F494306
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1486 | 701 | 2968 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300005347|Ga0070668_100277250|Ga0070668_1002772502 |
| Length | 238 |
| Sequence | MIGRSRRLEPEFSGKAGVNGYVRTATGDFSMYVRHFQFVRLLAAIAMVAGSTLYAIAQQPPSPTRVRGTIEAVDGGVLAVKSRGGEDFRLHMTGDLRVVGITKISLSDIKVGSFIGTTTVPGPDGSQNAVEVHVFPEAMRGTGEGSRPYDLRPNSTMTNATVAESVVGNDGHTLMIKYKDGEKKVVVSPETPVVTYVPADKSDLKPGAKVIAFIKKLPDGSFETNRVNVGRDGLTPPM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 102 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 103 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 104 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 105 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 106 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 135 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 137 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 138 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 139 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 140 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 141 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 218 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 219 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 220 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 228 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 229 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 230 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 233 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 234 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 235 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 238 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 239 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 240 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 241 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 242 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 243 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 244 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 245 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 246 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 247 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 248 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 249 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 250 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 251 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 252 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 253 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 254 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 255 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 256 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 257 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 258 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 260 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 263 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 266 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 269 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 271 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 276 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 280 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 282 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 284 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 285 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 286 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 288 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 289 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 290 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 291 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 292 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 293 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 294 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 295 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 296 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 297 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 298 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 299 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 300 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 301 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 302 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 303 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 305 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 306 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 307 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 308 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 309 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 310 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 311 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 312 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 313 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 314 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 315 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 316 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 317 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 318 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 319 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 320 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 405 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 406 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 407 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 408 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 409 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 410 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 413 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 414 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 415 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 416 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 417 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 418 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 419 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 420 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 421 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 422 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 423 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 424 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 425 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 426 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 427 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 428 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 443 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 444 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 445 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 446 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 447 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 448 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 449 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 450 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 458 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 461 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 465 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 466 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 467 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 468 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 469 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 470 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 471 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 472 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 473 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 474 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 475 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 476 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 477 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 478 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 479 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 480 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 481 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 482 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 483 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 484 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 485 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 486 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 487 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 488 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 489 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 490 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 491 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 492 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 493 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 494 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 495 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 496 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 497 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 498 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 499 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 500 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 501 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 502 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 503 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 504 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 505 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 506 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 507 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 508 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 509 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 510 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 511 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 512 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 513 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 514 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 515 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 516 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 517 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 518 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 519 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 520 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 521 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 522 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 523 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 524 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 525 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 526 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 527 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 528 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 529 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 530 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 531 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 532 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 533 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 534 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 535 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 536 | 2791355199 | |||
| 537 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 538 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 539 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 540 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 541 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 542 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 543 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 544 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 545 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 546 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 547 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 548 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 549 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 550 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 551 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 552 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 553 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 554 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 555 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 556 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 557 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 558 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 559 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 560 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 561 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 562 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 563 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 564 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 565 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 566 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 567 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 568 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 569 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 570 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 571 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 572 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 573 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 574 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 575 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 576 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 577 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 578 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 579 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 580 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 581 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 582 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 583 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 584 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 585 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 586 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 587 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 588 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 589 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 590 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 591 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 592 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 593 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 594 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 595 | 2906610324 | |||
| 596 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 597 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 598 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 599 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 600 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 601 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 602 | 2922368715 | |||
| 603 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 604 | 2922425934 | |||
| 605 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 606 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 607 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 608 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 609 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 610 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 611 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 612 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 613 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 614 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 615 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 616 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 617 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 618 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 619 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 620 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 621 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 622 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 623 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 624 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 625 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 626 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 627 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 628 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 629 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 630 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 631 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 632 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 633 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 634 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 635 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 636 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 637 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 638 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 639 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 640 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 641 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 642 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 643 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 644 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 645 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 646 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 647 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 648 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 649 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 650 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 651 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 652 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 653 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 654 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 655 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 656 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 657 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 658 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 659 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 660 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 661 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 662 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 663 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 664 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 665 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 666 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 667 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 668 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 669 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 670 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 671 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 672 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 673 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 674 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 675 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 676 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 677 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 678 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 679 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 680 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 681 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 682 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 683 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 684 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 685 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 686 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 687 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 688 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 689 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 690 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 691 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 692 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 693 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 694 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 695 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 696 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 697 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 698 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 699 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 700 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 701 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.38 |
| Metatranscriptomes | 0.47 |
| Isolates | 12.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.06 |
| Nodule | 9.96 |
| Rhizoplane | 6.12 |
| Rhizosphere | 62.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070668_100277250 | 3300005347 | Bacteria | 1399 |
| 2 | JGI24744J21845_10007283 | 3300002077 | Bacteria | 2286 |
| 3 | JGI24034J26672_10043701 | 3300002239 | Bacteria | 757 |
| 4 | JGI25406J46586_10000064 | 3300003203 | Bacteria | 49110 |
| 5 | JGI25153J46596_10002222 | 3300003215 | Bacteria | 11325 |
| 6 | JGI25153J46596_10005210 | 3300003215 | Bacteria | 6841 |
| 7 | JGI25153J46596_10010025 | 3300003215 | Bacteria | 4327 |
| 8 | JGI25153J46596_10059413 | 3300003215 | Bacteria | 1047 |
| 9 | JGI25153J46596_10065596 | 3300003215 | Bacteria | 964 |
| 10 | JGI25160J50197_1003229 | 3300003354 | Bacteria | 7360 |
| 11 | JGI25160J50197_1003286 | 3300003354 | Bacteria | 7284 |
| 12 | JGI25160J50197_1007225 | 3300003354 | Bacteria | 4369 |
| 13 | JGI25404J52841_10031685 | 3300003659 | Bacteria | 1129 |
| 14 | JGI25404J52841_10038592 | 3300003659 | Bacteria | 1013 |
| 15 | JGI25404J52841_10064843 | 3300003659 | Bacteria | 764 |
| 16 | Ga0055542_1012629 | 3300003762 | Bacteria | 1453 |
| 17 | Ga0055531_10010351 | 3300003794 | Bacteria | 4645 |
| 18 | Ga0055531_10010606 | 3300003794 | Bacteria | 4554 |
| 19 | Ga0058862_12106901 | 3300004803 | Bacteria | 785 |
| 20 | Ga0065165_1002846 | 3300005262 | Bacteria | 13437 |
| 21 | Ga0065165_1041273 | 3300005262 | Bacteria | 1371 |
| 22 | Ga0065165_1049278 | 3300005262 | Bacteria | 1205 |
| 23 | Ga0070658_10076494 | 3300005327 | Bacteria | 2745 |
| 24 | Ga0070658_10221291 | 3300005327 | Bacteria | 1601 |
| 25 | Ga0070676_10225461 | 3300005328 | Bacteria | 1240 |
| 26 | Ga0070670_100152910 | 3300005331 | Bacteria | 1997 |
| 27 | Ga0070677_10035552 | 3300005333 | Bacteria | 1932 |
| 28 | Ga0068869_100082663 | 3300005334 | Bacteria | 2400 |
| 29 | Ga0068869_101050448 | 3300005334 | Bacteria | 711 |
| 30 | Ga0068869_101076396 | 3300005334 | Bacteria | 703 |
| 31 | Ga0070680_100067108 | 3300005336 | Bacteria | 2942 |
| 32 | Ga0070680_100247525 | 3300005336 | Bacteria | 1507 |
| 33 | Ga0070682_100044400 | 3300005337 | Bacteria | 2752 |
| 34 | Ga0070682_100189458 | 3300005337 | Bacteria | 1443 |
| 35 | Ga0070682_100288353 | 3300005337 | Bacteria | 1199 |
| 36 | Ga0070682_100635339 | 3300005337 | Bacteria | 848 |
| 37 | Ga0068868_100018112 | 3300005338 | Bacteria | 5258 |
| 38 | Ga0068868_100332565 | 3300005338 | Bacteria | 1297 |
| 39 | Ga0068868_100631270 | 3300005338 | Bacteria | 952 |
| 40 | Ga0068868_100791953 | 3300005338 | Bacteria | 855 |
| 41 | Ga0070660_100006991 | 3300005339 | Bacteria | 7831 |
| 42 | Ga0070660_100034303 | 3300005339 | Bacteria | 3833 |
| 43 | Ga0070660_100602996 | 3300005339 | Bacteria | 918 |
| 44 | Ga0070689_100003410 | 3300005340 | Bacteria | 10568 |
| 45 | Ga0070691_10092996 | 3300005341 | Bacteria | 1489 |
| 46 | Ga0070691_10202301 | 3300005341 | Bacteria | 1044 |
| 47 | Ga0070687_100184969 | 3300005343 | Bacteria | 1251 |
| 48 | Ga0070661_100116508 | 3300005344 | Bacteria | 1998 |
| 49 | Ga0070661_100308864 | 3300005344 | Bacteria | 1232 |
| 50 | Ga0070692_10283048 | 3300005345 | Bacteria | 1006 |
| 51 | Ga0070668_100036445 | 3300005347 | Bacteria | 3754 |
| 52 | Ga0070668_100107537 | 3300005347 | Bacteria | 2217 |
| 53 | Ga0070668_100136497 | 3300005347 | Bacteria | 1973 |
| 54 | Ga0070669_100093037 | 3300005353 | Bacteria | 2264 |
| 55 | Ga0070675_100598194 | 3300005354 | Bacteria | 1000 |
| 56 | Ga0070671_100048918 | 3300005355 | Bacteria | 3518 |
| 57 | Ga0070671_100511190 | 3300005355 | Bacteria | 1034 |
| 58 | Ga0070674_100047397 | 3300005356 | Bacteria | 2944 |
| 59 | Ga0070674_100255194 | 3300005356 | Bacteria | 1379 |
| 60 | Ga0070674_100276964 | 3300005356 | Bacteria | 1328 |
| 61 | Ga0070674_100468151 | 3300005356 | Bacteria | 1043 |
| 62 | Ga0070674_101127222 | 3300005356 | Bacteria | 694 |
| 63 | Ga0070673_100015849 | 3300005364 | Bacteria | 5308 |
| 64 | Ga0070673_100283806 | 3300005364 | Bacteria | 1453 |
| 65 | Ga0070688_100014954 | 3300005365 | Bacteria | 4406 |
| 66 | Ga0070688_100273668 | 3300005365 | Bacteria | 1210 |
| 67 | Ga0070688_100344952 | 3300005365 | Bacteria | 1089 |
| 68 | Ga0070688_100489644 | 3300005365 | Bacteria | 926 |
| 69 | Ga0070688_100614993 | 3300005365 | Bacteria | 833 |
| 70 | Ga0070659_100161364 | 3300005366 | Bacteria | 1833 |
| 71 | Ga0070667_100334348 | 3300005367 | Bacteria | 1369 |
| 72 | Ga0070709_10023533 | 3300005434 | Bacteria | 3619 |
| 73 | Ga0070709_10207058 | 3300005434 | Bacteria | 1392 |
| 74 | Ga0070709_10426718 | 3300005434 | Bacteria | 995 |
| 75 | Ga0070709_10438058 | 3300005434 | Unclassified | 982 |
| 76 | Ga0070714_100021622 | 3300005435 | Bacteria | 5265 |
| 77 | Ga0070714_100022361 | 3300005435 | Bacteria | 5185 |
| 78 | Ga0070713_100003057 | 3300005436 | Bacteria | 10992 |
| 79 | Ga0070713_100027241 | 3300005436 | Bacteria | 4498 |
| 80 | Ga0070713_100194352 | 3300005436 | Bacteria | 1830 |
| 81 | Ga0070713_100216448 | 3300005436 | Bacteria | 1736 |
| 82 | Ga0070713_100254749 | 3300005436 | Bacteria | 1602 |
| 83 | Ga0070713_100591018 | 3300005436 | Unclassified | 1054 |
| 84 | Ga0070710_10000898 | 3300005437 | Bacteria | 14242 |
| 85 | Ga0070710_10004992 | 3300005437 | Bacteria | 6279 |
| 86 | Ga0070710_10057069 | 3300005437 | Bacteria | 2211 |
| 87 | Ga0070710_10401405 | 3300005437 | Bacteria | 919 |
| 88 | Ga0070701_10190953 | 3300005438 | Bacteria | 1205 |
| 89 | Ga0070701_10309709 | 3300005438 | Bacteria | 973 |
| 90 | Ga0070711_100006300 | 3300005439 | Bacteria | 7143 |
| 91 | Ga0070711_100013080 | 3300005439 | Bacteria | 5204 |
| 92 | Ga0070711_100130120 | 3300005439 | Bacteria | 1873 |
| 93 | Ga0070711_100222189 | 3300005439 | Bacteria | 1469 |
| 94 | Ga0070700_100140901 | 3300005441 | Bacteria | 1638 |
| 95 | Ga0070700_100379811 | 3300005441 | Bacteria | 1056 |
| 96 | Ga0070708_100688057 | 3300005445 | Bacteria | 963 |
| 97 | Ga0070663_100011845 | 3300005455 | Bacteria | 5495 |
| 98 | Ga0070663_100059872 | 3300005455 | Bacteria | 2737 |
| 99 | Ga0070663_100075825 | 3300005455 | Bacteria | 2458 |
| 100 | Ga0070663_100082344 | 3300005455 | Bacteria | 2367 |
| 101 | Ga0070663_100095393 | 3300005455 | Bacteria | 2211 |
| 102 | Ga0070663_100118294 | 3300005455 | Bacteria | 1999 |
| 103 | Ga0070663_100631414 | 3300005455 | Bacteria | 904 |
| 104 | Ga0070678_100027191 | 3300005456 | Bacteria | 3881 |
| 105 | Ga0070678_100066613 | 3300005456 | Bacteria | 2677 |
| 106 | Ga0070678_100180423 | 3300005456 | Bacteria | 1728 |
| 107 | Ga0070678_100185985 | 3300005456 | Bacteria | 1704 |
| 108 | Ga0070678_100325482 | 3300005456 | Bacteria | 1314 |
| 109 | Ga0070678_101008292 | 3300005456 | Bacteria | 765 |
| 110 | Ga0070662_100036491 | 3300005457 | Bacteria | 3478 |
| 111 | Ga0070662_100119335 | 3300005457 | Bacteria | 2020 |
| 112 | Ga0070662_100405729 | 3300005457 | Bacteria | 1125 |
| 113 | Ga0070662_100553987 | 3300005457 | Bacteria | 964 |
| 114 | Ga0070681_10076670 | 3300005458 | Bacteria | 3301 |
| 115 | Ga0070681_10223639 | 3300005458 | Bacteria | 1797 |
| 116 | Ga0070681_10258190 | 3300005458 | Bacteria | 1654 |
| 117 | Ga0068867_100372931 | 3300005459 | Bacteria | 1197 |
| 118 | Ga0068867_100461189 | 3300005459 | Bacteria | 1085 |
| 119 | Ga0068867_100852289 | 3300005459 | Bacteria | 816 |
| 120 | Ga0070685_10505786 | 3300005466 | Bacteria | 856 |
| 121 | Ga0070706_100294995 | 3300005467 | Bacteria | 1513 |
| 122 | Ga0070699_100004488 | 3300005518 | Bacteria | 12349 |
| 123 | Ga0070699_100205190 | 3300005518 | Bacteria | 1753 |
| 124 | Ga0070679_100009249 | 3300005530 | Bacteria | 9313 |
| 125 | Ga0070679_100026486 | 3300005530 | Bacteria | 5697 |
| 126 | Ga0070679_100051732 | 3300005530 | Bacteria | 4091 |
| 127 | Ga0070679_100127331 | 3300005530 | Bacteria | 2528 |
| 128 | Ga0070679_100141288 | 3300005530 | Bacteria | 2387 |
| 129 | Ga0070679_100285103 | 3300005530 | Bacteria | 1604 |
| 130 | Ga0070684_100008556 | 3300005535 | Bacteria | 8010 |
| 131 | Ga0070684_100074126 | 3300005535 | Bacteria | 3000 |
| 132 | Ga0070684_100254112 | 3300005535 | Bacteria | 1606 |
| 133 | Ga0070684_100387896 | 3300005535 | Bacteria | 1287 |
| 134 | Ga0070684_101017239 | 3300005535 | Bacteria | 778 |
| 135 | Ga0068853_100002207 | 3300005539 | Bacteria | 14542 |
| 136 | Ga0068853_100045254 | 3300005539 | Bacteria | 3769 |
| 137 | Ga0070672_100105181 | 3300005543 | Bacteria | 2294 |
| 138 | Ga0070672_100210306 | 3300005543 | Bacteria | 1629 |
| 139 | Ga0070686_100124132 | 3300005544 | Bacteria | 1777 |
| 140 | Ga0070686_100124523 | 3300005544 | Bacteria | 1774 |
| 141 | Ga0070686_100378295 | 3300005544 | Bacteria | 1071 |
| 142 | Ga0070695_100555546 | 3300005545 | Bacteria | 895 |
| 143 | Ga0070693_100215366 | 3300005547 | Bacteria | 1256 |
| 144 | Ga0070693_100300391 | 3300005547 | Bacteria | 1082 |
| 145 | Ga0070693_100310317 | 3300005547 | Bacteria | 1066 |
| 146 | Ga0070665_100009777 | 3300005548 | Bacteria | 9699 |
| 147 | Ga0070665_100063185 | 3300005548 | Bacteria | 3712 |
| 148 | Ga0070665_100105307 | 3300005548 | Bacteria | 2823 |
| 149 | Ga0070665_100352248 | 3300005548 | Bacteria | 1478 |
| 150 | Ga0070704_100143619 | 3300005549 | Bacteria | 1867 |
| 151 | Ga0068855_100121549 | 3300005563 | Bacteria | 2988 |
| 152 | Ga0068855_100259104 | 3300005563 | Bacteria | 1938 |
| 153 | Ga0070664_100064592 | 3300005564 | Bacteria | 3122 |
| 154 | Ga0070664_100187076 | 3300005564 | Bacteria | 1844 |
| 155 | Ga0070664_100594533 | 3300005564 | Bacteria | 1026 |
| 156 | Ga0068857_100536864 | 3300005577 | Bacteria | 1101 |
| 157 | Ga0068854_100189435 | 3300005578 | Bacteria | 1611 |
| 158 | Ga0068854_100414926 | 3300005578 | Bacteria | 1117 |
| 159 | Ga0068854_100435446 | 3300005578 | Bacteria | 1092 |
| 160 | Ga0068856_100271496 | 3300005614 | Bacteria | 1712 |
| 161 | Ga0070702_100599263 | 3300005615 | Bacteria | 826 |
| 162 | Ga0068852_100028959 | 3300005616 | Bacteria | 4542 |
| 163 | Ga0068852_100135745 | 3300005616 | Bacteria | 2271 |
| 164 | Ga0068852_100136685 | 3300005616 | Bacteria | 2263 |
| 165 | Ga0068852_100455078 | 3300005616 | Bacteria | 1268 |
| 166 | Ga0068852_101002766 | 3300005616 | Bacteria | 854 |
| 167 | Ga0068859_100058039 | 3300005617 | Bacteria | 3898 |
| 168 | Ga0068859_100279653 | 3300005617 | Bacteria | 1761 |
| 169 | Ga0068859_100990076 | 3300005617 | Bacteria | 923 |
| 170 | Ga0068864_100274516 | 3300005618 | Bacteria | 1572 |
| 171 | Ga0068864_100751491 | 3300005618 | Bacteria | 956 |
| 172 | Ga0068864_100826515 | 3300005618 | Bacteria | 912 |
| 173 | Ga0068866_10100091 | 3300005718 | Bacteria | 1597 |
| 174 | Ga0068866_10327838 | 3300005718 | Bacteria | 965 |
| 175 | Ga0068861_100048184 | 3300005719 | Bacteria | 3220 |
| 176 | Ga0068861_100092396 | 3300005719 | Bacteria | 2390 |
| 177 | Ga0068851_10010608 | 3300005834 | Bacteria | 4302 |
| 178 | Ga0068851_10065387 | 3300005834 | Bacteria | 1871 |
| 179 | Ga0068851_10099650 | 3300005834 | Bacteria | 1540 |
| 180 | Ga0068851_10226324 | 3300005834 | Bacteria | 1053 |
| 181 | Ga0068851_10400191 | 3300005834 | Bacteria | 808 |
| 182 | Ga0068870_10106031 | 3300005840 | Bacteria | 1597 |
| 183 | Ga0068870_10157228 | 3300005840 | Bacteria | 1345 |
| 184 | Ga0068870_10545969 | 3300005840 | Bacteria | 779 |
| 185 | Ga0068863_100178070 | 3300005841 | Bacteria | 2041 |
| 186 | Ga0068863_100560533 | 3300005841 | Bacteria | 1129 |
| 187 | Ga0068858_100079901 | 3300005842 | Bacteria | 3038 |
| 188 | Ga0068858_100359850 | 3300005842 | Bacteria | 1395 |
| 189 | Ga0068858_100453593 | 3300005842 | Bacteria | 1236 |
| 190 | Ga0068858_100701786 | 3300005842 | Bacteria | 985 |
| 191 | Ga0068858_100807844 | 3300005842 | Bacteria | 915 |
| 192 | Ga0068860_100002033 | 3300005843 | Bacteria | 21319 |
| 193 | Ga0068860_100158101 | 3300005843 | Bacteria | 2184 |
| 194 | Ga0068860_100233298 | 3300005843 | Bacteria | 1788 |
| 195 | Ga0068860_101555008 | 3300005843 | Bacteria | 683 |
| 196 | Ga0068862_100028055 | 3300005844 | Bacteria | 4741 |
| 197 | Ga0068862_100083389 | 3300005844 | Bacteria | 2775 |
| 198 | Ga0068862_100119078 | 3300005844 | Bacteria | 2325 |
| 199 | Ga0068862_100320479 | 3300005844 | Bacteria | 1430 |
| 200 | Ga0081455_10004676 | 3300005937 | Bacteria | 15239 |
| 201 | Ga0081455_10009004 | 3300005937 | Bacteria | 10307 |
| 202 | Ga0081455_10010961 | 3300005937 | Bacteria | 9137 |
| 203 | Ga0081455_10033922 | 3300005937 | Bacteria | 4579 |
| 204 | Ga0081455_10083752 | 3300005937 | Bacteria | 2605 |
| 205 | Ga0081455_10114395 | 3300005937 | Bacteria | 2138 |
| 206 | Ga0081455_10180133 | 3300005937 | Bacteria | 1601 |
| 207 | Ga0081538_10163438 | 3300005981 | Bacteria | 985 |
| 208 | Ga0081540_1002062 | 3300005983 | Bacteria | 16766 |
| 209 | Ga0081540_1002136 | 3300005983 | Bacteria | 16449 |
| 210 | Ga0081540_1004242 | 3300005983 | Bacteria | 11009 |
| 211 | Ga0081540_1008268 | 3300005983 | Bacteria | 7287 |
| 212 | Ga0081540_1008316 | 3300005983 | Bacteria | 7258 |
| 213 | Ga0081540_1015931 | 3300005983 | Bacteria | 4737 |
| 214 | Ga0081540_1021026 | 3300005983 | Bacteria | 3904 |
| 215 | Ga0081540_1030563 | 3300005983 | Bacteria | 2980 |
| 216 | Ga0081540_1043164 | 3300005983 | Bacteria | 2317 |
| 217 | Ga0081540_1105433 | 3300005983 | Bacteria | 1204 |
| 218 | Ga0081539_10000099 | 3300005985 | Bacteria | 201018 |
| 219 | Ga0081539_10000349 | 3300005985 | Bacteria | 101264 |
| 220 | Ga0081539_10005573 | 3300005985 | Bacteria | 12732 |
| 221 | Ga0081539_10101203 | 3300005985 | Bacteria | 1468 |
| 222 | Ga0070717_10003779 | 3300006028 | Bacteria | 10878 |
| 223 | Ga0070717_10004793 | 3300006028 | Bacteria | 9837 |
| 224 | Ga0070717_10078731 | 3300006028 | Bacteria | 2763 |
| 225 | Ga0070717_10139271 | 3300006028 | Bacteria | 2092 |
| 226 | Ga0070717_10699461 | 3300006028 | Bacteria | 921 |
| 227 | Ga0070717_10849307 | 3300006028 | Bacteria | 831 |
| 228 | Ga0075365_10030954 | 3300006038 | Bacteria | 3431 |
| 229 | Ga0075365_10038399 | 3300006038 | Bacteria | 3112 |
| 230 | Ga0075365_10046636 | 3300006038 | Bacteria | 2847 |
| 231 | Ga0075365_10105449 | 3300006038 | Bacteria | 1933 |
| 232 | Ga0075365_10124921 | 3300006038 | Bacteria | 1777 |
| 233 | Ga0075365_10356209 | 3300006038 | Bacteria | 1031 |
| 234 | Ga0075365_10356989 | 3300006038 | Bacteria | 1030 |
| 235 | Ga0075365_10661244 | 3300006038 | Unclassified | 738 |
| 236 | Ga0075368_10037927 | 3300006042 | Bacteria | 1885 |
| 237 | Ga0075368_10045140 | 3300006042 | Bacteria | 1740 |
| 238 | Ga0075363_100005067 | 3300006048 | Bacteria | 5827 |
| 239 | Ga0075363_100420213 | 3300006048 | Bacteria | 787 |
| 240 | Ga0075364_10095067 | 3300006051 | Bacteria | 1981 |
| 241 | Ga0075364_10101798 | 3300006051 | Bacteria | 1912 |
| 242 | Ga0075364_10288094 | 3300006051 | Bacteria | 1117 |
| 243 | Ga0070715_10037720 | 3300006163 | Bacteria | 2001 |
| 244 | Ga0070716_100008278 | 3300006173 | Bacteria | 5157 |
| 245 | Ga0070712_100048450 | 3300006175 | Bacteria | 2945 |
| 246 | Ga0070712_100062605 | 3300006175 | Bacteria | 2631 |
| 247 | Ga0070712_100093190 | 3300006175 | Bacteria | 2211 |
| 248 | Ga0070712_100294711 | 3300006175 | Bacteria | 1311 |
| 249 | Ga0070712_100301268 | 3300006175 | Bacteria | 1297 |
| 250 | Ga0070712_100349456 | 3300006175 | Bacteria | 1210 |
| 251 | Ga0070712_100539466 | 3300006175 | Bacteria | 982 |
| 252 | Ga0075367_10013887 | 3300006178 | Bacteria | 4344 |
| 253 | Ga0075367_10016061 | 3300006178 | Bacteria | 4082 |
| 254 | Ga0075367_10019716 | 3300006178 | Bacteria | 3744 |
| 255 | Ga0075367_10135468 | 3300006178 | Bacteria | 1523 |
| 256 | Ga0075367_10303128 | 3300006178 | Bacteria | 1006 |
| 257 | Ga0075367_10441974 | 3300006178 | Bacteria | 824 |
| 258 | Ga0075367_10450903 | 3300006178 | Bacteria | 815 |
| 259 | Ga0075369_10032817 | 3300006186 | Bacteria | 2198 |
| 260 | Ga0075369_10035385 | 3300006186 | Bacteria | 2122 |
| 261 | Ga0075366_10004220 | 3300006195 | Bacteria | 7703 |
| 262 | Ga0075366_10160920 | 3300006195 | Bacteria | 1360 |
| 263 | Ga0075366_10293055 | 3300006195 | Bacteria | 995 |
| 264 | Ga0097621_100376971 | 3300006237 | Bacteria | 1266 |
| 265 | Ga0097621_100449291 | 3300006237 | Bacteria | 1161 |
| 266 | Ga0097621_100473002 | 3300006237 | Bacteria | 1132 |
| 267 | Ga0097621_100572044 | 3300006237 | Bacteria | 1030 |
| 268 | Ga0097621_100734130 | 3300006237 | Bacteria | 911 |
| 269 | Ga0075370_10003183 | 3300006353 | Bacteria | 7771 |
| 270 | Ga0075370_10084281 | 3300006353 | Bacteria | 1829 |
| 271 | Ga0075370_10166136 | 3300006353 | Bacteria | 1296 |
| 272 | Ga0075370_10331962 | 3300006353 | Bacteria | 907 |
| 273 | Ga0075370_10400884 | 3300006353 | Bacteria | 823 |
| 274 | Ga0068871_100194643 | 3300006358 | Bacteria | 1748 |
| 275 | Ga0068871_100550763 | 3300006358 | Bacteria | 1045 |
| 276 | Ga0075428_100120108 | 3300006844 | Bacteria | 2861 |
| 277 | Ga0075428_100142954 | 3300006844 | Bacteria | 2601 |
| 278 | Ga0075428_100814854 | 3300006844 | Bacteria | 992 |
| 279 | Ga0075430_100148246 | 3300006846 | Bacteria | 1954 |
| 280 | Ga0075431_100272584 | 3300006847 | Bacteria | 1714 |
| 281 | Ga0075434_100247369 | 3300006871 | Bacteria | 1802 |
| 282 | Ga0068865_100076577 | 3300006881 | Bacteria | 2388 |
| 283 | Ga0068865_100234576 | 3300006881 | Bacteria | 1441 |
| 284 | Ga0068865_100443569 | 3300006881 | Bacteria | 1072 |
| 285 | Ga0068865_100445543 | 3300006881 | Bacteria | 1069 |
| 286 | Ga0075436_100707125 | 3300006914 | Bacteria | 747 |
| 287 | Ga0097620_100058038 | 3300006931 | Bacteria | 3898 |
| 288 | Ga0097620_100279657 | 3300006931 | Bacteria | 1761 |
| 289 | Ga0097620_100989817 | 3300006931 | Bacteria | 923 |
| 290 | Ga0099824_1023056 | 3300006942 | Bacteria | 3951 |
| 291 | Ga0099822_1001448 | 3300006943 | Bacteria | 27661 |
| 292 | Ga0099823_1004051 | 3300006944 | Bacteria | 14168 |
| 293 | Ga0099794_10118786 | 3300007265 | Bacteria | 1329 |
| 294 | Ga0099795_10010789 | 3300007788 | Bacteria | 2705 |
| 295 | Ga0099795_10025253 | 3300007788 | Bacteria | 1991 |
| 296 | Ga0099795_10033214 | 3300007788 | Bacteria | 1790 |
| 297 | Ga0105250_10041341 | 3300009092 | Bacteria | 1848 |
| 298 | Ga0105240_10008946 | 3300009093 | Bacteria | 14238 |
| 299 | Ga0105240_10012128 | 3300009093 | Bacteria | 11932 |
| 300 | Ga0105240_10029706 | 3300009093 | Bacteria | 7114 |
| 301 | Ga0105240_10755909 | 3300009093 | Bacteria | 1056 |
| 302 | Ga0105240_10866709 | 3300009093 | Bacteria | 974 |
| 303 | Ga0111539_10100511 | 3300009094 | Bacteria | 3396 |
| 304 | Ga0111539_10620552 | 3300009094 | Bacteria | 1259 |
| 305 | Ga0105245_10014034 | 3300009098 | Bacteria | 6976 |
| 306 | Ga0105245_10035028 | 3300009098 | Bacteria | 4454 |
| 307 | Ga0105245_10216755 | 3300009098 | Bacteria | 1845 |
| 308 | Ga0105245_10247473 | 3300009098 | Bacteria | 1731 |
| 309 | Ga0105245_11342145 | 3300009098 | Bacteria | 764 |
| 310 | Ga0105247_10087187 | 3300009101 | Bacteria | 1976 |
| 311 | Ga0105247_10146839 | 3300009101 | Bacteria | 1551 |
| 312 | Ga0105247_10280210 | 3300009101 | Bacteria | 1150 |
| 313 | Ga0114129_10434534 | 3300009147 | Bacteria | 1724 |
| 314 | Ga0114129_11182891 | 3300009147 | Bacteria | 953 |
| 315 | Ga0105243_10184971 | 3300009148 | Bacteria | 1815 |
| 316 | Ga0105243_10710138 | 3300009148 | Bacteria | 981 |
| 317 | Ga0105241_10033592 | 3300009174 | Bacteria | 3851 |
| 318 | Ga0105241_10040624 | 3300009174 | Bacteria | 3512 |
| 319 | Ga0105241_10062620 | 3300009174 | Bacteria | 2868 |
| 320 | Ga0105241_10608928 | 3300009174 | Bacteria | 988 |
| 321 | Ga0105242_10097450 | 3300009176 | Bacteria | 2486 |
| 322 | Ga0105242_10156664 | 3300009176 | Bacteria | 1990 |
| 323 | Ga0105242_10200858 | 3300009176 | Bacteria | 1771 |
| 324 | Ga0105248_10029891 | 3300009177 | Bacteria | 6080 |
| 325 | Ga0105248_10034176 | 3300009177 | Bacteria | 5684 |
| 326 | Ga0105248_10237637 | 3300009177 | Bacteria | 2051 |
| 327 | Ga0105237_10004719 | 3300009545 | Bacteria | 15684 |
| 328 | Ga0105237_10019250 | 3300009545 | Bacteria | 7053 |
| 329 | Ga0105237_10070348 | 3300009545 | Bacteria | 3495 |
| 330 | Ga0105237_10328510 | 3300009545 | Bacteria | 1533 |
| 331 | Ga0105237_10500675 | 3300009545 | Bacteria | 1221 |
| 332 | Ga0105237_10562408 | 3300009545 | Bacteria | 1147 |
| 333 | Ga0105237_10916003 | 3300009545 | Bacteria | 884 |
| 334 | Ga0105238_10003421 | 3300009551 | Bacteria | 15825 |
| 335 | Ga0105238_10264193 | 3300009551 | Bacteria | 1701 |
| 336 | Ga0105238_10398658 | 3300009551 | Bacteria | 1369 |
| 337 | Ga0105249_10094865 | 3300009553 | Bacteria | 2797 |
| 338 | Ga0105249_10623993 | 3300009553 | Bacteria | 1134 |
| 339 | Ga0099796_10022143 | 3300010159 | Bacteria | 1968 |
| 340 | Ga0099796_10031636 | 3300010159 | Bacteria | 1728 |
| 341 | Ga0105239_10023212 | 3300010375 | Bacteria | 6836 |
| 342 | Ga0105239_10053738 | 3300010375 | Bacteria | 4418 |
| 343 | Ga0105239_10070697 | 3300010375 | Bacteria | 3834 |
| 344 | Ga0105239_10079664 | 3300010375 | Bacteria | 3604 |
| 345 | Ga0105239_10414734 | 3300010375 | Bacteria | 1525 |
| 346 | Ga0105239_10438753 | 3300010375 | Bacteria | 1480 |
| 347 | Ga0105239_10641795 | 3300010375 | Bacteria | 1212 |
| 348 | Ga0105239_10768987 | 3300010375 | Bacteria | 1103 |
| 349 | Ga0105239_10854939 | 3300010375 | Bacteria | 1043 |
| 350 | Ga0105246_10012128 | 3300011119 | Bacteria | 5371 |
| 351 | Ga0105246_10274457 | 3300011119 | Bacteria | 1349 |
| 352 | Ga0157370_10101962 | 3300013104 | Bacteria | 2688 |
| 353 | Ga0157370_10294789 | 3300013104 | Bacteria | 1498 |
| 354 | Ga0157370_10690989 | 3300013104 | Bacteria | 931 |
| 355 | Ga0157369_10065365 | 3300013105 | Bacteria | 3914 |
| 356 | Ga0157369_10102930 | 3300013105 | Bacteria | 3041 |
| 357 | Ga0157374_10164515 | 3300013296 | Bacteria | 2162 |
| 358 | Ga0157374_10244750 | 3300013296 | Bacteria | 1764 |
| 359 | Ga0157378_10104776 | 3300013297 | Bacteria | 2586 |
| 360 | Ga0157378_10415140 | 3300013297 | Bacteria | 1329 |
| 361 | Ga0163162_10022106 | 3300013306 | Bacteria | 6268 |
| 362 | Ga0163162_10081453 | 3300013306 | Bacteria | 3307 |
| 363 | Ga0163162_10495094 | 3300013306 | Bacteria | 1353 |
| 364 | Ga0163162_10612411 | 3300013306 | Bacteria | 1214 |
| 365 | Ga0163162_10703340 | 3300013306 | Bacteria | 1132 |
| 366 | Ga0163162_10978071 | 3300013306 | Bacteria | 956 |
| 367 | Ga0163162_11290870 | 3300013306 | Unclassified | 829 |
| 368 | Ga0163162_11582452 | 3300013306 | Unclassified | 747 |
| 369 | Ga0157372_10376992 | 3300013307 | Bacteria | 1653 |
| 370 | Ga0157375_10064892 | 3300013308 | Bacteria | 3637 |
| 371 | Ga0157375_10084799 | 3300013308 | Bacteria | 3217 |
| 372 | Ga0157375_10249220 | 3300013308 | Bacteria | 1937 |
| 373 | Ga0157375_10456856 | 3300013308 | Bacteria | 1443 |
| 374 | Ga0157375_10651677 | 3300013308 | Bacteria | 1209 |
| 375 | Ga0163163_10036647 | 3300014325 | Bacteria | 4766 |
| 376 | Ga0163163_10155656 | 3300014325 | Bacteria | 2330 |
| 377 | Ga0163163_10284233 | 3300014325 | Bacteria | 1706 |
| 378 | Ga0163163_10349510 | 3300014325 | Bacteria | 1534 |
| 379 | Ga0163163_11203376 | 3300014325 | Bacteria | 820 |
| 380 | Ga0157380_10013506 | 3300014326 | Bacteria | 5957 |
| 381 | Ga0157380_10026474 | 3300014326 | Bacteria | 4403 |
| 382 | Ga0157380_10336024 | 3300014326 | Bacteria | 1407 |
| 383 | Ga0182008_10033738 | 3300014497 | Bacteria | 2568 |
| 384 | Ga0157379_10257216 | 3300014968 | Bacteria | 1586 |
| 385 | Ga0157379_10337907 | 3300014968 | Bacteria | 1377 |
| 386 | Ga0157379_10377598 | 3300014968 | Bacteria | 1300 |
| 387 | Ga0157376_10022095 | 3300014969 | Bacteria | 4952 |
| 388 | Ga0157376_10109705 | 3300014969 | Bacteria | 2426 |
| 389 | Ga0157376_10645124 | 3300014969 | Bacteria | 1059 |
| 390 | Ga0157376_10745147 | 3300014969 | Bacteria | 988 |
| 391 | Ga0206355_1084398 | 3300020076 | Bacteria | 1474 |
| 392 | Ga0206355_1509356 | 3300020076 | Bacteria | 1767 |
| 393 | Ga0206353_10301445 | 3300020082 | Bacteria | 786 |
| 394 | Ga0214544_1000163 | 3300021320 | Bacteria | 101631 |
| 395 | Ga0214542_1000156 | 3300021321 | Bacteria | 101631 |
| 396 | Ga0214545_1000078 | 3300021324 | Bacteria | 101631 |
| 397 | Ga0214543_1000136 | 3300021327 | Bacteria | 101629 |
| 398 | Ga0213873_10090504 | 3300021358 | Bacteria | 868 |
| 399 | Ga0213874_10204173 | 3300021377 | Unclassified | 712 |
| 400 | Ga0213876_10009304 | 3300021384 | Bacteria | 5292 |
| 401 | Ga0209563_108130 | 3300025230 | Bacteria | 1673 |
| 402 | Ga0207425_1014237 | 3300025245 | Bacteria | 1811 |
| 403 | Ga0209677_100831 | 3300025253 | Bacteria | 15382 |
| 404 | Ga0209677_107533 | 3300025253 | Bacteria | 2289 |
| 405 | Ga0209148_1000232 | 3300025254 | Bacteria | 90923 |
| 406 | Ga0209233_1001298 | 3300025261 | Bacteria | 9984 |
| 407 | Ga0209233_1005084 | 3300025261 | Bacteria | 4400 |
| 408 | Ga0209233_1007012 | 3300025261 | Bacteria | 3598 |
| 409 | Ga0209233_1015174 | 3300025261 | Bacteria | 2154 |
| 410 | Ga0209130_1034896 | 3300025284 | Bacteria | 1009 |
| 411 | Ga0209564_1013870 | 3300025295 | Bacteria | 3389 |
| 412 | Ga0209758_1000294 | 3300025297 | Bacteria | 98618 |
| 413 | Ga0209758_1000705 | 3300025297 | Bacteria | 49585 |
| 414 | Ga0209758_1000932 | 3300025297 | Bacteria | 39573 |
| 415 | Ga0209758_1000986 | 3300025297 | Bacteria | 38258 |
| 416 | Ga0209758_1001737 | 3300025297 | Bacteria | 24275 |
| 417 | Ga0209758_1002299 | 3300025297 | Bacteria | 19758 |
| 418 | Ga0209758_1003580 | 3300025297 | Bacteria | 13909 |
| 419 | Ga0209758_1046254 | 3300025297 | Bacteria | 1571 |
| 420 | Ga0209758_1071115 | 3300025297 | Bacteria | 1094 |
| 421 | Ga0209256_1008548 | 3300025299 | Bacteria | 4719 |
| 422 | Ga0207426_1000632 | 3300025302 | Bacteria | 44581 |
| 423 | Ga0207426_1001240 | 3300025302 | Bacteria | 22455 |
| 424 | Ga0207426_1006296 | 3300025302 | Bacteria | 5190 |
| 425 | Ga0207426_1020313 | 3300025302 | Bacteria | 2309 |
| 426 | Ga0209257_1001185 | 3300025304 | Bacteria | 32850 |
| 427 | Ga0209257_1042761 | 3300025304 | Bacteria | 1334 |
| 428 | Ga0207697_10016590 | 3300025315 | Bacteria | 3032 |
| 429 | Ga0207697_10017207 | 3300025315 | Bacteria | 2971 |
| 430 | Ga0207697_10065008 | 3300025315 | Bacteria | 1522 |
| 431 | Ga0207656_10099632 | 3300025321 | Bacteria | 1330 |
| 432 | Ga0207656_10208555 | 3300025321 | Bacteria | 946 |
| 433 | Ga0207682_10014469 | 3300025893 | Bacteria | 3074 |
| 434 | Ga0207682_10112858 | 3300025893 | Unclassified | 1198 |
| 435 | Ga0207692_10009126 | 3300025898 | Bacteria | 4129 |
| 436 | Ga0207692_10041740 | 3300025898 | Bacteria | 2273 |
| 437 | Ga0207692_10082610 | 3300025898 | Bacteria | 1722 |
| 438 | Ga0207692_10084679 | 3300025898 | Bacteria | 1704 |
| 439 | Ga0207692_10198845 | 3300025898 | Bacteria | 1177 |
| 440 | Ga0207642_10148028 | 3300025899 | Bacteria | 1246 |
| 441 | Ga0207710_10002730 | 3300025900 | Bacteria | 8088 |
| 442 | Ga0207710_10012543 | 3300025900 | Bacteria | 3567 |
| 443 | Ga0207710_10061895 | 3300025900 | Bacteria | 1699 |
| 444 | Ga0207710_10106267 | 3300025900 | Bacteria | 1329 |
| 445 | Ga0207688_10130259 | 3300025901 | Bacteria | 1474 |
| 446 | Ga0207688_10180981 | 3300025901 | Bacteria | 1257 |
| 447 | Ga0207647_10169161 | 3300025904 | Bacteria | 1273 |
| 448 | Ga0207647_10174003 | 3300025904 | Bacteria | 1253 |
| 449 | Ga0207699_10001069 | 3300025906 | Bacteria | 12945 |
| 450 | Ga0207699_10009102 | 3300025906 | Bacteria | 4930 |
| 451 | Ga0207699_10038117 | 3300025906 | Bacteria | 2752 |
| 452 | Ga0207699_10040581 | 3300025906 | Bacteria | 2682 |
| 453 | Ga0207699_10126389 | 3300025906 | Bacteria | 1661 |
| 454 | Ga0207699_10898627 | 3300025906 | Bacteria | 653 |
| 455 | Ga0207645_10080969 | 3300025907 | Bacteria | 2082 |
| 456 | Ga0207643_10073962 | 3300025908 | Bacteria | 1964 |
| 457 | Ga0207643_10164612 | 3300025908 | Bacteria | 1336 |
| 458 | Ga0207705_10081980 | 3300025909 | Bacteria | 2352 |
| 459 | Ga0207705_10345052 | 3300025909 | Bacteria | 1146 |
| 460 | Ga0207684_10255293 | 3300025910 | Bacteria | 1513 |
| 461 | Ga0207684_10653876 | 3300025910 | Bacteria | 895 |
| 462 | Ga0207684_10657426 | 3300025910 | Bacteria | 893 |
| 463 | Ga0207654_10017604 | 3300025911 | Bacteria | 3740 |
| 464 | Ga0207654_10271149 | 3300025911 | Bacteria | 1145 |
| 465 | Ga0207654_10338394 | 3300025911 | Bacteria | 1033 |
| 466 | Ga0207707_10001541 | 3300025912 | Bacteria | 21226 |
| 467 | Ga0207707_10002224 | 3300025912 | Bacteria | 17529 |
| 468 | Ga0207707_10006422 | 3300025912 | Bacteria | 10269 |
| 469 | Ga0207707_10027810 | 3300025912 | Bacteria | 4944 |
| 470 | Ga0207695_10000123 | 3300025913 | Bacteria | 232059 |
| 471 | Ga0207695_10046019 | 3300025913 | Bacteria | 4626 |
| 472 | Ga0207695_10088527 | 3300025913 | Bacteria | 3116 |
| 473 | Ga0207671_10009480 | 3300025914 | Bacteria | 8132 |
| 474 | Ga0207671_10064994 | 3300025914 | Bacteria | 2713 |
| 475 | Ga0207671_10134952 | 3300025914 | Bacteria | 1897 |
| 476 | Ga0207671_10180264 | 3300025914 | Bacteria | 1644 |
| 477 | Ga0207693_10000565 | 3300025915 | Bacteria | 33481 |
| 478 | Ga0207693_10003555 | 3300025915 | Bacteria | 13315 |
| 479 | Ga0207693_10018708 | 3300025915 | Bacteria | 5514 |
| 480 | Ga0207693_10021554 | 3300025915 | Bacteria | 5120 |
| 481 | Ga0207693_10076615 | 3300025915 | Bacteria | 2619 |
| 482 | Ga0207663_10000239 | 3300025916 | Bacteria | 24165 |
| 483 | Ga0207663_10012569 | 3300025916 | Bacteria | 4581 |
| 484 | Ga0207663_10032661 | 3300025916 | Bacteria | 3092 |
| 485 | Ga0207663_10171622 | 3300025916 | Bacteria | 1541 |
| 486 | Ga0207660_10010206 | 3300025917 | Bacteria | 6087 |
| 487 | Ga0207660_10517616 | 3300025917 | Bacteria | 969 |
| 488 | Ga0207660_10844845 | 3300025917 | Bacteria | 747 |
| 489 | Ga0207662_10122924 | 3300025918 | Bacteria | 1629 |
| 490 | Ga0207662_10162091 | 3300025918 | Bacteria | 1429 |
| 491 | Ga0207657_10005246 | 3300025919 | Bacteria | 13576 |
| 492 | Ga0207657_10044766 | 3300025919 | Bacteria | 3889 |
| 493 | Ga0207649_10108673 | 3300025920 | Bacteria | 1849 |
| 494 | Ga0207649_10149858 | 3300025920 | Bacteria | 1605 |
| 495 | Ga0207649_10490386 | 3300025920 | Bacteria | 933 |
| 496 | Ga0207652_10004348 | 3300025921 | Bacteria | 11546 |
| 497 | Ga0207652_10087224 | 3300025921 | Bacteria | 2737 |
| 498 | Ga0207652_10105233 | 3300025921 | Bacteria | 2497 |
| 499 | Ga0207652_10141692 | 3300025921 | Bacteria | 2150 |
| 500 | Ga0207652_10205046 | 3300025921 | Bacteria | 1775 |
| 501 | Ga0207681_10068564 | 3300025923 | Bacteria | 2464 |
| 502 | Ga0207681_10147608 | 3300025923 | Bacteria | 1759 |
| 503 | Ga0207694_10075578 | 3300025924 | Bacteria | 2637 |
| 504 | Ga0207694_10104378 | 3300025924 | Bacteria | 2249 |
| 505 | Ga0207694_10140214 | 3300025924 | Bacteria | 1944 |
| 506 | Ga0207694_10192758 | 3300025924 | Bacteria | 1656 |
| 507 | Ga0207694_10379800 | 3300025924 | Bacteria | 1173 |
| 508 | Ga0207650_10119131 | 3300025925 | Bacteria | 2053 |
| 509 | Ga0207659_10033122 | 3300025926 | Bacteria | 3553 |
| 510 | Ga0207687_10002549 | 3300025927 | Bacteria | 12372 |
| 511 | Ga0207687_10030484 | 3300025927 | Bacteria | 3637 |
| 512 | Ga0207700_10020496 | 3300025928 | Bacteria | 4493 |
| 513 | Ga0207700_10109510 | 3300025928 | Bacteria | 2220 |
| 514 | Ga0207700_10136981 | 3300025928 | Bacteria | 2007 |
| 515 | Ga0207700_10144687 | 3300025928 | Bacteria | 1958 |
| 516 | Ga0207700_10222775 | 3300025928 | Bacteria | 1600 |
| 517 | Ga0207700_10563904 | 3300025928 | Bacteria | 1012 |
| 518 | Ga0207664_10008257 | 3300025929 | Bacteria | 7252 |
| 519 | Ga0207664_10022863 | 3300025929 | Bacteria | 4676 |
| 520 | Ga0207664_10914425 | 3300025929 | Bacteria | 788 |
| 521 | Ga0207644_10055831 | 3300025931 | Bacteria | 2848 |
| 522 | Ga0207644_10127632 | 3300025931 | Bacteria | 1943 |
| 523 | Ga0207644_10301959 | 3300025931 | Bacteria | 1290 |
| 524 | Ga0207644_10606968 | 3300025931 | Bacteria | 909 |
| 525 | Ga0207690_10102385 | 3300025932 | Bacteria | 2047 |
| 526 | Ga0207690_10607343 | 3300025932 | Bacteria | 893 |
| 527 | Ga0207706_10063554 | 3300025933 | Bacteria | 3250 |
| 528 | Ga0207706_10103304 | 3300025933 | Bacteria | 2507 |
| 529 | Ga0207706_10116866 | 3300025933 | Bacteria | 2346 |
| 530 | Ga0207706_10129804 | 3300025933 | Bacteria | 2217 |
| 531 | Ga0207706_10158950 | 3300025933 | Bacteria | 1987 |
| 532 | Ga0207706_10725673 | 3300025933 | Bacteria | 848 |
| 533 | Ga0207709_10006190 | 3300025935 | Bacteria | 6736 |
| 534 | Ga0207709_10176383 | 3300025935 | Bacteria | 1505 |
| 535 | Ga0207709_10177153 | 3300025935 | Bacteria | 1502 |
| 536 | Ga0207670_10002928 | 3300025936 | Bacteria | 9025 |
| 537 | Ga0207669_10068965 | 3300025937 | Bacteria | 2211 |
| 538 | Ga0207669_10540936 | 3300025937 | Bacteria | 938 |
| 539 | Ga0207704_10006693 | 3300025938 | Bacteria | 5397 |
| 540 | Ga0207704_10188160 | 3300025938 | Bacteria | 1499 |
| 541 | Ga0207704_10286864 | 3300025938 | Bacteria | 1254 |
| 542 | Ga0207704_10632492 | 3300025938 | Bacteria | 880 |
| 543 | Ga0207665_10000127 | 3300025939 | Bacteria | 50413 |
| 544 | Ga0207665_10054670 | 3300025939 | Bacteria | 2692 |
| 545 | Ga0207665_10100748 | 3300025939 | Bacteria | 2016 |
| 546 | Ga0207665_10536614 | 3300025939 | Bacteria | 908 |
| 547 | Ga0207691_10083986 | 3300025940 | Bacteria | 2859 |
| 548 | Ga0207691_10113799 | 3300025940 | Bacteria | 2404 |
| 549 | Ga0207691_10159553 | 3300025940 | Bacteria | 1979 |
| 550 | Ga0207711_10101876 | 3300025941 | Bacteria | 2541 |
| 551 | Ga0207711_10321222 | 3300025941 | Bacteria | 1431 |
| 552 | Ga0207711_10844031 | 3300025941 | Bacteria | 852 |
| 553 | Ga0207689_10087744 | 3300025942 | Bacteria | 2555 |
| 554 | Ga0207689_10986595 | 3300025942 | Bacteria | 711 |
| 555 | Ga0207661_10082267 | 3300025944 | Bacteria | 2662 |
| 556 | Ga0207661_10184630 | 3300025944 | Bacteria | 1824 |
| 557 | Ga0207661_10903237 | 3300025944 | Bacteria | 813 |
| 558 | Ga0207679_10092963 | 3300025945 | Bacteria | 2338 |
| 559 | Ga0207679_10375274 | 3300025945 | Bacteria | 1245 |
| 560 | Ga0207679_10572341 | 3300025945 | Bacteria | 1015 |
| 561 | Ga0207667_10012980 | 3300025949 | Bacteria | 9561 |
| 562 | Ga0207667_10115171 | 3300025949 | Bacteria | 2771 |
| 563 | Ga0207667_10258297 | 3300025949 | Bacteria | 1782 |
| 564 | Ga0207667_10534465 | 3300025949 | Bacteria | 1187 |
| 565 | Ga0207651_10087185 | 3300025960 | Bacteria | 2271 |
| 566 | Ga0207712_10161210 | 3300025961 | Bacteria | 1743 |
| 567 | Ga0207668_10005581 | 3300025972 | Bacteria | 7417 |
| 568 | Ga0207668_10032114 | 3300025972 | Bacteria | 3465 |
| 569 | Ga0207668_10033457 | 3300025972 | Bacteria | 3405 |
| 570 | Ga0207668_10079730 | 3300025972 | Bacteria | 2369 |
| 571 | Ga0207668_10309695 | 3300025972 | Bacteria | 1306 |
| 572 | Ga0207668_10328109 | 3300025972 | Bacteria | 1272 |
| 573 | Ga0207640_10117722 | 3300025981 | Bacteria | 1897 |
| 574 | Ga0207640_10787973 | 3300025981 | Bacteria | 822 |
| 575 | Ga0207640_10832686 | 3300025981 | Bacteria | 802 |
| 576 | Ga0207658_10120481 | 3300025986 | Bacteria | 2091 |
| 577 | Ga0207677_10006044 | 3300026023 | Bacteria | 6604 |
| 578 | Ga0207677_10108914 | 3300026023 | Bacteria | 2058 |
| 579 | Ga0207677_10205363 | 3300026023 | Bacteria | 1569 |
| 580 | Ga0207677_10619679 | 3300026023 | Bacteria | 951 |
| 581 | Ga0207677_10666990 | 3300026023 | Bacteria | 919 |
| 582 | Ga0207703_10032293 | 3300026035 | Bacteria | 4143 |
| 583 | Ga0207703_10091507 | 3300026035 | Bacteria | 2559 |
| 584 | Ga0207703_10186517 | 3300026035 | Bacteria | 1834 |
| 585 | Ga0207703_10515260 | 3300026035 | Bacteria | 1124 |
| 586 | Ga0207639_10453797 | 3300026041 | Bacteria | 1164 |
| 587 | Ga0207639_10668976 | 3300026041 | Bacteria | 961 |
| 588 | Ga0207678_10021488 | 3300026067 | Bacteria | 5659 |
| 589 | Ga0207678_10022823 | 3300026067 | Bacteria | 5479 |
| 590 | Ga0207678_10027315 | 3300026067 | Bacteria | 4977 |
| 591 | Ga0207678_10048901 | 3300026067 | Bacteria | 3654 |
| 592 | Ga0207678_10062786 | 3300026067 | Bacteria | 3193 |
| 593 | Ga0207678_10080882 | 3300026067 | Bacteria | 2781 |
| 594 | Ga0207678_10410125 | 3300026067 | Bacteria | 1174 |
| 595 | Ga0207678_10658819 | 3300026067 | Bacteria | 920 |
| 596 | Ga0207708_10020931 | 3300026075 | Bacteria | 4935 |
| 597 | Ga0207708_10441622 | 3300026075 | Bacteria | 1082 |
| 598 | Ga0207702_10139751 | 3300026078 | Bacteria | 2190 |
| 599 | Ga0207702_10355046 | 3300026078 | Bacteria | 1404 |
| 600 | Ga0207641_10123517 | 3300026088 | Bacteria | 2314 |
| 601 | Ga0207641_10246229 | 3300026088 | Bacteria | 1668 |
| 602 | Ga0207641_10425599 | 3300026088 | Bacteria | 1279 |
| 603 | Ga0207641_10720324 | 3300026088 | Bacteria | 983 |
| 604 | Ga0207648_10046915 | 3300026089 | Bacteria | 3787 |
| 605 | Ga0207648_10062588 | 3300026089 | Bacteria | 3244 |
| 606 | Ga0207648_10304250 | 3300026089 | Bacteria | 1430 |
| 607 | Ga0207676_10564756 | 3300026095 | Bacteria | 1089 |
| 608 | Ga0207674_10033992 | 3300026116 | Bacteria | 5333 |
| 609 | Ga0207674_10094104 | 3300026116 | Bacteria | 2983 |
| 610 | Ga0207675_100104527 | 3300026118 | Bacteria | 2669 |
| 611 | Ga0207675_100836193 | 3300026118 | Bacteria | 935 |
| 612 | Ga0207683_10051919 | 3300026121 | Bacteria | 3592 |
| 613 | Ga0207683_10056530 | 3300026121 | Bacteria | 3442 |
| 614 | Ga0207683_10063916 | 3300026121 | Bacteria | 3242 |
| 615 | Ga0207683_10089743 | 3300026121 | Bacteria | 2736 |
| 616 | Ga0207683_10103355 | 3300026121 | Bacteria | 2545 |
| 617 | Ga0207683_10106915 | 3300026121 | Bacteria | 2502 |
| 618 | Ga0207683_10135139 | 3300026121 | Bacteria | 2220 |
| 619 | Ga0207683_10176198 | 3300026121 | Bacteria | 1938 |
| 620 | Ga0207698_10031006 | 3300026142 | Bacteria | 3854 |
| 621 | Ga0207698_10087412 | 3300026142 | Bacteria | 2539 |
| 622 | Ga0207698_10096641 | 3300026142 | Bacteria | 2435 |
| 623 | Ga0207698_10276347 | 3300026142 | Bacteria | 1551 |
| 624 | Ga0209389_1000019 | 3300027296 | Bacteria | 172067 |
| 625 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 626 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 627 | Ga0209489_100033 | 3300027361 | Bacteria | 172166 |
| 628 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 629 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 630 | Ga0209179_1058177 | 3300027512 | Bacteria | 837 |
| 631 | Ga0209588_1030111 | 3300027671 | Bacteria | 1733 |
| 632 | Ga0209813_10022047 | 3300027866 | Bacteria | 1797 |
| 633 | Ga0268266_10012217 | 3300028379 | Bacteria | 7429 |
| 634 | Ga0268266_10013853 | 3300028379 | Bacteria | 6942 |
| 635 | Ga0268266_10077802 | 3300028379 | Bacteria | 2885 |
| 636 | Ga0268266_10112988 | 3300028379 | Bacteria | 2408 |
| 637 | Ga0268266_10297770 | 3300028379 | Bacteria | 1504 |
| 638 | Ga0268266_10453774 | 3300028379 | Bacteria | 1219 |
| 639 | Ga0268265_10022554 | 3300028380 | Bacteria | 4425 |
| 640 | Ga0268265_10078528 | 3300028380 | Bacteria | 2596 |
| 641 | Ga0268265_10079812 | 3300028380 | Bacteria | 2578 |
| 642 | Ga0268265_10109386 | 3300028380 | Bacteria | 2252 |
| 643 | Ga0268265_10308031 | 3300028380 | Bacteria | 1429 |
| 644 | Ga0268264_10000174 | 3300028381 | Bacteria | 137254 |
| 645 | Ga0268264_10158236 | 3300028381 | Bacteria | 2038 |
| 646 | Ga0268264_10216954 | 3300028381 | Bacteria | 1759 |
| 647 | Ga0307517_10000859 | 3300028786 | Bacteria | 51881 |
| 648 | Ga0307517_10288563 | 3300028786 | Bacteria | 929 |
| 649 | Ga0307515_10028873 | 3300028794 | Bacteria | 9406 |
| 650 | Ga0307511_10032093 | 3300030521 | Bacteria | 4676 |
| 651 | Ga0265330_10092265 | 3300031235 | Bacteria | 1299 |
| 652 | Ga0265332_10006382 | 3300031238 | Bacteria | 5348 |
| 653 | Ga0265328_10107651 | 3300031239 | Bacteria | 1035 |
| 654 | Ga0265325_10006821 | 3300031241 | Bacteria | 6903 |
| 655 | Ga0265340_10009308 | 3300031247 | Bacteria | 5276 |
| 656 | Ga0265340_10018122 | 3300031247 | Bacteria | 3635 |
| 657 | Ga0265339_10011032 | 3300031249 | Bacteria | 5585 |
| 658 | Ga0265339_10012299 | 3300031249 | Bacteria | 5228 |
| 659 | Ga0265339_10147971 | 3300031249 | Bacteria | 1190 |
| 660 | Ga0265331_10115078 | 3300031250 | Bacteria | 1232 |
| 661 | Ga0265316_10297584 | 3300031344 | Bacteria | 1176 |
| 662 | Ga0307513_10190067 | 3300031456 | Bacteria | 1906 |
| 663 | Ga0307509_10006398 | 3300031507 | Bacteria | 15864 |
| 664 | Ga0307509_10082116 | 3300031507 | Bacteria | 3325 |
| 665 | Ga0307509_10287407 | 3300031507 | Bacteria | 1401 |
| 666 | Ga0307508_10000063 | 3300031616 | Bacteria | 122536 |
| 667 | Ga0307508_10175353 | 3300031616 | Bacteria | 1747 |
| 668 | Ga0307508_10276764 | 3300031616 | Bacteria | 1272 |
| 669 | Ga0265342_10005406 | 3300031712 | Bacteria | 9751 |
| 670 | Ga0265342_10414484 | 3300031712 | Bacteria | 694 |
| 671 | Ga0307516_10043872 | 3300031730 | Bacteria | 4428 |
| 672 | Ga0307516_10059646 | 3300031730 | Bacteria | 3710 |
| 673 | Ga0307516_10233028 | 3300031730 | Bacteria | 1544 |
| 674 | Ga0307405_10022939 | 3300031731 | Bacteria | 3538 |
| 675 | Ga0307405_10421766 | 3300031731 | Bacteria | 1050 |
| 676 | Ga0307413_10038231 | 3300031824 | Bacteria | 2780 |
| 677 | Ga0307407_10285421 | 3300031903 | Bacteria | 1145 |
| 678 | Ga0307412_10222845 | 3300031911 | Bacteria | 1447 |
| 679 | Ga0307416_100339157 | 3300032002 | Bacteria | 1515 |
| 680 | Ga0307416_100557320 | 3300032002 | Bacteria | 1220 |
| 681 | Ga0307411_10215983 | 3300032005 | Bacteria | 1484 |
| 682 | Ga0307411_10376020 | 3300032005 | Bacteria | 1167 |
| 683 | Ga0307415_100027815 | 3300032126 | Bacteria | 3588 |
| 684 | Ga0307415_100222388 | 3300032126 | Bacteria | 1514 |
| 685 | Ga0307510_10019115 | 3300033180 | Bacteria | 8037 |
| 686 | Ga0307510_10059498 | 3300033180 | Bacteria | 3944 |
| 687 | Ga0307510_10126787 | 3300033180 | Bacteria | 2239 |
| 688 | Ga0315911_1000040 | 3300033442 | Bacteria | 50766 |
| 689 | Ga0316215_1000931 | 3300033544 | Bacteria | 2860 |
| 690 | Ga0373930_0008599 | 3300034816 | Bacteria | 1788 |
| 691 | Ga0373938_0003270 | 3300034957 | Bacteria | 2645 |
| 692 | Ga0373926_0011522 | 3300035083 | Bacteria | 2976 |
| 693 | Ga0373926_0052120 | 3300035083 | Bacteria | 1478 |
| 694 | Ga0373928_0017581 | 3300035084 | Bacteria | 1473 |
| 695 | Ga0373929_0007992 | 3300035085 | Bacteria | 1945 |
| 696 | Ga0373929_0015014 | 3300035085 | Bacteria | 1502 |
| 697 | Ga0373951_0035524 | 3300035091 | Bacteria | 1187 |
| 698 | Ga0373952_0112859 | 3300035092 | Bacteria | 729 |
| 699 | Ga0373923_0021124 | 3300035111 | Bacteria | 2538 |
| 700 | Ga0373923_0027670 | 3300035111 | Bacteria | 2263 |
| 701 | Ga0373936_0006062 | 3300035113 | Bacteria | 4555 |
| 702 | Ga0373939_0135250 | 3300035114 | Unclassified | 884 |
| 703 | Ga0373941_0022812 | 3300035115 | Bacteria | 1781 |
| 704 | Ga0373945_0007291 | 3300035116 | Bacteria | 3581 |
| 705 | Ga0373945_0039567 | 3300035116 | Bacteria | 1700 |
| 706 | Ga0373953_0022125 | 3300035117 | Bacteria | 2394 |
| 707 | Ga0373953_0055061 | 3300035117 | Bacteria | 1614 |
| 708 | Ga0373954_0015754 | 3300035118 | Bacteria | 3381 |
| 709 | Ga0373954_0031320 | 3300035118 | Bacteria | 2455 |
| 710 | Ga0373956_0070077 | 3300035119 | Bacteria | 1599 |
| 711 | Ga0373957_0057628 | 3300035120 | Bacteria | 1499 |
| 712 | Ga0373957_0058267 | 3300035120 | Bacteria | 1492 |
| 713 | Ga0373957_0076748 | 3300035120 | Bacteria | 1314 |
| 714 | Ga0373960_0008005 | 3300035121 | Bacteria | 2520 |
| 715 | Ga0373960_0070311 | 3300035121 | Bacteria | 1081 |
| 716 | Ga0373943_0028008 | 3300035170 | Bacteria | 2652 |
| 717 | Ga0373943_0110788 | 3300035170 | Bacteria | 1448 |
| 718 | Ga0373943_0281472 | 3300035170 | Bacteria | 940 |
| 719 | Ga0373946_0129564 | 3300035171 | Bacteria | 1159 |
| 720 | Ga0373946_0208450 | 3300035171 | Bacteria | 939 |
| 721 | Ga0373946_0328742 | 3300035171 | Bacteria | 761 |
| 722 | Ga0373955_0110530 | 3300035172 | Unclassified | 1589 |
| 723 | Ga0373955_0284163 | 3300035172 | Bacteria | 996 |
| 724 | Ga0373942_0001205 | 3300035207 | Bacteria | 6822 |
| 725 | Ga0373942_0014236 | 3300035207 | Bacteria | 1923 |
| 726 | Ga0373961_0028713 | 3300035241 | Bacteria | 1535 |
| 727 | Ga0373961_0041343 | 3300035241 | Bacteria | 1332 |
| 728 | Ga0373962_0055943 | 3300035242 | Bacteria | 1147 |
| 729 | Ga0373924_0056280 | 3300035410 | Bacteria | 1638 |
| 730 | Ga0373924_0062915 | 3300035410 | Bacteria | 1555 |
| 731 | Ga0373924_0064892 | 3300035410 | Bacteria | 1533 |
| 732 | Ga0373931_0006487 | 3300035691 | Bacteria | 5467 |
| 733 | Ga0373935_0000942 | 3300035692 | Bacteria | 15748 |
| 734 | Ga0373935_0087971 | 3300035692 | Bacteria | 2029 |
| 735 | Ga0373935_0121844 | 3300035692 | Bacteria | 1743 |
| 736 | Ga0373935_0861206 | 3300035692 | Bacteria | 670 |
| 737 | Ga0373927_0000528 | 3300035695 | Bacteria | 29016 |
| 738 | Ga0373927_0047023 | 3300035695 | Bacteria | 2791 |
| 739 | Ga0373927_0054719 | 3300035695 | Bacteria | 2581 |
| 740 | Ga0373933_0000204 | 3300035724 | Bacteria | 39417 |
| 741 | Ga0373933_0085272 | 3300035724 | Bacteria | 1942 |
| 742 | Ga0373933_0155861 | 3300035724 | Bacteria | 1448 |
| 743 | Ga0373947_0000455 | 3300035725 | Bacteria | 23308 |
| 744 | Ga0373947_0008198 | 3300035725 | Bacteria | 6025 |
| 745 | Ga0373947_0039442 | 3300035725 | Bacteria | 2810 |
| 746 | Ga0373947_0078436 | 3300035725 | Bacteria | 2039 |
| 747 | Ga0373947_0141195 | 3300035725 | Bacteria | 1545 |
| 748 | Ga0373947_0178048 | 3300035725 | Bacteria | 1383 |
| 749 | Ga0373947_0227386 | 3300035725 | Bacteria | 1228 |
| 750 | Ga0373947_0530890 | 3300035725 | Bacteria | 800 |
| 751 | Ga0373937_0004613 | 3300036401 | Bacteria | 11701 |
| 752 | Ga0373937_0005769 | 3300036401 | Bacteria | 10643 |
| 753 | Ga0373937_0043618 | 3300036401 | Bacteria | 4095 |
| 754 | Ga0373937_0185926 | 3300036401 | Bacteria | 1951 |
| 755 | Ga0373937_0368725 | 3300036401 | Bacteria | 1361 |
| 756 | Ga0373937_0468570 | 3300036401 | Bacteria | 1196 |
| 757 | Ga0310112_012733 | 3300036458 | Bacteria | 1200 |
| 758 | Ga0372808_001169 | 3300036459 | Bacteria | 2608 |
| 759 | Ga0310109_012364 | 3300036534 | Bacteria | 1155 |
| 760 | Ga0373925_0003563 | 3300037068 | Bacteria | 12000 |
| 761 | Ga0373925_0011034 | 3300037068 | Bacteria | 6561 |
| 762 | Ga0373925_0041327 | 3300037068 | Bacteria | 3418 |
| 763 | Ga0373925_0081325 | 3300037068 | Bacteria | 2463 |
| 764 | Ga0373925_0104455 | 3300037068 | Bacteria | 2182 |
| 765 | Ga0373925_0120167 | 3300037068 | Bacteria | 2039 |
| 766 | Ga0373925_0230246 | 3300037068 | Bacteria | 1481 |
| 767 | Ga0373925_0400183 | 3300037068 | Bacteria | 1120 |
| 768 | Ga0395899_0603293 | 3300037312 | Bacteria | 699 |
| 769 | Ga0395900_0033975 | 3300037418 | Bacteria | 5249 |
| 770 | Ga0395900_0353858 | 3300037418 | Bacteria | 1442 |
| 771 | Ga0395898_0008444 | 3300037466 | Bacteria | 10888 |
| 772 | Ga0395898_0228638 | 3300037466 | Bacteria | 1774 |
| 773 | Ga0395898_0319214 | 3300037466 | Bacteria | 1482 |
| 774 | Ga0395898_0827851 | 3300037466 | Bacteria | 865 |
| 775 | Ga0395905_0026848 | 3300037471 | Bacteria | 5431 |
| 776 | Ga0395905_0077529 | 3300037471 | Bacteria | 3114 |
| 777 | Ga0436364_0426854 | 3300037853 | Bacteria | 1599 |
| 778 | Ga0395901_0067053 | 3300038443 | Bacteria | 3738 |
| 779 | Ga0395901_0137764 | 3300038443 | Bacteria | 2565 |
| 780 | Ga0436365_0551653 | 3300039437 | Bacteria | 809 |
| 781 | Ga0436365_0575320 | 3300039437 | Bacteria | 4814 |
| 782 | Ga0436363_0319535 | 3300039450 | Unclassified | 756 |
| 783 | Ga0436363_0804071 | 3300039450 | Bacteria | 2022 |
| 784 | Ga0436363_1060587 | 3300039450 | Bacteria | 6258 |
| 785 | Ga0436363_1326108 | 3300039450 | Bacteria | 1877 |
| 786 | Ga0436362_0343532 | 3300039453 | Bacteria | 2725 |
| 787 | Ga0439453_0038544 | 3300041408 | Bacteria | 930 |
| 788 | Ga0439466_0203574 | 3300041411 | Bacteria | 602 |
| 789 | Ga0451789_1318524 | 3300041443 | Bacteria | 1286 |
| 790 | Ga0451793_1573139 | 3300041452 | Bacteria | 1022 |
| 791 | Ga0451797_0456458 | 3300041453 | Bacteria | 1402 |
| 792 | Ga0451795_0000815 | 3300041456 | Bacteria | 1911 |
| 793 | Ga0451800_0669687 | 3300041459 | Bacteria | 1697 |
| 794 | Ga0451802_0603457 | 3300041460 | Bacteria | 1092 |
| 795 | Ga0451835_0501209 | 3300041492 | Bacteria | 1531 |
| 796 | Ga0451837_0151391 | 3300041494 | Bacteria | 959 |
| 797 | Ga0451845_0894429 | 3300041501 | Bacteria | 1288 |
| 798 | Ga0451851_0779149 | 3300041507 | Bacteria | 917 |
| 799 | Ga0451843_1260463 | 3300041509 | Bacteria | 790 |
| 800 | Ga0451853_2500835 | 3300041512 | Bacteria | 1013 |
| 801 | Ga0439456_035600 | 3300042013 | Bacteria | 1073 |
| 802 | Ga0439459_0067665 | 3300042438 | Bacteria | 820 |
| 803 | Ga0466972_0019831 | 3300044658 | Bacteria | 3362 |
| 804 | Ga0466966_0138961 | 3300044684 | Bacteria | 1485 |
| 805 | Ga0466963_0029700 | 3300044694 | Bacteria | 3521 |
| 806 | Ga0466971_0084464 | 3300044719 | Bacteria | 1450 |
| 807 | Ga0466968_0032806 | 3300044735 | Bacteria | 2161 |
| 808 | Ga0466957_0205718 | 3300044842 | Bacteria | 1294 |
| 809 | Ga0466960_0278623 | 3300044901 | Bacteria | 936 |
| 810 | Ga0466967_0213851 | 3300045976 | Bacteria | 1829 |
| 811 | Ga0466967_0529719 | 3300045976 | Bacteria | 1158 |
| 812 | Ga0495617_058096 | 3300046452 | Bacteria | 1282 |
| 813 | Ga0495592_0032569 | 3300046454 | Bacteria | 3932 |
| 814 | Ga0495592_0178233 | 3300046454 | Bacteria | 1449 |
| 815 | Ga0495603_0000239 | 3300046455 | Bacteria | 28578 |
| 816 | Ga0495603_0015374 | 3300046455 | Bacteria | 4631 |
| 817 | Ga0495603_0016923 | 3300046455 | Bacteria | 4412 |
| 818 | Ga0495603_0031556 | 3300046455 | Bacteria | 3190 |
| 819 | Ga0495603_0058945 | 3300046455 | Bacteria | 2269 |
| 820 | Ga0495603_0190044 | 3300046455 | Bacteria | 1187 |
| 821 | Ga0495603_0295826 | 3300046455 | Bacteria | 930 |
| 822 | Ga0495603_0560711 | 3300046455 | Bacteria | 654 |
| 823 | Ga0495590_0093377 | 3300046457 | Bacteria | 1065 |
| 824 | Ga0495590_0242304 | 3300046457 | Bacteria | 669 |
| 825 | Ga0495629_0000457 | 3300046459 | Bacteria | 34088 |
| 826 | Ga0495629_0139862 | 3300046459 | Bacteria | 1685 |
| 827 | Ga0495629_0288904 | 3300046459 | Bacteria | 1124 |
| 828 | Ga0495638_0076101 | 3300046460 | Bacteria | 2045 |
| 829 | Ga0495641_0002157 | 3300046461 | Bacteria | 15774 |
| 830 | Ga0495641_0112289 | 3300046461 | Bacteria | 1216 |
| 831 | Ga0495651_0001839 | 3300046462 | Bacteria | 16395 |
| 832 | Ga0495651_0017171 | 3300046462 | Bacteria | 5607 |
| 833 | Ga0495651_0037984 | 3300046462 | Bacteria | 3749 |
| 834 | Ga0495651_0133314 | 3300046462 | Bacteria | 1811 |
| 835 | Ga0495653_0114429 | 3300046463 | Bacteria | 1933 |
| 836 | Ga0495653_0155003 | 3300046463 | Bacteria | 1596 |
| 837 | Ga0495653_0256511 | 3300046463 | Bacteria | 1158 |
| 838 | Ga0495580_0002960 | 3300046472 | Bacteria | 14585 |
| 839 | Ga0495580_0009091 | 3300046472 | Bacteria | 7837 |
| 840 | Ga0495580_0162117 | 3300046472 | Bacteria | 1547 |
| 841 | Ga0495580_0377485 | 3300046472 | Bacteria | 958 |
| 842 | Ga0495580_0418271 | 3300046472 | Bacteria | 902 |
| 843 | Ga0495582_0000077 | 3300046473 | Bacteria | 49112 |
| 844 | Ga0495582_0008126 | 3300046473 | Bacteria | 5794 |
| 845 | Ga0495605_0072849 | 3300046474 | Bacteria | 1619 |
| 846 | Ga0495605_0240434 | 3300046474 | Bacteria | 777 |
| 847 | Ga0495639_0000101 | 3300046475 | Bacteria | 42348 |
| 848 | Ga0495639_0077209 | 3300046475 | Bacteria | 1546 |
| 849 | Ga0495662_0012510 | 3300046476 | Bacteria | 4140 |
| 850 | Ga0495664_0041464 | 3300046477 | Bacteria | 2724 |
| 851 | Ga0495664_0044789 | 3300046477 | Bacteria | 2622 |
| 852 | Ga0495664_0057942 | 3300046477 | Bacteria | 2305 |
| 853 | Ga0495664_0091013 | 3300046477 | Bacteria | 1834 |
| 854 | Ga0495664_0156103 | 3300046477 | Bacteria | 1384 |
| 855 | Ga0495584_0151207 | 3300046491 | Bacteria | 1179 |
| 856 | Ga0495584_0159063 | 3300046491 | Bacteria | 1148 |
| 857 | Ga0495584_0341558 | 3300046491 | Bacteria | 760 |
| 858 | Ga0495594_0000083 | 3300046499 | Bacteria | 42703 |
| 859 | Ga0495583_0153046 | 3300046506 | Bacteria | 955 |
| 860 | Ga0495606_0000357 | 3300046507 | Bacteria | 78015 |
| 861 | Ga0495606_0014109 | 3300046507 | Bacteria | 6257 |
| 862 | Ga0495606_0061389 | 3300046507 | Bacteria | 2404 |
| 863 | Ga0495608_0026963 | 3300046511 | Bacteria | 3913 |
| 864 | Ga0495608_0061364 | 3300046511 | Bacteria | 2472 |
| 865 | Ga0495608_0319874 | 3300046511 | Bacteria | 959 |
| 866 | Ga0495610_0165889 | 3300046512 | Bacteria | 930 |
| 867 | Ga0495618_0014258 | 3300046514 | Bacteria | 4840 |
| 868 | Ga0495618_0089816 | 3300046514 | Bacteria | 1965 |
| 869 | Ga0495628_0026676 | 3300046516 | Bacteria | 4706 |
| 870 | Ga0495628_0105477 | 3300046516 | Bacteria | 2171 |
| 871 | Ga0495628_0456940 | 3300046516 | Bacteria | 927 |
| 872 | Ga0495630_0012819 | 3300046517 | Bacteria | 6092 |
| 873 | Ga0495630_0336632 | 3300046517 | Bacteria | 1154 |
| 874 | Ga0495631_0148688 | 3300046518 | Bacteria | 1005 |
| 875 | Ga0495632_0103428 | 3300046519 | Bacteria | 1341 |
| 876 | Ga0495637_0146081 | 3300046520 | Bacteria | 895 |
| 877 | Ga0495643_0075302 | 3300046522 | Bacteria | 1766 |
| 878 | Ga0495643_0090766 | 3300046522 | Bacteria | 1576 |
| 879 | Ga0495644_0067688 | 3300046523 | Bacteria | 1342 |
| 880 | Ga0495648_0007226 | 3300046524 | Bacteria | 8920 |
| 881 | Ga0495648_0061450 | 3300046524 | Bacteria | 2231 |
| 882 | Ga0495648_0110741 | 3300046524 | Bacteria | 1495 |
| 883 | Ga0495666_0127088 | 3300046526 | Bacteria | 1192 |
| 884 | Ga0495666_0328858 | 3300046526 | Bacteria | 690 |
| 885 | Ga0495642_0070438 | 3300046528 | Bacteria | 1462 |
| 886 | Ga0495652_0011343 | 3300046529 | Bacteria | 8059 |
| 887 | Ga0495652_0021917 | 3300046529 | Bacteria | 5680 |
| 888 | Ga0495652_0070477 | 3300046529 | Bacteria | 2921 |
| 889 | Ga0495652_0094100 | 3300046529 | Bacteria | 2445 |
| 890 | Ga0495652_0213876 | 3300046529 | Bacteria | 1453 |
| 891 | Ga0495665_0000055 | 3300046531 | Bacteria | 45208 |
| 892 | Ga0495665_0103441 | 3300046531 | Bacteria | 1494 |
| 893 | Ga0495640_0024673 | 3300046533 | Bacteria | 4371 |
| 894 | Ga0495640_0046767 | 3300046533 | Bacteria | 2996 |
| 895 | Ga0495640_0049091 | 3300046533 | Bacteria | 2912 |
| 896 | Ga0495586_0046428 | 3300046535 | Bacteria | 2342 |
| 897 | Ga0495586_0138473 | 3300046535 | Bacteria | 1365 |
| 898 | Ga0495587_0005897 | 3300046536 | Bacteria | 7984 |
| 899 | Ga0495587_0023897 | 3300046536 | Bacteria | 3752 |
| 900 | Ga0495609_0101773 | 3300046538 | Bacteria | 1244 |
| 901 | Ga0495597_0110448 | 3300046542 | Bacteria | 1153 |
| 902 | Ga0495645_0005611 | 3300046543 | Bacteria | 8631 |
| 903 | Ga0495645_0115470 | 3300046543 | Bacteria | 1896 |
| 904 | Ga0495622_0002233 | 3300046557 | Bacteria | 9422 |
| 905 | Ga0495622_0033493 | 3300046557 | Bacteria | 2397 |
| 906 | Ga0495622_0166799 | 3300046557 | Bacteria | 991 |
| 907 | Ga0495633_0335488 | 3300046558 | Bacteria | 685 |
| 908 | Ga0495667_0014708 | 3300046559 | Bacteria | 5289 |
| 909 | Ga0495667_0023279 | 3300046559 | Bacteria | 4173 |
| 910 | Ga0495667_0197278 | 3300046559 | Bacteria | 1289 |
| 911 | Ga0495656_0008262 | 3300046615 | Bacteria | 3711 |
| 912 | Ga0495656_0028865 | 3300046615 | Bacteria | 2228 |
| 913 | Ga0495668_0035547 | 3300046616 | Bacteria | 2793 |
| 914 | Ga0495668_0118430 | 3300046616 | Bacteria | 1448 |
| 915 | Ga0495668_0335804 | 3300046616 | Bacteria | 829 |
| 916 | Ga0495634_0001036 | 3300046642 | Bacteria | 26033 |
| 917 | Ga0495634_0063846 | 3300046642 | Bacteria | 2443 |
| 918 | Ga0495634_0084757 | 3300046642 | Bacteria | 2066 |
| 919 | Ga0495634_0476507 | 3300046642 | Bacteria | 734 |
| 920 | Ga0495611_0238614 | 3300046648 | Bacteria | 844 |
| 921 | Ga0495625_0030051 | 3300046660 | Bacteria | 4057 |
| 922 | Ga0495625_0267662 | 3300046660 | Bacteria | 1104 |
| 923 | Ga0495625_0375103 | 3300046660 | Bacteria | 894 |
| 924 | Ga0495635_0000815 | 3300046663 | Bacteria | 20434 |
| 925 | Ga0495635_0029736 | 3300046663 | Bacteria | 3799 |
| 926 | Ga0495635_0063389 | 3300046663 | Bacteria | 2538 |
| 927 | Ga0495635_0127604 | 3300046663 | Bacteria | 1734 |
| 928 | Ga0495659_0004501 | 3300046664 | Bacteria | 4388 |
| 929 | Ga0495661_0048855 | 3300046665 | Bacteria | 2569 |
| 930 | Ga0495661_0192608 | 3300046665 | Bacteria | 1073 |
| 931 | Ga0495588_0005058 | 3300046674 | Bacteria | 5855 |
| 932 | Ga0495588_0005077 | 3300046674 | Bacteria | 5848 |
| 933 | Ga0495588_0015996 | 3300046674 | Bacteria | 3620 |
| 934 | Ga0495657_0004591 | 3300046675 | Bacteria | 11023 |
| 935 | Ga0495657_0068646 | 3300046675 | Bacteria | 2322 |
| 936 | Ga0495657_0197692 | 3300046675 | Bacteria | 1226 |
| 937 | Ga0495599_0054221 | 3300046678 | Bacteria | 2512 |
| 938 | Ga0495599_0097068 | 3300046678 | Bacteria | 1837 |
| 939 | Ga0495623_0030892 | 3300046679 | Bacteria | 3446 |
| 940 | Ga0495623_0077150 | 3300046679 | Bacteria | 2066 |
| 941 | Ga0495646_0022610 | 3300046680 | Bacteria | 3965 |
| 942 | Ga0495646_0208829 | 3300046680 | Bacteria | 1060 |
| 943 | Ga0495647_0010626 | 3300046681 | Bacteria | 3138 |
| 944 | Ga0495647_0027822 | 3300046681 | Bacteria | 2080 |
| 945 | Ga0495658_0001572 | 3300046683 | Bacteria | 11910 |
| 946 | Ga0495658_0176369 | 3300046683 | Bacteria | 1324 |
| 947 | Ga0495658_0315219 | 3300046683 | Bacteria | 991 |
| 948 | Ga0495669_0002048 | 3300046684 | Bacteria | 8266 |
| 949 | Ga0495669_0052218 | 3300046684 | Bacteria | 1836 |
| 950 | Ga0495669_0257020 | 3300046684 | Bacteria | 839 |
| 951 | Ga0495613_0003480 | 3300046689 | Bacteria | 11777 |
| 952 | Ga0495613_0165127 | 3300046689 | Bacteria | 1573 |
| 953 | Ga0495613_0208249 | 3300046689 | Bacteria | 1376 |
| 954 | Ga0495624_0000235 | 3300046690 | Bacteria | 43165 |
| 955 | Ga0495624_0077983 | 3300046690 | Bacteria | 2055 |
| 956 | Ga0495624_0112684 | 3300046690 | Bacteria | 1672 |
| 957 | Ga0495624_0226142 | 3300046690 | Bacteria | 1134 |
| 958 | Ga0495624_0338078 | 3300046690 | Bacteria | 906 |
| 959 | Ga0495670_0257557 | 3300046691 | Bacteria | 931 |
| 960 | Ga0495671_0212988 | 3300046692 | Bacteria | 936 |
| 961 | Ga0495649_0015557 | 3300046694 | Bacteria | 4328 |
| 962 | Ga0495649_0326688 | 3300046694 | Bacteria | 778 |
| 963 | Ga0495600_0002795 | 3300046809 | Bacteria | 10135 |
| 964 | Ga0495600_0015147 | 3300046809 | Bacteria | 4871 |
| 965 | Ga0495600_0148342 | 3300046809 | Bacteria | 1519 |
| 966 | Ga0495581_0000041 | 3300047315 | Bacteria | 46518 |
| 967 | Ga0495581_0091175 | 3300047315 | Bacteria | 1768 |
| 968 | Ga0495581_0206493 | 3300047315 | Bacteria | 1149 |
| 969 | Ga0495581_0214912 | 3300047315 | Bacteria | 1124 |
| 970 | Ga0495581_0225700 | 3300047315 | Bacteria | 1096 |
| 971 | Ga0495581_0266748 | 3300047315 | Bacteria | 1001 |
| 972 | Ga0495581_0365055 | 3300047315 | Bacteria | 843 |
| 973 | Ga0495604_0018047 | 3300047317 | Bacteria | 5647 |
| 974 | Ga0495604_0070109 | 3300047317 | Bacteria | 2655 |
| 975 | Ga0495604_0106288 | 3300047317 | Bacteria | 2053 |
| 976 | Ga0495674_0001192 | 3300047319 | Bacteria | 25126 |
| 977 | Ga0495674_0011929 | 3300047319 | Bacteria | 8194 |
| 978 | Ga0495674_0136511 | 3300047319 | Bacteria | 2063 |
| 979 | Ga0495674_0163470 | 3300047319 | Bacteria | 1861 |
| 980 | Ga0495674_0670865 | 3300047319 | Bacteria | 816 |
| 981 | Ga0495674_1026699 | 3300047319 | Bacteria | 631 |
| 982 | Ga0495672_0110322 | 3300047320 | Bacteria | 1478 |
| 983 | Ga0495672_0163323 | 3300047320 | Bacteria | 1143 |
| 984 | Ga0495676_0018550 | 3300047321 | Bacteria | 6135 |
| 985 | Ga0495676_0032821 | 3300047321 | Bacteria | 4379 |
| 986 | Ga0495676_0218093 | 3300047321 | Bacteria | 1316 |
| 987 | Ga0495676_0277904 | 3300047321 | Bacteria | 1135 |
| 988 | Ga0495680_0001654 | 3300047322 | Bacteria | 23702 |
| 989 | Ga0495680_0111828 | 3300047322 | Bacteria | 2024 |
| 990 | Ga0495680_0154374 | 3300047322 | Bacteria | 1671 |
| 991 | Ga0495680_0193025 | 3300047322 | Bacteria | 1464 |
| 992 | Ga0495680_0528089 | 3300047322 | Bacteria | 798 |
| 993 | Ga0495683_0070598 | 3300047323 | Bacteria | 1715 |
| 994 | Ga0495683_0136675 | 3300047323 | Bacteria | 1151 |
| 995 | Ga0495687_132979 | 3300047443 | Bacteria | 877 |
| 996 | Ga0495675_0020899 | 3300047444 | Bacteria | 4166 |
| 997 | Ga0495675_0151005 | 3300047444 | Bacteria | 1435 |
| 998 | Ga0495677_0046040 | 3300047445 | Bacteria | 1601 |
| 999 | Ga0495677_0090554 | 3300047445 | Bacteria | 1152 |
| 1000 | Ga0495685_140443 | 3300047447 | Bacteria | 787 |
| 1001 | Ga0495673_0069225 | 3300047469 | Bacteria | 1489 |
| 1002 | Ga0495673_0096671 | 3300047469 | Bacteria | 1200 |
| 1003 | Ga0495684_0039273 | 3300047471 | Bacteria | 3628 |
| 1004 | Ga0495684_0183455 | 3300047471 | Bacteria | 1550 |
| 1005 | Ga0495684_0791517 | 3300047471 | Bacteria | 620 |
| 1006 | Ga0495686_0324937 | 3300047472 | Bacteria | 842 |
| 1007 | Ga0495593_0000024 | 3300047673 | Bacteria | 65718 |
| 1008 | Ga0495593_0055700 | 3300047673 | Bacteria | 2080 |
| 1009 | Ga0495593_0413604 | 3300047673 | Bacteria | 674 |
| 1010 | Ga0495602_0050647 | 3300048088 | Bacteria | 3708 |
| 1011 | Ga0495602_0085186 | 3300048088 | Bacteria | 2642 |
| 1012 | Ga0495602_0350531 | 3300048088 | Bacteria | 1065 |
| 1013 | Ga0495626_0242914 | 3300048091 | Bacteria | 724 |
| 1014 | Ga0496100_0011240 | 3300048903 | Bacteria | 5092 |
| 1015 | Ga0496100_0082313 | 3300048903 | Bacteria | 2176 |
| 1016 | Ga0496100_0191359 | 3300048903 | Bacteria | 1485 |
| 1017 | Ga0496100_0362698 | 3300048903 | Bacteria | 1097 |
| 1018 | Ga0496101_0005706 | 3300048904 | Bacteria | 7948 |
| 1019 | Ga0496101_0017665 | 3300048904 | Bacteria | 4839 |
| 1020 | Ga0496101_0034243 | 3300048904 | Bacteria | 3586 |
| 1021 | Ga0496101_0070654 | 3300048904 | Bacteria | 2557 |
| 1022 | Ga0496101_0188287 | 3300048904 | Bacteria | 1592 |
| 1023 | Ga0496101_0766514 | 3300048904 | Bacteria | 761 |
| 1024 | Ga0496102_0014041 | 3300048905 | Bacteria | 6955 |
| 1025 | Ga0496102_0015668 | 3300048905 | Bacteria | 6604 |
| 1026 | Ga0496102_0092215 | 3300048905 | Bacteria | 2805 |
| 1027 | Ga0496102_0358055 | 3300048905 | Bacteria | 1374 |
| 1028 | Ga0496102_0371142 | 3300048905 | Bacteria | 1347 |
| 1029 | Ga0496103_0037032 | 3300048906 | Bacteria | 2989 |
| 1030 | Ga0496103_0197698 | 3300048906 | Bacteria | 1293 |
| 1031 | Ga0496103_0406165 | 3300048906 | Bacteria | 875 |
| 1032 | Ga0496104_0007787 | 3300048907 | Bacteria | 9493 |
| 1033 | Ga0496104_0088068 | 3300048907 | Bacteria | 2965 |
| 1034 | Ga0496104_0135420 | 3300048907 | Bacteria | 2366 |
| 1035 | Ga0496104_0187277 | 3300048907 | Bacteria | 1980 |
| 1036 | Ga0496104_0345760 | 3300048907 | Bacteria | 1400 |
| 1037 | Ga0496104_0614143 | 3300048907 | Bacteria | 997 |
| 1038 | Ga0496104_0758826 | 3300048907 | Bacteria | 877 |
| 1039 | Ga0496105_0012396 | 3300048908 | Bacteria | 6749 |
| 1040 | Ga0496105_0013422 | 3300048908 | Bacteria | 6502 |
| 1041 | Ga0496105_0015800 | 3300048908 | Bacteria | 6022 |
| 1042 | Ga0496105_0034013 | 3300048908 | Bacteria | 4190 |
| 1043 | Ga0496105_0062282 | 3300048908 | Bacteria | 3078 |
| 1044 | Ga0496105_0639741 | 3300048908 | Bacteria | 822 |
| 1045 | Ga0496106_0006865 | 3300048909 | Bacteria | 8425 |
| 1046 | Ga0496106_0017314 | 3300048909 | Bacteria | 5335 |
| 1047 | Ga0496106_0031297 | 3300048909 | Bacteria | 3964 |
| 1048 | Ga0496106_0039727 | 3300048909 | Bacteria | 3524 |
| 1049 | Ga0496106_0058706 | 3300048909 | Bacteria | 2913 |
| 1050 | Ga0496106_0149447 | 3300048909 | Bacteria | 1842 |
| 1051 | Ga0496107_0021914 | 3300048910 | Bacteria | 4514 |
| 1052 | Ga0496107_0036248 | 3300048910 | Bacteria | 3537 |
| 1053 | Ga0496107_0037820 | 3300048910 | Bacteria | 3464 |
| 1054 | Ga0496107_0055248 | 3300048910 | Bacteria | 2868 |
| 1055 | Ga0496107_0066054 | 3300048910 | Bacteria | 2622 |
| 1056 | Ga0496108_0043219 | 3300048911 | Bacteria | 3764 |
| 1057 | Ga0496108_0052323 | 3300048911 | Bacteria | 3421 |
| 1058 | Ga0496108_0907157 | 3300048911 | Bacteria | 756 |
| 1059 | Ga0496109_0026126 | 3300048912 | Bacteria | 5205 |
| 1060 | Ga0496109_0028415 | 3300048912 | Bacteria | 5001 |
| 1061 | Ga0496109_0063752 | 3300048912 | Bacteria | 3371 |
| 1062 | Ga0496109_0195654 | 3300048912 | Bacteria | 1900 |
| 1063 | Ga0496109_0393781 | 3300048912 | Bacteria | 1309 |
| 1064 | Ga0496109_0704363 | 3300048912 | Bacteria | 947 |
| 1065 | Ga0496110_0005741 | 3300048913 | Bacteria | 9749 |
| 1066 | Ga0496110_0083639 | 3300048913 | Bacteria | 2847 |
| 1067 | Ga0496110_0091790 | 3300048913 | Bacteria | 2717 |
| 1068 | Ga0496110_0116486 | 3300048913 | Bacteria | 2405 |
| 1069 | Ga0496110_0159652 | 3300048913 | Bacteria | 2043 |
| 1070 | Ga0496110_0213916 | 3300048913 | Bacteria | 1753 |
| 1071 | Ga0496110_0776679 | 3300048913 | Bacteria | 862 |
| 1072 | Ga0496111_0024753 | 3300048914 | Bacteria | 4233 |
| 1073 | Ga0496111_0034236 | 3300048914 | Bacteria | 3626 |
| 1074 | Ga0496111_0042463 | 3300048914 | Bacteria | 3265 |
| 1075 | Ga0496111_0331758 | 3300048914 | Bacteria | 1126 |
| 1076 | Ga0496112_0000052 | 3300048915 | Bacteria | 81285 |
| 1077 | Ga0496112_0064719 | 3300048915 | Bacteria | 3608 |
| 1078 | Ga0496112_0178060 | 3300048915 | Bacteria | 2090 |
| 1079 | Ga0496112_0500060 | 3300048915 | Bacteria | 1151 |
| 1080 | Ga0496112_0700756 | 3300048915 | Bacteria | 940 |
| 1081 | Ga0496113_0002503 | 3300048916 | Bacteria | 10701 |
| 1082 | Ga0496113_0055757 | 3300048916 | Bacteria | 2964 |
| 1083 | Ga0496113_0056499 | 3300048916 | Bacteria | 2947 |
| 1084 | Ga0496113_0156050 | 3300048916 | Bacteria | 1802 |
| 1085 | Ga0496113_0615574 | 3300048916 | Bacteria | 869 |
| 1086 | Ga0496114_0009294 | 3300048917 | Bacteria | 7801 |
| 1087 | Ga0496114_0022402 | 3300048917 | Bacteria | 5149 |
| 1088 | Ga0496114_0048418 | 3300048917 | Bacteria | 3536 |
| 1089 | Ga0496114_0228006 | 3300048917 | Bacteria | 1636 |
| 1090 | Ga0496115_0001250 | 3300048918 | Bacteria | 18240 |
| 1091 | Ga0496115_0023466 | 3300048918 | Bacteria | 4788 |
| 1092 | Ga0496115_0034919 | 3300048918 | Bacteria | 3975 |
| 1093 | Ga0496115_0059345 | 3300048918 | Bacteria | 3081 |
| 1094 | Ga0496115_0102199 | 3300048918 | Bacteria | 2351 |
| 1095 | Ga0496115_0107575 | 3300048918 | Bacteria | 2289 |
| 1096 | Ga0496115_0246554 | 3300048918 | Bacteria | 1471 |
| 1097 | Ga0496115_0353280 | 3300048918 | Bacteria | 1198 |
| 1098 | Ga0496115_0575331 | 3300048918 | Bacteria | 898 |
| 1099 | Ga0496116_0046981 | 3300048919 | Bacteria | 2910 |
| 1100 | Ga0496116_0281983 | 3300048919 | Bacteria | 804 |
| 1101 | Ga0496117_0017488 | 3300048920 | Bacteria | 5986 |
| 1102 | Ga0496118_0039136 | 3300048921 | Bacteria | 3788 |
| 1103 | Ga0496118_0079862 | 3300048921 | Bacteria | 2305 |
| 1104 | Ga0496118_0099169 | 3300048921 | Bacteria | 1976 |
| 1105 | Ga0496118_0108048 | 3300048921 | Bacteria | 1856 |
| 1106 | Ga0496118_0289608 | 3300048921 | Bacteria | 906 |
| 1107 | Ga0496119_0042593 | 3300048922 | Bacteria | 2877 |
| 1108 | Ga0496119_0047619 | 3300048922 | Bacteria | 2666 |
| 1109 | Ga0496119_0158590 | 3300048922 | Bacteria | 1205 |
| 1110 | Ga0496120_0013345 | 3300048923 | Bacteria | 5538 |
| 1111 | Ga0496120_0164156 | 3300048923 | Bacteria | 1104 |
| 1112 | Ga0496121_0007064 | 3300048924 | Bacteria | 13633 |
| 1113 | Ga0496121_0015737 | 3300048924 | Bacteria | 7882 |
| 1114 | Ga0496121_0061644 | 3300048924 | Bacteria | 3076 |
| 1115 | Ga0496121_0169886 | 3300048924 | Bacteria | 1585 |
| 1116 | Ga0496121_0184495 | 3300048924 | Bacteria | 1502 |
| 1117 | Ga0496121_0355463 | 3300048924 | Bacteria | 974 |
| 1118 | Ga0496121_0517662 | 3300048924 | Bacteria | 753 |
| 1119 | Ga0496121_0528391 | 3300048924 | Bacteria | 743 |
| 1120 | Ga0496122_0044821 | 3300048925 | Bacteria | 3447 |
| 1121 | Ga0496124_0024995 | 3300048927 | Bacteria | 5417 |
| 1122 | Ga0496124_0058635 | 3300048927 | Bacteria | 3237 |
| 1123 | Ga0496124_0061641 | 3300048927 | Bacteria | 3143 |
| 1124 | Ga0496124_0099901 | 3300048927 | Bacteria | 2352 |
| 1125 | Ga0496124_0560303 | 3300048927 | Bacteria | 752 |
| 1126 | Ga0496125_0027101 | 3300048928 | Bacteria | 5202 |
| 1127 | Ga0496125_0042169 | 3300048928 | Bacteria | 3891 |
| 1128 | Ga0496125_0063623 | 3300048928 | Bacteria | 2940 |
| 1129 | Ga0496125_0129856 | 3300048928 | Bacteria | 1776 |
| 1130 | Ga0496125_0130116 | 3300048928 | Bacteria | 1774 |
| 1131 | Ga0496126_0009548 | 3300048929 | Bacteria | 10292 |
| 1132 | Ga0496126_0021450 | 3300048929 | Bacteria | 6308 |
| 1133 | Ga0496126_0024908 | 3300048929 | Bacteria | 5769 |
| 1134 | Ga0496126_0052056 | 3300048929 | Bacteria | 3724 |
| 1135 | Ga0496126_0060792 | 3300048929 | Bacteria | 3396 |
| 1136 | Ga0496126_0082014 | 3300048929 | Bacteria | 2850 |
| 1137 | Ga0496126_0111925 | 3300048929 | Bacteria | 2377 |
| 1138 | Ga0496126_0132125 | 3300048929 | Bacteria | 2156 |
| 1139 | Ga0496126_0198738 | 3300048929 | Bacteria | 1694 |
| 1140 | Ga0496126_0278766 | 3300048929 | Bacteria | 1385 |
| 1141 | Ga0496126_0359422 | 3300048929 | Bacteria | 1189 |
| 1142 | Ga0496126_0475196 | 3300048929 | Bacteria | 1002 |
| 1143 | Ga0495678_076357 | 3300049459 | Bacteria | 1214 |
| 1144 | Ga0495682_0019019 | 3300049460 | Bacteria | 2585 |
| 1145 | Ga0495682_0178256 | 3300049460 | Bacteria | 755 |
| 1146 | Ga0501046_0110561 | 3300049580 | Bacteria | 2100 |
| 1147 | Ga0501047_0051633 | 3300049581 | Bacteria | 3973 |
| 1148 | Ga0501048_0497167 | 3300049582 | Bacteria | 874 |
| 1149 | Ga0501067_0039577 | 3300049583 | Bacteria | 2618 |
| 1150 | Ga0501069_0321218 | 3300049585 | Bacteria | 910 |
| 1151 | Ga0501070_0085084 | 3300049586 | Bacteria | 2618 |
| 1152 | Ga0501070_0521090 | 3300049586 | Bacteria | 954 |
| 1153 | Ga0501074_0019696 | 3300049590 | Bacteria | 4898 |
| 1154 | Ga0501076_0363492 | 3300049592 | Bacteria | 1189 |
| 1155 | Ga0501077_0758785 | 3300049593 | Bacteria | 624 |
| 1156 | Ga0501079_0296046 | 3300049741 | Bacteria | 1266 |
| 1157 | Ga0501080_0283585 | 3300049742 | Bacteria | 1505 |
| 1158 | Ga0501044_0063921 | 3300049823 | Bacteria | 3758 |
| 1159 | nmdc:mga03683_369144_c1 | 3300050489 | Bacteria | 681 |
| 1160 | nmdc:mga03683_56942_c1 | 3300050489 | Bacteria | 1644 |
| 1161 | nmdc:mga03n38_131764_c1 | 3300050490 | Bacteria | 1240 |
| 1162 | nmdc:mga03n38_297300_c1 | 3300050490 | Bacteria | 866 |
| 1163 | nmdc:mga03n38_388225_c1 | 3300050490 | Bacteria | 766 |
| 1164 | nmdc:mga00v17_59291_c1 | 3300050491 | Bacteria | 2348 |
| 1165 | nmdc:mga00v17_79825_c1 | 3300050491 | Bacteria | 2041 |
| 1166 | nmdc:mga0yw44_18644_c1 | 3300050492 | Bacteria | 3807 |
| 1167 | nmdc:mga0yw44_376143_c1 | 3300050492 | Bacteria | 959 |
| 1168 | nmdc:mga0yw44_489888_c1 | 3300050492 | Bacteria | 834 |
| 1169 | nmdc:mga0yw44_606324_c1 | 3300050492 | Bacteria | 744 |
| 1170 | nmdc:mga0k408_236877_c1 | 3300050493 | Bacteria | 1090 |
| 1171 | nmdc:mga0k408_252578_c1 | 3300050493 | Bacteria | 1053 |
| 1172 | nmdc:mga0k408_8015_c1 | 3300050493 | Bacteria | 5662 |
| 1173 | nmdc:mga06z11_124267_c1 | 3300050494 | Bacteria | 1443 |
| 1174 | nmdc:mga06z11_379571_c1 | 3300050494 | Bacteria | 849 |
| 1175 | nmdc:mga06z11_423829_c1 | 3300050494 | Bacteria | 802 |
| 1176 | nmdc:mga06z11_52802_c1 | 3300050494 | Bacteria | 2087 |
| 1177 | nmdc:mga06z11_742803_c1 | 3300050494 | Bacteria | 598 |
| 1178 | nmdc:mga04h51_9301_c1 | 3300050495 | Bacteria | 2658 |
| 1179 | nmdc:mga07m45_118401_c1 | 3300050496 | Bacteria | 1529 |
| 1180 | nmdc:mga07m45_146155_c1 | 3300050496 | Bacteria | 1370 |
| 1181 | nmdc:mga07m45_225798_c1 | 3300050496 | Bacteria | 1090 |
| 1182 | nmdc:mga07m45_284446_c1 | 3300050496 | Bacteria | 962 |
| 1183 | nmdc:mga07m45_84199_c1 | 3300050496 | Bacteria | 1818 |
| 1184 | nmdc:mga07m45_8848_c1 | 3300050496 | Bacteria | 5195 |
| 1185 | nmdc:mga05p37_296846_c1 | 3300050507 | Bacteria | 1921 |
| 1186 | nmdc:mga09592_472867_c1 | 3300050508 | Bacteria | 1080 |
| 1187 | nmdc:mga09592_852083_c1 | 3300050508 | Bacteria | 768 |
| 1188 | nmdc:mga0qj67_491781_c1 | 3300050509 | Bacteria | 986 |
| 1189 | nmdc:mga06r32_35594_c1 | 3300050510 | Bacteria | 4698 |
| 1190 | nmdc:mga08y16_182493_c1 | 3300050511 | Bacteria | 2178 |
| 1191 | nmdc:mga08y16_80488_c1 | 3300050511 | Bacteria | 3396 |
| 1192 | nmdc:mga0n895_210173_c1 | 3300050512 | Bacteria | 1976 |
| 1193 | nmdc:mga0n895_234505_c1 | 3300050512 | Bacteria | 1862 |
| 1194 | nmdc:mga08x19_170936_c1 | 3300050514 | Bacteria | 1480 |
| 1195 | nmdc:mga0sz30_52882_c1 | 3300050516 | Bacteria | 1725 |
| 1196 | Ga0495601_0028308 | 3300053077 | Bacteria | 3471 |
| 1197 | Ga0495601_0050959 | 3300053077 | Bacteria | 2612 |
| 1198 | Ga0495601_0581725 | 3300053077 | Bacteria | 719 |
| 1199 | Ga0495612_0095370 | 3300053078 | Bacteria | 1263 |
| 1200 | Ga0500635_0001974 | 3300053080 | Bacteria | 5009 |
| 1201 | Ga0495655_0005605 | 3300053083 | Bacteria | 2229 |
| 1202 | Ga0495655_0011323 | 3300053083 | Bacteria | 1789 |
| 1203 | Ga0495655_0147245 | 3300053083 | Bacteria | 738 |
| 1204 | Ga0495595_0295542 | 3300053084 | Bacteria | 814 |
| 1205 | Ga0495619_0058227 | 3300053085 | Bacteria | 2564 |
| 1206 | Ga0495619_0201397 | 3300053085 | Bacteria | 1378 |
| 1207 | Ga0500578_0065579 | 3300053086 | Bacteria | 2316 |
| 1208 | Ga0500643_009443 | 3300053087 | Bacteria | 3727 |
| 1209 | Ga0500646_0129889 | 3300053090 | Bacteria | 818 |
| 1210 | Ga0500647_0026362 | 3300053091 | Bacteria | 2741 |
| 1211 | Ga0500647_0247577 | 3300053091 | Bacteria | 785 |
| 1212 | Ga0500651_0038749 | 3300053093 | Bacteria | 3002 |
| 1213 | Ga0500651_0133134 | 3300053093 | Bacteria | 1502 |
| 1214 | Ga0500651_0221003 | 3300053093 | Bacteria | 1111 |
| 1215 | Ga0500566_0001419 | 3300053094 | Bacteria | 14035 |
| 1216 | Ga0500566_0012672 | 3300053094 | Bacteria | 4960 |
| 1217 | Ga0500566_0012702 | 3300053094 | Bacteria | 4954 |
| 1218 | Ga0500640_000253 | 3300053095 | Bacteria | 11745 |
| 1219 | Ga0500641_0005024 | 3300053096 | Bacteria | 4691 |
| 1220 | Ga0500641_0024967 | 3300053096 | Bacteria | 2309 |
| 1221 | Ga0500650_0065434 | 3300053098 | Bacteria | 1698 |
| 1222 | Ga0500650_0187205 | 3300053098 | Bacteria | 947 |
| 1223 | Ga0500650_0279517 | 3300053098 | Bacteria | 742 |
| 1224 | Ga0500554_003440 | 3300053102 | Bacteria | 3242 |
| 1225 | Ga0500554_097943 | 3300053102 | Bacteria | 979 |
| 1226 | Ga0500555_040298 | 3300053103 | Bacteria | 1302 |
| 1227 | Ga0500556_0130958 | 3300053104 | Bacteria | 983 |
| 1228 | Ga0500557_000077 | 3300053105 | Bacteria | 36950 |
| 1229 | Ga0500562_008760 | 3300053108 | Bacteria | 2557 |
| 1230 | Ga0500569_019077 | 3300053109 | Bacteria | 1780 |
| 1231 | Ga0500569_117683 | 3300053109 | Bacteria | 882 |
| 1232 | Ga0500572_000199 | 3300053111 | Bacteria | 21285 |
| 1233 | Ga0500580_155697 | 3300053113 | Bacteria | 818 |
| 1234 | Ga0500591_127801 | 3300053115 | Bacteria | 1031 |
| 1235 | Ga0500593_210889 | 3300053117 | Bacteria | 692 |
| 1236 | Ga0500595_000842 | 3300053119 | Bacteria | 17493 |
| 1237 | Ga0500595_001951 | 3300053119 | Bacteria | 10615 |
| 1238 | Ga0500595_026055 | 3300053119 | Bacteria | 2020 |
| 1239 | Ga0500595_033593 | 3300053119 | Bacteria | 1701 |
| 1240 | Ga0500597_092711 | 3300053120 | Bacteria | 1313 |
| 1241 | Ga0500597_171874 | 3300053120 | Bacteria | 923 |
| 1242 | Ga0500614_000715 | 3300053123 | Bacteria | 8481 |
| 1243 | Ga0500618_074244 | 3300053125 | Bacteria | 763 |
| 1244 | Ga0500642_0000381 | 3300053130 | Bacteria | 14828 |
| 1245 | Ga0500652_017525 | 3300053131 | Bacteria | 2627 |
| 1246 | Ga0500655_017813 | 3300053133 | Bacteria | 1317 |
| 1247 | Ga0500658_0011386 | 3300053134 | Bacteria | 3278 |
| 1248 | Ga0500559_0001308 | 3300053136 | Bacteria | 14372 |
| 1249 | Ga0500559_0015190 | 3300053136 | Bacteria | 3253 |
| 1250 | Ga0500559_0033115 | 3300053136 | Bacteria | 2224 |
| 1251 | Ga0500561_0076190 | 3300053137 | Bacteria | 969 |
| 1252 | Ga0500568_0025605 | 3300053139 | Bacteria | 2487 |
| 1253 | Ga0500568_0040223 | 3300053139 | Bacteria | 1884 |
| 1254 | Ga0500568_0111366 | 3300053139 | Bacteria | 1023 |
| 1255 | Ga0500573_0008543 | 3300053140 | Bacteria | 5644 |
| 1256 | Ga0500577_0254070 | 3300053142 | Bacteria | 764 |
| 1257 | Ga0500588_0013956 | 3300053146 | Bacteria | 2025 |
| 1258 | Ga0500588_0045892 | 3300053146 | Bacteria | 1341 |
| 1259 | Ga0500590_115662 | 3300053148 | Bacteria | 1265 |
| 1260 | Ga0500590_236232 | 3300053148 | Bacteria | 740 |
| 1261 | Ga0500603_000226 | 3300053150 | Bacteria | 14827 |
| 1262 | Ga0500603_000580 | 3300053150 | Bacteria | 9181 |
| 1263 | Ga0500603_033497 | 3300053150 | Bacteria | 1338 |
| 1264 | Ga0500604_0020234 | 3300053151 | Bacteria | 1871 |
| 1265 | Ga0500616_0150912 | 3300053153 | Bacteria | 1076 |
| 1266 | Ga0500622_0100369 | 3300053156 | Bacteria | 1426 |
| 1267 | Ga0500622_0309444 | 3300053156 | Bacteria | 670 |
| 1268 | Ga0500627_0254523 | 3300053158 | Bacteria | 776 |
| 1269 | Ga0500630_000573 | 3300053159 | Bacteria | 16713 |
| 1270 | Ga0500634_0075126 | 3300053161 | Bacteria | 1758 |
| 1271 | Ga0500638_001609 | 3300053162 | Bacteria | 7251 |
| 1272 | Ga0500638_103774 | 3300053162 | Bacteria | 1322 |
| 1273 | Ga0500638_106684 | 3300053162 | Bacteria | 1299 |
| 1274 | Ga0500638_147627 | 3300053162 | Bacteria | 1049 |
| 1275 | Ga0500638_184845 | 3300053162 | Bacteria | 896 |
| 1276 | Ga0500639_000006 | 3300053163 | Bacteria | 165068 |
| 1277 | Ga0500639_048715 | 3300053163 | Bacteria | 2212 |
| 1278 | Ga0500639_061171 | 3300053163 | Bacteria | 1940 |
| 1279 | Ga0500636_0013138 | 3300053177 | Bacteria | 4858 |
| 1280 | Ga0500636_0030340 | 3300053177 | Bacteria | 3197 |
| 1281 | Ga0500636_0326661 | 3300053177 | Bacteria | 743 |
| 1282 | Ga0500637_0000251 | 3300053178 | Bacteria | 19903 |
| 1283 | Ga0500637_0003349 | 3300053178 | Bacteria | 7387 |
| 1284 | Ga0500637_0062354 | 3300053178 | Bacteria | 2136 |
| 1285 | Ga0500637_0127120 | 3300053178 | Bacteria | 1478 |
| 1286 | Ga0500637_0241712 | 3300053178 | Bacteria | 1012 |
| 1287 | Ga0500657_101993 | 3300053728 | Bacteria | 1182 |
| 1288 | Ga0500625_009381 | 3300053729 | Bacteria | 4362 |
| 1289 | Ga0500645_032182 | 3300053730 | Bacteria | 1573 |
| 1290 | Ga0500645_071012 | 3300053730 | Bacteria | 999 |
| 1291 | Ga0500609_020918 | 3300053731 | Bacteria | 892 |
| 1292 | Ga0500609_027898 | 3300053731 | Bacteria | 774 |
| 1293 | Ga0500552_006601 | 3300053733 | Bacteria | 1308 |
| 1294 | Ga0500552_015254 | 3300053733 | Bacteria | 1024 |
| 1295 | Ga0500596_000603 | 3300053735 | Bacteria | 6894 |
| 1296 | Ga0500596_003281 | 3300053735 | Bacteria | 3099 |
| 1297 | Ga0500596_012112 | 3300053735 | Bacteria | 1312 |
| 1298 | Ga0500601_000371 | 3300053737 | Bacteria | 8090 |
| 1299 | Ga0501082_0375794 | 3300060353 | Bacteria | 1240 |
| 1300 | Ga0530510_0471127 | 3300061734 | Bacteria | 951 |
| 1301 | 2507511876 | 2507262055 | Bacteria | 8048963 |
| 1302 | 2508545540 | 2508501009 | Bacteria | 7784016 |
| 1303 | 2508694358 | 2508501042 | Bacteria | 8719808 |
| 1304 | 2509146624 | 2508501128 | Bacteria | 8613869 |
| 1305 | 2513673496 | 2513237098 | Bacteria | 9902361 |
| 1306 | 2513717792 | 2513237104 | Bacteria | 10034502 |
| 1307 | 2513875298 | 2513237139 | Bacteria | 8737671 |
| 1308 | 2514014404 | 2513237161 | Bacteria | 8871253 |
| 1309 | 2515624711 | 2515154112 | Bacteria | 8294334 |
| 1310 | 2517108572 | 2517093001 | Bacteria | 9002274 |
| 1311 | 2524438318 | 2524023205 | Bacteria | 8918781 |
| 1312 | 2528854955 | 2528768022 | Bacteria | 10457665 |
| 1313 | 2617349628 | 2617270735 | Bacteria | 9163226 |
| 1314 | 2617376814 | 2617270741 | Bacteria | 8201522 |
| 1315 | 2728752343 | 2728368998 | Bacteria | 8720350 |
| 1316 | 2745078536 | 2744054633 | Bacteria | 8678936 |
| 1317 | 2793059633 | 2791355196 | Bacteria | 7323613 |
| 1318 | 2793069608 | 2791355197 | Bacteria | 8420563 |
| 1319 | 2793080289 | |||
| 1320 | 2805921873 | 2802429603 | Bacteria | 8777136 |
| 1321 | 2824608015 | 2824600985 | Bacteria | 8488197 |
| 1322 | 2824615055 | 2824609381 | Bacteria | 8672835 |
| 1323 | 2824624848 | 2824617872 | Bacteria | 8814715 |
| 1324 | 2824633746 | 2824626560 | Bacteria | 8813858 |
| 1325 | 2824642309 | 2824635225 | Bacteria | 8785348 |
| 1326 | 2824649645 | 2824644064 | Bacteria | 8743947 |
| 1327 | 2824659529 | 2824653114 | Bacteria | 8493680 |
| 1328 | 2824670057 | 2824661429 | Bacteria | 9877870 |
| 1329 | 2824676705 | 2824671348 | Bacteria | 8369588 |
| 1330 | 2824692994 | 2824687955 | Bacteria | 8360029 |
| 1331 | 2824702579 | 2824696289 | Bacteria | 8335049 |
| 1332 | 2824712401 | 2824704595 | Bacteria | 9667483 |
| 1333 | 2824719747 | 2824714736 | Bacteria | 8717648 |
| 1334 | 2824730050 | 2824723954 | Bacteria | 8758240 |
| 1335 | 2824738291 | 2824732956 | Bacteria | 7810675 |
| 1336 | 2824751732 | 2824746037 | Bacteria | 7911610 |
| 1337 | 2824762425 | 2824753945 | Bacteria | 9787441 |
| 1338 | 2824772740 | 2824763712 | Bacteria | 9792355 |
| 1339 | 2824776991 | 2824773399 | Bacteria | 8360218 |
| 1340 | 2838128390 | 2838122688 | Bacteria | 8803140 |
| 1341 | 2841942250 | 2841941048 | Bacteria | 8688029 |
| 1342 | 2841955620 | 2841949485 | Bacteria | 8680857 |
| 1343 | 2841960961 | 2841957949 | Bacteria | 8652217 |
| 1344 | 2841971229 | 2841966195 | Bacteria | 8673214 |
| 1345 | 2841982349 | 2841974524 | Bacteria | 8931498 |
| 1346 | 2841984264 | 2841983080 | Bacteria | 8395090 |
| 1347 | 2844321093 | 2844315083 | Bacteria | 8138177 |
| 1348 | 2847932306 | 2847930680 | Bacteria | 9342022 |
| 1349 | 2847943541 | 2847939898 | Bacteria | 8606328 |
| 1350 | 2849077264 | 2849076700 | Bacteria | 7039503 |
| 1351 | 2857515161 | 2857509624 | Bacteria | 7472071 |
| 1352 | 2874592256 | 2874590934 | Bacteria | 8299676 |
| 1353 | 2874624009 | 2874620515 | Bacteria | 8290088 |
| 1354 | 2874630983 | 2874628541 | Bacteria | 8630250 |
| 1355 | 2874647372 | 2874645413 | Bacteria | 8214782 |
| 1356 | 2876767414 | 2876761206 | Bacteria | 10111113 |
| 1357 | 2876774783 | 2876771140 | Bacteria | 8287509 |
| 1358 | 2876809828 | 2876808645 | Bacteria | 8824342 |
| 1359 | 2876819736 | 2876818435 | Bacteria | 8274608 |
| 1360 | 2879079351 | 2879074833 | Bacteria | 8279565 |
| 1361 | 2879091529 | 2879083081 | Bacteria | 8587928 |
| 1362 | 2879101399 | 2879099564 | Bacteria | 10442239 |
| 1363 | 2879113775 | 2879110137 | Bacteria | 8907982 |
| 1364 | 2879129085 | 2879127579 | Bacteria | 8294491 |
| 1365 | 2879144760 | 2879142872 | Bacteria | 8267021 |
| 1366 | 2881371131 | 2881364244 | Bacteria | 7710352 |
| 1367 | 2885374061 | 2885366525 | Bacteria | 8326213 |
| 1368 | 2885382989 | 2885374607 | Bacteria | 8927485 |
| 1369 | 2888391817 | 2888388044 | Bacteria | 7304136 |
| 1370 | 2888426607 | 2888419890 | Bacteria | 7857137 |
| 1371 | 2889033864 | 2889033259 | Bacteria | 9099371 |
| 1372 | 2903728516 | 2903727486 | Bacteria | 8281579 |
| 1373 | 2903773947 | 2903768456 | Bacteria | 9749579 |
| 1374 | 2904670720 | 2904666416 | Bacteria | 8226587 |
| 1375 | 2904699114 | 2904690495 | Bacteria | 9412302 |
| 1376 | 2904713671 | 2904711408 | Bacteria | 9771557 |
| 1377 | 2906607708 | 2906602504 | Bacteria | 8295279 |
| 1378 | 2906615568 | |||
| 1379 | 2906627115 | 2906626472 | Bacteria | 8826946 |
| 1380 | 2906645375 | 2906643746 | Bacteria | 8722424 |
| 1381 | 2908745611 | 2908739725 | Bacteria | 8628932 |
| 1382 | 2908763683 | 2908756301 | Bacteria | 8864324 |
| 1383 | 2908782712 | 2908775508 | Bacteria | 8092255 |
| 1384 | 2922367286 | 2922361189 | Bacteria | 7436256 |
| 1385 | 2922370559 | |||
| 1386 | 2922390010 | 2922386360 | Bacteria | 7017218 |
| 1387 | 2922432438 | |||
| 1388 | 2929620135 | 2929615660 | Bacteria | 9193770 |
| 1389 | 2929629448 | 2929624759 | Bacteria | 9339455 |
| 1390 | 2932791490 | 2932784394 | Bacteria | 9704911 |
| 1391 | 2932796893 | 2932794094 | Bacteria | 7915132 |
| 1392 | 2932802329 | 2932801729 | Bacteria | 7987968 |
| 1393 | 2932816746 | 2932809354 | Bacteria | 9135765 |
| 1394 | 2932824072 | 2932818245 | Bacteria | 9955613 |
| 1395 | 2932835392 | 2932828146 | Bacteria | 9745859 |
| 1396 | 2933582052 | 2933577622 | Bacteria | 9116884 |
| 1397 | 2935613481 | 2935608549 | Bacteria | 8203142 |
| 1398 | 2935621135 | 2935616580 | Bacteria | 9032984 |
| 1399 | 2935630749 | 2935630451 | Bacteria | 8169952 |
| 1400 | 2935643558 | 2935638405 | Bacteria | 10015038 |
| 1401 | 2935650477 | 2935648319 | Bacteria | 8801166 |
| 1402 | 2935662919 | 2935656913 | Bacteria | 8965014 |
| 1403 | 2935671132 | 2935665750 | Bacteria | 9571747 |
| 1404 | 2935681262 | 2935675223 | Bacteria | 9928132 |
| 1405 | 2935689395 | 2935684952 | Bacteria | 9590419 |
| 1406 | 2935699970 | 2935694250 | Bacteria | 9291695 |
| 1407 | 2935712099 | 2935703347 | Bacteria | 10242284 |
| 1408 | 2935720341 | 2935713505 | Bacteria | 9608509 |
| 1409 | 2935728042 | 2935722832 | Bacteria | 9608746 |
| 1410 | 2935737361 | 2935732158 | Bacteria | 9706831 |
| 1411 | 2935746578 | 2935741537 | Bacteria | 9707219 |
| 1412 | 2935757545 | 2935750917 | Bacteria | 9590372 |
| 1413 | 2935763922 | 2935760218 | Bacteria | 9817913 |
| 1414 | 2935776642 | 2935769743 | Bacteria | 7878163 |
| 1415 | 2935781535 | 2935777560 | Bacteria | 8077691 |
| 1416 | 2935789853 | 2935785616 | Bacteria | 7962367 |
| 1417 | 2935798381 | 2935793552 | Bacteria | 8012592 |
| 1418 | 2935807899 | 2935801545 | Bacteria | 9301974 |
| 1419 | 2935818767 | 2935810662 | Bacteria | 9401221 |
| 1420 | 2935824666 | 2935819856 | Bacteria | 8261050 |
| 1421 | 2935833075 | 2935827899 | Bacteria | 10038562 |
| 1422 | 2935844269 | 2935837841 | Bacteria | 9454360 |
| 1423 | 2935851886 | 2935847175 | Bacteria | 8228321 |
| 1424 | 2935859672 | 2935855204 | Bacteria | 9035059 |
| 1425 | 2935872070 | 2935864058 | Bacteria | 9784707 |
| 1426 | 2935879006 | 2935873716 | Bacteria | 9632195 |
| 1427 | 2935887231 | 2935883170 | Bacteria | 7964738 |
| 1428 | 2935911236 | 2935908558 | Bacteria | 8568796 |
| 1429 | 2935920768 | 2935916978 | Bacteria | 9113783 |
| 1430 | 2935928265 | 2935926038 | Bacteria | 8601059 |
| 1431 | 2935937910 | 2935934488 | Bacteria | 8602579 |
| 1432 | 2935945192 | 2935942939 | Bacteria | 8599779 |
| 1433 | 2935954302 | 2935951376 | Bacteria | 8602333 |
| 1434 | 2935971430 | 2935967501 | Bacteria | 8603075 |
| 1435 | 2935982050 | 2935975950 | Bacteria | 8347125 |
| 1436 | 2935990611 | 2935984226 | Bacteria | 8302647 |
| 1437 | 2936000353 | 2935992306 | Bacteria | 9802711 |
| 1438 | 2936008511 | 2936002035 | Bacteria | 9362176 |
| 1439 | 2936017167 | 2936011229 | Bacteria | 8801034 |
| 1440 | 2936026698 | 2936019824 | Bacteria | 8804134 |
| 1441 | 2936035441 | 2936028420 | Bacteria | 8965941 |
| 1442 | 2936045577 | 2936037263 | Bacteria | 9446081 |
| 1443 | 2936053590 | 2936046547 | Bacteria | 8903709 |
| 1444 | 2936062668 | 2936055302 | Bacteria | 8785755 |
| 1445 | 2940563633 | 2940556831 | Bacteria | 9590747 |
| 1446 | 2941507401 | 2941507105 | Bacteria | 8166816 |
| 1447 | 2941515828 | 2941515067 | Bacteria | 8166720 |
| 1448 | 2941523464 | 2941523033 | Bacteria | 8169134 |
| 1449 | 2941542601 | 2941538514 | Bacteria | 9402094 |
| 1450 | 3005506907 | 3005506211 | Bacteria | 6943378 |
| 1451 | 3005591714 | 3005587118 | Bacteria | 7794411 |
| 1452 | 3005601433 | 3005594810 | Bacteria | 8716512 |
| 1453 | 3005717154 | 3005710791 | Bacteria | 7622528 |
| 1454 | 8006966126 | 8006964411 | Bacteria | 8966052 |
| 1455 | 8006989711 | 8006984368 | Bacteria | 9651211 |
| 1456 | 8016519489 | 8016511872 | Bacteria | 9921665 |
| 1457 | 8016524868 | 8016522445 | Bacteria | 8156687 |
| 1458 | 8016542724 | 8016539877 | Bacteria | 8155419 |
| 1459 | 8016550557 | 8016548790 | Bacteria | 8155074 |
| 1460 | 8016558977 | 8016557553 | Bacteria | 8154380 |
| 1461 | 8016580785 | 8016575299 | Bacteria | 8154085 |
| 1462 | 8016588686 | 8016583857 | Bacteria | 10421953 |
| 1463 | 8016596938 | 8016595262 | Bacteria | 8149947 |
| 1464 | 8016607846 | 8016603502 | Bacteria | 8731218 |
| 1465 | 8016619629 | 8016613128 | Bacteria | 8794220 |
| 1466 | 8016637186 | 8016630954 | Bacteria | 9217207 |
| 1467 | 8017066033 | 8017057580 | Bacteria | 10023680 |
| 1468 | 8019538108 | 8019530166 | Bacteria | 8155624 |
| 1469 | 8019541875 | 8019538911 | Bacteria | 7872763 |
| 1470 | 8019563774 | 8019555841 | Bacteria | 9642137 |
| 1471 | 8019573839 | 8019565922 | Bacteria | 9639779 |
| 1472 | 8019578599 | 8019576017 | Bacteria | 10049540 |
| 1473 | 8019596649 | 8019586578 | Bacteria | 10212056 |
| 1474 | 8019605054 | 8019597564 | Bacteria | 10041141 |
| 1475 | 8019613481 | 8019608314 | Bacteria | 10042931 |
| 1476 | 8019624151 | 8019619141 | Bacteria | 9218857 |
| 1477 | 8019637876 | 8019629233 | Bacteria | 8687553 |
| 1478 | 8019641748 | 8019638758 | Bacteria | 9062356 |
| 1479 | 8019665805 | 8019659431 | Bacteria | 8577854 |
| 1480 | 8019694994 | 8019687851 | Bacteria | 8712826 |
| 1481 | 8055750112 | 8055742211 | Bacteria | 9226248 |
| 1482 | 8056684617 | 8056681323 | Bacteria | 8472857 |
| 1483 | 8056696201 | 8056689827 | Bacteria | 6712655 |
| 1484 | 8056975891 | 8056967851 | Bacteria | 9038162 |
| 1485 | Ga0070668_100277250 | |||
| 1486 | JGI24744J21845_10007283 | |||
| 1487 | JGI24034J26672_10043701 | |||
| 1488 | JGI25406J46586_10000064 | |||
| 1489 | JGI25153J46596_10002222 | |||
| 1490 | JGI25153J46596_10005210 | |||
| 1491 | JGI25153J46596_10010025 | |||
| 1492 | JGI25153J46596_10059413 | |||
| 1493 | JGI25153J46596_10065596 | |||
| 1494 | JGI25160J50197_1003229 | |||
| 1495 | JGI25160J50197_1003286 | |||
| 1496 | JGI25160J50197_1007225 | |||
| 1497 | JGI25404J52841_10031685 | |||
| 1498 | JGI25404J52841_10038592 | |||
| 1499 | JGI25404J52841_10064843 | |||
| 1500 | Ga0055542_1012629 | |||
| 1501 | Ga0055531_10010351 | |||
| 1502 | Ga0055531_10010606 | |||
| 1503 | Ga0058862_12106901 | |||
| 1504 | Ga0065165_1002846 | |||
| 1505 | Ga0065165_1041273 | |||
| 1506 | Ga0065165_1049278 | |||
| 1507 | Ga0070658_10076494 | |||
| 1508 | Ga0070658_10221291 | |||
| 1509 | Ga0070676_10225461 | |||
| 1510 | Ga0070670_100152910 | |||
| 1511 | Ga0070677_10035552 | |||
| 1512 | Ga0068869_100082663 | |||
| 1513 | Ga0068869_101050448 | |||
| 1514 | Ga0068869_101076396 | |||
| 1515 | Ga0070680_100067108 | |||
| 1516 | Ga0070680_100247525 | |||
| 1517 | Ga0070682_100044400 | |||
| 1518 | Ga0070682_100189458 | |||
| 1519 | Ga0070682_100288353 | |||
| 1520 | Ga0070682_100635339 | |||
| 1521 | Ga0068868_100018112 | |||
| 1522 | Ga0068868_100332565 | |||
| 1523 | Ga0068868_100631270 | |||
| 1524 | Ga0068868_100791953 | |||
| 1525 | Ga0070660_100006991 | |||
| 1526 | Ga0070660_100034303 | |||
| 1527 | Ga0070660_100602996 | |||
| 1528 | Ga0070689_100003410 | |||
| 1529 | Ga0070691_10092996 | |||
| 1530 | Ga0070691_10202301 | |||
| 1531 | Ga0070687_100184969 | |||
| 1532 | Ga0070661_100116508 | |||
| 1533 | Ga0070661_100308864 | |||
| 1534 | Ga0070692_10283048 | |||
| 1535 | Ga0070668_100036445 | |||
| 1536 | Ga0070668_100107537 | |||
| 1537 | Ga0070668_100136497 | |||
| 1538 | Ga0070669_100093037 | |||
| 1539 | Ga0070675_100598194 | |||
| 1540 | Ga0070671_100048918 | |||
| 1541 | Ga0070671_100511190 | |||
| 1542 | Ga0070674_100047397 | |||
| 1543 | Ga0070674_100255194 | |||
| 1544 | Ga0070674_100276964 | |||
| 1545 | Ga0070674_100468151 | |||
| 1546 | Ga0070674_101127222 | |||
| 1547 | Ga0070673_100015849 | |||
| 1548 | Ga0070673_100283806 | |||
| 1549 | Ga0070688_100014954 | |||
| 1550 | Ga0070688_100273668 | |||
| 1551 | Ga0070688_100344952 | |||
| 1552 | Ga0070688_100489644 | |||
| 1553 | Ga0070688_100614993 | |||
| 1554 | Ga0070659_100161364 | |||
| 1555 | Ga0070667_100334348 | |||
| 1556 | Ga0070709_10023533 | |||
| 1557 | Ga0070709_10207058 | |||
| 1558 | Ga0070709_10426718 | |||
| 1559 | Ga0070709_10438058 | |||
| 1560 | Ga0070714_100021622 | |||
| 1561 | Ga0070714_100022361 | |||
| 1562 | Ga0070713_100003057 | |||
| 1563 | Ga0070713_100027241 | |||
| 1564 | Ga0070713_100194352 | |||
| 1565 | Ga0070713_100216448 | |||
| 1566 | Ga0070713_100254749 | |||
| 1567 | Ga0070713_100591018 | |||
| 1568 | Ga0070710_10000898 | |||
| 1569 | Ga0070710_10004992 | |||
| 1570 | Ga0070710_10057069 | |||
| 1571 | Ga0070710_10401405 | |||
| 1572 | Ga0070701_10190953 | |||
| 1573 | Ga0070701_10309709 | |||
| 1574 | Ga0070711_100006300 | |||
| 1575 | Ga0070711_100013080 | |||
| 1576 | Ga0070711_100130120 | |||
| 1577 | Ga0070711_100222189 | |||
| 1578 | Ga0070700_100140901 | |||
| 1579 | Ga0070700_100379811 | |||
| 1580 | Ga0070708_100688057 | |||
| 1581 | Ga0070663_100011845 | |||
| 1582 | Ga0070663_100059872 | |||
| 1583 | Ga0070663_100075825 | |||
| 1584 | Ga0070663_100082344 | |||
| 1585 | Ga0070663_100095393 | |||
| 1586 | Ga0070663_100118294 | |||
| 1587 | Ga0070663_100631414 | |||
| 1588 | Ga0070678_100027191 | |||
| 1589 | Ga0070678_100066613 | |||
| 1590 | Ga0070678_100180423 | |||
| 1591 | Ga0070678_100185985 | |||
| 1592 | Ga0070678_100325482 | |||
| 1593 | Ga0070678_101008292 | |||
| 1594 | Ga0070662_100036491 | |||
| 1595 | Ga0070662_100119335 | |||
| 1596 | Ga0070662_100405729 | |||
| 1597 | Ga0070662_100553987 | |||
| 1598 | Ga0070681_10076670 | |||
| 1599 | Ga0070681_10223639 | |||
| 1600 | Ga0070681_10258190 | |||
| 1601 | Ga0068867_100372931 | |||
| 1602 | Ga0068867_100461189 | |||
| 1603 | Ga0068867_100852289 | |||
| 1604 | Ga0070685_10505786 | |||
| 1605 | Ga0070706_100294995 | |||
| 1606 | Ga0070699_100004488 | |||
| 1607 | Ga0070699_100205190 | |||
| 1608 | Ga0070679_100009249 | |||
| 1609 | Ga0070679_100026486 | |||
| 1610 | Ga0070679_100051732 | |||
| 1611 | Ga0070679_100127331 | |||
| 1612 | Ga0070679_100141288 | |||
| 1613 | Ga0070679_100285103 | |||
| 1614 | Ga0070684_100008556 | |||
| 1615 | Ga0070684_100074126 | |||
| 1616 | Ga0070684_100254112 | |||
| 1617 | Ga0070684_100387896 | |||
| 1618 | Ga0070684_101017239 | |||
| 1619 | Ga0068853_100002207 | |||
| 1620 | Ga0068853_100045254 | |||
| 1621 | Ga0070672_100105181 | |||
| 1622 | Ga0070672_100210306 | |||
| 1623 | Ga0070686_100124132 | |||
| 1624 | Ga0070686_100124523 | |||
| 1625 | Ga0070686_100378295 | |||
| 1626 | Ga0070695_100555546 | |||
| 1627 | Ga0070693_100215366 | |||
| 1628 | Ga0070693_100300391 | |||
| 1629 | Ga0070693_100310317 | |||
| 1630 | Ga0070665_100009777 | |||
| 1631 | Ga0070665_100063185 | |||
| 1632 | Ga0070665_100105307 | |||
| 1633 | Ga0070665_100352248 | |||
| 1634 | Ga0070704_100143619 | |||
| 1635 | Ga0068855_100121549 | |||
| 1636 | Ga0068855_100259104 | |||
| 1637 | Ga0070664_100064592 | |||
| 1638 | Ga0070664_100187076 | |||
| 1639 | Ga0070664_100594533 | |||
| 1640 | Ga0068857_100536864 | |||
| 1641 | Ga0068854_100189435 | |||
| 1642 | Ga0068854_100414926 | |||
| 1643 | Ga0068854_100435446 | |||
| 1644 | Ga0068856_100271496 | |||
| 1645 | Ga0070702_100599263 | |||
| 1646 | Ga0068852_100028959 | |||
| 1647 | Ga0068852_100135745 | |||
| 1648 | Ga0068852_100136685 | |||
| 1649 | Ga0068852_100455078 | |||
| 1650 | Ga0068852_101002766 | |||
| 1651 | Ga0068859_100058039 | |||
| 1652 | Ga0068859_100279653 | |||
| 1653 | Ga0068859_100990076 | |||
| 1654 | Ga0068864_100274516 | |||
| 1655 | Ga0068864_100751491 | |||
| 1656 | Ga0068864_100826515 | |||
| 1657 | Ga0068866_10100091 | |||
| 1658 | Ga0068866_10327838 | |||
| 1659 | Ga0068861_100048184 | |||
| 1660 | Ga0068861_100092396 | |||
| 1661 | Ga0068851_10010608 | |||
| 1662 | Ga0068851_10065387 | |||
| 1663 | Ga0068851_10099650 | |||
| 1664 | Ga0068851_10226324 | |||
| 1665 | Ga0068851_10400191 | |||
| 1666 | Ga0068870_10106031 | |||
| 1667 | Ga0068870_10157228 | |||
| 1668 | Ga0068870_10545969 | |||
| 1669 | Ga0068863_100178070 | |||
| 1670 | Ga0068863_100560533 | |||
| 1671 | Ga0068858_100079901 | |||
| 1672 | Ga0068858_100359850 | |||
| 1673 | Ga0068858_100453593 | |||
| 1674 | Ga0068858_100701786 | |||
| 1675 | Ga0068858_100807844 | |||
| 1676 | Ga0068860_100002033 | |||
| 1677 | Ga0068860_100158101 | |||
| 1678 | Ga0068860_100233298 | |||
| 1679 | Ga0068860_101555008 | |||
| 1680 | Ga0068862_100028055 | |||
| 1681 | Ga0068862_100083389 | |||
| 1682 | Ga0068862_100119078 | |||
| 1683 | Ga0068862_100320479 | |||
| 1684 | Ga0081455_10004676 | |||
| 1685 | Ga0081455_10009004 | |||
| 1686 | Ga0081455_10010961 | |||
| 1687 | Ga0081455_10033922 | |||
| 1688 | Ga0081455_10083752 | |||
| 1689 | Ga0081455_10114395 | |||
| 1690 | Ga0081455_10180133 | |||
| 1691 | Ga0081538_10163438 | |||
| 1692 | Ga0081540_1002062 | |||
| 1693 | Ga0081540_1002136 | |||
| 1694 | Ga0081540_1004242 | |||
| 1695 | Ga0081540_1008268 | |||
| 1696 | Ga0081540_1008316 | |||
| 1697 | Ga0081540_1015931 | |||
| 1698 | Ga0081540_1021026 | |||
| 1699 | Ga0081540_1030563 | |||
| 1700 | Ga0081540_1043164 | |||
| 1701 | Ga0081540_1105433 | |||
| 1702 | Ga0081539_10000099 | |||
| 1703 | Ga0081539_10000349 | |||
| 1704 | Ga0081539_10005573 | |||
| 1705 | Ga0081539_10101203 | |||
| 1706 | Ga0070717_10003779 | |||
| 1707 | Ga0070717_10004793 | |||
| 1708 | Ga0070717_10078731 | |||
| 1709 | Ga0070717_10139271 | |||
| 1710 | Ga0070717_10699461 | |||
| 1711 | Ga0070717_10849307 | |||
| 1712 | Ga0075365_10030954 | |||
| 1713 | Ga0075365_10038399 | |||
| 1714 | Ga0075365_10046636 | |||
| 1715 | Ga0075365_10105449 | |||
| 1716 | Ga0075365_10124921 | |||
| 1717 | Ga0075365_10356209 | |||
| 1718 | Ga0075365_10356989 | |||
| 1719 | Ga0075365_10661244 | |||
| 1720 | Ga0075368_10037927 | |||
| 1721 | Ga0075368_10045140 | |||
| 1722 | Ga0075363_100005067 | |||
| 1723 | Ga0075363_100420213 | |||
| 1724 | Ga0075364_10095067 | |||
| 1725 | Ga0075364_10101798 | |||
| 1726 | Ga0075364_10288094 | |||
| 1727 | Ga0070715_10037720 | |||
| 1728 | Ga0070716_100008278 | |||
| 1729 | Ga0070712_100048450 | |||
| 1730 | Ga0070712_100062605 | |||
| 1731 | Ga0070712_100093190 | |||
| 1732 | Ga0070712_100294711 | |||
| 1733 | Ga0070712_100301268 | |||
| 1734 | Ga0070712_100349456 | |||
| 1735 | Ga0070712_100539466 | |||
| 1736 | Ga0075367_10013887 | |||
| 1737 | Ga0075367_10016061 | |||
| 1738 | Ga0075367_10019716 | |||
| 1739 | Ga0075367_10135468 | |||
| 1740 | Ga0075367_10303128 | |||
| 1741 | Ga0075367_10441974 | |||
| 1742 | Ga0075367_10450903 | |||
| 1743 | Ga0075369_10032817 | |||
| 1744 | Ga0075369_10035385 | |||
| 1745 | Ga0075366_10004220 | |||
| 1746 | Ga0075366_10160920 | |||
| 1747 | Ga0075366_10293055 | |||
| 1748 | Ga0097621_100376971 | |||
| 1749 | Ga0097621_100449291 | |||
| 1750 | Ga0097621_100473002 | |||
| 1751 | Ga0097621_100572044 | |||
| 1752 | Ga0097621_100734130 | |||
| 1753 | Ga0075370_10003183 | |||
| 1754 | Ga0075370_10084281 | |||
| 1755 | Ga0075370_10166136 | |||
| 1756 | Ga0075370_10331962 | |||
| 1757 | Ga0075370_10400884 | |||
| 1758 | Ga0068871_100194643 | |||
| 1759 | Ga0068871_100550763 | |||
| 1760 | Ga0075428_100120108 | |||
| 1761 | Ga0075428_100142954 | |||
| 1762 | Ga0075428_100814854 | |||
| 1763 | Ga0075430_100148246 | |||
| 1764 | Ga0075431_100272584 | |||
| 1765 | Ga0075434_100247369 | |||
| 1766 | Ga0068865_100076577 | |||
| 1767 | Ga0068865_100234576 | |||
| 1768 | Ga0068865_100443569 | |||
| 1769 | Ga0068865_100445543 | |||
| 1770 | Ga0075436_100707125 | |||
| 1771 | Ga0097620_100058038 | |||
| 1772 | Ga0097620_100279657 | |||
| 1773 | Ga0097620_100989817 | |||
| 1774 | Ga0099824_1023056 | |||
| 1775 | Ga0099822_1001448 | |||
| 1776 | Ga0099823_1004051 | |||
| 1777 | Ga0099794_10118786 | |||
| 1778 | Ga0099795_10010789 | |||
| 1779 | Ga0099795_10025253 | |||
| 1780 | Ga0099795_10033214 | |||
| 1781 | Ga0105250_10041341 | |||
| 1782 | Ga0105240_10008946 | |||
| 1783 | Ga0105240_10012128 | |||
| 1784 | Ga0105240_10029706 | |||
| 1785 | Ga0105240_10755909 | |||
| 1786 | Ga0105240_10866709 | |||
| 1787 | Ga0111539_10100511 | |||
| 1788 | Ga0111539_10620552 | |||
| 1789 | Ga0105245_10014034 | |||
| 1790 | Ga0105245_10035028 | |||
| 1791 | Ga0105245_10216755 | |||
| 1792 | Ga0105245_10247473 | |||
| 1793 | Ga0105245_11342145 | |||
| 1794 | Ga0105247_10087187 | |||
| 1795 | Ga0105247_10146839 | |||
| 1796 | Ga0105247_10280210 | |||
| 1797 | Ga0114129_10434534 | |||
| 1798 | Ga0114129_11182891 | |||
| 1799 | Ga0105243_10184971 | |||
| 1800 | Ga0105243_10710138 | |||
| 1801 | Ga0105241_10033592 | |||
| 1802 | Ga0105241_10040624 | |||
| 1803 | Ga0105241_10062620 | |||
| 1804 | Ga0105241_10608928 | |||
| 1805 | Ga0105242_10097450 | |||
| 1806 | Ga0105242_10156664 | |||
| 1807 | Ga0105242_10200858 | |||
| 1808 | Ga0105248_10029891 | |||
| 1809 | Ga0105248_10034176 | |||
| 1810 | Ga0105248_10237637 | |||
| 1811 | Ga0105237_10004719 | |||
| 1812 | Ga0105237_10019250 | |||
| 1813 | Ga0105237_10070348 | |||
| 1814 | Ga0105237_10328510 | |||
| 1815 | Ga0105237_10500675 | |||
| 1816 | Ga0105237_10562408 | |||
| 1817 | Ga0105237_10916003 | |||
| 1818 | Ga0105238_10003421 | |||
| 1819 | Ga0105238_10264193 | |||
| 1820 | Ga0105238_10398658 | |||
| 1821 | Ga0105249_10094865 | |||
| 1822 | Ga0105249_10623993 | |||
| 1823 | Ga0099796_10022143 | |||
| 1824 | Ga0099796_10031636 | |||
| 1825 | Ga0105239_10023212 | |||
| 1826 | Ga0105239_10053738 | |||
| 1827 | Ga0105239_10070697 | |||
| 1828 | Ga0105239_10079664 | |||
| 1829 | Ga0105239_10414734 | |||
| 1830 | Ga0105239_10438753 | |||
| 1831 | Ga0105239_10641795 | |||
| 1832 | Ga0105239_10768987 | |||
| 1833 | Ga0105239_10854939 | |||
| 1834 | Ga0105246_10012128 | |||
| 1835 | Ga0105246_10274457 | |||
| 1836 | Ga0157370_10101962 | |||
| 1837 | Ga0157370_10294789 | |||
| 1838 | Ga0157370_10690989 | |||
| 1839 | Ga0157369_10065365 | |||
| 1840 | Ga0157369_10102930 | |||
| 1841 | Ga0157374_10164515 | |||
| 1842 | Ga0157374_10244750 | |||
| 1843 | Ga0157378_10104776 | |||
| 1844 | Ga0157378_10415140 | |||
| 1845 | Ga0163162_10022106 | |||
| 1846 | Ga0163162_10081453 | |||
| 1847 | Ga0163162_10495094 | |||
| 1848 | Ga0163162_10612411 | |||
| 1849 | Ga0163162_10703340 | |||
| 1850 | Ga0163162_10978071 | |||
| 1851 | Ga0163162_11290870 | |||
| 1852 | Ga0163162_11582452 | |||
| 1853 | Ga0157372_10376992 | |||
| 1854 | Ga0157375_10064892 | |||
| 1855 | Ga0157375_10084799 | |||
| 1856 | Ga0157375_10249220 | |||
| 1857 | Ga0157375_10456856 | |||
| 1858 | Ga0157375_10651677 | |||
| 1859 | Ga0163163_10036647 | |||
| 1860 | Ga0163163_10155656 | |||
| 1861 | Ga0163163_10284233 | |||
| 1862 | Ga0163163_10349510 | |||
| 1863 | Ga0163163_11203376 | |||
| 1864 | Ga0157380_10013506 | |||
| 1865 | Ga0157380_10026474 | |||
| 1866 | Ga0157380_10336024 | |||
| 1867 | Ga0182008_10033738 | |||
| 1868 | Ga0157379_10257216 | |||
| 1869 | Ga0157379_10337907 | |||
| 1870 | Ga0157379_10377598 | |||
| 1871 | Ga0157376_10022095 | |||
| 1872 | Ga0157376_10109705 | |||
| 1873 | Ga0157376_10645124 | |||
| 1874 | Ga0157376_10745147 | |||
| 1875 | Ga0206355_1084398 | |||
| 1876 | Ga0206355_1509356 | |||
| 1877 | Ga0206353_10301445 | |||
| 1878 | Ga0214544_1000163 | |||
| 1879 | Ga0214542_1000156 | |||
| 1880 | Ga0214545_1000078 | |||
| 1881 | Ga0214543_1000136 | |||
| 1882 | Ga0213873_10090504 | |||
| 1883 | Ga0213874_10204173 | |||
| 1884 | Ga0213876_10009304 | |||
| 1885 | Ga0209563_108130 | |||
| 1886 | Ga0207425_1014237 | |||
| 1887 | Ga0209677_100831 | |||
| 1888 | Ga0209677_107533 | |||
| 1889 | Ga0209148_1000232 | |||
| 1890 | Ga0209233_1001298 | |||
| 1891 | Ga0209233_1005084 | |||
| 1892 | Ga0209233_1007012 | |||
| 1893 | Ga0209233_1015174 | |||
| 1894 | Ga0209130_1034896 | |||
| 1895 | Ga0209564_1013870 | |||
| 1896 | Ga0209758_1000294 | |||
| 1897 | Ga0209758_1000705 | |||
| 1898 | Ga0209758_1000932 | |||
| 1899 | Ga0209758_1000986 | |||
| 1900 | Ga0209758_1001737 | |||
| 1901 | Ga0209758_1002299 | |||
| 1902 | Ga0209758_1003580 | |||
| 1903 | Ga0209758_1046254 | |||
| 1904 | Ga0209758_1071115 | |||
| 1905 | Ga0209256_1008548 | |||
| 1906 | Ga0207426_1000632 | |||
| 1907 | Ga0207426_1001240 | |||
| 1908 | Ga0207426_1006296 | |||
| 1909 | Ga0207426_1020313 | |||
| 1910 | Ga0209257_1001185 | |||
| 1911 | Ga0209257_1042761 | |||
| 1912 | Ga0207697_10016590 | |||
| 1913 | Ga0207697_10017207 | |||
| 1914 | Ga0207697_10065008 | |||
| 1915 | Ga0207656_10099632 | |||
| 1916 | Ga0207656_10208555 | |||
| 1917 | Ga0207682_10014469 | |||
| 1918 | Ga0207682_10112858 | |||
| 1919 | Ga0207692_10009126 | |||
| 1920 | Ga0207692_10041740 | |||
| 1921 | Ga0207692_10082610 | |||
| 1922 | Ga0207692_10084679 | |||
| 1923 | Ga0207692_10198845 | |||
| 1924 | Ga0207642_10148028 | |||
| 1925 | Ga0207710_10002730 | |||
| 1926 | Ga0207710_10012543 | |||
| 1927 | Ga0207710_10061895 | |||
| 1928 | Ga0207710_10106267 | |||
| 1929 | Ga0207688_10130259 | |||
| 1930 | Ga0207688_10180981 | |||
| 1931 | Ga0207647_10169161 | |||
| 1932 | Ga0207647_10174003 | |||
| 1933 | Ga0207699_10001069 | |||
| 1934 | Ga0207699_10009102 | |||
| 1935 | Ga0207699_10038117 | |||
| 1936 | Ga0207699_10040581 | |||
| 1937 | Ga0207699_10126389 | |||
| 1938 | Ga0207699_10898627 | |||
| 1939 | Ga0207645_10080969 | |||
| 1940 | Ga0207643_10073962 | |||
| 1941 | Ga0207643_10164612 | |||
| 1942 | Ga0207705_10081980 | |||
| 1943 | Ga0207705_10345052 | |||
| 1944 | Ga0207684_10255293 | |||
| 1945 | Ga0207684_10653876 | |||
| 1946 | Ga0207684_10657426 | |||
| 1947 | Ga0207654_10017604 | |||
| 1948 | Ga0207654_10271149 | |||
| 1949 | Ga0207654_10338394 | |||
| 1950 | Ga0207707_10001541 | |||
| 1951 | Ga0207707_10002224 | |||
| 1952 | Ga0207707_10006422 | |||
| 1953 | Ga0207707_10027810 | |||
| 1954 | Ga0207695_10000123 | |||
| 1955 | Ga0207695_10046019 | |||
| 1956 | Ga0207695_10088527 | |||
| 1957 | Ga0207671_10009480 | |||
| 1958 | Ga0207671_10064994 | |||
| 1959 | Ga0207671_10134952 | |||
| 1960 | Ga0207671_10180264 | |||
| 1961 | Ga0207693_10000565 | |||
| 1962 | Ga0207693_10003555 | |||
| 1963 | Ga0207693_10018708 | |||
| 1964 | Ga0207693_10021554 | |||
| 1965 | Ga0207693_10076615 | |||
| 1966 | Ga0207663_10000239 | |||
| 1967 | Ga0207663_10012569 | |||
| 1968 | Ga0207663_10032661 | |||
| 1969 | Ga0207663_10171622 | |||
| 1970 | Ga0207660_10010206 | |||
| 1971 | Ga0207660_10517616 | |||
| 1972 | Ga0207660_10844845 | |||
| 1973 | Ga0207662_10122924 | |||
| 1974 | Ga0207662_10162091 | |||
| 1975 | Ga0207657_10005246 | |||
| 1976 | Ga0207657_10044766 | |||
| 1977 | Ga0207649_10108673 | |||
| 1978 | Ga0207649_10149858 | |||
| 1979 | Ga0207649_10490386 | |||
| 1980 | Ga0207652_10004348 | |||
| 1981 | Ga0207652_10087224 | |||
| 1982 | Ga0207652_10105233 | |||
| 1983 | Ga0207652_10141692 | |||
| 1984 | Ga0207652_10205046 | |||
| 1985 | Ga0207681_10068564 | |||
| 1986 | Ga0207681_10147608 | |||
| 1987 | Ga0207694_10075578 | |||
| 1988 | Ga0207694_10104378 | |||
| 1989 | Ga0207694_10140214 | |||
| 1990 | Ga0207694_10192758 | |||
| 1991 | Ga0207694_10379800 | |||
| 1992 | Ga0207650_10119131 | |||
| 1993 | Ga0207659_10033122 | |||
| 1994 | Ga0207687_10002549 | |||
| 1995 | Ga0207687_10030484 | |||
| 1996 | Ga0207700_10020496 | |||
| 1997 | Ga0207700_10109510 | |||
| 1998 | Ga0207700_10136981 | |||
| 1999 | Ga0207700_10144687 | |||
| 2000 | Ga0207700_10222775 | |||
| 2001 | Ga0207700_10563904 | |||
| 2002 | Ga0207664_10008257 | |||
| 2003 | Ga0207664_10022863 | |||
| 2004 | Ga0207664_10914425 | |||
| 2005 | Ga0207644_10055831 | |||
| 2006 | Ga0207644_10127632 | |||
| 2007 | Ga0207644_10301959 | |||
| 2008 | Ga0207644_10606968 | |||
| 2009 | Ga0207690_10102385 | |||
| 2010 | Ga0207690_10607343 | |||
| 2011 | Ga0207706_10063554 | |||
| 2012 | Ga0207706_10103304 | |||
| 2013 | Ga0207706_10116866 | |||
| 2014 | Ga0207706_10129804 | |||
| 2015 | Ga0207706_10158950 | |||
| 2016 | Ga0207706_10725673 | |||
| 2017 | Ga0207709_10006190 | |||
| 2018 | Ga0207709_10176383 | |||
| 2019 | Ga0207709_10177153 | |||
| 2020 | Ga0207670_10002928 | |||
| 2021 | Ga0207669_10068965 | |||
| 2022 | Ga0207669_10540936 | |||
| 2023 | Ga0207704_10006693 | |||
| 2024 | Ga0207704_10188160 | |||
| 2025 | Ga0207704_10286864 | |||
| 2026 | Ga0207704_10632492 | |||
| 2027 | Ga0207665_10000127 | |||
| 2028 | Ga0207665_10054670 | |||
| 2029 | Ga0207665_10100748 | |||
| 2030 | Ga0207665_10536614 | |||
| 2031 | Ga0207691_10083986 | |||
| 2032 | Ga0207691_10113799 | |||
| 2033 | Ga0207691_10159553 | |||
| 2034 | Ga0207711_10101876 | |||
| 2035 | Ga0207711_10321222 | |||
| 2036 | Ga0207711_10844031 | |||
| 2037 | Ga0207689_10087744 | |||
| 2038 | Ga0207689_10986595 | |||
| 2039 | Ga0207661_10082267 | |||
| 2040 | Ga0207661_10184630 | |||
| 2041 | Ga0207661_10903237 | |||
| 2042 | Ga0207679_10092963 | |||
| 2043 | Ga0207679_10375274 | |||
| 2044 | Ga0207679_10572341 | |||
| 2045 | Ga0207667_10012980 | |||
| 2046 | Ga0207667_10115171 | |||
| 2047 | Ga0207667_10258297 | |||
| 2048 | Ga0207667_10534465 | |||
| 2049 | Ga0207651_10087185 | |||
| 2050 | Ga0207712_10161210 | |||
| 2051 | Ga0207668_10005581 | |||
| 2052 | Ga0207668_10032114 | |||
| 2053 | Ga0207668_10033457 | |||
| 2054 | Ga0207668_10079730 | |||
| 2055 | Ga0207668_10309695 | |||
| 2056 | Ga0207668_10328109 | |||
| 2057 | Ga0207640_10117722 | |||
| 2058 | Ga0207640_10787973 | |||
| 2059 | Ga0207640_10832686 | |||
| 2060 | Ga0207658_10120481 | |||
| 2061 | Ga0207677_10006044 | |||
| 2062 | Ga0207677_10108914 | |||
| 2063 | Ga0207677_10205363 | |||
| 2064 | Ga0207677_10619679 | |||
| 2065 | Ga0207677_10666990 | |||
| 2066 | Ga0207703_10032293 | |||
| 2067 | Ga0207703_10091507 | |||
| 2068 | Ga0207703_10186517 | |||
| 2069 | Ga0207703_10515260 | |||
| 2070 | Ga0207639_10453797 | |||
| 2071 | Ga0207639_10668976 | |||
| 2072 | Ga0207678_10021488 | |||
| 2073 | Ga0207678_10022823 | |||
| 2074 | Ga0207678_10027315 | |||
| 2075 | Ga0207678_10048901 | |||
| 2076 | Ga0207678_10062786 | |||
| 2077 | Ga0207678_10080882 | |||
| 2078 | Ga0207678_10410125 | |||
| 2079 | Ga0207678_10658819 | |||
| 2080 | Ga0207708_10020931 | |||
| 2081 | Ga0207708_10441622 | |||
| 2082 | Ga0207702_10139751 | |||
| 2083 | Ga0207702_10355046 | |||
| 2084 | Ga0207641_10123517 | |||
| 2085 | Ga0207641_10246229 | |||
| 2086 | Ga0207641_10425599 | |||
| 2087 | Ga0207641_10720324 | |||
| 2088 | Ga0207648_10046915 | |||
| 2089 | Ga0207648_10062588 | |||
| 2090 | Ga0207648_10304250 | |||
| 2091 | Ga0207676_10564756 | |||
| 2092 | Ga0207674_10033992 | |||
| 2093 | Ga0207674_10094104 | |||
| 2094 | Ga0207675_100104527 | |||
| 2095 | Ga0207675_100836193 | |||
| 2096 | Ga0207683_10051919 | |||
| 2097 | Ga0207683_10056530 | |||
| 2098 | Ga0207683_10063916 | |||
| 2099 | Ga0207683_10089743 | |||
| 2100 | Ga0207683_10103355 | |||
| 2101 | Ga0207683_10106915 | |||
| 2102 | Ga0207683_10135139 | |||
| 2103 | Ga0207683_10176198 | |||
| 2104 | Ga0207698_10031006 | |||
| 2105 | Ga0207698_10087412 | |||
| 2106 | Ga0207698_10096641 | |||
| 2107 | Ga0207698_10276347 | |||
| 2108 | Ga0209389_1000019 | |||
| 2109 | Ga0209589_1000005 | |||
| 2110 | Ga0209489_100005 | |||
| 2111 | Ga0209489_100033 | |||
| 2112 | Ga0209700_100006 | |||
| 2113 | Ga0209700_100012 | |||
| 2114 | Ga0209179_1058177 | |||
| 2115 | Ga0209588_1030111 | |||
| 2116 | Ga0209813_10022047 | |||
| 2117 | Ga0268266_10012217 | |||
| 2118 | Ga0268266_10013853 | |||
| 2119 | Ga0268266_10077802 | |||
| 2120 | Ga0268266_10112988 | |||
| 2121 | Ga0268266_10297770 | |||
| 2122 | Ga0268266_10453774 | |||
| 2123 | Ga0268265_10022554 | |||
| 2124 | Ga0268265_10078528 | |||
| 2125 | Ga0268265_10079812 | |||
| 2126 | Ga0268265_10109386 | |||
| 2127 | Ga0268265_10308031 | |||
| 2128 | Ga0268264_10000174 | |||
| 2129 | Ga0268264_10158236 | |||
| 2130 | Ga0268264_10216954 | |||
| 2131 | Ga0307517_10000859 | |||
| 2132 | Ga0307517_10288563 | |||
| 2133 | Ga0307515_10028873 | |||
| 2134 | Ga0307511_10032093 | |||
| 2135 | Ga0265330_10092265 | |||
| 2136 | Ga0265332_10006382 | |||
| 2137 | Ga0265328_10107651 | |||
| 2138 | Ga0265325_10006821 | |||
| 2139 | Ga0265340_10009308 | |||
| 2140 | Ga0265340_10018122 | |||
| 2141 | Ga0265339_10011032 | |||
| 2142 | Ga0265339_10012299 | |||
| 2143 | Ga0265339_10147971 | |||
| 2144 | Ga0265331_10115078 | |||
| 2145 | Ga0265316_10297584 | |||
| 2146 | Ga0307513_10190067 | |||
| 2147 | Ga0307509_10006398 | |||
| 2148 | Ga0307509_10082116 | |||
| 2149 | Ga0307509_10287407 | |||
| 2150 | Ga0307508_10000063 | |||
| 2151 | Ga0307508_10175353 | |||
| 2152 | Ga0307508_10276764 | |||
| 2153 | Ga0265342_10005406 | |||
| 2154 | Ga0265342_10414484 | |||
| 2155 | Ga0307516_10043872 | |||
| 2156 | Ga0307516_10059646 | |||
| 2157 | Ga0307516_10233028 | |||
| 2158 | Ga0307405_10022939 | |||
| 2159 | Ga0307405_10421766 | |||
| 2160 | Ga0307413_10038231 | |||
| 2161 | Ga0307407_10285421 | |||
| 2162 | Ga0307412_10222845 | |||
| 2163 | Ga0307416_100339157 | |||
| 2164 | Ga0307416_100557320 | |||
| 2165 | Ga0307411_10215983 | |||
| 2166 | Ga0307411_10376020 | |||
| 2167 | Ga0307415_100027815 | |||
| 2168 | Ga0307415_100222388 | |||
| 2169 | Ga0307510_10019115 | |||
| 2170 | Ga0307510_10059498 | |||
| 2171 | Ga0307510_10126787 | |||
| 2172 | Ga0315911_1000040 | |||
| 2173 | Ga0316215_1000931 | |||
| 2174 | Ga0373930_0008599 | |||
| 2175 | Ga0373938_0003270 | |||
| 2176 | Ga0373926_0011522 | |||
| 2177 | Ga0373926_0052120 | |||
| 2178 | Ga0373928_0017581 | |||
| 2179 | Ga0373929_0007992 | |||
| 2180 | Ga0373929_0015014 | |||
| 2181 | Ga0373951_0035524 | |||
| 2182 | Ga0373952_0112859 | |||
| 2183 | Ga0373923_0021124 | |||
| 2184 | Ga0373923_0027670 | |||
| 2185 | Ga0373936_0006062 | |||
| 2186 | Ga0373939_0135250 | |||
| 2187 | Ga0373941_0022812 | |||
| 2188 | Ga0373945_0007291 | |||
| 2189 | Ga0373945_0039567 | |||
| 2190 | Ga0373953_0022125 | |||
| 2191 | Ga0373953_0055061 | |||
| 2192 | Ga0373954_0015754 | |||
| 2193 | Ga0373954_0031320 | |||
| 2194 | Ga0373956_0070077 | |||
| 2195 | Ga0373957_0057628 | |||
| 2196 | Ga0373957_0058267 | |||
| 2197 | Ga0373957_0076748 | |||
| 2198 | Ga0373960_0008005 | |||
| 2199 | Ga0373960_0070311 | |||
| 2200 | Ga0373943_0028008 | |||
| 2201 | Ga0373943_0110788 | |||
| 2202 | Ga0373943_0281472 | |||
| 2203 | Ga0373946_0129564 | |||
| 2204 | Ga0373946_0208450 | |||
| 2205 | Ga0373946_0328742 | |||
| 2206 | Ga0373955_0110530 | |||
| 2207 | Ga0373955_0284163 | |||
| 2208 | Ga0373942_0001205 | |||
| 2209 | Ga0373942_0014236 | |||
| 2210 | Ga0373961_0028713 | |||
| 2211 | Ga0373961_0041343 | |||
| 2212 | Ga0373962_0055943 | |||
| 2213 | Ga0373924_0056280 | |||
| 2214 | Ga0373924_0062915 | |||
| 2215 | Ga0373924_0064892 | |||
| 2216 | Ga0373931_0006487 | |||
| 2217 | Ga0373935_0000942 | |||
| 2218 | Ga0373935_0087971 | |||
| 2219 | Ga0373935_0121844 | |||
| 2220 | Ga0373935_0861206 | |||
| 2221 | Ga0373927_0000528 | |||
| 2222 | Ga0373927_0047023 | |||
| 2223 | Ga0373927_0054719 | |||
| 2224 | Ga0373933_0000204 | |||
| 2225 | Ga0373933_0085272 | |||
| 2226 | Ga0373933_0155861 | |||
| 2227 | Ga0373947_0000455 | |||
| 2228 | Ga0373947_0008198 | |||
| 2229 | Ga0373947_0039442 | |||
| 2230 | Ga0373947_0078436 | |||
| 2231 | Ga0373947_0141195 | |||
| 2232 | Ga0373947_0178048 | |||
| 2233 | Ga0373947_0227386 | |||
| 2234 | Ga0373947_0530890 | |||
| 2235 | Ga0373937_0004613 | |||
| 2236 | Ga0373937_0005769 | |||
| 2237 | Ga0373937_0043618 | |||
| 2238 | Ga0373937_0185926 | |||
| 2239 | Ga0373937_0368725 | |||
| 2240 | Ga0373937_0468570 | |||
| 2241 | Ga0310112_012733 | |||
| 2242 | Ga0372808_001169 | |||
| 2243 | Ga0310109_012364 | |||
| 2244 | Ga0373925_0003563 | |||
| 2245 | Ga0373925_0011034 | |||
| 2246 | Ga0373925_0041327 | |||
| 2247 | Ga0373925_0081325 | |||
| 2248 | Ga0373925_0104455 | |||
| 2249 | Ga0373925_0120167 | |||
| 2250 | Ga0373925_0230246 | |||
| 2251 | Ga0373925_0400183 | |||
| 2252 | Ga0395899_0603293 | |||
| 2253 | Ga0395900_0033975 | |||
| 2254 | Ga0395900_0353858 | |||
| 2255 | Ga0395898_0008444 | |||
| 2256 | Ga0395898_0228638 | |||
| 2257 | Ga0395898_0319214 | |||
| 2258 | Ga0395898_0827851 | |||
| 2259 | Ga0395905_0026848 | |||
| 2260 | Ga0395905_0077529 | |||
| 2261 | Ga0436364_0426854 | |||
| 2262 | Ga0395901_0067053 | |||
| 2263 | Ga0395901_0137764 | |||
| 2264 | Ga0436365_0551653 | |||
| 2265 | Ga0436365_0575320 | |||
| 2266 | Ga0436363_0319535 | |||
| 2267 | Ga0436363_0804071 | |||
| 2268 | Ga0436363_1060587 | |||
| 2269 | Ga0436363_1326108 | |||
| 2270 | Ga0436362_0343532 | |||
| 2271 | Ga0439453_0038544 | |||
| 2272 | Ga0439466_0203574 | |||
| 2273 | Ga0451789_1318524 | |||
| 2274 | Ga0451793_1573139 | |||
| 2275 | Ga0451797_0456458 | |||
| 2276 | Ga0451795_0000815 | |||
| 2277 | Ga0451800_0669687 | |||
| 2278 | Ga0451802_0603457 | |||
| 2279 | Ga0451835_0501209 | |||
| 2280 | Ga0451837_0151391 | |||
| 2281 | Ga0451845_0894429 | |||
| 2282 | Ga0451851_0779149 | |||
| 2283 | Ga0451843_1260463 | |||
| 2284 | Ga0451853_2500835 | |||
| 2285 | Ga0439456_035600 | |||
| 2286 | Ga0439459_0067665 | |||
| 2287 | Ga0466972_0019831 | |||
| 2288 | Ga0466966_0138961 | |||
| 2289 | Ga0466963_0029700 | |||
| 2290 | Ga0466971_0084464 | |||
| 2291 | Ga0466968_0032806 | |||
| 2292 | Ga0466957_0205718 | |||
| 2293 | Ga0466960_0278623 | |||
| 2294 | Ga0466967_0213851 | |||
| 2295 | Ga0466967_0529719 | |||
| 2296 | Ga0495617_058096 | |||
| 2297 | Ga0495592_0032569 | |||
| 2298 | Ga0495592_0178233 | |||
| 2299 | Ga0495603_0000239 | |||
| 2300 | Ga0495603_0015374 | |||
| 2301 | Ga0495603_0016923 | |||
| 2302 | Ga0495603_0031556 | |||
| 2303 | Ga0495603_0058945 | |||
| 2304 | Ga0495603_0190044 | |||
| 2305 | Ga0495603_0295826 | |||
| 2306 | Ga0495603_0560711 | |||
| 2307 | Ga0495590_0093377 | |||
| 2308 | Ga0495590_0242304 | |||
| 2309 | Ga0495629_0000457 | |||
| 2310 | Ga0495629_0139862 | |||
| 2311 | Ga0495629_0288904 | |||
| 2312 | Ga0495638_0076101 | |||
| 2313 | Ga0495641_0002157 | |||
| 2314 | Ga0495641_0112289 | |||
| 2315 | Ga0495651_0001839 | |||
| 2316 | Ga0495651_0017171 | |||
| 2317 | Ga0495651_0037984 | |||
| 2318 | Ga0495651_0133314 | |||
| 2319 | Ga0495653_0114429 | |||
| 2320 | Ga0495653_0155003 | |||
| 2321 | Ga0495653_0256511 | |||
| 2322 | Ga0495580_0002960 | |||
| 2323 | Ga0495580_0009091 | |||
| 2324 | Ga0495580_0162117 | |||
| 2325 | Ga0495580_0377485 | |||
| 2326 | Ga0495580_0418271 | |||
| 2327 | Ga0495582_0000077 | |||
| 2328 | Ga0495582_0008126 | |||
| 2329 | Ga0495605_0072849 | |||
| 2330 | Ga0495605_0240434 | |||
| 2331 | Ga0495639_0000101 | |||
| 2332 | Ga0495639_0077209 | |||
| 2333 | Ga0495662_0012510 | |||
| 2334 | Ga0495664_0041464 | |||
| 2335 | Ga0495664_0044789 | |||
| 2336 | Ga0495664_0057942 | |||
| 2337 | Ga0495664_0091013 | |||
| 2338 | Ga0495664_0156103 | |||
| 2339 | Ga0495584_0151207 | |||
| 2340 | Ga0495584_0159063 | |||
| 2341 | Ga0495584_0341558 | |||
| 2342 | Ga0495594_0000083 | |||
| 2343 | Ga0495583_0153046 | |||
| 2344 | Ga0495606_0000357 | |||
| 2345 | Ga0495606_0014109 | |||
| 2346 | Ga0495606_0061389 | |||
| 2347 | Ga0495608_0026963 | |||
| 2348 | Ga0495608_0061364 | |||
| 2349 | Ga0495608_0319874 | |||
| 2350 | Ga0495610_0165889 | |||
| 2351 | Ga0495618_0014258 | |||
| 2352 | Ga0495618_0089816 | |||
| 2353 | Ga0495628_0026676 | |||
| 2354 | Ga0495628_0105477 | |||
| 2355 | Ga0495628_0456940 | |||
| 2356 | Ga0495630_0012819 | |||
| 2357 | Ga0495630_0336632 | |||
| 2358 | Ga0495631_0148688 | |||
| 2359 | Ga0495632_0103428 | |||
| 2360 | Ga0495637_0146081 | |||
| 2361 | Ga0495643_0075302 | |||
| 2362 | Ga0495643_0090766 | |||
| 2363 | Ga0495644_0067688 | |||
| 2364 | Ga0495648_0007226 | |||
| 2365 | Ga0495648_0061450 | |||
| 2366 | Ga0495648_0110741 | |||
| 2367 | Ga0495666_0127088 | |||
| 2368 | Ga0495666_0328858 | |||
| 2369 | Ga0495642_0070438 | |||
| 2370 | Ga0495652_0011343 | |||
| 2371 | Ga0495652_0021917 | |||
| 2372 | Ga0495652_0070477 | |||
| 2373 | Ga0495652_0094100 | |||
| 2374 | Ga0495652_0213876 | |||
| 2375 | Ga0495665_0000055 | |||
| 2376 | Ga0495665_0103441 | |||
| 2377 | Ga0495640_0024673 | |||
| 2378 | Ga0495640_0046767 | |||
| 2379 | Ga0495640_0049091 | |||
| 2380 | Ga0495586_0046428 | |||
| 2381 | Ga0495586_0138473 | |||
| 2382 | Ga0495587_0005897 | |||
| 2383 | Ga0495587_0023897 | |||
| 2384 | Ga0495609_0101773 | |||
| 2385 | Ga0495597_0110448 | |||
| 2386 | Ga0495645_0005611 | |||
| 2387 | Ga0495645_0115470 | |||
| 2388 | Ga0495622_0002233 | |||
| 2389 | Ga0495622_0033493 | |||
| 2390 | Ga0495622_0166799 | |||
| 2391 | Ga0495633_0335488 | |||
| 2392 | Ga0495667_0014708 | |||
| 2393 | Ga0495667_0023279 | |||
| 2394 | Ga0495667_0197278 | |||
| 2395 | Ga0495656_0008262 | |||
| 2396 | Ga0495656_0028865 | |||
| 2397 | Ga0495668_0035547 | |||
| 2398 | Ga0495668_0118430 | |||
| 2399 | Ga0495668_0335804 | |||
| 2400 | Ga0495634_0001036 | |||
| 2401 | Ga0495634_0063846 | |||
| 2402 | Ga0495634_0084757 | |||
| 2403 | Ga0495634_0476507 | |||
| 2404 | Ga0495611_0238614 | |||
| 2405 | Ga0495625_0030051 | |||
| 2406 | Ga0495625_0267662 | |||
| 2407 | Ga0495625_0375103 | |||
| 2408 | Ga0495635_0000815 | |||
| 2409 | Ga0495635_0029736 | |||
| 2410 | Ga0495635_0063389 | |||
| 2411 | Ga0495635_0127604 | |||
| 2412 | Ga0495659_0004501 | |||
| 2413 | Ga0495661_0048855 | |||
| 2414 | Ga0495661_0192608 | |||
| 2415 | Ga0495588_0005058 | |||
| 2416 | Ga0495588_0005077 | |||
| 2417 | Ga0495588_0015996 | |||
| 2418 | Ga0495657_0004591 | |||
| 2419 | Ga0495657_0068646 | |||
| 2420 | Ga0495657_0197692 | |||
| 2421 | Ga0495599_0054221 | |||
| 2422 | Ga0495599_0097068 | |||
| 2423 | Ga0495623_0030892 | |||
| 2424 | Ga0495623_0077150 | |||
| 2425 | Ga0495646_0022610 | |||
| 2426 | Ga0495646_0208829 | |||
| 2427 | Ga0495647_0010626 | |||
| 2428 | Ga0495647_0027822 | |||
| 2429 | Ga0495658_0001572 | |||
| 2430 | Ga0495658_0176369 | |||
| 2431 | Ga0495658_0315219 | |||
| 2432 | Ga0495669_0002048 | |||
| 2433 | Ga0495669_0052218 | |||
| 2434 | Ga0495669_0257020 | |||
| 2435 | Ga0495613_0003480 | |||
| 2436 | Ga0495613_0165127 | |||
| 2437 | Ga0495613_0208249 | |||
| 2438 | Ga0495624_0000235 | |||
| 2439 | Ga0495624_0077983 | |||
| 2440 | Ga0495624_0112684 | |||
| 2441 | Ga0495624_0226142 | |||
| 2442 | Ga0495624_0338078 | |||
| 2443 | Ga0495670_0257557 | |||
| 2444 | Ga0495671_0212988 | |||
| 2445 | Ga0495649_0015557 | |||
| 2446 | Ga0495649_0326688 | |||
| 2447 | Ga0495600_0002795 | |||
| 2448 | Ga0495600_0015147 | |||
| 2449 | Ga0495600_0148342 | |||
| 2450 | Ga0495581_0000041 | |||
| 2451 | Ga0495581_0091175 | |||
| 2452 | Ga0495581_0206493 | |||
| 2453 | Ga0495581_0214912 | |||
| 2454 | Ga0495581_0225700 | |||
| 2455 | Ga0495581_0266748 | |||
| 2456 | Ga0495581_0365055 | |||
| 2457 | Ga0495604_0018047 | |||
| 2458 | Ga0495604_0070109 | |||
| 2459 | Ga0495604_0106288 | |||
| 2460 | Ga0495674_0001192 | |||
| 2461 | Ga0495674_0011929 | |||
| 2462 | Ga0495674_0136511 | |||
| 2463 | Ga0495674_0163470 | |||
| 2464 | Ga0495674_0670865 | |||
| 2465 | Ga0495674_1026699 | |||
| 2466 | Ga0495672_0110322 | |||
| 2467 | Ga0495672_0163323 | |||
| 2468 | Ga0495676_0018550 | |||
| 2469 | Ga0495676_0032821 | |||
| 2470 | Ga0495676_0218093 | |||
| 2471 | Ga0495676_0277904 | |||
| 2472 | Ga0495680_0001654 | |||
| 2473 | Ga0495680_0111828 | |||
| 2474 | Ga0495680_0154374 | |||
| 2475 | Ga0495680_0193025 | |||
| 2476 | Ga0495680_0528089 | |||
| 2477 | Ga0495683_0070598 | |||
| 2478 | Ga0495683_0136675 | |||
| 2479 | Ga0495687_132979 | |||
| 2480 | Ga0495675_0020899 | |||
| 2481 | Ga0495675_0151005 | |||
| 2482 | Ga0495677_0046040 | |||
| 2483 | Ga0495677_0090554 | |||
| 2484 | Ga0495685_140443 | |||
| 2485 | Ga0495673_0069225 | |||
| 2486 | Ga0495673_0096671 | |||
| 2487 | Ga0495684_0039273 | |||
| 2488 | Ga0495684_0183455 | |||
| 2489 | Ga0495684_0791517 | |||
| 2490 | Ga0495686_0324937 | |||
| 2491 | Ga0495593_0000024 | |||
| 2492 | Ga0495593_0055700 | |||
| 2493 | Ga0495593_0413604 | |||
| 2494 | Ga0495602_0050647 | |||
| 2495 | Ga0495602_0085186 | |||
| 2496 | Ga0495602_0350531 | |||
| 2497 | Ga0495626_0242914 | |||
| 2498 | Ga0496100_0011240 | |||
| 2499 | Ga0496100_0082313 | |||
| 2500 | Ga0496100_0191359 | |||
| 2501 | Ga0496100_0362698 | |||
| 2502 | Ga0496101_0005706 | |||
| 2503 | Ga0496101_0017665 | |||
| 2504 | Ga0496101_0034243 | |||
| 2505 | Ga0496101_0070654 | |||
| 2506 | Ga0496101_0188287 | |||
| 2507 | Ga0496101_0766514 | |||
| 2508 | Ga0496102_0014041 | |||
| 2509 | Ga0496102_0015668 | |||
| 2510 | Ga0496102_0092215 | |||
| 2511 | Ga0496102_0358055 | |||
| 2512 | Ga0496102_0371142 | |||
| 2513 | Ga0496103_0037032 | |||
| 2514 | Ga0496103_0197698 | |||
| 2515 | Ga0496103_0406165 | |||
| 2516 | Ga0496104_0007787 | |||
| 2517 | Ga0496104_0088068 | |||
| 2518 | Ga0496104_0135420 | |||
| 2519 | Ga0496104_0187277 | |||
| 2520 | Ga0496104_0345760 | |||
| 2521 | Ga0496104_0614143 | |||
| 2522 | Ga0496104_0758826 | |||
| 2523 | Ga0496105_0012396 | |||
| 2524 | Ga0496105_0013422 | |||
| 2525 | Ga0496105_0015800 | |||
| 2526 | Ga0496105_0034013 | |||
| 2527 | Ga0496105_0062282 | |||
| 2528 | Ga0496105_0639741 | |||
| 2529 | Ga0496106_0006865 | |||
| 2530 | Ga0496106_0017314 | |||
| 2531 | Ga0496106_0031297 | |||
| 2532 | Ga0496106_0039727 | |||
| 2533 | Ga0496106_0058706 | |||
| 2534 | Ga0496106_0149447 | |||
| 2535 | Ga0496107_0021914 | |||
| 2536 | Ga0496107_0036248 | |||
| 2537 | Ga0496107_0037820 | |||
| 2538 | Ga0496107_0055248 | |||
| 2539 | Ga0496107_0066054 | |||
| 2540 | Ga0496108_0043219 | |||
| 2541 | Ga0496108_0052323 | |||
| 2542 | Ga0496108_0907157 | |||
| 2543 | Ga0496109_0026126 | |||
| 2544 | Ga0496109_0028415 | |||
| 2545 | Ga0496109_0063752 | |||
| 2546 | Ga0496109_0195654 | |||
| 2547 | Ga0496109_0393781 | |||
| 2548 | Ga0496109_0704363 | |||
| 2549 | Ga0496110_0005741 | |||
| 2550 | Ga0496110_0083639 | |||
| 2551 | Ga0496110_0091790 | |||
| 2552 | Ga0496110_0116486 | |||
| 2553 | Ga0496110_0159652 | |||
| 2554 | Ga0496110_0213916 | |||
| 2555 | Ga0496110_0776679 | |||
| 2556 | Ga0496111_0024753 | |||
| 2557 | Ga0496111_0034236 | |||
| 2558 | Ga0496111_0042463 | |||
| 2559 | Ga0496111_0331758 | |||
| 2560 | Ga0496112_0000052 | |||
| 2561 | Ga0496112_0064719 | |||
| 2562 | Ga0496112_0178060 | |||
| 2563 | Ga0496112_0500060 | |||
| 2564 | Ga0496112_0700756 | |||
| 2565 | Ga0496113_0002503 | |||
| 2566 | Ga0496113_0055757 | |||
| 2567 | Ga0496113_0056499 | |||
| 2568 | Ga0496113_0156050 | |||
| 2569 | Ga0496113_0615574 | |||
| 2570 | Ga0496114_0009294 | |||
| 2571 | Ga0496114_0022402 | |||
| 2572 | Ga0496114_0048418 | |||
| 2573 | Ga0496114_0228006 | |||
| 2574 | Ga0496115_0001250 | |||
| 2575 | Ga0496115_0023466 | |||
| 2576 | Ga0496115_0034919 | |||
| 2577 | Ga0496115_0059345 | |||
| 2578 | Ga0496115_0102199 | |||
| 2579 | Ga0496115_0107575 | |||
| 2580 | Ga0496115_0246554 | |||
| 2581 | Ga0496115_0353280 | |||
| 2582 | Ga0496115_0575331 | |||
| 2583 | Ga0496116_0046981 | |||
| 2584 | Ga0496116_0281983 | |||
| 2585 | Ga0496117_0017488 | |||
| 2586 | Ga0496118_0039136 | |||
| 2587 | Ga0496118_0079862 | |||
| 2588 | Ga0496118_0099169 | |||
| 2589 | Ga0496118_0108048 | |||
| 2590 | Ga0496118_0289608 | |||
| 2591 | Ga0496119_0042593 | |||
| 2592 | Ga0496119_0047619 | |||
| 2593 | Ga0496119_0158590 | |||
| 2594 | Ga0496120_0013345 | |||
| 2595 | Ga0496120_0164156 | |||
| 2596 | Ga0496121_0007064 | |||
| 2597 | Ga0496121_0015737 | |||
| 2598 | Ga0496121_0061644 | |||
| 2599 | Ga0496121_0169886 | |||
| 2600 | Ga0496121_0184495 | |||
| 2601 | Ga0496121_0355463 | |||
| 2602 | Ga0496121_0517662 | |||
| 2603 | Ga0496121_0528391 | |||
| 2604 | Ga0496122_0044821 | |||
| 2605 | Ga0496124_0024995 | |||
| 2606 | Ga0496124_0058635 | |||
| 2607 | Ga0496124_0061641 | |||
| 2608 | Ga0496124_0099901 | |||
| 2609 | Ga0496124_0560303 | |||
| 2610 | Ga0496125_0027101 | |||
| 2611 | Ga0496125_0042169 | |||
| 2612 | Ga0496125_0063623 | |||
| 2613 | Ga0496125_0129856 | |||
| 2614 | Ga0496125_0130116 | |||
| 2615 | Ga0496126_0009548 | |||
| 2616 | Ga0496126_0021450 | |||
| 2617 | Ga0496126_0024908 | |||
| 2618 | Ga0496126_0052056 | |||
| 2619 | Ga0496126_0060792 | |||
| 2620 | Ga0496126_0082014 | |||
| 2621 | Ga0496126_0111925 | |||
| 2622 | Ga0496126_0132125 | |||
| 2623 | Ga0496126_0198738 | |||
| 2624 | Ga0496126_0278766 | |||
| 2625 | Ga0496126_0359422 | |||
| 2626 | Ga0496126_0475196 | |||
| 2627 | Ga0495678_076357 | |||
| 2628 | Ga0495682_0019019 | |||
| 2629 | Ga0495682_0178256 | |||
| 2630 | Ga0501046_0110561 | |||
| 2631 | Ga0501047_0051633 | |||
| 2632 | Ga0501048_0497167 | |||
| 2633 | Ga0501067_0039577 | |||
| 2634 | Ga0501069_0321218 | |||
| 2635 | Ga0501070_0085084 | |||
| 2636 | Ga0501070_0521090 | |||
| 2637 | Ga0501074_0019696 | |||
| 2638 | Ga0501076_0363492 | |||
| 2639 | Ga0501077_0758785 | |||
| 2640 | Ga0501079_0296046 | |||
| 2641 | Ga0501080_0283585 | |||
| 2642 | Ga0501044_0063921 | |||
| 2643 | nmdc:mga03683_369144_c1 | |||
| 2644 | nmdc:mga03683_56942_c1 | |||
| 2645 | nmdc:mga03n38_131764_c1 | |||
| 2646 | nmdc:mga03n38_297300_c1 | |||
| 2647 | nmdc:mga03n38_388225_c1 | |||
| 2648 | nmdc:mga00v17_59291_c1 | |||
| 2649 | nmdc:mga00v17_79825_c1 | |||
| 2650 | nmdc:mga0yw44_18644_c1 | |||
| 2651 | nmdc:mga0yw44_376143_c1 | |||
| 2652 | nmdc:mga0yw44_489888_c1 | |||
| 2653 | nmdc:mga0yw44_606324_c1 | |||
| 2654 | nmdc:mga0k408_236877_c1 | |||
| 2655 | nmdc:mga0k408_252578_c1 | |||
| 2656 | nmdc:mga0k408_8015_c1 | |||
| 2657 | nmdc:mga06z11_124267_c1 | |||
| 2658 | nmdc:mga06z11_379571_c1 | |||
| 2659 | nmdc:mga06z11_423829_c1 | |||
| 2660 | nmdc:mga06z11_52802_c1 | |||
| 2661 | nmdc:mga06z11_742803_c1 | |||
| 2662 | nmdc:mga04h51_9301_c1 | |||
| 2663 | nmdc:mga07m45_118401_c1 | |||
| 2664 | nmdc:mga07m45_146155_c1 | |||
| 2665 | nmdc:mga07m45_225798_c1 | |||
| 2666 | nmdc:mga07m45_284446_c1 | |||
| 2667 | nmdc:mga07m45_84199_c1 | |||
| 2668 | nmdc:mga07m45_8848_c1 | |||
| 2669 | nmdc:mga05p37_296846_c1 | |||
| 2670 | nmdc:mga09592_472867_c1 | |||
| 2671 | nmdc:mga09592_852083_c1 | |||
| 2672 | nmdc:mga0qj67_491781_c1 | |||
| 2673 | nmdc:mga06r32_35594_c1 | |||
| 2674 | nmdc:mga08y16_182493_c1 | |||
| 2675 | nmdc:mga08y16_80488_c1 | |||
| 2676 | nmdc:mga0n895_210173_c1 | |||
| 2677 | nmdc:mga0n895_234505_c1 | |||
| 2678 | nmdc:mga08x19_170936_c1 | |||
| 2679 | nmdc:mga0sz30_52882_c1 | |||
| 2680 | Ga0495601_0028308 | |||
| 2681 | Ga0495601_0050959 | |||
| 2682 | Ga0495601_0581725 | |||
| 2683 | Ga0495612_0095370 | |||
| 2684 | Ga0500635_0001974 | |||
| 2685 | Ga0495655_0005605 | |||
| 2686 | Ga0495655_0011323 | |||
| 2687 | Ga0495655_0147245 | |||
| 2688 | Ga0495595_0295542 | |||
| 2689 | Ga0495619_0058227 | |||
| 2690 | Ga0495619_0201397 | |||
| 2691 | Ga0500578_0065579 | |||
| 2692 | Ga0500643_009443 | |||
| 2693 | Ga0500646_0129889 | |||
| 2694 | Ga0500647_0026362 | |||
| 2695 | Ga0500647_0247577 | |||
| 2696 | Ga0500651_0038749 | |||
| 2697 | Ga0500651_0133134 | |||
| 2698 | Ga0500651_0221003 | |||
| 2699 | Ga0500566_0001419 | |||
| 2700 | Ga0500566_0012672 | |||
| 2701 | Ga0500566_0012702 | |||
| 2702 | Ga0500640_000253 | |||
| 2703 | Ga0500641_0005024 | |||
| 2704 | Ga0500641_0024967 | |||
| 2705 | Ga0500650_0065434 | |||
| 2706 | Ga0500650_0187205 | |||
| 2707 | Ga0500650_0279517 | |||
| 2708 | Ga0500554_003440 | |||
| 2709 | Ga0500554_097943 | |||
| 2710 | Ga0500555_040298 | |||
| 2711 | Ga0500556_0130958 | |||
| 2712 | Ga0500557_000077 | |||
| 2713 | Ga0500562_008760 | |||
| 2714 | Ga0500569_019077 | |||
| 2715 | Ga0500569_117683 | |||
| 2716 | Ga0500572_000199 | |||
| 2717 | Ga0500580_155697 | |||
| 2718 | Ga0500591_127801 | |||
| 2719 | Ga0500593_210889 | |||
| 2720 | Ga0500595_000842 | |||
| 2721 | Ga0500595_001951 | |||
| 2722 | Ga0500595_026055 | |||
| 2723 | Ga0500595_033593 | |||
| 2724 | Ga0500597_092711 | |||
| 2725 | Ga0500597_171874 | |||
| 2726 | Ga0500614_000715 | |||
| 2727 | Ga0500618_074244 | |||
| 2728 | Ga0500642_0000381 | |||
| 2729 | Ga0500652_017525 | |||
| 2730 | Ga0500655_017813 | |||
| 2731 | Ga0500658_0011386 | |||
| 2732 | Ga0500559_0001308 | |||
| 2733 | Ga0500559_0015190 | |||
| 2734 | Ga0500559_0033115 | |||
| 2735 | Ga0500561_0076190 | |||
| 2736 | Ga0500568_0025605 | |||
| 2737 | Ga0500568_0040223 | |||
| 2738 | Ga0500568_0111366 | |||
| 2739 | Ga0500573_0008543 | |||
| 2740 | Ga0500577_0254070 | |||
| 2741 | Ga0500588_0013956 | |||
| 2742 | Ga0500588_0045892 | |||
| 2743 | Ga0500590_115662 | |||
| 2744 | Ga0500590_236232 | |||
| 2745 | Ga0500603_000226 | |||
| 2746 | Ga0500603_000580 | |||
| 2747 | Ga0500603_033497 | |||
| 2748 | Ga0500604_0020234 | |||
| 2749 | Ga0500616_0150912 | |||
| 2750 | Ga0500622_0100369 | |||
| 2751 | Ga0500622_0309444 | |||
| 2752 | Ga0500627_0254523 | |||
| 2753 | Ga0500630_000573 | |||
| 2754 | Ga0500634_0075126 | |||
| 2755 | Ga0500638_001609 | |||
| 2756 | Ga0500638_103774 | |||
| 2757 | Ga0500638_106684 | |||
| 2758 | Ga0500638_147627 | |||
| 2759 | Ga0500638_184845 | |||
| 2760 | Ga0500639_000006 | |||
| 2761 | Ga0500639_048715 | |||
| 2762 | Ga0500639_061171 | |||
| 2763 | Ga0500636_0013138 | |||
| 2764 | Ga0500636_0030340 | |||
| 2765 | Ga0500636_0326661 | |||
| 2766 | Ga0500637_0000251 | |||
| 2767 | Ga0500637_0003349 | |||
| 2768 | Ga0500637_0062354 | |||
| 2769 | Ga0500637_0127120 | |||
| 2770 | Ga0500637_0241712 | |||
| 2771 | Ga0500657_101993 | |||
| 2772 | Ga0500625_009381 | |||
| 2773 | Ga0500645_032182 | |||
| 2774 | Ga0500645_071012 | |||
| 2775 | Ga0500609_020918 | |||
| 2776 | Ga0500609_027898 | |||
| 2777 | Ga0500552_006601 | |||
| 2778 | Ga0500552_015254 | |||
| 2779 | Ga0500596_000603 | |||
| 2780 | Ga0500596_003281 | |||
| 2781 | Ga0500596_012112 | |||
| 2782 | Ga0500601_000371 | |||
| 2783 | Ga0501082_0375794 | |||
| 2784 | Ga0530510_0471127 | |||
| 2785 | 2507511876 | |||
| 2786 | 2508545540 | |||
| 2787 | 2508694358 | |||
| 2788 | 2509146624 | |||
| 2789 | 2513673496 | |||
| 2790 | 2513717792 | |||
| 2791 | 2513875298 | |||
| 2792 | 2514014404 | |||
| 2793 | 2515624711 | |||
| 2794 | 2517108572 | |||
| 2795 | 2524438318 | |||
| 2796 | 2528854955 | |||
| 2797 | 2617349628 | |||
| 2798 | 2617376814 | |||
| 2799 | 2728752343 | |||
| 2800 | 2745078536 | |||
| 2801 | 2793059633 | |||
| 2802 | 2793069608 | |||
| 2803 | 2793080289 | |||
| 2804 | 2805921873 | |||
| 2805 | 2824608015 | |||
| 2806 | 2824615055 | |||
| 2807 | 2824624848 | |||
| 2808 | 2824633746 | |||
| 2809 | 2824642309 | |||
| 2810 | 2824649645 | |||
| 2811 | 2824659529 | |||
| 2812 | 2824670057 | |||
| 2813 | 2824676705 | |||
| 2814 | 2824692994 | |||
| 2815 | 2824702579 | |||
| 2816 | 2824712401 | |||
| 2817 | 2824719747 | |||
| 2818 | 2824730050 | |||
| 2819 | 2824738291 | |||
| 2820 | 2824751732 | |||
| 2821 | 2824762425 | |||
| 2822 | 2824772740 | |||
| 2823 | 2824776991 | |||
| 2824 | 2838128390 | |||
| 2825 | 2841942250 | |||
| 2826 | 2841955620 | |||
| 2827 | 2841960961 | |||
| 2828 | 2841971229 | |||
| 2829 | 2841982349 | |||
| 2830 | 2841984264 | |||
| 2831 | 2844321093 | |||
| 2832 | 2847932306 | |||
| 2833 | 2847943541 | |||
| 2834 | 2849077264 | |||
| 2835 | 2857515161 | |||
| 2836 | 2874592256 | |||
| 2837 | 2874624009 | |||
| 2838 | 2874630983 | |||
| 2839 | 2874647372 | |||
| 2840 | 2876767414 | |||
| 2841 | 2876774783 | |||
| 2842 | 2876809828 | |||
| 2843 | 2876819736 | |||
| 2844 | 2879079351 | |||
| 2845 | 2879091529 | |||
| 2846 | 2879101399 | |||
| 2847 | 2879113775 | |||
| 2848 | 2879129085 | |||
| 2849 | 2879144760 | |||
| 2850 | 2881371131 | |||
| 2851 | 2885374061 | |||
| 2852 | 2885382989 | |||
| 2853 | 2888391817 | |||
| 2854 | 2888426607 | |||
| 2855 | 2889033864 | |||
| 2856 | 2903728516 | |||
| 2857 | 2903773947 | |||
| 2858 | 2904670720 | |||
| 2859 | 2904699114 | |||
| 2860 | 2904713671 | |||
| 2861 | 2906607708 | |||
| 2862 | 2906615568 | |||
| 2863 | 2906627115 | |||
| 2864 | 2906645375 | |||
| 2865 | 2908745611 | |||
| 2866 | 2908763683 | |||
| 2867 | 2908782712 | |||
| 2868 | 2922367286 | |||
| 2869 | 2922370559 | |||
| 2870 | 2922390010 | |||
| 2871 | 2922432438 | |||
| 2872 | 2929620135 | |||
| 2873 | 2929629448 | |||
| 2874 | 2932791490 | |||
| 2875 | 2932796893 | |||
| 2876 | 2932802329 | |||
| 2877 | 2932816746 | |||
| 2878 | 2932824072 | |||
| 2879 | 2932835392 | |||
| 2880 | 2933582052 | |||
| 2881 | 2935613481 | |||
| 2882 | 2935621135 | |||
| 2883 | 2935630749 | |||
| 2884 | 2935643558 | |||
| 2885 | 2935650477 | |||
| 2886 | 2935662919 | |||
| 2887 | 2935671132 | |||
| 2888 | 2935681262 | |||
| 2889 | 2935689395 | |||
| 2890 | 2935699970 | |||
| 2891 | 2935712099 | |||
| 2892 | 2935720341 | |||
| 2893 | 2935728042 | |||
| 2894 | 2935737361 | |||
| 2895 | 2935746578 | |||
| 2896 | 2935757545 | |||
| 2897 | 2935763922 | |||
| 2898 | 2935776642 | |||
| 2899 | 2935781535 | |||
| 2900 | 2935789853 | |||
| 2901 | 2935798381 | |||
| 2902 | 2935807899 | |||
| 2903 | 2935818767 | |||
| 2904 | 2935824666 | |||
| 2905 | 2935833075 | |||
| 2906 | 2935844269 | |||
| 2907 | 2935851886 | |||
| 2908 | 2935859672 | |||
| 2909 | 2935872070 | |||
| 2910 | 2935879006 | |||
| 2911 | 2935887231 | |||
| 2912 | 2935911236 | |||
| 2913 | 2935920768 | |||
| 2914 | 2935928265 | |||
| 2915 | 2935937910 | |||
| 2916 | 2935945192 | |||
| 2917 | 2935954302 | |||
| 2918 | 2935971430 | |||
| 2919 | 2935982050 | |||
| 2920 | 2935990611 | |||
| 2921 | 2936000353 | |||
| 2922 | 2936008511 | |||
| 2923 | 2936017167 | |||
| 2924 | 2936026698 | |||
| 2925 | 2936035441 | |||
| 2926 | 2936045577 | |||
| 2927 | 2936053590 | |||
| 2928 | 2936062668 | |||
| 2929 | 2940563633 | |||
| 2930 | 2941507401 | |||
| 2931 | 2941515828 | |||
| 2932 | 2941523464 | |||
| 2933 | 2941542601 | |||
| 2934 | 3005506907 | |||
| 2935 | 3005591714 | |||
| 2936 | 3005601433 | |||
| 2937 | 3005717154 | |||
| 2938 | 8006966126 | |||
| 2939 | 8006989711 | |||
| 2940 | 8016519489 | |||
| 2941 | 8016524868 | |||
| 2942 | 8016542724 | |||
| 2943 | 8016550557 | |||
| 2944 | 8016558977 | |||
| 2945 | 8016580785 | |||
| 2946 | 8016588686 | |||
| 2947 | 8016596938 | |||
| 2948 | 8016607846 | |||
| 2949 | 8016619629 | |||
| 2950 | 8016637186 | |||
| 2951 | 8017066033 | |||
| 2952 | 8019538108 | |||
| 2953 | 8019541875 | |||
| 2954 | 8019563774 | |||
| 2955 | 8019573839 | |||
| 2956 | 8019578599 | |||
| 2957 | 8019596649 | |||
| 2958 | 8019605054 | |||
| 2959 | 8019613481 | |||
| 2960 | 8019624151 | |||
| 2961 | 8019637876 | |||
| 2962 | 8019641748 | |||
| 2963 | 8019665805 | |||
| 2964 | 8019694994 | |||
| 2965 | 8055750112 | |||
| 2966 | 8056684617 | |||
| 2967 | 8056696201 | |||
| 2968 | 8056975891 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8qyr-assembly1.cif.gz_B | beta-cardiac myosin motor domain in the pre-powerstroke state complexed to mavacamten | 0.8708 | 36 | 61 |
| 7x7q-assembly1.cif.gz_H | cryoem structure of ruva-ruvb-holliday junction complex | 0.8392 | 35 | 62 |
| 2oqk-assembly1.cif.gz_A | crystal structure of putative cryptosporidium parvum translation initiation factor eif-1a | 0.7988 | 33 | 66 |
| 3udi-assembly1.cif.gz_A | crystal structure of acinetobacter baumannii pbp1a in complex with penicillin g | 0.7923 | 33 | 61 |
| 3udf-assembly1.cif.gz_A | crystal structure of apo pbp1a from acinetobacter baumannii | 0.791 | 33 | 61 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O13936_472_519_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9403 | 36 | 61 | 2.30.30.30 |
| af_A0A0P0W5U4_33_123_2.30.30.360 | Mainly Beta;Roll;SH3 type barrels.;Myosin S1 fragment, N-terminal | 0.9256 | 36 | 61 | 2.30.30.360 |
| af_A0A2R8QM44_30_80_2.30.30.360 | Mainly Beta;Roll;SH3 type barrels.;Myosin S1 fragment, N-terminal | 0.9117 | 36 | 61 | 2.30.30.360 |
| 1d8lB02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.888 | 35 | 63 | 2.40.50.140 |
| af_A0A0R0H3D7_137_176_2.30.30.140 | Mainly Beta;Roll;SH3 type barrels.; | 0.8805 | 38 | 61 | 2.30.30.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1E1V4W6-F1-model_v4 | DUF5666 domain-containing protein | 0.9148 | 35 | 208 |
|
| AF-H0TIX6-F1-model_v4 | DUF5666 domain-containing protein | 0.911 | 37 | 208 |
|
| AF-A0A4R3M5L2-F1-model_v4 | DUF5666 domain-containing protein | 0.911 | 35 | 208 |
|
| AF-U6ZQW0-F1-model_v4 | deleted | 0.9089 | 35 | 208 |
|
| AF-A0A0K2GDJ4-F1-model_v4 | DUF5666 domain-containing protein | 0.9046 | 35 | 70 |
|