861_101114476
1877 Ga0068861_101217472
1878 Ga0068851_10002888
1879 Ga0068851_10010098
1880 Ga0068851_10015536
1881 Ga0068851_10017493
1882 Ga0068851_10045665
1883 Ga0068851_10102684
1884 Ga0068851_10462328
1885 Ga0068870_10011295
1886 Ga0068870_10013697
1887 Ga0068870_10024771
1888 Ga0068870_10146490
1889 Ga0068870_10155989
1890 Ga0068870_10427668
1891 Ga0068870_10434541
1892 Ga0068863_100007778
1893 Ga0068863_100010341
1894 Ga0068863_100017079
1895 Ga0068863_100017142
1896 Ga0068863_100089280
1897 Ga0068863_100089474
1898 Ga0068863_100152609
1899 Ga0068863_100381561
1900 Ga0068863_100410416
1901 Ga0068863_100462731
1902 Ga0068863_100503377
1903 Ga0068863_100717650
1904 Ga0068858_100005201
1905 Ga0068858_100007116
1906 Ga0068858_100008383
1907 Ga0068858_100025618
1908 Ga0068858_100031012
1909 Ga0068858_100038624
1910 Ga0068858_100097462
1911 Ga0068858_100112030
1912 Ga0068858_100248656
1913 Ga0068858_100554054
1914 Ga0068858_101128837
1915 Ga0068860_100003853
1916 Ga0068860_100006923
1917 Ga0068860_100028491
1918 Ga0068860_100049948
1919 Ga0068860_100058629
1920 Ga0068860_100103036
1921 Ga0068860_100118186
1922 Ga0068860_100142833
1923 Ga0068860_100272969
1924 Ga0068860_100289383
1925 Ga0068860_100438342
1926 Ga0068860_100466196
1927 Ga0068860_100640400
1928 Ga0068862_100007988
1929 Ga0068862_100016343
1930 Ga0068862_100022934
1931 Ga0068862_100045373
1932 Ga0068862_100206038
1933 Ga0070715_10497504
1934 Ga0070716_100016651
1935 Ga0070716_100301596
1936 Ga0070716_101018324
1937 Ga0070712_100003612
1938 Ga0070712_100004881
1939 Ga0070712_100635049
1940 Ga0070712_100911020
1941 Ga0075362_10059457
1942 Ga0075367_10389397
1943 Ga0075366_10161046
1944 Ga0075366_10223903
1945 Ga0075366_10569283
1946 Ga0097621_100005070
1947 Ga0097621_100011618
1948 Ga0097621_100014528
1949 Ga0097621_100059433
1950 Ga0097621_100085160
1951 Ga0097621_100112531
1952 Ga0097621_100175283
1953 Ga0097621_100206410
1954 Ga0097621_100211255
1955 Ga0097621_100213448
1956 Ga0097621_100970915
1957 Ga0097621_101005143
1958 Ga0097621_101014047
1959 Ga0075370_10007832
1960 Ga0075370_10301590
1961 Ga0068871_100004840
1962 Ga0068871_100009792
1963 Ga0068871_100032204
1964 Ga0068871_100111440
1965 Ga0068871_100223181
1966 Ga0068871_100228649
1967 Ga0068871_100275257
1968 Ga0075428_100027531
1969 Ga0075428_101296960
1970 Ga0075434_100007245
1971 Ga0075434_100336236
1972 Ga0075429_100001051
1973 Ga0075429_100414980
1974 Ga0068865_100006023
1975 Ga0068865_100017868
1976 Ga0068865_100144694
1977 Ga0068865_100204565
1978 Ga0068865_101512517
1979 Ga0075436_100189631
1980 Ga0075436_100299875
1981 Ga0097620_100001741
1982 Ga0097620_100006755
1983 Ga0097620_100013682
1984 Ga0097620_100015466
1985 Ga0097620_100018437
1986 Ga0097620_100146188
1987 Ga0097620_100241073
1988 Ga0097620_100437775
1989 Ga0097620_100693026
1990 Ga0079104_1000001
1991 Ga0075435_100091917
1992 Ga0099794_10014365
1993 Ga0099794_10019347
1994 Ga0099794_10030122
1995 Ga0105240_10001889
1996 Ga0105240_10008787
1997 Ga0105240_10013727
1998 Ga0105240_10022316
1999 Ga0105240_11738242
2000 Ga0111539_10077714
2001 Ga0111539_10868363
2002 Ga0105245_10009343
2003 Ga0105245_10009415
2004 Ga0105245_10035818
2005 Ga0105245_10082944
2006 Ga0105245_10492541
2007 Ga0105245_10932365
2008 Ga0105245_11873599
2009 Ga0105247_10018997
2010 Ga0105247_10072757
2011 Ga0114129_10272777
2012 Ga0105243_11837791
2013 Ga0105241_10006963
2014 Ga0105241_10011046
2015 Ga0105241_10063871
2016 Ga0105241_10692202
2017 Ga0105241_11250830
2018 Ga0105241_11337483
2019 Ga0105242_10008131
2020 Ga0105242_10077721
2021 Ga0105242_10258737
2022 Ga0105248_10000878
2023 Ga0105248_10003568
2024 Ga0105248_10013308
2025 Ga0105248_10057367
2026 Ga0105248_10081931
2027 Ga0105248_10101263
2028 Ga0105248_10276297
2029 Ga0105248_10759452
2030 Ga0105248_11098406
2031 Ga0105237_10024857
2032 Ga0105237_10053862
2033 Ga0105237_10078968
2034 Ga0105237_10114390
2035 Ga0105237_10300962
2036 Ga0105237_11011002
2037 Ga0105237_11911226
2038 Ga0105238_10009503
2039 Ga0105238_10035807
2040 Ga0105238_10331229
2041 Ga0105238_11640935
2042 Ga0105238_12411654
2043 Ga0105249_10140898
2044 Ga0105249_10157207
2045 Ga0105249_10188866
2046 Ga0105249_10317138
2047 Ga0105249_10669218
2048 Ga0105249_11075945
2049 Ga0105239_10170886
2050 Ga0105239_10696001
2051 Ga0105239_10932774
2052 Ga0105239_11507199
2053 Ga0105246_10023747
2054 Ga0105246_10145440
2055 Ga0157373_10001063
2056 Ga0157373_10013745
2057 Ga0157373_10170001
2058 Ga0157371_10001162
2059 Ga0157371_10695242
2060 Ga0157371_10703964
2061 Ga0157371_10804122
2062 Ga0157370_10018289
2063 Ga0157370_10042167
2064 Ga0157370_10046754
2065 Ga0157370_10114567
2066 Ga0157370_10361564
2067 Ga0157370_10683768
2068 Ga0157370_10734214
2069 Ga0157369_10002639
2070 Ga0157369_10054350
2071 Ga0157369_10203685
2072 Ga0157369_10229695
2073 Ga0157369_10275373
2074 Ga0157369_10412080
2075 Ga0157369_10442483
2076 Ga0157369_11160926
2077 Ga0157374_10001809
2078 Ga0157374_10035751
2079 Ga0157374_10035915
2080 Ga0157374_10133566
2081 Ga0157374_10215766
2082 Ga0157374_10659770
2083 Ga0157374_10700986
2084 Ga0157374_11543223
2085 Ga0157378_10009283
2086 Ga0157378_10009954
2087 Ga0157378_10030000
2088 Ga0157378_10401907
2089 Ga0157378_10654335
2090 Ga0163162_10001211
2091 Ga0163162_10011811
2092 Ga0163162_10096594
2093 Ga0163162_10201399
2094 Ga0163162_10328857
2095 Ga0163162_10617676
2096 Ga0163162_10717152
2097 Ga0163162_10934839
2098 Ga0157372_10001523
2099 Ga0157372_10001692
2100 Ga0157372_10006706
2101 Ga0157372_10021790
2102 Ga0157372_10038529
2103 Ga0157372_10057008
2104 Ga0157372_10125179
2105 Ga0157372_10127426
2106 Ga0157372_10235050
2107 Ga0157372_10342593
2108 Ga0157372_10611369
2109 Ga0157372_10653370
2110 Ga0157372_11040013
2111 Ga0157372_11081066
2112 Ga0157372_11268004
2113 Ga0157375_10005469
2114 Ga0157375_10008616
2115 Ga0157375_10009546
2116 Ga0157375_10030473
2117 Ga0157375_10139594
2118 Ga0157375_10160405
2119 Ga0157375_10192365
2120 Ga0157375_10341164
2121 Ga0157375_11331140
2122 Ga0163163_10001352
2123 Ga0163163_10005124
2124 Ga0163163_10017644
2125 Ga0163163_10116185
2126 Ga0163163_10129546
2127 Ga0163163_10277309
2128 Ga0163163_10788761
2129 Ga0163163_11206576
2130 Ga0157380_10075229
2131 Ga0157380_10127469
2132 Ga0157380_10183319
2133 Ga0157380_10323229
2134 Ga0157380_10406241
2135 Ga0157380_11896899
2136 Ga0157377_10005762
2137 Ga0157377_10020805
2138 Ga0157377_10192613
2139 Ga0157377_10354686
2140 Ga0157379_10003084
2141 Ga0157379_10006078
2142 Ga0157379_10014992
2143 Ga0157379_10044107
2144 Ga0157379_10094110
2145 Ga0157379_10177073
2146 Ga0157379_10290174
2147 Ga0157379_10295756
2148 Ga0157379_10877914
2149 Ga0157376_10005980
2150 Ga0157376_10006034
2151 Ga0157376_10008657
2152 Ga0157376_10021115
2153 Ga0157376_10056422
2154 Ga0157376_10108541
2155 Ga0157376_10156469
2156 Ga0157376_10216043
2157 Ga0157376_10268444
2158 Ga0157376_10329577
2159 Ga0157376_10432172
2160 Ga0163161_10091924
2161 Ga0163161_10292088
2162 Ga0206356_10378156
2163 Ga0206354_10831956
2164 Ga0206353_10348253
2165 Ga0213872_10010960
2166 Ga0209565_1008854
2167 Ga0209050_1000118
2168 Ga0209256_1000015
2169 Ga0209051_1048365
2170 Ga0207697_10001322
2171 Ga0207697_10006351
2172 Ga0207697_10064319
2173 Ga0207656_10021638
2174 Ga0207656_10040066
2175 Ga0207656_10110599
2176 Ga0207656_10436309
2177 Ga0207682_10001314
2178 Ga0207682_10066945
2179 Ga0207692_10151398
2180 Ga0207692_10243228
2181 Ga0207692_10742301
2182 Ga0207642_10049883
2183 Ga0207642_10059991
2184 Ga0207642_10086113
2185 Ga0207642_10228143
2186 Ga0207710_10224370
2187 Ga0207710_10274693
2188 Ga0207688_10040755
2189 Ga0207688_10137724
2190 Ga0207680_10002102
2191 Ga0207680_10002576
2192 Ga0207680_10006510
2193 Ga0207680_10130197
2194 Ga0207680_10778992
2195 Ga0207685_10052916
2196 Ga0207699_10020977
2197 Ga0207699_10045839
2198 Ga0207699_10156363
2199 Ga0207699_10542025
2200 Ga0207699_10891022
2201 Ga0207645_10000214
2202 Ga0207645_10000421
2203 Ga0207645_10000695
2204 Ga0207645_10051776
2205 Ga0207645_10221952
2206 Ga0207643_10000537
2207 Ga0207643_10006837
2208 Ga0207643_10031135
2209 Ga0207643_10190696
2210 Ga0207705_10029140
2211 Ga0207705_10046332
2212 Ga0207705_10125004
2213 Ga0207705_10251199
2214 Ga0207705_10347690
2215 Ga0207705_10430450
2216 Ga0207684_10062559
2217 Ga0207654_10030084
2218 Ga0207654_10046536
2219 Ga0207654_10761391
2220 Ga0207707_10002896
2221 Ga0207707_10012845
2222 Ga0207707_10741698
2223 Ga0207695_10053255
2224 Ga0207695_10460568
2225 Ga0207695_11164634
2226 Ga0207671_10053265
2227 Ga0207671_10333599
2228 Ga0207693_10000652
2229 Ga0207693_10257300
2230 Ga0207693_10465167
2231 Ga0207663_10002608
2232 Ga0207663_10080045
2233 Ga0207660_10040475
2234 Ga0207660_10239956
2235 Ga0207662_10045518
2236 Ga0207662_10260182
2237 Ga0207657_10000750
2238 Ga0207657_10002560
2239 Ga0207657_10007901
2240 Ga0207657_10024835
2241 Ga0207657_10032956
2242 Ga0207649_10004987
2243 Ga0207649_10011486
2244 Ga0207649_10053399
2245 Ga0207649_10162744
2246 Ga0207649_10732780
2247 Ga0207649_10918792
2248 Ga0207652_10114356
2249 Ga0207652_10235188
2250 Ga0207652_10523802
2251 Ga0207646_10014581
2252 Ga0207646_11206169
2253 Ga0207681_10029078
2254 Ga0207681_10062396
2255 Ga0207681_10200987
2256 Ga0207681_10301407
2257 Ga0207681_10318132
2258 Ga0207694_10005853
2259 Ga0207694_10016726
2260 Ga0207694_10041190
2261 Ga0207694_10323906
2262 Ga0207694_10498964
2263 Ga0207694_11520836
2264 Ga0207650_10008724
2265 Ga0207650_10017230
2266 Ga0207650_10020685
2267 Ga0207650_10032090
2268 Ga0207650_10044419
2269 Ga0207650_10094251
2270 Ga0207650_10116313
2271 Ga0207650_10177971
2272 Ga0207650_10895675
2273 Ga0207650_11345727
2274 Ga0207659_10002136
2275 Ga0207659_10012703
2276 Ga0207659_10017200
2277 Ga0207659_10041351
2278 Ga0207659_10074554
2279 Ga0207659_10377670
2280 Ga0207687_10002403
2281 Ga0207687_10009624
2282 Ga0207687_10089592
2283 Ga0207687_11428951
2284 Ga0207700_10006059
2285 Ga0207700_10006798
2286 Ga0207700_10061260
2287 Ga0207700_10302396
2288 Ga0207700_10386787
2289 Ga0207700_10742649
2290 Ga0207700_11277872
2291 Ga0207664_10000912
2292 Ga0207664_10055495
2293 Ga0207664_10462445
2294 Ga0207664_10534050
2295 Ga0207664_11133358
2296 Ga0207644_10001317
2297 Ga0207644_10001544
2298 Ga0207644_10007546
2299 Ga0207644_10010859
2300 Ga0207644_10039904
2301 Ga0207644_10044769
2302 Ga0207644_10111826
2303 Ga0207644_10151743
2304 Ga0207644_10263945
2305 Ga0207644_10392191
2306 Ga0207644_10504612
2307 Ga0207690_10000826
2308 Ga0207690_10018363
2309 Ga0207690_10024622
2310 Ga0207690_10028312
2311 Ga0207690_10265877
2312 Ga0207690_10273017
2313 Ga0207706_10000465
2314 Ga0207706_10004984
2315 Ga0207706_10008050
2316 Ga0207706_10013535
2317 Ga0207706_10141051
2318 Ga0207706_10219105
2319 Ga0207706_10228234
2320 Ga0207686_10016224
2321 Ga0207686_10081829
2322 Ga0207709_10193197
2323 Ga0207709_10226720
2324 Ga0207670_10008447
2325 Ga0207670_10028643
2326 Ga0207670_10041928
2327 Ga0207670_10122272
2328 Ga0207670_10226472
2329 Ga0207670_10644180
2330 Ga0207670_10912645
2331 Ga0207669_10016731
2332 Ga0207669_10049351
2333 Ga0207669_10062316
2334 Ga0207669_10168199
2335 Ga0207669_10219510
2336 Ga0207669_10349222
2337 Ga0207704_10003217
2338 Ga0207704_10051971
2339 Ga0207704_10089364
2340 Ga0207704_10159849
2341 Ga0207704_10514262
2342 Ga0207704_10934686
2343 Ga0207665_10006908
2344 Ga0207665_10439099
2345 Ga0207691_10000084
2346 Ga0207691_10000577
2347 Ga0207691_10001328
2348 Ga0207691_10007830
2349 Ga0207691_10009589
2350 Ga0207691_10024667
2351 Ga0207691_10050830
2352 Ga0207691_10133319
2353 Ga0207691_10168116
2354 Ga0207691_10277792
2355 Ga0207691_10304882
2356 Ga0207711_10000087
2357 Ga0207711_10068506
2358 Ga0207711_10079464
2359 Ga0207711_10554326
2360 Ga0207711_11864467
2361 Ga0207689_10000069
2362 Ga0207689_10001822
2363 Ga0207689_10004226
2364 Ga0207689_10014272
2365 Ga0207689_10020777
2366 Ga0207689_10127315
2367 Ga0207689_10392687
2368 Ga0207661_10009752
2369 Ga0207661_10068005
2370 Ga0207661_10081925
2371 Ga0207661_10139313
2372 Ga0207661_10307273
2373 Ga0207661_10495668
2374 Ga0207661_11402725
2375 Ga0207679_10002617
2376 Ga0207679_10003953
2377 Ga0207679_10009503
2378 Ga0207679_10018509
2379 Ga0207679_10024164
2380 Ga0207679_10033839
2381 Ga0207679_10224474
2382 Ga0207679_10328735
2383 Ga0207679_10353045
2384 Ga0207679_10655101
2385 Ga0207667_10000490
2386 Ga0207667_10001200
2387 Ga0207667_10020237
2388 Ga0207667_10034332
2389 Ga0207667_10049680
2390 Ga0207667_10230511
2391 Ga0207667_10754105
2392 Ga0207651_10034097
2393 Ga0207651_10058537
2394 Ga0207651_10076025
2395 Ga0207651_10098714
2396 Ga0207651_10412067
2397 Ga0207651_10896648
2398 Ga0207712_10169501
2399 Ga0207712_10588000
2400 Ga0207712_10598117
2401 Ga0207668_10002833
2402 Ga0207668_10020812
2403 Ga0207668_10072731
2404 Ga0207668_10082765
2405 Ga0207668_10096561
2406 Ga0207668_10139413
2407 Ga0207668_10184349
2408 Ga0207668_10264603
2409 Ga0207640_10004420
2410 Ga0207640_10196228
2411 Ga0207640_10322519
2412 Ga0207640_10381345
2413 Ga0207640_10836124
2414 Ga0207640_10877677
2415 Ga0207658_10004792
2416 Ga0207658_10015419
2417 Ga0207658_10030693
2418 Ga0207658_10034077
2419 Ga0207658_10040854
2420 Ga0207658_10131100
2421 Ga0207658_10385542
2422 Ga0207658_10836479
2423 Ga0207677_10002351
2424 Ga0207677_10003281
2425 Ga0207677_10013587
2426 Ga0207677_10096955
2427 Ga0207677_10205834
2428 Ga0207677_10258002
2429 Ga0207677_10315814
2430 Ga0207677_10387167
2431 Ga0207677_11023988
2432 Ga0207703_10003435
2433 Ga0207703_10020784
2434 Ga0207703_10047877
2435 Ga0207703_10097054
2436 Ga0207703_10099385
2437 Ga0207703_10234858
2438 Ga0207703_10535412
2439 Ga0207703_10927693
2440 Ga0207703_11135969
2441 Ga0207703_11166214
2442 Ga0207639_10002729
2443 Ga0207639_10085045
2444 Ga0207639_10115683
2445 Ga0207639_10206423
2446 Ga0207639_10225232
2447 Ga0207639_10590504
2448 Ga0207639_10845258
2449 Ga0207678_10000429
2450 Ga0207678_10024896
2451 Ga0207678_10063616
2452 Ga0207678_10257659
2453 Ga0207678_10433641
2454 Ga0207678_10483840
2455 Ga0207678_10955631
2456 Ga0207708_10000710
2457 Ga0207708_10070723
2458 Ga0207708_10609583
2459 Ga0207708_10728229
2460 Ga0207702_10000635
2461 Ga0207702_10007712
2462 Ga0207702_10555710
2463 Ga0207702_10741525
2464 Ga0207641_10000832
2465 Ga0207641_10008086
2466 Ga0207641_10028936
2467 Ga0207641_10046362
2468 Ga0207641_10074523
2469 Ga0207641_10091874
2470 Ga0207641_10252563
2471 Ga0207641_10430200
2472 Ga0207641_10484223
2473 Ga0207641_10623493
2474 Ga0207641_10848422
2475 Ga0207648_10001494
2476 Ga0207648_10002166
2477 Ga0207648_10005304
2478 Ga0207648_10007639
2479 Ga0207648_10010002
2480 Ga0207648_10258076
2481 Ga0207648_10314828
2482 Ga0207648_10823879
2483 Ga0207676_10000294
2484 Ga0207676_10010977
2485 Ga0207676_10031242
2486 Ga0207676_10034632
2487 Ga0207676_10087407
2488 Ga0207676_10117327
2489 Ga0207676_10157544
2490 Ga0207676_10636366
2491 Ga0207676_11009222
2492 Ga0207676_11097917
2493 Ga0207676_11373440
2494 Ga0207674_10000140
2495 Ga0207674_10001268
2496 Ga0207674_10002122
2497 Ga0207674_10008483
2498 Ga0207674_10066352
2499 Ga0207674_10126579
2500 Ga0207675_100003688
2501 Ga0207675_100024173
2502 Ga0207675_100133130
2503 Ga0207675_100258972
2504 Ga0207675_100621877
2505 Ga0207675_100754562
2506 Ga0207683_10000003
2507 Ga0207683_10000355
2508 Ga0207683_10004640
2509 Ga0207683_10013734
2510 Ga0207683_10038235
2511 Ga0207683_10041228
2512 Ga0207683_10244960
2513 Ga0207683_11224833
2514 Ga0207683_11269342
2515 Ga0207698_10001629
2516 Ga0207698_10016336
2517 Ga0207698_10026907
2518 Ga0207698_10098460
2519 Ga0207698_10140919
2520 Ga0207698_10331444
2521 Ga0207698_10500209
2522 Ga0207698_10694092
2523 Ga0207698_12038168
2524 Ga0209281_1000151
2525 Ga0209998_10063347
2526 Ga0207428_10459083
2527 Ga0268266_10098208
2528 Ga0268266_10398746
2529 Ga0268266_10448216
2530 Ga0268266_10469980
2531 Ga0268266_10507024
2532 Ga0268266_11906427
2533 Ga0268265_10055502
2534 Ga0268265_10151504
2535 Ga0268265_10171615
2536 Ga0268265_10326190
2537 Ga0268264_10007174
2538 Ga0268264_10007222
2539 Ga0268264_10014173
2540 Ga0268264_10027411
2541 Ga0268264_10072575
2542 Ga0268264_10172961
2543 Ga0268264_10317376
2544 Ga0268264_10469749
2545 Ga0268264_10522120
2546 Ga0307515_10104002
2547 Ga0265328_10010415
2548 Ga0265325_10005542
2549 Ga0265329_10001188
2550 Ga0265331_10000588
2551 Ga0265327_10001246
2552 Ga0265316_10003969
2553 Ga0307513_10039326
2554 Ga0307408_100056526
2555 Ga0307508_10291073
2556 Ga0307508_10303334
2557 Ga0265342_10035908
2558 Ga0307405_10006897
2559 Ga0307405_10150781
2560 Ga0307405_10441964
2561 Ga0307413_10258834
2562 Ga0307413_10272077
2563 Ga0307410_10001643
2564 Ga0307410_10347028
2565 Ga0307406_10002738
2566 Ga0307406_10011363
2567 Ga0307406_11119924
2568 Ga0307407_10006893
2569 Ga0307407_10082475
2570 Ga0307407_10194948
2571 Ga0307407_10504138
2572 Ga0307412_10022675
2573 Ga0307412_10072937
2574 Ga0307412_10252357
2575 Ga0307412_10742330
2576 Ga0307409_100072777
2577 Ga0307409_100343701
2578 Ga0307409_100618660
2579 Ga0307416_100287861
2580 Ga0307416_100581064
2581 Ga0307416_100881466
2582 Ga0307414_10008851
2583 Ga0307414_10031387
2584 Ga0307414_10407716
2585 Ga0307411_10008275
2586 Ga0307415_100003530
2587 Ga0307415_100013901
2588 Ga0307415_100300861
2589 Ga0307510_10145803
2590 Ga0373950_0025484
2591 Ga0373926_0023656
2592 Ga0373926_0063682
2593 Ga0373926_0187788
2594 Ga0373934_0001028
2595 Ga0373934_0028705
2596 Ga0373940_0006679
2597 Ga0373944_0095052
2598 Ga0373944_0220730
2599 Ga0373949_0033605
2600 Ga0373951_0005905
2601 Ga0373951_0197114
2602 Ga0373952_0020617
2603 Ga0373923_0000349
2604 Ga0373923_0234089
2605 Ga0373932_0127581
2606 Ga0373936_0085339
2607 Ga0373939_0000181
2608 Ga0373945_0022054
2609 Ga0373945_0055004
2610 Ga0373945_0116426
2611 Ga0373953_0011995
2612 Ga0373954_0000014
2613 Ga0373954_0001030
2614 Ga0373954_0088249
2615 Ga0373954_0350248
2616 Ga0373954_0370139
2617 Ga0373956_0002915
2618 Ga0373957_0000571
2619 Ga0373957_0020193
2620 Ga0373957_0066703
2621 Ga0373957_0409280
2622 Ga0373960_0001830
2623 Ga0373960_0021540
2624 Ga0373943_0006181
2625 Ga0373943_0020255
2626 Ga0373943_0093965
2627 Ga0373943_0319466
2628 Ga0373946_0019765
2629 Ga0373946_0134764
2630 Ga0373955_0007208
2631 Ga0373955_0009860
2632 Ga0373955_0021182
2633 Ga0373955_0040880
2634 Ga0373955_0086287
2635 Ga0373955_0433414
2636 Ga0373961_0201507
2637 Ga0373962_0025391
2638 Ga0373924_0052026
2639 Ga0373924_0220160
2640 Ga0373931_0000400
2641 Ga0373931_0006244
2642 Ga0373931_0324949
2643 Ga0373931_0499369
2644 Ga0373931_0618554
2645 Ga0373935_0001974
2646 Ga0373935_0008949
2647 Ga0373935_0060731
2648 Ga0373935_0146577
2649 Ga0373935_0884709
2650 Ga0373927_0012584
2651 Ga0373927_0027951
2652 Ga0373927_0052206
2653 Ga0373927_0176704
2654 Ga0373927_0419486
2655 Ga0373933_0020603
2656 Ga0373933_0206472
2657 Ga0373933_0381085
2658 Ga0373947_0037034
2659 Ga0373947_0072873
2660 Ga0373947_0078718
2661 Ga0373937_0001093
2662 Ga0373937_0006625
2663 Ga0373937_0014281
2664 Ga0373937_0016376
2665 Ga0373937_0029114
2666 Ga0373937_0039190
2667 Ga0373937_0223074
2668 Ga0373937_0297402
2669 Ga0373937_0370279
2670 Ga0373937_0398840
2671 Ga0373937_1076454
2672 Ga0373925_0013167
2673 Ga0373925_0031283
2674 Ga0373925_0033878
2675 Ga0373925_0161591
2676 Ga0373925_0218196
2677 Ga0373925_0409949
2678 Ga0373925_0513838
2679 Ga0373925_0714276
2680 Ga0395899_0298613
2681 Ga0395900_0000058
2682 Ga0395905_0020330
2683 Ga0395905_0057608
2684 Ga0395905_0674301
2685 Ga0395905_0685052
2686 Ga0436365_0267431
2687 Ga0436365_0612874
2688 Ga0436361_0550950
2689 Ga0436361_0610301
2690 Ga0436361_1181538
2691 Ga0451787_067562
2692 Ga0451791_1059383
2693 Ga0451793_0982348
2694 Ga0451793_1844437
2695 Ga0451802_0395932
2696 Ga0451807_1126674
2697 Ga0451807_1466985
2698 Ga0451853_2209825
2699 Ga0451853_3563638
2700 Ga0450888_017070
2701 Ga0450898_094800
2702 Ga0439444_0069724
2703 Ga0439460_0132680
2704 Ga0451577_0000166
2705 Ga0451577_0011347
2706 Ga0451577_0041533
2707 Ga0451577_0089006
2708 Ga0451577_0196562
2709 Ga0451577_0319536
2710 Ga0451577_0478437
2711 Ga0451577_0819077
2712 Ga0453684_0000187
2713 Ga0453684_0326016
2714 Ga0453684_0459968
2715 Ga0453684_0595395
2716 Ga0453684_0747795
2717 Ga0453684_1674208
2718 Ga0451576_0004563
2719 Ga0451576_0066511
2720 Ga0451576_0078737
2721 Ga0451576_0088289
2722 Ga0451576_0109010
2723 Ga0451576_0144474
2724 Ga0451576_0378520
2725 Ga0451576_0771342
2726 Ga0451576_1283296
2727 Ga0451576_1868636
2728 Ga0495592_0000306
2729 Ga0495592_0033331
2730 Ga0495603_0055973
2731 Ga0495603_0233658
2732 Ga0495590_0006658
2733 Ga0495629_0122985
2734 Ga0495629_0377754
2735 Ga0495629_0451808
2736 Ga0495651_0120855
2737 Ga0495653_0061608
2738 Ga0495653_0435556
2739 Ga0495580_0035274
2740 Ga0495580_0155868
2741 Ga0495580_0837688
2742 Ga0495639_0477521
2743 Ga0495662_0014882
2744 Ga0495662_0097628
2745 Ga0495664_0136347
2746 Ga0495594_0033790
2747 Ga0495606_0323201
2748 Ga0495608_0000439
2749 Ga0495608_0005328
2750 Ga0495628_0001253
2751 Ga0495628_0073905
2752 Ga0495628_0172955
2753 Ga0495628_0199969
2754 Ga0495630_0003035
2755 Ga0495630_0105486
2756 Ga0495630_0222128
2757 Ga0495630_0618217
2758 Ga0495630_1439012
2759 Ga0495644_0157003
2760 Ga0495666_0012180
2761 Ga0495652_0031405
2762 Ga0495652_0065732
2763 Ga0495640_0000418
2764 Ga0495640_0076952
2765 Ga0495640_0531035
2766 Ga0495586_0001587
2767 Ga0495586_0264459
2768 Ga0495587_0004909
2769 Ga0495587_0010361
2770 Ga0495598_0087349
2771 Ga0495621_0032710
2772 Ga0495645_0000490
2773 Ga0495645_0026388
2774 Ga0495645_0078524
2775 Ga0495645_0458000
2776 Ga0495622_0139844
2777 Ga0495667_0003624
2778 Ga0495667_0010719
2779 Ga0495634_0003074
2780 Ga0495635_0012559
2781 Ga0495635_0028372
2782 Ga0495635_0061638
2783 Ga0495635_0569354
2784 Ga0495659_0220722
2785 Ga0495657_0053644
2786 Ga0495657_0252240
2787 Ga0495599_0030882
2788 Ga0495623_0016103
2789 Ga0495623_0016408
2790 Ga0495646_0161500
2791 Ga0495646_0267894
2792 Ga0495647_0006266
2793 Ga0495647_0410149
2794 Ga0495658_0001390
2795 Ga0495658_0051443
2796 Ga0495658_0405231
2797 Ga0495658_0425095
2798 Ga0495669_0154193
2799 Ga0495613_0003181
2800 Ga0495624_0086555
2801 Ga0495600_0010182
2802 Ga0495660_0175115
2803 Ga0495581_0007795
2804 Ga0495581_0236104
2805 Ga0495581_0360171
2806 Ga0495604_0001668
2807 Ga0495604_0036725
2808 Ga0495604_0091377
2809 Ga0495636_0008982
2810 Ga0495674_0157845
2811 Ga0495676_0118717
2812 Ga0495680_0003157
2813 Ga0495680_0221855
2814 Ga0495680_1073305
2815 Ga0495675_0032340
2816 Ga0495684_0033460
2817 Ga0495684_0108494
2818 Ga0495684_0229618
2819 Ga0495684_0254489
2820 Ga0495686_0007201
2821 Ga0495593_0062059
2822 Ga0495593_0254632
2823 Ga0495593_0547638
2824 Ga0495602_0088274
2825 Ga0495602_0267579
2826 Ga0495602_0592727
2827 Ga0495614_0189555
2828 Ga0496100_0148853
2829 Ga0496100_0275800
2830 Ga0496101_0111777
2831 Ga0496101_0373198
2832 Ga0496102_0011222
2833 Ga0496102_0028779
2834 Ga0496102_0068326
2835 Ga0496102_0181835
2836 Ga0496102_0637073
2837 Ga0496102_1112387
2838 Ga0496103_0082550
2839 Ga0496104_0015746
2840 Ga0496104_0047473
2841 Ga0496104_0190240
2842 Ga0496104_1132789
2843 Ga0496105_0004395
2844 Ga0496105_1323374
2845 Ga0496106_0002520
2846 Ga0496106_0412147
2847 Ga0496106_1084368
2848 Ga0496107_0025820
2849 Ga0496107_0041380
2850 Ga0496107_0203866
2851 Ga0496108_0044550
2852 Ga0496108_0159103
2853 Ga0496108_0215054
2854 Ga0496108_0516898
2855 Ga0496109_0004450
2856 Ga0496109_0105832
2857 Ga0496109_0212835
2858 Ga0496110_0091381
2859 Ga0496110_0149406
2860 Ga0496110_0286969
2861 Ga0496110_1090073
2862 Ga0496111_0176743
2863 Ga0496111_0613467
2864 Ga0496112_0000349
2865 Ga0496112_0003789
2866 Ga0496112_0073785
2867 Ga0496113_0071646
2868 Ga0496113_0245005
2869 Ga0496113_0320863
2870 Ga0496113_0562266
2871 Ga0496114_0021666
2872 Ga0496114_0620088
2873 Ga0496115_0892985
2874 Ga0496124_0001001
2875 Ga0501290_000024
2876 Ga0501291_000039
2877 Ga0501292_000069
2878 Ga0501294_000192
2879 Ga0501295_000183
2880 Ga0501296_000176
2881 Ga0501297_000004
2882 Ga0501298_000124
2883 Ga0501299_000282
2884 Ga0501300_000132
2885 Ga0501301_000026
2886 Ga0501303_000147
2887 Ga0501070_1203259
2888 Ga0501072_0343786
2889 Ga0501073_0283398
2890 Ga0501076_0116726
2891 Ga0501198_000280
2892 Ga0501199_005334
2893 Ga0501201_000014
2894 Ga0501202_000015
2895 Ga0501206_000010
2896 Ga0501207_000613
2897 Ga0501208_004334
2898 Ga0501211_000610
2899 Ga0501214_005204
2900 Ga0501216_000112
2901 Ga0501223_010883
2902 Ga0501227_001636
2903 Ga0501228_003108
2904 Ga0501230_000274
2905 Ga0501233_000058
2906 Ga0501235_000042
2907 Ga0501236_000929
2908 Ga0501239_004284
2909 Ga0501243_000440
2910 Ga0501246_000059
2911 Ga0501248_000300
2912 Ga0501249_000123
2913 Ga0501251_000033
2914 Ga0501255_000822
2915 Ga0501256_000952
2916 Ga0501257_016794
2917 Ga0501259_001098
2918 Ga0501260_000011
2919 Ga0501261_000100
2920 Ga0501219_001625
2921 Ga0501221_000074
2922 Ga0501225_0000250
2923 Ga0501229_000218
2924 Ga0501234_000065
2925 Ga0501080_0861603
2926 Ga0501232_007375
2927 Ga0501263_039330
2928 Ga0501264_000438
2929 Ga0501265_000143
2930 Ga0501266_008958
2931 Ga0501268_002618
2932 Ga0501269_008319
2933 Ga0501270_000408
2934 Ga0501271_001648
2935 Ga0501272_000128
2936 Ga0501274_000535
2937 Ga0501276_002219
2938 Ga0501278_001279
2939 Ga0501279_000130
2940 Ga0501280_004263
2941 Ga0501281_00749
2942 Ga0501283_000044
2943 Ga0501200_00096
2944 Ga0501226_002204
2945 nmdc:mga03683_46821_c1
2946 nmdc:mga0k408_239696_c1
2947 nmdc:mga07m45_1390_c1
2948 nmdc:mga05p37_41232_c1
2949 nmdc:mga09592_544091_c1
2950 nmdc:mga09592_8709_c1
2951 nmdc:mga0qj67_17879_c1
2952 nmdc:mga08y16_368861_c1
2953 nmdc:mga08y16_79846_c1
2954 nmdc:mga0n895_3063_c1
2955 nmdc:mga0n895_593505_c1
2956 nmdc:mga0rr50_154529_c1
2957 Ga0495601_0003644
2958 Ga0495612_0163011
2959 Ga0495612_0288231
2960 Ga0495595_0130017
2961 Ga0495595_0134453
2962 Ga0495619_0005553
2963 Ga0495619_0024756
2964 Ga0495619_0844092
2965 Ga0500651_0457437
2966 Ga0500593_008110
2967 Ga0530510_0107075
2968 2644217166
2969 2644303004
2970 2644338610

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

38

182

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qkv-assembly1.cif.gz_B structure of yibk from p. aeruginosa 0.9446 1 156
6qh8-assembly2.cif.gz_B structure of knotted yibk from p. aeruginosa 0.944 1 156
4kdz-assembly1.cif.gz_A crystal structure of trna/rrna methyltransferase yibk from escherichia coli (target nysgrc-012599) 0.9435 1 155
6qh8-assembly1.cif.gz_C structure of knotted yibk from p. aeruginosa 0.9407 1 154
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.9333 1 156
ID Description Score Start End Superfamily
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9333 1 156 3.40.1280.10
af_O50394_1_154_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9304 1 156 3.40.1280.10
af_C6TCU8_69_240_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9286 2 154 3.40.1280.10
af_O50394_1_154_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9189 1 156 3.40.1280.10
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9097 1 156 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A5M4EN07-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9607 3 156 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A4P5WXF1-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9542 2 151 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-N6Z7Y9-F1-model_v4 tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) 0.9522 1 156 GO:0002131
GO:0002132
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A7J7B2Z1-F1-model_v4 deleted 0.9513 1 153
AF-A0A0K8P130-F1-model_v4 tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) 0.9511 1 156 GO:0002131
GO:0002132
GO:0003723
GO:0005737
GO:0141098
GO:0141102

Map