F494313

General Info

Members Datasets Scaffolds Average Seq Length
1487 751 1208 216

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1000086|Ga0065165_100008619
Length 245
Sequence MIEFDFGAVLAEWPLLLRGLAWTVGLTAVAVPLGLLIATLGAWARACGSAALRRAVGVYVELLRNTPFIVQLFFVFFGLPAMGVKLSPEAASLIAMTLNLGAYGTEILRAGIQAAPRGQWEAAQSLALGPTQVFTRVILPPAFKRVWPAMTSQIVIVMLGSAVCGQISTEELSYATNLIHSRNFRAFEATFVALAIYLALTLMLRRFLLWAGPRWFFGGASLPMRPSLWRRLGRAAGAGAGAAND

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
7 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
8 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
9 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
10 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
11 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
12 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
13 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
14 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
15 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
16 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
17 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
18 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
19 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
20 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
21 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
22 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
23 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
24 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
25 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
26 2516143018 Ensifer sp. BR816 Isolate Nodule
27 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
28 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
29 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
30 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
31 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
32 2547132374 Acidovorax radicis N35 Isolate Unclassified
33 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
34 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
35 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
36 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
37 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
38 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
39 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
40 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
41 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
42 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
43 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
44 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
45 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
46 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
47 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
48 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
49 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
50 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
51 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
52 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
53 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
54 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
55 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
56 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
57 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
58 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
59 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
60 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
61 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
62 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
63 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
64 2643221570 Acidovorax sp. Root568 Isolate Unclassified
65 2643221585 Pelomonas sp. Root662 Isolate Unclassified
66 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
67 2643221609 Acidovorax sp. Root217 Isolate Unclassified
68 2643221611 Acidovorax sp. Root219 Isolate Unclassified
69 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
70 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
71 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
72 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
73 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
74 2643221652 Acidovorax sp. Root402 Isolate Unclassified
75 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
76 2643221656 Pelomonas sp. Root405 Isolate Unclassified
77 2643221658 Variovorax sp. Root411 Isolate Unclassified
78 2643221672 Variovorax sp. Root434 Isolate Unclassified
79 2643221683 Variovorax sp. Root473 Isolate Unclassified
80 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
81 2643221717 Acidovorax sp. Root267 Isolate Unclassified
82 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
83 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
84 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
85 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
86 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
87 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
88 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
89 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
90 2718218365 Rhizobium sp. N731 Isolate Nodule
91 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
92 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
93 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
94 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
95 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
96 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
97 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
98 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
99 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
100 2728369397 Rhizobium sp. N1314 Isolate Nodule
101 2738541277 Variovorax sp. GV051 Isolate Unclassified
102 2738541307 Variovorax sp. GV008 Isolate Unclassified
103 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
104 2738543012 Acidovorax sp. CF301 Isolate Unclassified
105 2738543019 Variovorax sp. GV040 Isolate Unclassified
106 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
107 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
108 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
109 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
110 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
111 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
112 2791355199
113 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
114 2791355256 Rhizobium sp. M10 Isolate Nodule
115 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
116 2791355261 Rhizobium sp. J15 Isolate Nodule
117 2791355262 Rhizobium sp. M1 Isolate Nodule
118 2791355263 Rhizobium chutanense C5 Isolate Nodule
119 2791355265 Rhizobium sp. H4 Isolate Nodule
120 2791355266 Rhizobium sp. L43 Isolate Nodule
121 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
122 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
123 2802429633 Rhizobium anhuiense J3 Isolate Nodule
124 2802429634 Rhizobium anhuiense S10 Isolate Nodule
125 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
126 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
127 2802429637 Rhizobium anhuiense C15 Isolate Nodule
128 2816332133 Acidovorax radicis 2721A Isolate Unclassified
129 2818991446 Variovorax sp. 1180 Isolate Unclassified
130 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
131 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
132 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
133 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
134 2831864461 Roseateles noduli HZ7 Isolate Nodule
135 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
136 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
137 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
138 2838048938 Rhizobium pisi 27/80 Isolate Nodule
139 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
140 2838061910 Rhizobium phaseoli L15 Isolate Nodule
141 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
142 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
143 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
144 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
145 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
146 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
147 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
148 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
149 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
150 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
151 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
152 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
153 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
154 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
155 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
156 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
157 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
158 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
159 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
160 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
161 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
162 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
163 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
164 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
165 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
166 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
167 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
168 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
169 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
170 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
171 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
172 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
173 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
174 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
175 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
176 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
177 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
178 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
179 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
180 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
181 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
182 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
183 2842677519 Variovorax sp. R-72495 Isolate Unclassified
184 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
185 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
186 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
187 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
188 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
189 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
190 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
191 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
192 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
193 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
194 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
195 2885198086 Variovorax sp. 679 Isolate Unclassified
196 2885211737 Variovorax sp. 553 Isolate Unclassified
197 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
198 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
199 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
200 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
201 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
202 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
203 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
204 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
205 2899924645 Variovorax sp. 369 Isolate Unclassified
206 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
207 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
208 2904456579 Variovorax sp. 2002 Isolate Unclassified
209 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
210 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
211 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
212 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
213 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
214 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
215 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
216 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
217 2928037797 Variovorax sp. 1126 Isolate Unclassified
218 2928044640 Variovorax sp. 1128 Isolate Unclassified
219 2928051484 Variovorax sp. 1133 Isolate Unclassified
220 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
221 2928070936 Variovorax gossypii 1167 Isolate Unclassified
222 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
223 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
224 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
225 2929520902 Variovorax beijingensis 502 Isolate Unclassified
226 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
227 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
228 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
229 2933599457 Rhizobium phaseoli M3 Isolate Nodule
230 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
231 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
232 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
233 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
234 2936381700 Rhizobium chutanense C16 Isolate Unclassified
235 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
236 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
237 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
238 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
239 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
240 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
241 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
242 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
243 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
244 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
245 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
246 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
247 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
248 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
249 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
250 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
251 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
252 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
253 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
254 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
255 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
256 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
257 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
258 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
259 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
260 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
261 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
262 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
263 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
264 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
265 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
266 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
267 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
268 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
269 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
270 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
271 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
272 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
273 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
274 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
275 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
276 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
277 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
278 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
279 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
280 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
281 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
282 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
283 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
284 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
285 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
286 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
287 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
288 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
289 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
290 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
291 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
292 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
293 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
294 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
295 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
296 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
297 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
298 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
299 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
300 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
301 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
302 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
303 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
304 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
305 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
306 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
307 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
308 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
309 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
310 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
311 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
312 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
313 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
314 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
315 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
316 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
317 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
318 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
319 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
320 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
321 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
322 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
323 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
324 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
325 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
326 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
327 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
328 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
329 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
330 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
331 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
332 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
333 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
334 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
335 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
336 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
337 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
338 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
339 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
340 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
341 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
342 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
343 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
344 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
345 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
346 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
347 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
348 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
349 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
350 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
351 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
352 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
353 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
354 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
355 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
356 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
357 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
358 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
359 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
360 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
361 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
362 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
363 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
364 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
365 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
366 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
367 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
368 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
369 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
370 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
371 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
372 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
373 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
374 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
375 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
376 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
377 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
378 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
379 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
380 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
381 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
382 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
383 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
384 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
385 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
386 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
387 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
388 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
389 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
390 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
391 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
392 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
393 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
394 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
395 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
396 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
397 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
398 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
399 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
400 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
401 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
402 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
403 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
404 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
405 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
406 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
407 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
408 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
409 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
444 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
449 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
450 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
451 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
452 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
453 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
455 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
456 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
457 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
458 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
459 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
460 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
461 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
463 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
464 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
465 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
466 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
467 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
468 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
469 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
470 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
471 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
472 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
473 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
474 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
475 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
477 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
478 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
479 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
480 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
481 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
482 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
483 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
484 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
485 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
486 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
487 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
488 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
489 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
490 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
491 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
492 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
493 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
494 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
495 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
496 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
497 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
498 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
499 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
500 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
501 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
502 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
503 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
504 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
505 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
506 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
507 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
508 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
509 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
510 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
511 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
512 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
513 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
514 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
515 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
516 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
517 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
518 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
519 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
520 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
521 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
522 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
523 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
524 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
525 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
526 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
527 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
528 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
529 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
530 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
531 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
532 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
533 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
534 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
535 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
536 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
537 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
538 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
539 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
540 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
541 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
542 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
543 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
544 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
545 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
546 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
547 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
548 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
549 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
550 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
551 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
552 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
553 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
554 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
555 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
556 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
557 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
558 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
559 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
560 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
561 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
562 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
563 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
564 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
565 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
566 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
567 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
568 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
569 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
570 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
571 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
572 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
573 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
574 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
575 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
576 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
577 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
578 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
579 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
580 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
581 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
582 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
583 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
584 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
585 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
586 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
587 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
588 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
589 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
590 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
591 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
592 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
593 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
594 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
595 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
596 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
597 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
598 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
599 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
600 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
601 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
602 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
603 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
604 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
605 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
606 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
607 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
608 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
609 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
610 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
611 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
612 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
613 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
614 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
615 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
616 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
617 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
618 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
619 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
620 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
621 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
622 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
623 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
624 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
625 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
626 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
627 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
628 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
629 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
630 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
631 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
632 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
633 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
634 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
635 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
636 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
637 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
638 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
639 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
640 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
641 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
642 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
643 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
644 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
645 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
646 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
647 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
648 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
649 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
650 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
651 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
652 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
653 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
654 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
655 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
656 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
657 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
658 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
659 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
660 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
661 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
662 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
663 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
664 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
665 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
666 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
667 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
668 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
669 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
670 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
671 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
672 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
673 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
674 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
675 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
676 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
677 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
678 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
679 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
680 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
681 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
682 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
683 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
684 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
685 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
686 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
687 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
688 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
689 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
690 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
691 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
692 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
693 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
694 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
695 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
696 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
697 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
698 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
699 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
700 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
701 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
702 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
703 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
704 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
705 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
706 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
707 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
708 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
709 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
710 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
711 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
712 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
713 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
714 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
715 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
716 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
717 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
718 8005258706 Rhizobium sp. R693 Isolate Nodule
719 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
720 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
721 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
722 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
723 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
724 8005382845 Rhizobium sp. R634 Isolate Nodule
725 8005395548 Rhizobium sp. R339 Isolate Nodule
726 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
727 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
728 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
729 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
730 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
731 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
732 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
733 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
734 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
735 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
736 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
737 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
738 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
739 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
740 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
741 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
742 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
743 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
744 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
745 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
746 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
747 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
748 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
749 8056382006 Rhizobium croatiense 13T Isolate Nodule
750 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
751 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.22
Metatranscriptomes 0.07
Isolates 18.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.92
Nodule 11.9
Rhizoplane 1.48
Rhizosphere 42.17
Stem 0
Stem Tuber 0
Unclassified 15.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000078 3300002705 Bacteria 74254
2 JGI25156J39149_1000292 3300002705 Bacteria 33804
3 JGI25156J39149_1019440 3300002705 Bacteria 1223
4 JGI25154J39366_1000105 3300002738 Bacteria 74254
5 JGI25154J39366_1001784 3300002738 Bacteria 6799
6 JGI25158J39367_1010611 3300002739 Bacteria 1242
7 JGI25157J39369_1000098 3300002741 Bacteria 74254
8 JGI25157J39369_1000326 3300002741 Bacteria 33818
9 JGI25152J39213_1000197 3300002773 Bacteria 40490
10 JGI25150J39212_1001350 3300002774 Bacteria 6959
11 JGI25150J39212_1001977 3300002774 Bacteria 5370
12 JGI25150J39212_1008029 3300002774 Bacteria 2089
13 JGI25159J45721_1000534 3300002987 Bacteria 17310
14 JGI25159J45721_1001110 3300002987 Bacteria 11491
15 JGI25159J45721_1008306 3300002987 Bacteria 2865
16 JGI25151J46595_10000472 3300003187 Bacteria 38112
17 JGI25151J46595_10001106 3300003187 Bacteria 19788
18 JGI25151J46595_10005434 3300003187 Bacteria 6582
19 JGI25151J46595_10006117 3300003187 Bacteria 6111
20 JGI25151J46595_10036825 3300003187 Bacteria 1841
21 JGI25151J46595_10043824 3300003187 Bacteria 1596
22 JGI25151J46595_10044525 3300003187 Bacteria 1575
23 JGI25151J46595_10046226 3300003187 Bacteria 1527
24 JGI25165J46597_1002203 3300003214 Bacteria 6883
25 JGI25153J46596_10000205 3300003215 Bacteria 54275
26 JGI25153J46596_10000575 3300003215 Bacteria 22652
27 JGI25153J46596_10001250 3300003215 Bacteria 15290
28 JGI25153J46596_10001774 3300003215 Bacteria 12805
29 JGI25153J46596_10003407 3300003215 Bacteria 8907
30 JGI25153J46596_10013073 3300003215 Bacteria 3532
31 rootH1_10000553 3300003316 Bacteria 12668
32 rootH1_10061156 3300003316 Bacteria 2250
33 rootH2_10000536 3300003320 Bacteria 7653
34 rootH2_10148895 3300003320 Bacteria 2093
35 rootL2_10001141 3300003322 Bacteria 16441
36 rootL2_10046551 3300003322 Bacteria 8991
37 rootH1_10092082 3300003323 Bacteria 2567
38 JGI25160J50197_1000270 3300003354 Bacteria 38571
39 JGI25160J50197_1003793 3300003354 Bacteria 6654
40 JGI25160J50197_1021488 3300003354 Bacteria 1916
41 JGI25161J50226_1000040 3300003374 Bacteria 124804
42 JGI25161J50226_1005024 3300003374 Bacteria 2654
43 Ga0055539_1000347 3300003752 Bacteria 20554
44 Ga0055539_1001525 3300003752 Bacteria 4229
45 Ga0055533_1000006 3300003756 Bacteria 635559
46 Ga0055525_1000172 3300003759 Bacteria 81789
47 Ga0055525_1002347 3300003759 Bacteria 1992
48 Ga0055527_1005544 3300003760 Bacteria 1635
49 Ga0055535_1000630 3300003761 Bacteria 28140
50 Ga0055542_1000009 3300003762 Bacteria 416550
51 Ga0055529_1000158 3300003763 Bacteria 93023
52 Ga0055526_1001173 3300003771 Bacteria 18973
53 Ga0055526_1003105 3300003771 Bacteria 10776
54 Ga0055526_1009534 3300003771 Bacteria 4653
55 Ga0055526_1014122 3300003771 Bacteria 3312
56 Ga0055526_1019724 3300003771 Bacteria 2442
57 Ga0055537_1000157 3300003773 Bacteria 50500
58 Ga0055537_1000544 3300003773 Bacteria 21755
59 Ga0055537_1005617 3300003773 Bacteria 3326
60 Ga0055524_1000077 3300003775 Bacteria 121584
61 Ga0055524_1000162 3300003775 Bacteria 77486
62 Ga0055524_1002935 3300003775 Bacteria 8504
63 Ga0055524_1013618 3300003775 Bacteria 3061
64 Ga0055524_1031466 3300003775 Bacteria 1525
65 Ga0055524_1053457 3300003775 Bacteria 894
66 Ga0055536_1006592 3300003781 Bacteria 5368
67 Ga0055534_1000494 3300003784 Bacteria 21755
68 Ga0055534_1021822 3300003784 Bacteria 1066
69 Ga0055528_1000310 3300003790 Bacteria 41194
70 Ga0055528_1001471 3300003790 Bacteria 14314
71 Ga0055528_1007944 3300003790 Bacteria 4623
72 Ga0055528_1020476 3300003790 Bacteria 2146
73 Ga0055528_1021363 3300003790 Bacteria 2057
74 Ga0055530_10001005 3300003791 Bacteria 22543
75 Ga0055530_10014342 3300003791 Bacteria 2645
76 Ga0055540_1000010 3300003792 Bacteria 290865
77 Ga0055540_1001295 3300003792 Bacteria 15147
78 Ga0055540_1002128 3300003792 Bacteria 10807
79 Ga0055540_1003254 3300003792 Bacteria 7959
80 Ga0055540_1006686 3300003792 Bacteria 4522
81 Ga0055540_1019150 3300003792 Bacteria 1853
82 Ga0055540_1024926 3300003792 Bacteria 1475
83 Ga0055531_10000001 3300003794 Bacteria 543586
84 Ga0055531_10000010 3300003794 Bacteria 206117
85 Ga0055531_10002797 3300003794 Bacteria 11441
86 Ga0055531_10004907 3300003794 Bacteria 7959
87 Ga0055531_10006999 3300003794 Bacteria 6259
88 Ga0055531_10007249 3300003794 Bacteria 6093
89 Ga0055531_10008911 3300003794 Bacteria 5206
90 Ga0055531_10012389 3300003794 Bacteria 4016
91 Ga0055543_1001055 3300004625 Bacteria 12223
92 Ga0055543_1001197 3300004625 Bacteria 10928
93 Ga0055543_1010217 3300004625 Bacteria 1978
94 Ga0065165_1000086 3300005262 Bacteria 154235
95 Ga0065165_1000562 3300005262 Bacteria 55318
96 Ga0065165_1001932 3300005262 Bacteria 19751
97 Ga0065165_1014032 3300005262 Bacteria 3135
98 Ga0065165_1019113 3300005262 Bacteria 2458
99 Ga0065165_1022764 3300005262 Bacteria 2139
100 Ga0070658_10023677 3300005327 Bacteria 4924
101 Ga0070690_100041483 3300005330 Bacteria 2914
102 Ga0070670_100014970 3300005331 Bacteria 6656
103 Ga0070670_100300266 3300005331 Bacteria 1405
104 Ga0070670_100682913 3300005331 Bacteria 922
105 Ga0068869_100017098 3300005334 Bacteria 4908
106 Ga0068869_100360783 3300005334 Bacteria 1186
107 Ga0068869_100393692 3300005334 Bacteria 1138
108 Ga0070682_100117701 3300005337 Bacteria 1779
109 Ga0068868_100017412 3300005338 Bacteria 5354
110 Ga0068868_100281029 3300005338 Bacteria 1409
111 Ga0068868_100651496 3300005338 Bacteria 938
112 Ga0070660_100009372 3300005339 Bacteria 6881
113 Ga0070692_10182631 3300005345 Bacteria 1217
114 Ga0070668_100186597 3300005347 Bacteria 1696
115 Ga0070668_100364784 3300005347 Bacteria 1226
116 Ga0070669_100046539 3300005353 Bacteria 3164
117 Ga0070669_100280227 3300005353 Bacteria 1336
118 Ga0070669_100429192 3300005353 Bacteria 1086
119 Ga0070675_100001203 3300005354 Bacteria 18809
120 Ga0070675_100049209 3300005354 Bacteria 3459
121 Ga0070675_100143202 3300005354 Bacteria 2045
122 Ga0070675_100432836 3300005354 Bacteria 1178
123 Ga0070671_100027644 3300005355 Bacteria 4671
124 Ga0070671_100158006 3300005355 Bacteria 1916
125 Ga0070671_100163168 3300005355 Bacteria 1883
126 Ga0070674_100193609 3300005356 Bacteria 1565
127 Ga0070673_100016661 3300005364 Bacteria 5204
128 Ga0070673_100022575 3300005364 Bacteria 4583
129 Ga0070673_100330200 3300005364 Bacteria 1349
130 Ga0070659_100141386 3300005366 Bacteria 1960
131 Ga0070659_100372196 3300005366 Bacteria 1202
132 Ga0070667_100022232 3300005367 Bacteria 5262
133 Ga0070667_100083096 3300005367 Bacteria 2743
134 Ga0070667_100259381 3300005367 Bacteria 1556
135 Ga0070714_100012486 3300005435 Bacteria 6783
136 Ga0070713_100738363 3300005436 Bacteria 941
137 Ga0070700_100171079 3300005441 Bacteria 1504
138 Ga0070708_100140294 3300005445 Bacteria 2241
139 Ga0070663_100121742 3300005455 Bacteria 1972
140 Ga0070678_100010582 3300005456 Bacteria 5644
141 Ga0070678_100036144 3300005456 Bacteria 3455
142 Ga0070678_100122634 3300005456 Bacteria 2052
143 Ga0070678_100136996 3300005456 Bacteria 1953
144 Ga0070662_100003100 3300005457 Bacteria 10323
145 Ga0070662_100129502 3300005457 Bacteria 1944
146 Ga0070662_100221172 3300005457 Bacteria 1511
147 Ga0068867_100000493 3300005459 Bacteria 26395
148 Ga0068867_100005605 3300005459 Bacteria 8895
149 Ga0068867_100015311 3300005459 Bacteria 5436
150 Ga0070706_100028048 3300005467 Bacteria 5180
151 Ga0070706_100040108 3300005467 Bacteria 4322
152 Ga0070706_100256706 3300005467 Bacteria 1632
153 Ga0070706_100695505 3300005467 Bacteria 943
154 Ga0070707_100008004 3300005468 Bacteria 9823
155 Ga0070684_100330755 3300005535 Bacteria 1400
156 Ga0068853_100005290 3300005539 Bacteria 10103
157 Ga0068853_100056082 3300005539 Bacteria 3397
158 Ga0068853_100120828 3300005539 Bacteria 2337
159 Ga0068853_100203419 3300005539 Bacteria 1802
160 Ga0068853_100213667 3300005539 Bacteria 1759
161 Ga0068853_100919374 3300005539 Bacteria 841
162 Ga0070672_100021950 3300005543 Bacteria 4679
163 Ga0070672_100064902 3300005543 Bacteria 2886
164 Ga0070672_100192249 3300005543 Bacteria 1704
165 Ga0070686_100223467 3300005544 Bacteria 1362
166 Ga0070665_100060322 3300005548 Bacteria 3802
167 Ga0070665_100241024 3300005548 Bacteria 1809
168 Ga0070665_100918783 3300005548 Bacteria 888
169 Ga0068855_100024892 3300005563 Bacteria 7163
170 Ga0068855_100140845 3300005563 Bacteria 2749
171 Ga0070664_100013925 3300005564 Bacteria 6557
172 Ga0068857_100000085 3300005577 Bacteria 54135
173 Ga0068857_100175810 3300005577 Bacteria 1947
174 Ga0068857_100200318 3300005577 Bacteria 1820
175 Ga0068857_100240371 3300005577 Bacteria 1658
176 Ga0068854_100056806 3300005578 Bacteria 2822
177 Ga0068854_100063931 3300005578 Bacteria 2672
178 Ga0068854_100083692 3300005578 Bacteria 2359
179 Ga0068856_100161633 3300005614 Bacteria 2250
180 Ga0068852_100039371 3300005616 Bacteria 3980
181 Ga0068852_100097836 3300005616 Bacteria 2641
182 Ga0068852_100102361 3300005616 Bacteria 2588
183 Ga0068852_100265737 3300005616 Bacteria 1649
184 Ga0068859_100039130 3300005617 Bacteria 4757
185 Ga0068859_100135150 3300005617 Bacteria 2538
186 Ga0068864_100089931 3300005618 Bacteria 2706
187 Ga0068866_10079834 3300005718 Bacteria 1754
188 Ga0068861_100127124 3300005719 Bacteria 2064
189 Ga0068861_100144687 3300005719 Bacteria 1944
190 Ga0068861_100184160 3300005719 Bacteria 1740
191 Ga0068861_100233068 3300005719 Bacteria 1562
192 Ga0068861_100523885 3300005719 Bacteria 1075
193 Ga0068851_10013180 3300005834 Bacteria 3911
194 Ga0068851_10035165 3300005834 Bacteria 2503
195 Ga0068851_10053813 3300005834 Bacteria 2050
196 Ga0068851_10350302 3300005834 Bacteria 859
197 Ga0068870_10039933 3300005840 Bacteria 2431
198 Ga0068858_100326792 3300005842 Bacteria 1466
199 Ga0068858_100539668 3300005842 Bacteria 1129
200 Ga0068858_100628430 3300005842 Bacteria 1043
201 Ga0068860_100000161 3300005843 Bacteria 110123
202 Ga0068860_100135240 3300005843 Bacteria 2367
203 Ga0068862_100052518 3300005844 Bacteria 3488
204 Ga0068862_100157436 3300005844 Bacteria 2026
205 Ga0068862_100392012 3300005844 Bacteria 1297
206 Ga0081538_10106443 3300005981 Bacteria 1392
207 Ga0081540_1000001 3300005983 Bacteria 293507
208 Ga0081540_1001503 3300005983 Bacteria 20089
209 Ga0081540_1002032 3300005983 Bacteria 16875
210 Ga0081540_1014618 3300005983 Bacteria 5018
211 Ga0081540_1025165 3300005983 Bacteria 3433
212 Ga0081539_10011653 3300005985 Bacteria 6918
213 Ga0081539_10168377 3300005985 Bacteria 1038
214 Ga0075365_10000422 3300006038 Bacteria 15645
215 Ga0075365_10035846 3300006038 Bacteria 3212
216 Ga0075365_10106151 3300006038 Bacteria 1927
217 Ga0075365_10147503 3300006038 Bacteria 1635
218 Ga0075365_10581411 3300006038 Bacteria 792
219 Ga0075368_10009279 3300006042 Bacteria 3535
220 Ga0075368_10041354 3300006042 Bacteria 1811
221 Ga0075368_10114445 3300006042 Bacteria 1114
222 Ga0075368_10123239 3300006042 Bacteria 1075
223 Ga0075368_10206740 3300006042 Bacteria 831
224 Ga0075363_100037956 3300006048 Bacteria 2531
225 Ga0075363_100090857 3300006048 Bacteria 1680
226 Ga0075363_100132515 3300006048 Bacteria 1399
227 Ga0075363_100155062 3300006048 Bacteria 1294
228 Ga0075363_100291536 3300006048 Bacteria 946
229 Ga0075363_100394401 3300006048 Bacteria 813
230 Ga0075364_10039620 3300006051 Bacteria 3055
231 Ga0075364_10055117 3300006051 Bacteria 2601
232 Ga0075364_10132498 3300006051 Bacteria 1673
233 Ga0075432_10016580 3300006058 Bacteria 2515
234 Ga0075362_10000553 3300006177 Bacteria 10868
235 Ga0075362_10005353 3300006177 Bacteria 4688
236 Ga0075362_10011391 3300006177 Bacteria 3502
237 Ga0075362_10039609 3300006177 Bacteria 2072
238 Ga0075362_10068895 3300006177 Bacteria 1612
239 Ga0075362_10078640 3300006177 Bacteria 1517
240 Ga0075362_10252766 3300006177 Bacteria 867
241 Ga0075367_10006073 3300006178 Bacteria 6068
242 Ga0075367_10006881 3300006178 Bacteria 5787
243 Ga0075367_10014639 3300006178 Bacteria 4247
244 Ga0075367_10059790 3300006178 Bacteria 2270
245 Ga0075367_10063502 3300006178 Bacteria 2208
246 Ga0075367_10087478 3300006178 Bacteria 1892
247 Ga0075367_10120776 3300006178 Bacteria 1614
248 Ga0075367_10365796 3300006178 Bacteria 911
249 Ga0075369_10000481 3300006186 Bacteria 12314
250 Ga0075369_10065967 3300006186 Bacteria 1587
251 Ga0075366_10001027 3300006195 Bacteria 13684
252 Ga0075366_10002900 3300006195 Bacteria 8906
253 Ga0075366_10003289 3300006195 Bacteria 8497
254 Ga0075366_10005662 3300006195 Bacteria 6775
255 Ga0075366_10009464 3300006195 Bacteria 5439
256 Ga0075366_10031124 3300006195 Bacteria 3139
257 Ga0075366_10090938 3300006195 Bacteria 1828
258 Ga0075366_10106619 3300006195 Bacteria 1684
259 Ga0075366_10114492 3300006195 Bacteria 1624
260 Ga0075366_10202872 3300006195 Bacteria 1206
261 Ga0075366_10333045 3300006195 Bacteria 931
262 Ga0075366_10416103 3300006195 Bacteria 828
263 Ga0097621_100007195 3300006237 Bacteria 7939
264 Ga0075370_10000157 3300006353 Bacteria 23226
265 Ga0075370_10000617 3300006353 Bacteria 13729
266 Ga0075370_10004634 3300006353 Bacteria 6710
267 Ga0075370_10005158 3300006353 Bacteria 6451
268 Ga0075370_10008439 3300006353 Bacteria 5301
269 Ga0075370_10011616 3300006353 Bacteria 4632
270 Ga0075370_10014295 3300006353 Bacteria 4234
271 Ga0075370_10015438 3300006353 Bacteria 4090
272 Ga0075370_10022506 3300006353 Bacteria 3461
273 Ga0075370_10043838 3300006353 Bacteria 2529
274 Ga0075370_10072137 3300006353 Bacteria 1976
275 Ga0075370_10073471 3300006353 Bacteria 1958
276 Ga0075370_10099252 3300006353 Bacteria 1684
277 Ga0075370_10138613 3300006353 Bacteria 1422
278 Ga0068871_100040972 3300006358 Bacteria 3712
279 Ga0068871_100095533 3300006358 Bacteria 2482
280 Ga0097620_100039125 3300006931 Bacteria 4757
281 Ga0097620_100135146 3300006931 Bacteria 2538
282 Ga0099823_1000003 3300006944 Bacteria 189058
283 Ga0079104_1005275 3300006946 Bacteria 5207
284 Ga0079104_1013084 3300006946 Bacteria 2575
285 Ga0099826_10000408 3300006948 Bacteria 20307
286 Ga0105244_10005024 3300009036 Bacteria 8907
287 Ga0105244_10121184 3300009036 Bacteria 1266
288 Ga0105240_10000076 3300009093 Bacteria 198848
289 Ga0105240_10017734 3300009093 Bacteria 9585
290 Ga0105240_10461534 3300009093 Bacteria 1419
291 Ga0105245_10030303 3300009098 Bacteria 4783
292 Ga0105245_10141591 3300009098 Bacteria 2265
293 Ga0105245_11478432 3300009098 Bacteria 730
294 Ga0114129_10124043 3300009147 Bacteria 3552
295 Ga0105243_10003677 3300009148 Bacteria 12326
296 Ga0105243_10006418 3300009148 Bacteria 9089
297 Ga0105243_10011984 3300009148 Bacteria 6556
298 Ga0105243_10103847 3300009148 Bacteria 2364
299 Ga0105243_10116653 3300009148 Bacteria 2243
300 Ga0105243_10200062 3300009148 Bacteria 1751
301 Ga0105243_10301838 3300009148 Bacteria 1452
302 Ga0105243_10711101 3300009148 Bacteria 980
303 Ga0105241_10055495 3300009174 Bacteria 3035
304 Ga0105242_10018250 3300009176 Bacteria 5483
305 Ga0105242_10115237 3300009176 Bacteria 2297
306 Ga0105237_10003353 3300009545 Bacteria 19073
307 Ga0105237_10008909 3300009545 Bacteria 10813
308 Ga0105237_10214553 3300009545 Bacteria 1924
309 Ga0105237_10230368 3300009545 Bacteria 1853
310 Ga0105237_10248545 3300009545 Bacteria 1780
311 Ga0105237_10333616 3300009545 Bacteria 1521
312 Ga0105238_10057136 3300009551 Bacteria 3913
313 Ga0105238_10594673 3300009551 Bacteria 1114
314 Ga0105249_10292669 3300009553 Bacteria 1630
315 Ga0123341_1000005 3300009765 Bacteria 150422
316 Ga0123341_1052592 3300009765 Bacteria 2240
317 Ga0123341_1052593 3300009765 Bacteria 2240
318 Ga0123342_1010761 3300009766 Bacteria 10320
319 Ga0123342_1012900 3300009766 Bacteria 8539
320 Ga0105239_10007443 3300010375 Bacteria 12562
321 Ga0105239_10026173 3300010375 Bacteria 6421
322 Ga0105239_10199406 3300010375 Bacteria 2242
323 Ga0105246_10121353 3300011119 Bacteria 1937
324 Ga0157317_1000102 3300012475 Bacteria 2482
325 Ga0157319_1000002 3300012497 Bacteria 410803
326 Ga0157371_10109718 3300013102 Bacteria 1959
327 Ga0157370_10000282 3300013104 Bacteria 64601
328 Ga0157370_10012371 3300013104 Bacteria 8853
329 Ga0157370_10327974 3300013104 Bacteria 1411
330 Ga0157369_10036372 3300013105 Bacteria 5395
331 Ga0157369_10063537 3300013105 Bacteria 3977
332 Ga0157374_10050587 3300013296 Bacteria 3863
333 Ga0157374_10441814 3300013296 Bacteria 1301
334 Ga0157374_10507810 3300013296 Bacteria 1211
335 Ga0157374_10667812 3300013296 Bacteria 1051
336 Ga0163162_10231687 3300013306 Bacteria 1977
337 Ga0163162_10796648 3300013306 Bacteria 1062
338 Ga0157372_10458714 3300013307 Bacteria 1485
339 Ga0157375_10023002 3300013308 Bacteria 5745
340 Ga0157375_10069823 3300013308 Bacteria 3520
341 Ga0157375_10107199 3300013308 Bacteria 2887
342 Ga0157375_10306020 3300013308 Bacteria 1753
343 Ga0163163_10505818 3300014325 Bacteria 1270
344 Ga0182008_10004309 3300014497 Bacteria 8328
345 Ga0182008_10029346 3300014497 Bacteria 2779
346 Ga0182008_10090174 3300014497 Bacteria 1511
347 Ga0157377_10000092 3300014745 Bacteria 65323
348 Ga0157377_10230770 3300014745 Bacteria 1190
349 Ga0157377_10494944 3300014745 Bacteria 853
350 Ga0157379_10096937 3300014968 Bacteria 2647
351 Ga0157379_10250783 3300014968 Bacteria 1607
352 Ga0157376_10009278 3300014969 Bacteria 7142
353 Ga0157376_11015349 3300014969 Bacteria 852
354 Ga0182006_1012628 3300015261 Bacteria 3692
355 Ga0182007_10002349 3300015262 Bacteria 9471
356 Ga0182007_10004768 3300015262 Bacteria 6094
357 Ga0182007_10022400 3300015262 Bacteria 2232
358 Ga0182005_1001905 3300015265 Bacteria 7903
359 Ga0182005_1021585 3300015265 Bacteria 1765
360 Ga0182005_1080520 3300015265 Bacteria 899
361 Ga0163161_10000598 3300017792 Bacteria 28842
362 Ga0163161_10010182 3300017792 Bacteria 6509
363 Ga0214544_1002525 3300021320 Bacteria 38469
364 Ga0214542_1000084 3300021321 Bacteria 120499
365 Ga0214542_1017219 3300021321 Bacteria 6635
366 Ga0214543_1000018 3300021327 Bacteria 272335
367 Ga0214543_1000076 3300021327 Bacteria 120483
368 Ga0213872_10000161 3300021361 Bacteria 61406
369 Ga0213872_10034437 3300021361 Bacteria 2318
370 Ga0209435_100010 3300025206 Bacteria 475373
371 Ga0209436_107131 3300025208 Bacteria 2371
372 Ga0209436_108437 3300025208 Bacteria 2051
373 Ga0209674_100003 3300025226 Bacteria 2196646
374 Ga0209672_103043 3300025228 Bacteria 3655
375 Ga0209147_100510 3300025229 Bacteria 22609
376 Ga0209563_100010 3300025230 Bacteria 1337457
377 Ga0209563_100044 3300025230 Bacteria 396812
378 Ga0207427_100528 3300025231 Bacteria 19897
379 Ga0209258_100009 3300025242 Bacteria 996276
380 Ga0209258_100110 3300025242 Bacteria 201322
381 Ga0209258_100277 3300025242 Bacteria 86422
382 Ga0209258_108045 3300025242 Bacteria 1516
383 Ga0207425_1000329 3300025245 Bacteria 33415
384 Ga0207425_1000529 3300025245 Bacteria 23293
385 Ga0207425_1001200 3300025245 Bacteria 11453
386 Ga0207425_1021848 3300025245 Bacteria 1354
387 Ga0209646_1000001 3300025246 Bacteria 3092932
388 Ga0209646_1000039 3300025246 Bacteria 349637
389 Ga0209026_1000001 3300025250 Bacteria 1228671
390 Ga0209026_1000006 3300025250 Bacteria 677225
391 Ga0209026_1032685 3300025250 Bacteria 769
392 Ga0209677_100026 3300025253 Bacteria 382520
393 Ga0209677_100067 3300025253 Bacteria 146379
394 Ga0209677_100268 3300025253 Bacteria 35373
395 Ga0209677_108952 3300025253 Bacteria 1860
396 Ga0209148_1000007 3300025254 Bacteria 1592273
397 Ga0209759_1000001 3300025256 Bacteria 2799452
398 Ga0209759_1000189 3300025256 Bacteria 98732
399 Ga0209759_1000291 3300025256 Bacteria 69357
400 Ga0209759_1000542 3300025256 Bacteria 39451
401 Ga0209129_1000013 3300025258 Bacteria 524874
402 Ga0209129_1000382 3300025258 Bacteria 35589
403 Ga0209129_1002487 3300025258 Bacteria 8991
404 Ga0209129_1018601 3300025258 Bacteria 1330
405 Ga0209233_1000260 3300025261 Bacteria 79607
406 Ga0209565_1000036 3300025263 Bacteria 293334
407 Ga0209565_1000138 3300025263 Bacteria 101729
408 Ga0209565_1000226 3300025263 Bacteria 63161
409 Ga0209565_1000243 3300025263 Bacteria 58571
410 Ga0209565_1040609 3300025263 Bacteria 868
411 Ga0209455_1000104 3300025272 Bacteria 201321
412 Ga0209673_1000022 3300025273 Bacteria 413125
413 Ga0209673_1000064 3300025273 Bacteria 254712
414 Ga0209673_1000282 3300025273 Bacteria 95013
415 Ga0209673_1000309 3300025273 Bacteria 90058
416 Ga0209673_1000329 3300025273 Bacteria 87170
417 Ga0209673_1004964 3300025273 Bacteria 6904
418 Ga0209673_1006233 3300025273 Bacteria 5817
419 Ga0209673_1006331 3300025273 Bacteria 5737
420 Ga0209673_1013824 3300025273 Bacteria 3164
421 Ga0209673_1017435 3300025273 Bacteria 2647
422 Ga0209673_1033472 3300025273 Bacteria 1566
423 Ga0209130_1000042 3300025284 Bacteria 257581
424 Ga0209130_1000255 3300025284 Bacteria 67166
425 Ga0209130_1000489 3300025284 Bacteria 40639
426 Ga0209130_1001079 3300025284 Bacteria 20438
427 Ga0209675_1000036 3300025291 Bacteria 254712
428 Ga0209675_1000238 3300025291 Bacteria 54807
429 Ga0209675_1000289 3300025291 Bacteria 47643
430 Ga0209675_1001085 3300025291 Bacteria 16755
431 Ga0209675_1001591 3300025291 Bacteria 12841
432 Ga0209675_1020476 3300025291 Bacteria 1791
433 Ga0209676_1000004 3300025292 Bacteria 1138360
434 Ga0209676_1000007 3300025292 Bacteria 1029371
435 Ga0209676_1000092 3300025292 Bacteria 250453
436 Ga0209676_1000162 3300025292 Bacteria 159931
437 Ga0209676_1001101 3300025292 Bacteria 29990
438 Ga0209676_1006358 3300025292 Bacteria 5854
439 Ga0209676_1028115 3300025292 Bacteria 1757
440 Ga0209025_1000168 3300025294 Bacteria 162386
441 Ga0209025_1000220 3300025294 Bacteria 136977
442 Ga0209025_1000228 3300025294 Bacteria 132088
443 Ga0209025_1000393 3300025294 Bacteria 90571
444 Ga0209025_1000558 3300025294 Bacteria 68589
445 Ga0209025_1001915 3300025294 Bacteria 24191
446 Ga0209025_1002780 3300025294 Bacteria 17653
447 Ga0209025_1004014 3300025294 Bacteria 13190
448 Ga0209025_1008041 3300025294 Bacteria 7682
449 Ga0209025_1008724 3300025294 Bacteria 7226
450 Ga0209025_1029896 3300025294 Bacteria 2623
451 Ga0209025_1034233 3300025294 Bacteria 2325
452 Ga0209025_1041357 3300025294 Bacteria 1975
453 Ga0209564_1000025 3300025295 Bacteria 520535
454 Ga0209564_1000222 3300025295 Bacteria 129405
455 Ga0209564_1000229 3300025295 Bacteria 125047
456 Ga0209564_1000287 3300025295 Bacteria 102328
457 Ga0209564_1000440 3300025295 Bacteria 71511
458 Ga0209564_1000991 3300025295 Bacteria 35474
459 Ga0209564_1001702 3300025295 Bacteria 20812
460 Ga0209564_1001728 3300025295 Bacteria 20491
461 Ga0209564_1004245 3300025295 Bacteria 8902
462 Ga0209564_1034839 3300025295 Bacteria 1468
463 Ga0209758_1000113 3300025297 Bacteria 202528
464 Ga0209758_1000134 3300025297 Bacteria 178294
465 Ga0209758_1000167 3300025297 Bacteria 151074
466 Ga0209758_1000503 3300025297 Bacteria 63354
467 Ga0209758_1001078 3300025297 Bacteria 35474
468 Ga0209758_1003390 3300025297 Bacteria 14572
469 Ga0209758_1005551 3300025297 Bacteria 9617
470 Ga0209758_1006104 3300025297 Bacteria 8845
471 Ga0209758_1012867 3300025297 Bacteria 4634
472 Ga0209758_1014912 3300025297 Bacteria 4078
473 Ga0209758_1074164 3300025297 Bacteria 1056
474 Ga0209758_1076316 3300025297 Bacteria 1032
475 Ga0209050_1000002 3300025298 Bacteria 1792849
476 Ga0209050_1000003 3300025298 Bacteria 1609245
477 Ga0209050_1001008 3300025298 Bacteria 35207
478 Ga0209050_1002574 3300025298 Bacteria 15089
479 Ga0209050_1003923 3300025298 Bacteria 10525
480 Ga0209050_1005552 3300025298 Bacteria 7862
481 Ga0209050_1011437 3300025298 Bacteria 4207
482 Ga0209050_1012804 3300025298 Bacteria 3801
483 Ga0209050_1013000 3300025298 Bacteria 3754
484 Ga0209256_1000001 3300025299 Bacteria 2166974
485 Ga0209256_1000060 3300025299 Bacteria 262342
486 Ga0209256_1000072 3300025299 Bacteria 239812
487 Ga0209256_1000970 3300025299 Bacteria 34492
488 Ga0209256_1001206 3300025299 Bacteria 28955
489 Ga0209256_1002034 3300025299 Bacteria 17988
490 Ga0209256_1002250 3300025299 Bacteria 16402
491 Ga0209256_1002687 3300025299 Bacteria 13906
492 Ga0209256_1010774 3300025299 Bacteria 3770
493 Ga0209256_1013155 3300025299 Bacteria 3093
494 Ga0207426_1000095 3300025302 Bacteria 274234
495 Ga0207426_1000097 3300025302 Bacteria 265930
496 Ga0207426_1000100 3300025302 Bacteria 262342
497 Ga0207426_1000307 3300025302 Bacteria 96085
498 Ga0207426_1001088 3300025302 Bacteria 25302
499 Ga0209051_1000002 3300025303 Bacteria 1631846
500 Ga0209051_1000003 3300025303 Bacteria 1609245
501 Ga0209051_1000113 3300025303 Bacteria 152417
502 Ga0209051_1000274 3300025303 Bacteria 84662
503 Ga0209051_1000311 3300025303 Bacteria 76050
504 Ga0209051_1001591 3300025303 Bacteria 18621
505 Ga0209051_1003757 3300025303 Bacteria 9751
506 Ga0209051_1006077 3300025303 Bacteria 6886
507 Ga0209051_1025604 3300025303 Bacteria 2396
508 Ga0209051_1030305 3300025303 Bacteria 2101
509 Ga0209051_1034434 3300025303 Bacteria 1898
510 Ga0209257_1000002 3300025304 Bacteria 1767052
511 Ga0209257_1000020 3300025304 Bacteria 773356
512 Ga0209257_1000033 3300025304 Bacteria 671006
513 Ga0209257_1000286 3300025304 Bacteria 111738
514 Ga0209257_1000385 3300025304 Bacteria 88117
515 Ga0209257_1000432 3300025304 Bacteria 80643
516 Ga0209257_1004439 3300025304 Bacteria 10865
517 Ga0209257_1006354 3300025304 Bacteria 7670
518 Ga0209257_1006722 3300025304 Bacteria 7269
519 Ga0209257_1006726 3300025304 Bacteria 7267
520 Ga0207656_10013042 3300025321 Bacteria 3168
521 Ga0207656_10053228 3300025321 Bacteria 1756
522 Ga0207655_1011138 3300025728 Bacteria 5382
523 Ga0207655_1063617 3300025728 Bacteria 1412
524 Ga0207682_10007704 3300025893 Bacteria 4283
525 Ga0207682_10138958 3300025893 Bacteria 1089
526 Ga0207642_10027797 3300025899 Bacteria 2320
527 Ga0207699_10079788 3300025906 Bacteria 2026
528 Ga0207645_10005608 3300025907 Bacteria 9076
529 Ga0207645_10407405 3300025907 Bacteria 915
530 Ga0207643_10102524 3300025908 Bacteria 1679
531 Ga0207643_10144060 3300025908 Bacteria 1425
532 Ga0207705_10228894 3300025909 Bacteria 1413
533 Ga0207684_10034822 3300025910 Bacteria 4277
534 Ga0207684_10044532 3300025910 Bacteria 3764
535 Ga0207684_10179131 3300025910 Bacteria 1827
536 Ga0207684_10926067 3300025910 Bacteria 732
537 Ga0207695_10000011 3300025913 Bacteria 910221
538 Ga0207695_10005283 3300025913 Bacteria 17220
539 Ga0207695_10163392 3300025913 Bacteria 2156
540 Ga0207695_10616714 3300025913 Bacteria 966
541 Ga0207671_10000093 3300025914 Bacteria 138939
542 Ga0207671_10034858 3300025914 Bacteria 3739
543 Ga0207671_10128694 3300025914 Bacteria 1942
544 Ga0207671_10181606 3300025914 Bacteria 1637
545 Ga0207657_10004770 3300025919 Bacteria 14302
546 Ga0207657_10363849 3300025919 Bacteria 1140
547 Ga0207649_10550574 3300025920 Bacteria 883
548 Ga0207646_10056445 3300025922 Bacteria 3510
549 Ga0207681_10178688 3300025923 Bacteria 1615
550 Ga0207681_10181707 3300025923 Bacteria 1603
551 Ga0207681_10408180 3300025923 Bacteria 1098
552 Ga0207694_10003012 3300025924 Bacteria 13504
553 Ga0207694_10100864 3300025924 Bacteria 2287
554 Ga0207650_10230816 3300025925 Bacteria 1493
555 Ga0207650_10275603 3300025925 Bacteria 1368
556 Ga0207650_10845431 3300025925 Bacteria 776
557 Ga0207659_10049889 3300025926 Bacteria 2971
558 Ga0207687_10013919 3300025927 Bacteria 5256
559 Ga0207687_10038647 3300025927 Bacteria 3263
560 Ga0207700_10598749 3300025928 Bacteria 981
561 Ga0207644_10061336 3300025931 Bacteria 2723
562 Ga0207644_10237504 3300025931 Bacteria 1450
563 Ga0207690_10061876 3300025932 Bacteria 2546
564 Ga0207690_10304190 3300025932 Bacteria 1249
565 Ga0207706_10005534 3300025933 Bacteria 11776
566 Ga0207706_10008079 3300025933 Bacteria 9710
567 Ga0207706_10064087 3300025933 Bacteria 3236
568 Ga0207706_10116753 3300025933 Bacteria 2347
569 Ga0207706_10214533 3300025933 Bacteria 1686
570 Ga0207709_10000205 3300025935 Bacteria 77131
571 Ga0207709_10006214 3300025935 Bacteria 6718
572 Ga0207709_10067033 3300025935 Bacteria 2263
573 Ga0207709_10148407 3300025935 Bacteria 1621
574 Ga0207669_10024573 3300025937 Bacteria 3241
575 Ga0207669_10280286 3300025937 Bacteria 1257
576 Ga0207704_10310784 3300025938 Bacteria 1211
577 Ga0207691_10020976 3300025940 Bacteria 6175
578 Ga0207691_10037859 3300025940 Bacteria 4464
579 Ga0207689_10074051 3300025942 Bacteria 2798
580 Ga0207689_10228587 3300025942 Bacteria 1538
581 Ga0207679_10149371 3300025945 Bacteria 1900
582 Ga0207667_10046311 3300025949 Bacteria 4604
583 Ga0207667_10070583 3300025949 Bacteria 3635
584 Ga0207667_10108361 3300025949 Bacteria 2866
585 Ga0207651_10015896 3300025960 Bacteria 4389
586 Ga0207651_10065575 3300025960 Bacteria 2547
587 Ga0207651_10194756 3300025960 Bacteria 1619
588 Ga0207668_10212248 3300025972 Bacteria 1549
589 Ga0207640_10044194 3300025981 Bacteria 2853
590 Ga0207640_10128662 3300025981 Bacteria 1827
591 Ga0207640_10441426 3300025981 Bacteria 1070
592 Ga0207658_10057686 3300025986 Bacteria 2887
593 Ga0207658_10131850 3300025986 Bacteria 2009
594 Ga0207658_10173841 3300025986 Bacteria 1777
595 Ga0207658_10201928 3300025986 Bacteria 1660
596 Ga0207658_10205157 3300025986 Bacteria 1648
597 Ga0207658_10314417 3300025986 Bacteria 1354
598 Ga0207658_10650811 3300025986 Bacteria 950
599 Ga0207677_10055198 3300026023 Bacteria 2715
600 Ga0207677_10658294 3300026023 Bacteria 925
601 Ga0207677_10703984 3300026023 Bacteria 896
602 Ga0207703_10578913 3300026035 Bacteria 1060
603 Ga0207703_10602992 3300026035 Bacteria 1039
604 Ga0207639_10111926 3300026041 Bacteria 2226
605 Ga0207639_10136134 3300026041 Bacteria 2040
606 Ga0207639_10288912 3300026041 Bacteria 1445
607 Ga0207639_10417395 3300026041 Bacteria 1212
608 Ga0207678_10274552 3300026067 Bacteria 1446
609 Ga0207708_10129544 3300026075 Bacteria 1972
610 Ga0207702_10000111 3300026078 Bacteria 95170
611 Ga0207702_10166512 3300026078 Bacteria 2017
612 Ga0207648_10000329 3300026089 Bacteria 52037
613 Ga0207648_10012219 3300026089 Bacteria 8041
614 Ga0207648_10032141 3300026089 Bacteria 4636
615 Ga0207648_10239710 3300026089 Bacteria 1614
616 Ga0207648_10291167 3300026089 Bacteria 1462
617 Ga0207676_10477920 3300026095 Bacteria 1180
618 Ga0207676_10603462 3300026095 Bacteria 1054
619 Ga0207676_10773769 3300026095 Bacteria 935
620 Ga0207674_10001263 3300026116 Bacteria 33047
621 Ga0207674_10040289 3300026116 Bacteria 4840
622 Ga0207674_10100391 3300026116 Bacteria 2875
623 Ga0207674_10133324 3300026116 Bacteria 2447
624 Ga0207674_10182686 3300026116 Bacteria 2048
625 Ga0207675_100013893 3300026118 Bacteria 7505
626 Ga0207675_100088902 3300026118 Bacteria 2902
627 Ga0207675_100123030 3300026118 Bacteria 2456
628 Ga0207675_100310123 3300026118 Bacteria 1539
629 Ga0207683_10049950 3300026121 Bacteria 3662
630 Ga0207683_10385634 3300026121 Bacteria 1288
631 Ga0207698_10070164 3300026142 Bacteria 2775
632 Ga0207698_10112928 3300026142 Bacteria 2282
633 Ga0209281_1011677 3300027111 Bacteria 1957
634 Ga0209389_1000243 3300027296 Bacteria 34996
635 Ga0209282_1000521 3300027666 Bacteria 18596
636 Ga0209813_10054737 3300027866 Bacteria 1258
637 Ga0209974_10008262 3300027876 Bacteria 3564
638 Ga0209974_10122864 3300027876 Bacteria 921
639 Ga0207428_10462032 3300027907 Bacteria 925
640 Ga0268266_10188799 3300028379 Bacteria 1880
641 Ga0268266_10221713 3300028379 Bacteria 1739
642 Ga0268265_10032097 3300028380 Bacteria 3800
643 Ga0268264_10000096 3300028381 Bacteria 230188
644 Ga0268264_10182736 3300028381 Bacteria 1906
645 Ga0268264_11269297 3300028381 Bacteria 746
646 Ga0307517_10000858 3300028786 Bacteria 51951
647 Ga0307517_10005247 3300028786 Bacteria 19599
648 Ga0307517_10202220 3300028786 Bacteria 1239
649 Ga0307517_10257626 3300028786 Bacteria 1016
650 Ga0307517_10277283 3300028786 Bacteria 959
651 Ga0307515_10000013 3300028794 Bacteria 568456
652 Ga0307515_10000037 3300028794 Bacteria 331970
653 Ga0307515_10000416 3300028794 Bacteria 102535
654 Ga0307515_10000459 3300028794 Bacteria 97482
655 Ga0307515_10001547 3300028794 Bacteria 51411
656 Ga0307515_10003402 3300028794 Bacteria 33496
657 Ga0307515_10014281 3300028794 Bacteria 14746
658 Ga0307515_10044904 3300028794 Bacteria 6808
659 Ga0307515_10052836 3300028794 Bacteria 6013
660 Ga0307515_10066856 3300028794 Bacteria 4969
661 Ga0307515_10079960 3300028794 Bacteria 4272
662 Ga0307515_10080743 3300028794 Bacteria 4235
663 Ga0307515_10088904 3300028794 Bacteria 3897
664 Ga0307515_10167790 3300028794 Bacteria 2204
665 Ga0307515_10232256 3300028794 Bacteria 1634
666 Ga0307515_10250810 3300028794 Bacteria 1523
667 Ga0307515_10264224 3300028794 Bacteria 1452
668 Ga0307515_10481414 3300028794 Bacteria 853
669 Ga0265338_10005140 3300028800 Bacteria 17228
670 Ga0307511_10039656 3300030521 Bacteria 4019
671 Ga0307512_10128677 3300030522 Bacteria 1597
672 Ga0314311_1055507 3300030733 Bacteria 11059
673 Ga0316179_1038668 3300030734 Bacteria 3056
674 Ga0316178_1036717 3300030735 Bacteria 5475
675 Ga0316183_1108089 3300030742 Bacteria 2780
676 Ga0316181_1137195 3300030744 Bacteria 1594
677 Ga0316182_1009183 3300030745 Bacteria 4421
678 Ga0316182_1388324 3300030745 Bacteria 4148
679 Ga0265760_10011376 3300031090 Bacteria 2543
680 Ga0265325_10004238 3300031241 Bacteria 9105
681 Ga0265325_10035259 3300031241 Bacteria 2658
682 Ga0265329_10090225 3300031242 Bacteria 972
683 Ga0265327_10000028 3300031251 Bacteria 361066
684 Ga0265327_10002018 3300031251 Bacteria 22920
685 Ga0265316_10382938 3300031344 Bacteria 1015
686 Ga0307513_10000011 3300031456 Bacteria 354929
687 Ga0307513_10000017 3300031456 Bacteria 282386
688 Ga0307513_10006089 3300031456 Bacteria 15829
689 Ga0307513_10013518 3300031456 Bacteria 10016
690 Ga0307513_10036304 3300031456 Bacteria 5500
691 Ga0307513_10080173 3300031456 Bacteria 3368
692 Ga0307513_10121327 3300031456 Bacteria 2580
693 Ga0307513_10177010 3300031456 Bacteria 2002
694 Ga0307513_10221517 3300031456 Bacteria 1713
695 Ga0307513_10240803 3300031456 Bacteria 1614
696 Ga0307513_10304631 3300031456 Bacteria 1358
697 Ga0307513_10357159 3300031456 Bacteria 1207
698 Ga0307513_10485041 3300031456 Bacteria 955
699 Ga0307509_10000577 3300031507 Bacteria 62808
700 Ga0307509_10015812 3300031507 Bacteria 8773
701 Ga0307509_10024552 3300031507 Bacteria 6746
702 Ga0307509_10060212 3300031507 Bacteria 4014
703 Ga0307509_10062994 3300031507 Bacteria 3907
704 Ga0307509_10098166 3300031507 Bacteria 2975
705 Ga0307509_10135747 3300031507 Bacteria 2406
706 Ga0307509_10161738 3300031507 Bacteria 2135
707 Ga0307509_10205420 3300031507 Bacteria 1801
708 Ga0307408_100000016 3300031548 Bacteria 356896
709 Ga0307408_100000136 3300031548 Bacteria 81550
710 Ga0307408_100003858 3300031548 Bacteria 10198
711 Ga0307408_100008251 3300031548 Bacteria 6874
712 Ga0307408_100027631 3300031548 Bacteria 3912
713 Ga0307408_100177221 3300031548 Bacteria 1706
714 Ga0307408_100236339 3300031548 Bacteria 1499
715 Ga0307408_101114743 3300031548 Bacteria 732
716 Ga0265313_10008624 3300031595 Bacteria 6745
717 Ga0307508_10000272 3300031616 Bacteria 63553
718 Ga0307508_10002454 3300031616 Bacteria 19549
719 Ga0307508_10006724 3300031616 Bacteria 10783
720 Ga0307508_10183573 3300031616 Bacteria 1694
721 Ga0307508_10261018 3300031616 Bacteria 1327
722 Ga0307514_10000979 3300031649 Bacteria 42521
723 Ga0307514_10021786 3300031649 Bacteria 5217
724 Ga0307514_10061247 3300031649 Bacteria 2867
725 Ga0307514_10069582 3300031649 Bacteria 2647
726 Ga0316575_10041038 3300031665 Bacteria 1830
727 Ga0265342_10017666 3300031712 Bacteria 4635
728 Ga0307516_10000114 3300031730 Bacteria 93691
729 Ga0307516_10002718 3300031730 Bacteria 23306
730 Ga0307516_10004153 3300031730 Bacteria 18060
731 Ga0307516_10019240 3300031730 Bacteria 7075
732 Ga0307516_10031780 3300031730 Bacteria 5320
733 Ga0307516_10079016 3300031730 Bacteria 3135
734 Ga0307516_10137554 3300031730 Bacteria 2215
735 Ga0307516_10166079 3300031730 Bacteria 1952
736 Ga0307516_10190647 3300031730 Bacteria 1776
737 Ga0307516_10225414 3300031730 Bacteria 1581
738 Ga0307516_10302528 3300031730 Bacteria 1275
739 Ga0307516_10330165 3300031730 Bacteria 1194
740 Ga0307516_10341945 3300031730 Bacteria 1163
741 Ga0307516_10539003 3300031730 Bacteria 821
742 Ga0307516_10645691 3300031730 Bacteria 713
743 Ga0307405_10007105 3300031731 Bacteria 5567
744 Ga0307405_10185879 3300031731 Bacteria 1496
745 Ga0307410_10437014 3300031852 Bacteria 1065
746 Ga0307406_10000105 3300031901 Bacteria 48938
747 Ga0307406_10002407 3300031901 Bacteria 10164
748 Ga0307406_10138637 3300031901 Bacteria 1718
749 Ga0307412_10011637 3300031911 Bacteria 5101
750 Ga0307412_10130555 3300031911 Bacteria 1824
751 Ga0307412_10170156 3300031911 Bacteria 1628
752 Ga0307412_10853752 3300031911 Bacteria 794
753 Ga0307409_100085384 3300031995 Bacteria 2566
754 Ga0307409_100368338 3300031995 Bacteria 1362
755 Ga0307416_100002355 3300032002 Bacteria 10811
756 Ga0307416_100202910 3300032002 Bacteria 1883
757 Ga0307416_100248004 3300032002 Bacteria 1731
758 Ga0307416_100821471 3300032002 Bacteria 1026
759 Ga0307416_100833873 3300032002 Bacteria 1019
760 Ga0307414_10150467 3300032004 Bacteria 1836
761 Ga0307414_10247596 3300032004 Bacteria 1479
762 Ga0307414_10592096 3300032004 Bacteria 993
763 Ga0307411_10000054 3300032005 Bacteria 34373
764 Ga0307411_10130354 3300032005 Bacteria 1837
765 Ga0307507_10031298 3300033179 Bacteria 5588
766 Ga0307507_10061609 3300033179 Bacteria 3492
767 Ga0307507_10261356 3300033179 Bacteria 1105
768 Ga0307510_10000553 3300033180 Bacteria 37544
769 Ga0307510_10010271 3300033180 Bacteria 11121
770 Ga0307510_10029719 3300033180 Bacteria 6213
771 Ga0307510_10091449 3300033180 Bacteria 2885
772 Ga0307510_10151804 3300033180 Bacteria 1933
773 Ga0373926_0066217 3300035083 Bacteria 1323
774 Ga0373951_0004305 3300035091 Bacteria 3391
775 Ga0373923_0028389 3300035111 Bacteria 2238
776 Ga0373939_0000086 3300035114 Bacteria 29575
777 Ga0373939_0021247 3300035114 Bacteria 1774
778 Ga0373960_0000504 3300035121 Bacteria 7792
779 Ga0373943_0289422 3300035170 Bacteria 928
780 Ga0373931_0001184 3300035691 Bacteria 11142
781 Ga0373931_0004756 3300035691 Bacteria 6227
782 Ga0373931_0011123 3300035691 Bacteria 4340
783 Ga0373931_0228585 3300035691 Bacteria 1123
784 Ga0373925_0026197 3300037068 Bacteria 4266
785 Ga0373925_0693428 3300037068 Bacteria 840
786 Ga0395899_0141196 3300037312 Bacteria 1713
787 Ga0395900_0358348 3300037418 Bacteria 1430
788 Ga0395900_0373612 3300037418 Bacteria 1395
789 Ga0395900_0555499 3300037418 Bacteria 1092
790 Ga0395900_0775625 3300037418 Bacteria 888
791 Ga0395898_0005955 3300037466 Bacteria 13088
792 Ga0395898_0030122 3300037466 Bacteria 5432
793 Ga0395905_0000065 3300037471 Bacteria 184928
794 Ga0395905_0012748 3300037471 Bacteria 8085
795 Ga0395905_0023244 3300037471 Bacteria 5860
796 Ga0395905_0023439 3300037471 Bacteria 5832
797 Ga0395905_0028755 3300037471 Bacteria 5237
798 Ga0395905_0066621 3300037471 Bacteria 3372
799 Ga0395905_0074436 3300037471 Bacteria 3182
800 Ga0395905_0086537 3300037471 Bacteria 2937
801 Ga0395905_0134227 3300037471 Bacteria 2328
802 Ga0395905_0257324 3300037471 Bacteria 1630
803 Ga0395905_0568864 3300037471 Bacteria 1035
804 Ga0395901_0000986 3300038443 Bacteria 30762
805 Ga0395901_0126807 3300038443 Bacteria 2682
806 Ga0395901_0252759 3300038443 Bacteria 1836
807 Ga0436361_0468617 3300039447 Bacteria 15829
808 Ga0436361_0481133 3300039447 Bacteria 61506
809 Ga0439465_0004703 3300041413 Bacteria 4403
810 Ga0439465_0005878 3300041413 Bacteria 3904
811 Ga0439465_0041150 3300041413 Bacteria 1495
812 Ga0439465_0082018 3300041413 Bacteria 1095
813 Ga0451789_0064587 3300041443 Bacteria 1301
814 Ga0451795_0571965 3300041456 Bacteria 704
815 Ga0451795_0610494 3300041456 Bacteria 1244
816 Ga0451802_1050121 3300041460 Bacteria 1199
817 Ga0451806_070579 3300041462 Bacteria 905
818 Ga0451835_0809375 3300041492 Bacteria 2843
819 Ga0451839_1037155 3300041496 Bacteria 2501
820 Ga0451841_1103848 3300041498 Bacteria 2932
821 Ga0451851_0479940 3300041507 Bacteria 3728
822 Ga0451851_1086331 3300041507 Bacteria 756
823 Ga0451843_0061446 3300041509 Bacteria 1726
824 Ga0451855_0094398 3300041511 Bacteria 1413
825 Ga0451853_1740632 3300041512 Bacteria 1396
826 Ga0439437_017236 3300042000 Bacteria 857
827 Ga0439442_007281 3300042002 Bacteria 2224
828 Ga0439432_036275 3300042006 Bacteria 1578
829 Ga0439449_0003860 3300042007 Bacteria 5811
830 Ga0439449_0038871 3300042007 Bacteria 1769
831 Ga0439449_0082466 3300042007 Bacteria 1186
832 Ga0439449_0180412 3300042007 Bacteria 789
833 Ga0439462_0042848 3300042015 Bacteria 1209
834 Ga0450911_000263 3300042115 Bacteria 19596
835 Ga0450917_001441 3300042120 Bacteria 1705
836 Ga0450888_000124 3300042126 Bacteria 6201
837 Ga0450890_001321 3300042127 Bacteria 3579
838 Ga0450890_001564 3300042127 Bacteria 3289
839 Ga0450890_021562 3300042127 Bacteria 877
840 Ga0450891_000787 3300042129 Bacteria 3315
841 Ga0450899_012353 3300042135 Bacteria 959
842 Ga0450902_017578 3300042137 Bacteria 1169
843 Ga0450904_002767 3300042139 Bacteria 2006
844 Ga0450889_000412 3300042144 Bacteria 4773
845 Ga0439434_0002848 3300042435 Bacteria 5049
846 Ga0439459_0001403 3300042438 Bacteria 3537
847 Ga0439464_0094401 3300042439 Bacteria 904
848 Ga0450918_000970 3300042531 Bacteria 5983
849 Ga0450893_0003189 3300042532 Bacteria 2577
850 Ga0450893_0007186 3300042532 Bacteria 1808
851 Ga0450893_0021178 3300042532 Bacteria 1122
852 Ga0451577_0000068 3300042876 Bacteria 241923
853 Ga0451577_0544539 3300042876 Bacteria 1054
854 Ga0466969_0000006 3300044656 Bacteria 152970
855 Ga0466969_0023693 3300044656 Bacteria 3161
856 Ga0466972_0001165 3300044658 Bacteria 12590
857 Ga0466972_0178612 3300044658 Bacteria 996
858 Ga0466966_0011852 3300044684 Bacteria 5774
859 Ga0466961_0010850 3300044693 Bacteria 5818
860 Ga0466963_0017134 3300044694 Bacteria 4513
861 Ga0466963_0177928 3300044694 Bacteria 1484
862 Ga0453684_0000126 3300044712 Bacteria 336395
863 Ga0453684_0052651 3300044712 Bacteria 5320
864 Ga0466970_0142147 3300044765 Bacteria 1322
865 Ga0466957_0058069 3300044842 Bacteria 2370
866 Ga0466960_0170841 3300044901 Bacteria 1173
867 Ga0466959_0015914 3300045049 Bacteria 5487
868 Ga0466959_0085652 3300045049 Bacteria 2267
869 Ga0466959_0431854 3300045049 Bacteria 894
870 Ga0451576_0010126 3300045051 Bacteria 10855
871 Ga0451576_0074794 3300045051 Bacteria 3524
872 Ga0451576_0092337 3300045051 Bacteria 3148
873 Ga0451576_0125447 3300045051 Bacteria 2675
874 Ga0451576_0951463 3300045051 Bacteria 901
875 Ga0466967_0068814 3300045976 Bacteria 3162
876 Ga0495617_042543 3300046452 Bacteria 1518
877 Ga0495592_0000142 3300046454 Bacteria 63571
878 Ga0495592_0559598 3300046454 Bacteria 702
879 Ga0495592_0581159 3300046454 Bacteria 685
880 Ga0495603_0149472 3300046455 Bacteria 1357
881 Ga0495638_0027683 3300046460 Bacteria 3667
882 Ga0495638_0042130 3300046460 Bacteria 2885
883 Ga0495638_0099172 3300046460 Bacteria 1744
884 Ga0495638_0101417 3300046460 Bacteria 1721
885 Ga0495641_0152583 3300046461 Bacteria 1033
886 Ga0495650_0020791 3300046471 Bacteria 3191
887 Ga0495650_0057741 3300046471 Bacteria 1569
888 Ga0495582_0098764 3300046473 Bacteria 1634
889 Ga0495639_0035463 3300046475 Bacteria 2232
890 Ga0495639_0048050 3300046475 Bacteria 1935
891 Ga0495585_0017087 3300046492 Bacteria 4199
892 Ga0495585_0089471 3300046492 Bacteria 1659
893 Ga0495585_0218222 3300046492 Bacteria 963
894 Ga0495594_0003929 3300046499 Bacteria 7647
895 Ga0495594_0326123 3300046499 Bacteria 874
896 Ga0495607_0000109 3300046501 Bacteria 86702
897 Ga0495583_0000376 3300046506 Bacteria 69314
898 Ga0495583_0066141 3300046506 Bacteria 1600
899 Ga0495583_0107647 3300046506 Bacteria 1184
900 Ga0495606_0001320 3300046507 Bacteria 33873
901 Ga0495606_0171705 3300046507 Bacteria 1257
902 Ga0495610_0025099 3300046512 Bacteria 3206
903 Ga0495610_0110421 3300046512 Bacteria 1219
904 Ga0495616_0000916 3300046513 Bacteria 21218
905 Ga0495631_0000233 3300046518 Bacteria 38235
906 Ga0495631_0033936 3300046518 Bacteria 2289
907 Ga0495631_0073140 3300046518 Bacteria 1480
908 Ga0495631_0235917 3300046518 Bacteria 780
909 Ga0495632_0003636 3300046519 Bacteria 10835
910 Ga0495632_0009650 3300046519 Bacteria 5795
911 Ga0495637_0008199 3300046520 Bacteria 5138
912 Ga0495648_0066509 3300046524 Bacteria 2113
913 Ga0495648_0253525 3300046524 Bacteria 848
914 Ga0495663_0081929 3300046525 Bacteria 1040
915 Ga0495666_0064627 3300046526 Bacteria 1746
916 Ga0495666_0226699 3300046526 Bacteria 855
917 Ga0495654_0010956 3300046530 Bacteria 4926
918 Ga0495665_0019054 3300046531 Bacteria 3688
919 Ga0495609_0016688 3300046538 Bacteria 3420
920 Ga0495621_0020533 3300046539 Bacteria 2169
921 Ga0495621_0079989 3300046539 Bacteria 1217
922 Ga0495597_0166426 3300046542 Bacteria 897
923 Ga0495622_0127057 3300046557 Bacteria 1162
924 Ga0495622_0227374 3300046557 Bacteria 825
925 Ga0495633_0035191 3300046558 Bacteria 2405
926 Ga0495656_0021867 3300046615 Bacteria 2496
927 Ga0495656_0023620 3300046615 Bacteria 2421
928 Ga0495611_0140328 3300046648 Bacteria 1128
929 Ga0495611_0215781 3300046648 Bacteria 893
930 Ga0495625_0000057 3300046660 Bacteria 181623
931 Ga0495625_0002261 3300046660 Bacteria 21166
932 Ga0495625_0007412 3300046660 Bacteria 9555
933 Ga0495625_0056299 3300046660 Bacteria 2800
934 Ga0495625_0271290 3300046660 Bacteria 1095
935 Ga0495661_0123742 3300046665 Bacteria 1425
936 Ga0495661_0178313 3300046665 Bacteria 1128
937 Ga0495588_0039983 3300046674 Bacteria 2390
938 Ga0495588_0301486 3300046674 Bacteria 843
939 Ga0495658_0019792 3300046683 Bacteria 3519
940 Ga0495658_0039179 3300046683 Bacteria 2628
941 Ga0495669_0082428 3300046684 Bacteria 1477
942 Ga0495670_0012581 3300046691 Bacteria 4162
943 Ga0495670_0097843 3300046691 Bacteria 1508
944 Ga0495670_0142166 3300046691 Bacteria 1255
945 Ga0495671_0001282 3300046692 Bacteria 17146
946 Ga0495671_0158219 3300046692 Bacteria 1102
947 Ga0495649_0002087 3300046694 Bacteria 14357
948 Ga0495649_0005309 3300046694 Bacteria 8223
949 Ga0495589_0256336 3300046794 Bacteria 816
950 Ga0495660_0031035 3300046810 Bacteria 3007
951 Ga0495660_0095788 3300046810 Bacteria 1535
952 Ga0495660_0128345 3300046810 Bacteria 1275
953 Ga0495676_0012350 3300047321 Bacteria 7695
954 Ga0495683_0076585 3300047323 Bacteria 1636
955 Ga0495687_001004 3300047443 Bacteria 28188
956 Ga0495687_012020 3300047443 Bacteria 4605
957 Ga0495677_0036975 3300047445 Bacteria 1783
958 Ga0495686_0028682 3300047472 Bacteria 3624
959 Ga0495686_0072858 3300047472 Bacteria 2111
960 Ga0495686_0100520 3300047472 Bacteria 1744
961 Ga0495686_0338926 3300047472 Bacteria 820
962 Ga0495593_0037832 3300047673 Bacteria 2607
963 Ga0495593_0042953 3300047673 Bacteria 2425
964 Ga0495614_0006188 3300048089 Bacteria 5377
965 Ga0495614_0053453 3300048089 Bacteria 1732
966 Ga0495615_0008063 3300048090 Bacteria 2022
967 Ga0495626_0218434 3300048091 Bacteria 775
968 Ga0496100_0154590 3300048903 Bacteria 1639
969 Ga0496100_0229336 3300048903 Bacteria 1366
970 Ga0496101_0067987 3300048904 Bacteria 2603
971 Ga0496102_0007041 3300048905 Bacteria 9600
972 Ga0496102_0155958 3300048905 Bacteria 2146
973 Ga0496103_0011650 3300048906 Bacteria 5215
974 Ga0496106_0085390 3300048909 Bacteria 2430
975 Ga0496107_0372121 3300048910 Bacteria 1063
976 Ga0496108_0813614 3300048911 Bacteria 806
977 Ga0496109_0182082 3300048912 Bacteria 1974
978 Ga0496110_0490737 3300048913 Bacteria 1119
979 Ga0496110_0677333 3300048913 Bacteria 932
980 Ga0496113_0104500 3300048916 Bacteria 2198
981 Ga0496113_0221629 3300048916 Bacteria 1507
982 Ga0496116_0015406 3300048919 Bacteria 6042
983 Ga0496116_0022162 3300048919 Bacteria 4769
984 Ga0496116_0057064 3300048919 Bacteria 2555
985 Ga0496117_0001468 3300048920 Bacteria 33907
986 Ga0496117_0038061 3300048920 Bacteria 3573
987 Ga0496117_0116370 3300048920 Bacteria 1652
988 Ga0496118_0001422 3300048921 Bacteria 36121
989 Ga0496118_0001567 3300048921 Bacteria 33913
990 Ga0496118_0011544 3300048921 Bacteria 8608
991 Ga0496118_0072606 3300048921 Bacteria 2470
992 Ga0496118_0078889 3300048921 Bacteria 2327
993 Ga0496118_0088420 3300048921 Bacteria 2143
994 Ga0496118_0101001 3300048921 Bacteria 1949
995 Ga0496119_0011813 3300048922 Bacteria 7173
996 Ga0496120_0014081 3300048923 Bacteria 5343
997 Ga0496121_0001848 3300048924 Bacteria 34098
998 Ga0496121_0003975 3300048924 Bacteria 20393
999 Ga0496121_0011069 3300048924 Bacteria 10066
1000 Ga0496121_0066020 3300048924 Bacteria 2940
1001 Ga0496121_0290745 3300048924 Bacteria 1113
1002 Ga0496121_0347834 3300048924 Bacteria 988
1003 Ga0496121_0504302 3300048924 Bacteria 767
1004 Ga0496121_0563010 3300048924 Bacteria 711
1005 Ga0496122_0048835 3300048925 Bacteria 3249
1006 Ga0496122_0064555 3300048925 Bacteria 2663
1007 Ga0496122_0093644 3300048925 Bacteria 2037
1008 Ga0496122_0113078 3300048925 Bacteria 1775
1009 Ga0496123_0010560 3300048926 Bacteria 8140
1010 Ga0496123_0043777 3300048926 Bacteria 3070
1011 Ga0496123_0094573 3300048926 Bacteria 1760
1012 Ga0496124_0006608 3300048927 Bacteria 12593
1013 Ga0496124_0006999 3300048927 Bacteria 12089
1014 Ga0496124_0011068 3300048927 Bacteria 9055
1015 Ga0496124_0021012 3300048927 Bacteria 6020
1016 Ga0496124_0134745 3300048927 Bacteria 1957
1017 Ga0496124_0137998 3300048927 Bacteria 1928
1018 Ga0496124_0146586 3300048927 Bacteria 1857
1019 Ga0496124_0194790 3300048927 Bacteria 1547
1020 Ga0496124_0453967 3300048927 Bacteria 873
1021 Ga0496125_0000125 3300048928 Bacteria 169979
1022 Ga0496125_0000352 3300048928 Bacteria 87143
1023 Ga0496125_0001478 3300048928 Bacteria 33952
1024 Ga0496125_0042236 3300048928 Bacteria 3886
1025 Ga0496125_0043144 3300048928 Bacteria 3833
1026 Ga0496125_0115090 3300048928 Bacteria 1935
1027 Ga0496125_0172060 3300048928 Bacteria 1454
1028 Ga0496126_0026679 3300048929 Bacteria 5533
1029 Ga0496126_0071852 3300048929 Bacteria 3079
1030 Ga0496126_0249102 3300048929 Bacteria 1481
1031 Ga0496126_0334278 3300048929 Bacteria 1242
1032 Ga0495678_020187 3300049459 Bacteria 2956
1033 Ga0495678_089296 3300049459 Bacteria 1089
1034 Ga0501292_032155 3300049515 Bacteria 885
1035 Ga0501031_0416502 3300049568 Bacteria 869
1036 Ga0501034_0488425 3300049571 Bacteria 1146
1037 Ga0501046_0030075 3300049580 Bacteria 4411
1038 Ga0501048_0250250 3300049582 Bacteria 1258
1039 Ga0501070_0472174 3300049586 Bacteria 1010
1040 Ga0501075_0440371 3300049591 Bacteria 994
1041 Ga0501202_006430 3300049652 Bacteria 2103
1042 Ga0501206_001528 3300049653 Bacteria 2884
1043 Ga0501211_000285 3300049658 Bacteria 4615
1044 Ga0501217_015236 3300049661 Bacteria 1748
1045 Ga0501222_001447 3300049662 Bacteria 3329
1046 Ga0501222_011808 3300049662 Bacteria 1152
1047 Ga0501227_006696 3300049665 Bacteria 2471
1048 Ga0501235_003072 3300049669 Bacteria 3597
1049 Ga0501249_009632 3300049679 Bacteria 2010
1050 Ga0501253_006500 3300049683 Bacteria 1587
1051 Ga0501221_007887 3300049704 Bacteria 1838
1052 Ga0501225_0007904 3300049705 Bacteria 3069
1053 Ga0501229_010523 3300049706 Bacteria 1168
1054 Ga0501229_015362 3300049706 Bacteria 992
1055 Ga0501080_0072940 3300049742 Bacteria 3194
1056 Ga0501232_000254 3300049757 Bacteria 3295
1057 Ga0501262_000028 3300049759 Bacteria 19106
1058 Ga0501271_003968 3300049768 Bacteria 1387
1059 Ga0501272_001874 3300049769 Bacteria 2046
1060 Ga0501282_002251 3300049778 Bacteria 2118
1061 nmdc:mga03683_10366_c1 3300050489 Bacteria 3341
1062 nmdc:mga03683_22329_c1 3300050489 Bacteria 2452
1063 nmdc:mga03683_289133_c1 3300050489 Bacteria 767
1064 nmdc:mga03683_36961_c1 3300050489 Bacteria 1988
1065 nmdc:mga03683_4135_c1 3300050489 Bacteria 4772
1066 nmdc:mga03683_97608_c1 3300050489 Bacteria 1288
1067 nmdc:mga03n38_292914_c1 3300050490 Bacteria 872
1068 nmdc:mga03n38_3262_c1 3300050490 Bacteria 5183
1069 nmdc:mga03n38_63322_c1 3300050490 Bacteria 1690
1070 nmdc:mga03n38_93120_c1 3300050490 Bacteria 1439
1071 nmdc:mga00v17_11218_c1 3300050491 Bacteria 4921
1072 nmdc:mga00v17_2356_c1 3300050491 Bacteria 9673
1073 nmdc:mga0yw44_103670_c1 3300050492 Bacteria 1815
1074 nmdc:mga0yw44_124115_c1 3300050492 Bacteria 1666
1075 nmdc:mga0yw44_215370_c1 3300050492 Bacteria 1271
1076 nmdc:mga0yw44_395542_c1 3300050492 Bacteria 934
1077 nmdc:mga0yw44_4974_c1 3300050492 Bacteria 6201
1078 nmdc:mga0yw44_8131_c1 3300050492 Bacteria 5209
1079 nmdc:mga0k408_10654_c1 3300050493 Bacteria 4978
1080 nmdc:mga0k408_130472_c1 3300050493 Bacteria 1492
1081 nmdc:mga0k408_151135_c1 3300050493 Bacteria 1383
1082 nmdc:mga0k408_186197_c1 3300050493 Bacteria 1238
1083 nmdc:mga0k408_279467_c1 3300050493 Bacteria 997
1084 nmdc:mga0k408_408488_c1 3300050493 Bacteria 808
1085 nmdc:mga0k408_59185_c1 3300050493 Bacteria 2226
1086 nmdc:mga0k408_6388_c1 3300050493 Bacteria 6292
1087 nmdc:mga0k408_67147_c1 3300050493 Bacteria 2090
1088 nmdc:mga0k408_74244_c1 3300050493 Bacteria 1987
1089 nmdc:mga0k408_79091_c1 3300050493 Bacteria 1924
1090 nmdc:mga06z11_258857_c1 3300050494 Bacteria 1026
1091 nmdc:mga06z11_33226_c1 3300050494 Bacteria 2522
1092 nmdc:mga06z11_62697_c1 3300050494 Bacteria 1943
1093 nmdc:mga06z11_6540_c1 3300050494 Bacteria 4751
1094 nmdc:mga04h51_27204_c1 3300050495 Bacteria 1775
1095 nmdc:mga04h51_9886_c1 3300050495 Bacteria 2217
1096 nmdc:mga07m45_1812_c1 3300050496 Bacteria 9847
1097 nmdc:mga07m45_190717_c1 3300050496 Bacteria 1192
1098 nmdc:mga07m45_22778_c1 3300050496 Bacteria 3422
1099 nmdc:mga07m45_24703_c1 3300050496 Bacteria 3294
1100 nmdc:mga07m45_30502_c1 3300050496 Bacteria 2986
1101 nmdc:mga07m45_35107_c1 3300050496 Bacteria 2789
1102 nmdc:mga07m45_3652_c1 3300050496 Bacteria 7431
1103 nmdc:mga07m45_4190_c1 3300050496 Bacteria 7047
1104 nmdc:mga07m45_47016_c1 3300050496 Bacteria 2425
1105 nmdc:mga07m45_480782_c1 3300050496 Bacteria 720
1106 nmdc:mga07m45_48543_c1 3300050496 Bacteria 2388
1107 nmdc:mga07m45_56087_c1 3300050496 Bacteria 2227
1108 nmdc:mga07m45_59_c1 3300050496 Bacteria 45010
1109 nmdc:mga07m45_81739_c1 3300050496 Bacteria 1845
1110 nmdc:mga07m45_873_c1 3300050496 Bacteria 13139
1111 nmdc:mga07m45_910_c1 3300050496 Bacteria 12934
1112 nmdc:mga09592_367410_c1 3300050508 Bacteria 1244
1113 nmdc:mga06r32_676900_c1 3300050510 Bacteria 998
1114 nmdc:mga0sz30_147794_c1 3300050516 Bacteria 1039
1115 nmdc:mga0sz30_35107_c1 3300050516 Bacteria 2090
1116 nmdc:mga0sz30_73110_c1 3300050516 Bacteria 1478
1117 nmdc:mga0sz30_803_c1 3300050516 Bacteria 11349
1118 Ga0500635_0000121 3300053080 Bacteria 45993
1119 Ga0495655_0002828 3300053083 Bacteria 2794
1120 Ga0495655_0032722 3300053083 Bacteria 1275
1121 Ga0500578_0000122 3300053086 Bacteria 94493
1122 Ga0500643_014230 3300053087 Bacteria 2774
1123 Ga0500644_0087108 3300053088 Bacteria 1161
1124 Ga0500646_0009863 3300053090 Bacteria 2445
1125 Ga0500651_0000026 3300053093 Bacteria 117323
1126 Ga0500651_0019783 3300053093 Bacteria 4188
1127 Ga0500651_0089108 3300053093 Bacteria 1902
1128 Ga0500651_0155388 3300053093 Bacteria 1371
1129 Ga0500651_0166562 3300053093 Bacteria 1316
1130 Ga0500566_0079772 3300053094 Bacteria 1824
1131 Ga0500566_0113279 3300053094 Bacteria 1472
1132 Ga0500566_0188775 3300053094 Bacteria 1051
1133 Ga0500641_0025077 3300053096 Bacteria 2305
1134 Ga0500641_0040874 3300053096 Bacteria 1874
1135 Ga0500560_062239 3300053107 Bacteria 1219
1136 Ga0500562_066490 3300053108 Bacteria 971
1137 Ga0500569_002595 3300053109 Bacteria 3587
1138 Ga0500571_000839 3300053110 Bacteria 13266
1139 Ga0500572_137129 3300053111 Bacteria 796
1140 Ga0500593_000625 3300053117 Bacteria 13599
1141 Ga0500593_008528 3300053117 Bacteria 4215
1142 Ga0500594_0005684 3300053118 Bacteria 2772
1143 Ga0500594_0014303 3300053118 Bacteria 1898
1144 Ga0500595_001459 3300053119 Bacteria 12603
1145 Ga0500595_054943 3300053119 Bacteria 1221
1146 Ga0500597_088817 3300053120 Bacteria 1342
1147 Ga0500607_004274 3300053121 Bacteria 9938
1148 Ga0500607_040469 3300053121 Bacteria 2526
1149 Ga0500607_107413 3300053121 Bacteria 1374
1150 Ga0500608_033574 3300053122 Bacteria 2442
1151 Ga0500618_000480 3300053125 Bacteria 25656
1152 Ga0500618_022011 3300053125 Bacteria 1552
1153 Ga0500621_108278 3300053126 Bacteria 1089
1154 Ga0500626_071451 3300053128 Bacteria 1544
1155 Ga0500628_001358 3300053129 Bacteria 4205
1156 Ga0500628_045594 3300053129 Bacteria 1019
1157 Ga0500642_0025425 3300053130 Bacteria 2404
1158 Ga0500642_0156069 3300053130 Bacteria 1071
1159 Ga0500652_000127 3300053131 Bacteria 28982
1160 Ga0500655_004596 3300053133 Bacteria 2482
1161 Ga0500655_005059 3300053133 Bacteria 2373
1162 Ga0500655_011444 3300053133 Bacteria 1608
1163 Ga0500658_0004281 3300053134 Bacteria 5348
1164 Ga0500658_0006149 3300053134 Bacteria 4469
1165 Ga0500658_0117157 3300053134 Bacteria 1178
1166 Ga0500559_0000014 3300053136 Bacteria 160139
1167 Ga0500559_0013968 3300053136 Bacteria 3393
1168 Ga0500559_0252232 3300053136 Bacteria 831
1169 Ga0500568_0004013 3300053139 Bacteria 7983
1170 Ga0500568_0025148 3300053139 Bacteria 2515
1171 Ga0500568_0026977 3300053139 Bacteria 2406
1172 Ga0500568_0042114 3300053139 Bacteria 1831
1173 Ga0500573_0003319 3300053140 Bacteria 8313
1174 Ga0500573_0005541 3300053140 Bacteria 6769
1175 Ga0500573_0035188 3300053140 Bacteria 2889
1176 Ga0500574_000537 3300053141 Bacteria 4879
1177 Ga0500577_0009701 3300053142 Bacteria 2805
1178 Ga0500590_126648 3300053148 Bacteria 1188
1179 Ga0500604_0002538 3300053151 Bacteria 4983
1180 Ga0500604_0029488 3300053151 Bacteria 1600
1181 Ga0500616_0035141 3300053153 Bacteria 2727
1182 Ga0500616_0036513 3300053153 Bacteria 2666
1183 Ga0500616_0119852 3300053153 Bacteria 1258
1184 Ga0500622_0000274 3300053156 Bacteria 53160
1185 Ga0500622_0002493 3300053156 Bacteria 13244
1186 Ga0500622_0003526 3300053156 Bacteria 10376
1187 Ga0500624_009396 3300053157 Bacteria 1390
1188 Ga0500627_0151825 3300053158 Bacteria 1046
1189 Ga0500633_0110267 3300053160 Bacteria 1019
1190 Ga0500634_0024290 3300053161 Bacteria 3296
1191 Ga0500634_0063235 3300053161 Bacteria 1958
1192 Ga0500634_0070361 3300053161 Bacteria 1832
1193 Ga0500638_006555 3300053162 Bacteria 4777
1194 Ga0500636_0235878 3300053177 Bacteria 943
1195 Ga0500636_0291732 3300053177 Bacteria 808
1196 Ga0500637_0152063 3300053178 Bacteria 1336
1197 Ga0500570_091733 3300053724 Bacteria 1319
1198 Ga0500645_000408 3300053730 Bacteria 30041
1199 Ga0500645_007619 3300053730 Bacteria 3753
1200 Ga0500645_012528 3300053730 Bacteria 2738
1201 Ga0500645_024852 3300053730 Bacteria 1829
1202 Ga0500645_030395 3300053730 Bacteria 1626
1203 Ga0500596_009403 3300053735 Bacteria 1526
1204 Ga0500587_005656 3300053739 Bacteria 1674
1205 Ga0500661_026656 3300055283 Bacteria 1021
1206 Ga0590075_020130 3300059424 Bacteria 1661
1207 Ga0501082_0983153 3300060353 Bacteria 738
1208 Ga0466962_0207637 3300061719 Bacteria 958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100364784 Ga0070668_1003647842 176
2 3300005983 Ga0081540_1025165 Ga0081540_10251653 181
3 3300046454 Ga0495592_0581159 Ga0495592_0581159_10_627 184
4 3300048913 Ga0496110_0677333 Ga0496110_0677333_117_779 187
5 3300009147 Ga0114129_10124043 Ga0114129_101240434 188
6 3300053119 Ga0500595_001459 Ga0500595_001459_10460_11122 188
7 3300026095 Ga0207676_10477920 Ga0207676_104779201 190
8 3300026121 Ga0207683_10385634 Ga0207683_103856341 190
9 3300046665 Ga0495661_0178313 Ga0495661_0178313_98_760 190
10 3300005334 Ga0068869_100360783 Ga0068869_1003607832 191
11 3300005347 Ga0070668_100186597 Ga0070668_1001865972 191
12 3300005354 Ga0070675_100432836 Ga0070675_1004328362 191
13 3300005441 Ga0070700_100171079 Ga0070700_1001710791 191
14 3300005577 Ga0068857_100175810 Ga0068857_1001758102 191
15 3300005617 Ga0068859_100135150 Ga0068859_1001351502 191
16 3300005719 Ga0068861_100233068 Ga0068861_1002330682 191
17 3300005842 Ga0068858_100326792 Ga0068858_1003267922 191
18 3300006931 Ga0097620_100135146 Ga0097620_1001351462 191
19 3300009545 Ga0105237_10333616 Ga0105237_103336162 191
20 3300014968 Ga0157379_10250783 Ga0157379_102507832 191
21 3300031730 Ga0307516_10302528 Ga0307516_103025282 191
22 3300033179 Ga0307507_10261356 Ga0307507_102613562 191
23 3300033180 Ga0307510_10010271 Ga0307510_100102713 191
24 3300037471 Ga0395905_0023244 Ga0395905_0023244_4388_5062 191
25 3300046455 Ga0495603_0149472 Ga0495603_0149472_278_940 191
26 3300046473 Ga0495582_0098764 Ga0495582_0098764_123_785 191
27 3300046499 Ga0495594_0003929 Ga0495594_0003929_1645_2307 191
28 3300046526 Ga0495666_0226699 Ga0495666_0226699_180_842 191
29 3300046557 Ga0495622_0127057 Ga0495622_0127057_342_1004 191
30 3300031730 Ga0307516_10190647 Ga0307516_101906472 192
31 3300037418 Ga0395900_0555499 Ga0395900_0555499_277_951 192
32 3300005844 Ga0068862_100157436 Ga0068862_1001574361 193
33 3300005983 Ga0081540_1001503 Ga0081540_100150317 193
34 3300005983 Ga0081540_1002032 Ga0081540_10020322 193
35 3300005985 Ga0081539_10011653 Ga0081539_100116536 193
36 3300006048 Ga0075363_100291536 Ga0075363_1002915361 193
37 3300006177 Ga0075362_10068895 Ga0075362_100688952 193
38 3300025937 Ga0207669_10280286 Ga0207669_102802861 193
39 3300028786 Ga0307517_10000858 Ga0307517_100008586 193
40 3300028794 Ga0307515_10014281 Ga0307515_1001428112 193
41 3300037471 Ga0395905_0568864 Ga0395905_0568864_17_679 193
42 3300049591 Ga0501075_0440371 Ga0501075_0440371_55_717 193
43 3300050492 nmdc:mga0yw44_103670_c1 nmdc:mga0yw44_103670_c1_980_1642 193
44 3300050493 nmdc:mga0k408_79091_c1 nmdc:mga0k408_79091_c1_615_1277 193
45 3300050510 nmdc:mga06r32_676900_c1 nmdc:mga06r32_676900_c1_310_972 193
46 3300050516 nmdc:mga0sz30_147794_c1 nmdc:mga0sz30_147794_c1_47_709 193
47 3300005345 Ga0070692_10182631 Ga0070692_101826312 194
48 3300005719 Ga0068861_100144687 Ga0068861_1001446871 194
49 3300005844 Ga0068862_100052518 Ga0068862_1000525184 194
50 3300005983 Ga0081540_1000001 Ga0081540_100000120 194
51 3300006178 Ga0075367_10365796 Ga0075367_103657962 194
52 3300006195 Ga0075366_10002900 Ga0075366_100029007 194
53 3300025242 Ga0209258_100277 Ga0209258_10027712 194
54 3300026118 Ga0207675_100088902 Ga0207675_1000889022 194
55 3300028380 Ga0268265_10032097 Ga0268265_100320974 194
56 3300031507 Ga0307509_10062994 Ga0307509_100629944 194
57 3300032002 Ga0307416_100821471 Ga0307416_1008214711 194
58 3300050489 nmdc:mga03683_36961_c1 nmdc:mga03683_36961_c1_502_1176 194
59 3300060353 Ga0501082_0983153 Ga0501082_0983153_29_691 194
60 3300003215 JGI25153J46596_10000575 JGI25153J46596_100005758 195
61 3300005985 Ga0081539_10168377 Ga0081539_101683772 195
62 3300025297 Ga0209758_1005551 Ga0209758_10055514 195
63 3300031730 Ga0307516_10225414 Ga0307516_102254142 195
64 3300035083 Ga0373926_0066217 Ga0373926_0066217_644_1306 195
65 3300046492 Ga0495585_0089471 Ga0495585_0089471_448_1110 195
66 3300046558 Ga0495633_0035191 Ga0495633_0035191_1177_1839 195
67 3300046691 Ga0495670_0142166 Ga0495670_0142166_554_1216 195
68 3300003790 Ga0055528_1020476 Ga0055528_10204763 196
69 3300005467 Ga0070706_100256706 Ga0070706_1002567062 196
70 3300005719 Ga0068861_100523885 Ga0068861_1005238852 196
71 3300005844 Ga0068862_100392012 Ga0068862_1003920122 196
72 3300006353 Ga0075370_10022506 Ga0075370_100225063 196
73 3300009148 Ga0105243_10301838 Ga0105243_103018382 196
74 3300009176 Ga0105242_10115237 Ga0105242_101152372 196
75 3300014745 Ga0157377_10494944 Ga0157377_104949441 196
76 3300025907 Ga0207645_10407405 Ga0207645_104074052 196
77 3300025910 Ga0207684_10179131 Ga0207684_101791312 196
78 3300025942 Ga0207689_10228587 Ga0207689_102285872 196
79 3300026067 Ga0207678_10274552 Ga0207678_102745522 196
80 3300026089 Ga0207648_10239710 Ga0207648_102397102 196
81 3300026118 Ga0207675_100013893 Ga0207675_1000138933 196
82 3300028381 Ga0268264_11269297 Ga0268264_112692971 196
83 3300028794 Ga0307515_10250810 Ga0307515_102508102 196
84 3300031456 Ga0307513_10221517 Ga0307513_102215172 196
85 3300031595 Ga0265313_10008624 Ga0265313_100086246 196
86 3300031731 Ga0307405_10185879 Ga0307405_101858792 196
87 3300031901 Ga0307406_10138637 Ga0307406_101386373 196
88 3300031995 Ga0307409_100085384 Ga0307409_1000853842 196
89 3300032002 Ga0307416_100202910 Ga0307416_1002029102 196
90 3300032002 Ga0307416_100248004 Ga0307416_1002480042 196
91 3300032004 Ga0307414_10150467 Ga0307414_101504672 196
92 3300035170 Ga0373943_0289422 Ga0373943_0289422_138_800 196
93 3300046452 Ga0495617_042543 Ga0495617_042543_505_1167 196
94 3300046471 Ga0495650_0020791 Ga0495650_0020791_971_1633 196
95 3300046475 Ga0495639_0035463 Ga0495639_0035463_807_1469 196
96 3300046492 Ga0495585_0218222 Ga0495585_0218222_128_790 196
97 3300046499 Ga0495594_0326123 Ga0495594_0326123_154_816 196
98 3300046506 Ga0495583_0107647 Ga0495583_0107647_148_810 196
99 3300046518 Ga0495631_0033936 Ga0495631_0033936_1082_1744 196
100 3300046525 Ga0495663_0081929 Ga0495663_0081929_217_879 196
101 3300046538 Ga0495609_0016688 Ga0495609_0016688_346_1008 196
102 3300046539 Ga0495621_0079989 Ga0495621_0079989_479_1141 196
103 3300046615 Ga0495656_0023620 Ga0495656_0023620_732_1394 196
104 3300046648 Ga0495611_0140328 Ga0495611_0140328_346_1008 196
105 3300046684 Ga0495669_0082428 Ga0495669_0082428_627_1289 196
106 3300046794 Ga0495589_0256336 Ga0495589_0256336_114_776 196
107 3300046810 Ga0495660_0095788 Ga0495660_0095788_268_930 196
108 3300047323 Ga0495683_0076585 Ga0495683_0076585_19_681 196
109 3300047445 Ga0495677_0036975 Ga0495677_0036975_609_1271 196
110 3300048905 Ga0496102_0155958 Ga0496102_0155958_201_863 196
111 3300048921 Ga0496118_0088420 Ga0496118_0088420_851_1513 196
112 3300048924 Ga0496121_0347834 Ga0496121_0347834_71_733 196
113 3300048924 Ga0496121_0504302 Ga0496121_0504302_44_706 196
114 3300048927 Ga0496124_0453967 Ga0496124_0453967_188_850 196
115 3300050496 nmdc:mga07m45_47016_c1 nmdc:mga07m45_47016_c1_908_1570 196
116 3300050508 nmdc:mga09592_367410_c1 nmdc:mga09592_367410_c1_261_923 196
117 3300053083 Ga0495655_0002828 Ga0495655_0002828_1643_2305 196
118 3300053126 Ga0500621_108278 Ga0500621_108278_68_730 196
119 3300053130 Ga0500642_0156069 Ga0500642_0156069_372_1034 196
120 3300053133 Ga0500655_011444 Ga0500655_011444_810_1472 196
121 3300053134 Ga0500658_0117157 Ga0500658_0117157_127_789 196
122 3300053730 Ga0500645_012528 Ga0500645_012528_80_742 196
123 3300002705 JGI25156J39149_1000292 JGI25156J39149_100029220 197
124 3300002738 JGI25154J39366_1001784 JGI25154J39366_10017846 197
125 3300002741 JGI25157J39369_1000326 JGI25157J39369_100032620 197
126 3300003316 rootH1_10000553 rootH1_1000055315 197
127 3300003752 Ga0055539_1001525 Ga0055539_10015253 197
128 3300005456 Ga0070678_100136996 Ga0070678_1001369963 197
129 3300005539 Ga0068853_100120828 Ga0068853_1001208283 197
130 3300005563 Ga0068855_100140845 Ga0068855_1001408452 197
131 3300005577 Ga0068857_100000085 Ga0068857_1000000855 197
132 3300005578 Ga0068854_100056806 Ga0068854_1000568062 197
133 3300005616 Ga0068852_100039371 Ga0068852_1000393715 197
134 3300005981 Ga0081538_10106443 Ga0081538_101064432 197
135 3300005983 Ga0081540_1014618 Ga0081540_10146184 197
136 3300009093 Ga0105240_10017734 Ga0105240_100177348 197
137 3300009174 Ga0105241_10055495 Ga0105241_100554953 197
138 3300009545 Ga0105237_10248545 Ga0105237_102485453 197
139 3300009551 Ga0105238_10057136 Ga0105238_100571364 197
140 3300010375 Ga0105239_10026173 Ga0105239_100261736 197
141 3300013105 Ga0157369_10036372 Ga0157369_100363723 197
142 3300025246 Ga0209646_1000039 Ga0209646_1000039262 197
143 3300025250 Ga0209026_1000006 Ga0209026_1000006339 197
144 3300025253 Ga0209677_100067 Ga0209677_10006736 197
145 3300025256 Ga0209759_1000189 Ga0209759_100018980 197
146 3300025913 Ga0207695_10005283 Ga0207695_1000528312 197
147 3300025914 Ga0207671_10034858 Ga0207671_100348585 197
148 3300025919 Ga0207657_10363849 Ga0207657_103638492 197
149 3300025924 Ga0207694_10003012 Ga0207694_1000301211 197
150 3300025949 Ga0207667_10070583 Ga0207667_100705833 197
151 3300025981 Ga0207640_10044194 Ga0207640_100441942 197
152 3300026078 Ga0207702_10000111 Ga0207702_1000011135 197
153 3300026116 Ga0207674_10001263 Ga0207674_100012633 197
154 3300031665 Ga0316575_10041038 Ga0316575_100410382 197
155 3300037471 Ga0395905_0257324 Ga0395905_0257324_178_855 197
156 3300042007 Ga0439449_0082466 Ga0439449_0082466_535_1170 197
157 3300006042 Ga0075368_10206740 Ga0075368_102067401 198
158 3300009545 Ga0105237_10230368 Ga0105237_102303683 198
159 3300025250 Ga0209026_1032685 Ga0209026_10326851 198
160 3300025986 Ga0207658_10650811 Ga0207658_106508111 198
161 3300028379 Ga0268266_10221713 Ga0268266_102217132 198
162 3300031730 Ga0307516_10031780 Ga0307516_100317803 198
163 3300031730 Ga0307516_10341945 Ga0307516_103419452 198
164 3300041456 Ga0451795_0610494 Ga0451795_0610494_430_1092 198
165 3300048928 Ga0496125_0000125 Ga0496125_0000125_102358_103020 198
166 3300053096 Ga0500641_0040874 Ga0500641_0040874_211_873 198
167 3300053136 Ga0500559_0252232 Ga0500559_0252232_149_811 198
168 3300053139 Ga0500568_0026977 Ga0500568_0026977_552_1214 198
169 3300053140 Ga0500573_0035188 Ga0500573_0035188_2196_2858 198
170 3300053161 Ga0500634_0024290 Ga0500634_0024290_882_1544 198
171 3300061719 Ga0466962_0207637 Ga0466962_0207637_306_941 198
172 3300003752 Ga0055539_1000347 Ga0055539_100034718 199
173 3300003756 Ga0055533_1000006 Ga0055533_1000006391 199
174 3300003759 Ga0055525_1002347 Ga0055525_10023472 199
175 3300009093 Ga0105240_10461534 Ga0105240_104615342 199
176 3300025226 Ga0209674_100003 Ga0209674_100003942 199
177 3300025230 Ga0209563_100010 Ga0209563_100010671 199
178 3300025231 Ga0207427_100528 Ga0207427_1005282 199
179 3300025253 Ga0209677_100026 Ga0209677_100026264 199
180 3300025913 Ga0207695_10163392 Ga0207695_101633922 199
181 3300026041 Ga0207639_10136134 Ga0207639_101361342 199
182 3300031090 Ga0265760_10011376 Ga0265760_100113763 199
183 3300045049 Ga0466959_0431854 Ga0466959_0431854_62_718 199
184 3300053177 Ga0500636_0291732 Ga0500636_0291732_89_751 199
185 3300002705 JGI25156J39149_1019440 JGI25156J39149_10194402 200
186 3300005330 Ga0070690_100041483 Ga0070690_1000414833 200
187 3300005544 Ga0070686_100223467 Ga0070686_1002234672 200
188 3300005719 Ga0068861_100127124 Ga0068861_1001271242 200
189 3300006042 Ga0075368_10041354 Ga0075368_100413542 200
190 3300006177 Ga0075362_10039609 Ga0075362_100396092 200
191 3300006195 Ga0075366_10003289 Ga0075366_100032893 200
192 3300006195 Ga0075366_10106619 Ga0075366_101066191 200
193 3300006353 Ga0075370_10043838 Ga0075370_100438383 200
194 3300009176 Ga0105242_10018250 Ga0105242_100182504 200
195 3300013296 Ga0157374_10441814 Ga0157374_104418141 200
196 3300013296 Ga0157374_10507810 Ga0157374_105078102 200
197 3300025256 Ga0209759_1000291 Ga0209759_100029129 200
198 3300025913 Ga0207695_10616714 Ga0207695_106167142 200
199 3300026118 Ga0207675_100310123 Ga0207675_1003101232 200
200 3300028794 Ga0307515_10000416 Ga0307515_1000041638 200
201 3300028794 Ga0307515_10001547 Ga0307515_1000154721 200
202 3300030522 Ga0307512_10128677 Ga0307512_101286772 200
203 3300031241 Ga0265325_10004238 Ga0265325_100042385 200
204 3300031507 Ga0307509_10161738 Ga0307509_101617382 200
205 3300031616 Ga0307508_10000272 Ga0307508_1000027231 200
206 3300031649 Ga0307514_10061247 Ga0307514_100612473 200
207 3300033179 Ga0307507_10061609 Ga0307507_100616093 200
208 3300037418 Ga0395900_0775625 Ga0395900_0775625_144_821 200
209 3300037466 Ga0395898_0005955 Ga0395898_0005955_7817_8494 200
210 3300038443 Ga0395901_0000986 Ga0395901_0000986_21605_22282 200
211 3300041456 Ga0451795_0571965 Ga0451795_0571965_29_688 200
212 3300045976 Ga0466967_0068814 Ga0466967_0068814_2121_2798 200
213 3300048924 Ga0496121_0563010 Ga0496121_0563010_79_681 200
214 3300050489 nmdc:mga03683_22329_c1 nmdc:mga03683_22329_c1_622_1296 200
215 3300050492 nmdc:mga0yw44_395542_c1 nmdc:mga0yw44_395542_c1_55_729 200
216 3300050493 nmdc:mga0k408_10654_c1 nmdc:mga0k408_10654_c1_2842_3519 200
217 3300050496 nmdc:mga07m45_56087_c1 nmdc:mga07m45_56087_c1_867_1544 200
218 3300053724 Ga0500570_091733 Ga0500570_091733_180_839 200
219 3300003792 Ga0055540_1024926 Ga0055540_10249262 201
220 3300005339 Ga0070660_100009372 Ga0070660_1000093722 201
221 3300005435 Ga0070714_100012486 Ga0070714_1000124869 201
222 3300005436 Ga0070713_100738363 Ga0070713_1007383631 201
223 3300006195 Ga0075366_10202872 Ga0075366_102028722 201
224 3300006353 Ga0075370_10099252 Ga0075370_100992523 201
225 3300025303 Ga0209051_1006077 Ga0209051_10060775 201
226 3300025906 Ga0207699_10079788 Ga0207699_100797883 201
227 3300025919 Ga0207657_10004770 Ga0207657_100047703 201
228 3300025928 Ga0207700_10598749 Ga0207700_105987492 201
229 3300026116 Ga0207674_10040289 Ga0207674_100402892 201
230 3300031507 Ga0307509_10205420 Ga0307509_102054202 201
231 3300037068 Ga0373925_0026197 Ga0373925_0026197_2399_3061 201
232 3300044656 Ga0466969_0000006 Ga0466969_0000006_7457_8116 201
233 3300045049 Ga0466959_0085652 Ga0466959_0085652_578_1237 201
234 3300049515 Ga0501292_032155 Ga0501292_032155_22_675 201
235 3300049653 Ga0501206_001528 Ga0501206_001528_1473_2126 201
236 3300049662 Ga0501222_011808 Ga0501222_011808_428_1081 201
237 3300050496 nmdc:mga07m45_873_c1 nmdc:mga07m45_873_c1_11892_12563 201
238 3300053094 Ga0500566_0079772 Ga0500566_0079772_1140_1802 201
239 3300053096 Ga0500641_0025077 Ga0500641_0025077_907_1569 201
240 3300053119 Ga0500595_054943 Ga0500595_054943_178_840 201
241 3300053178 Ga0500637_0152063 Ga0500637_0152063_359_1021 201
242 3300005327 Ga0070658_10023677 Ga0070658_100236772 202
243 3300005843 Ga0068860_100000161 Ga0068860_100000161125 202
244 3300006048 Ga0075363_100037956 Ga0075363_1000379562 202
245 3300025909 Ga0207705_10228894 Ga0207705_102288942 202
246 3300025932 Ga0207690_10304190 Ga0207690_103041902 202
247 3300028381 Ga0268264_10000096 Ga0268264_10000096220 202
248 3300028794 Ga0307515_10079960 Ga0307515_100799604 202
249 3300044658 Ga0466972_0001165 Ga0466972_0001165_980_1642 202
250 3300044658 Ga0466972_0178612 Ga0466972_0178612_208_867 202
251 3300045051 Ga0451576_0951463 Ga0451576_0951463_74_745 202
252 3300046512 Ga0495610_0025099 Ga0495610_0025099_2216_2875 202
253 3300053117 Ga0500593_008528 Ga0500593_008528_3134_3799 202
254 3300053739 Ga0500587_005656 Ga0500587_005656_878_1537 202
255 3300025914 Ga0207671_10181606 Ga0207671_101816062 203
256 3300025986 Ga0207658_10057686 Ga0207658_100576863 203
257 3300031456 Ga0307513_10036304 Ga0307513_100363043 203
258 3300031507 Ga0307509_10060212 Ga0307509_100602122 203
259 3300031649 Ga0307514_10021786 Ga0307514_100217862 203
260 3300042876 Ga0451577_0000068 Ga0451577_0000068_143517_144188 203
261 3300044712 Ga0453684_0000126 Ga0453684_0000126_53468_54139 203
262 3300045051 Ga0451576_0010126 Ga0451576_0010126_5118_5789 203
263 3300048905 Ga0496102_0007041 Ga0496102_0007041_8421_9092 203
264 3300048920 Ga0496117_0001468 Ga0496117_0001468_10757_11428 203
265 3300048921 Ga0496118_0001567 Ga0496118_0001567_22486_23157 203
266 3300053093 Ga0500651_0166562 Ga0500651_0166562_301_966 203
267 3300053111 Ga0500572_137129 Ga0500572_137129_35_712 203
268 3300053136 Ga0500559_0013968 Ga0500559_0013968_1009_1686 203
269 3300003214 JGI25165J46597_1002203 JGI25165J46597_10022036 204
270 3300005563 Ga0068855_100024892 Ga0068855_1000248922 204
271 3300005578 Ga0068854_100083692 Ga0068854_1000836923 204
272 3300009036 Ga0105244_10121184 Ga0105244_101211842 204
273 3300009093 Ga0105240_10000076 Ga0105240_10000076111 204
274 3300009148 Ga0105243_10711101 Ga0105243_107111012 204
275 3300009545 Ga0105237_10003353 Ga0105237_1000335310 204
276 3300010375 Ga0105239_10007443 Ga0105239_100074439 204
277 3300013104 Ga0157370_10000282 Ga0157370_1000028210 204
278 3300013105 Ga0157369_10063537 Ga0157369_100635372 204
279 3300014497 Ga0182008_10090174 Ga0182008_100901742 204
280 3300015262 Ga0182007_10002349 Ga0182007_100023494 204
281 3300015265 Ga0182005_1001905 Ga0182005_10019058 204
282 3300025253 Ga0209677_100268 Ga0209677_1002688 204
283 3300025261 Ga0209233_1000260 Ga0209233_100026057 204
284 3300025321 Ga0207656_10053228 Ga0207656_100532282 204
285 3300025913 Ga0207695_10000011 Ga0207695_1000001187 204
286 3300025914 Ga0207671_10000093 Ga0207671_1000009342 204
287 3300025949 Ga0207667_10108361 Ga0207667_101083612 204
288 3300025981 Ga0207640_10128662 Ga0207640_101286623 204
289 3300037471 Ga0395905_0028755 Ga0395905_0028755_4416_5090 204
290 3300042876 Ga0451577_0544539 Ga0451577_0544539_251_925 204
291 3300048903 Ga0496100_0154590 Ga0496100_0154590_631_1302 204
292 3300048906 Ga0496103_0011650 Ga0496103_0011650_2848_3519 204
293 3300048916 Ga0496113_0221629 Ga0496113_0221629_567_1238 204
294 3300048919 Ga0496116_0015406 Ga0496116_0015406_2851_3522 204
295 3300048922 Ga0496119_0011813 Ga0496119_0011813_2662_3333 204
296 3300048923 Ga0496120_0014081 Ga0496120_0014081_2667_3338 204
297 3300048924 Ga0496121_0001848 Ga0496121_0001848_11213_11884 204
298 3300048925 Ga0496122_0064555 Ga0496122_0064555_1642_2313 204
299 3300048926 Ga0496123_0010560 Ga0496123_0010560_347_1018 204
300 3300048927 Ga0496124_0011068 Ga0496124_0011068_6462_7133 204
301 3300048928 Ga0496125_0043144 Ga0496125_0043144_280_951 204
302 3300048929 Ga0496126_0334278 Ga0496126_0334278_224_895 204
303 3300010375 Ga0105239_10199406 Ga0105239_101994063 205
304 3300031251 Ga0265327_10000028 Ga0265327_10000028225 205
305 3300044842 Ga0466957_0058069 Ga0466957_0058069_664_1320 205
306 3300047472 Ga0495686_0338926 Ga0495686_0338926_182_799 205
307 3300048921 Ga0496118_0011544 Ga0496118_0011544_4864_5526 205
308 3300048924 Ga0496121_0011069 Ga0496121_0011069_5717_6379 205
309 3300048927 Ga0496124_0006608 Ga0496124_0006608_11463_12125 205
310 3300048929 Ga0496126_0071852 Ga0496126_0071852_196_858 205
311 3300053125 Ga0500618_000480 Ga0500618_000480_5052_5714 205
312 3300006195 Ga0075366_10090938 Ga0075366_100909382 206
313 3300028786 Ga0307517_10277283 Ga0307517_102772832 206
314 3300046519 Ga0495632_0003636 Ga0495632_0003636_4660_5319 206
315 3300046530 Ga0495654_0010956 Ga0495654_0010956_1355_2026 206
316 3300046660 Ga0495625_0056299 Ga0495625_0056299_686_1345 206
317 3300046694 Ga0495649_0005309 Ga0495649_0005309_4441_5100 206
318 3300046810 Ga0495660_0031035 Ga0495660_0031035_296_955 206
319 3300048928 Ga0496125_0000352 Ga0496125_0000352_72859_73521 206
320 3300049459 Ga0495678_089296 Ga0495678_089296_36_695 206
321 3300050493 nmdc:mga0k408_67147_c1 nmdc:mga0k408_67147_c1_1079_1738 206
322 3300053093 Ga0500651_0089108 Ga0500651_0089108_63_722 206
323 3300053139 Ga0500568_0042114 Ga0500568_0042114_641_1300 206
324 3300006353 Ga0075370_10138613 Ga0075370_101386131 207
325 3300028794 Ga0307515_10167790 Ga0307515_101677902 207
326 3300031456 Ga0307513_10080173 Ga0307513_100801732 207
327 3300031548 Ga0307408_100000136 Ga0307408_10000013656 207
328 3300031730 Ga0307516_10539003 Ga0307516_105390032 207
329 3300031901 Ga0307406_10000105 Ga0307406_1000010538 207
330 3300035691 Ga0373931_0228585 Ga0373931_0228585_120_791 207
331 3300037471 Ga0395905_0023439 Ga0395905_0023439_943_1602 207
332 3300050496 nmdc:mga07m45_30502_c1 nmdc:mga07m45_30502_c1_231_908 207
333 3300050496 nmdc:mga07m45_81739_c1 nmdc:mga07m45_81739_c1_825_1484 207
334 3300028786 Ga0307517_10257626 Ga0307517_102576262 208
335 3300028794 Ga0307515_10003402 Ga0307515_1000340230 208
336 3300041413 Ga0439465_0082018 Ga0439465_0082018_35_712 208
337 3300042532 Ga0450893_0021178 Ga0450893_0021178_384_1046 208
338 3300048909 Ga0496106_0085390 Ga0496106_0085390_1576_2235 208
339 3300048927 Ga0496124_0194790 Ga0496124_0194790_514_1140 208
340 3300053730 Ga0500645_024852 Ga0500645_024852_402_1061 208
341 3300042015 Ga0439462_0042848 Ga0439462_0042848_502_1164 209
342 3300046531 Ga0495665_0019054 Ga0495665_0019054_1833_2492 209
343 3300050496 nmdc:mga07m45_190717_c1 nmdc:mga07m45_190717_c1_78_737 209
344 3300027876 Ga0209974_10122864 Ga0209974_101228642 210
345 3300031911 Ga0307412_10170156 Ga0307412_101701562 210
346 3300042532 Ga0450893_0003189 Ga0450893_0003189_793_1455 210
347 3300046615 Ga0495656_0021867 Ga0495656_0021867_1010_1678 210
348 3300048090 Ga0495615_0008063 Ga0495615_0008063_259_927 210
349 3300003316 rootH1_10061156 rootH1_100611562 211
350 3300003320 rootH2_10148895 rootH2_101488952 211
351 3300003322 rootL2_10046551 rootL2_100465519 211
352 3300003323 rootH1_10092082 rootH1_100920822 211
353 3300005843 Ga0068860_100135240 Ga0068860_1001352402 211
354 3300009098 Ga0105245_10141591 Ga0105245_101415911 211
355 3300025927 Ga0207687_10038647 Ga0207687_100386474 211
356 3300028381 Ga0268264_10182736 Ga0268264_101827363 211
357 3300031731 Ga0307405_10007105 Ga0307405_100071052 211
358 3300053140 Ga0500573_0005541 Ga0500573_0005541_570_1232 211
359 3300005445 Ga0070708_100140294 Ga0070708_1001402942 212
360 3300005467 Ga0070706_100028048 Ga0070706_1000280482 212
361 3300005468 Ga0070707_100008004 Ga0070707_1000080047 212
362 3300006042 Ga0075368_10123239 Ga0075368_101232392 212
363 3300006195 Ga0075366_10009464 Ga0075366_100094646 212
364 3300006353 Ga0075370_10004634 Ga0075370_100046344 212
365 3300025910 Ga0207684_10034822 Ga0207684_100348224 212
366 3300030744 Ga0316181_1137195 Ga0316181_11371952 212
367 3300030745 Ga0316182_1009183 Ga0316182_10091834 212
368 3300031251 Ga0265327_10002018 Ga0265327_1000201813 212
369 3300050496 nmdc:mga07m45_48543_c1 nmdc:mga07m45_48543_c1_499_1158 212
370 3300053140 Ga0500573_0003319 Ga0500573_0003319_1778_2440 212
371 3300003792 Ga0055540_1001295 Ga0055540_100129513 213
372 3300005331 Ga0070670_100682913 Ga0070670_1006829131 213
373 3300005338 Ga0068868_100651496 Ga0068868_1006514962 213
374 3300005354 Ga0070675_100143202 Ga0070675_1001432022 213
375 3300005355 Ga0070671_100158006 Ga0070671_1001580063 213
376 3300005364 Ga0070673_100330200 Ga0070673_1003302002 213
377 3300005366 Ga0070659_100372196 Ga0070659_1003721962 213
378 3300005456 Ga0070678_100122634 Ga0070678_1001226341 213
379 3300005459 Ga0068867_100015311 Ga0068867_1000153114 213
380 3300005539 Ga0068853_100056082 Ga0068853_1000560822 213
381 3300005577 Ga0068857_100200318 Ga0068857_1002003183 213
382 3300005616 Ga0068852_100102361 Ga0068852_1001023613 213
383 3300005718 Ga0068866_10079834 Ga0068866_100798342 213
384 3300005842 Ga0068858_100539668 Ga0068858_1005396681 213
385 3300006048 Ga0075363_100394401 Ga0075363_1003944011 213
386 3300006051 Ga0075364_10132498 Ga0075364_101324982 213
387 3300006177 Ga0075362_10005353 Ga0075362_100053532 213
388 3300006178 Ga0075367_10120776 Ga0075367_101207761 213
389 3300006353 Ga0075370_10072137 Ga0075370_100721371 213
390 3300009148 Ga0105243_10200062 Ga0105243_102000622 213
391 3300009545 Ga0105237_10008909 Ga0105237_1000890911 213
392 3300009553 Ga0105249_10292669 Ga0105249_102926692 213
393 3300014497 Ga0182008_10029346 Ga0182008_100293462 213
394 3300025263 Ga0209565_1000036 Ga0209565_1000036157 213
395 3300025273 Ga0209673_1000282 Ga0209673_100028267 213
396 3300025291 Ga0209675_1000289 Ga0209675_10002892 213
397 3300025295 Ga0209564_1001702 Ga0209564_100170222 213
398 3300025299 Ga0209256_1000001 Ga0209256_10000011284 213
399 3300025303 Ga0209051_1000113 Ga0209051_100011320 213
400 3300025893 Ga0207682_10138958 Ga0207682_101389582 213
401 3300025899 Ga0207642_10027797 Ga0207642_100277972 213
402 3300025931 Ga0207644_10237504 Ga0207644_102375041 213
403 3300025933 Ga0207706_10064087 Ga0207706_100640871 213
404 3300025981 Ga0207640_10441426 Ga0207640_104414261 213
405 3300025986 Ga0207658_10314417 Ga0207658_103144171 213
406 3300026035 Ga0207703_10602992 Ga0207703_106029921 213
407 3300026041 Ga0207639_10417395 Ga0207639_104173951 213
408 3300026089 Ga0207648_10032141 Ga0207648_100321412 213
409 3300026116 Ga0207674_10182686 Ga0207674_101826863 213
410 3300031548 Ga0307408_100003858 Ga0307408_1000038586 213
411 3300031730 Ga0307516_10079016 Ga0307516_100790162 213
412 3300031901 Ga0307406_10002407 Ga0307406_100024075 213
413 3300031911 Ga0307412_10853752 Ga0307412_108537521 213
414 3300032004 Ga0307414_10247596 Ga0307414_102475962 213
415 3300046542 Ga0495597_0166426 Ga0495597_0166426_186_845 213
416 3300047443 Ga0495687_001004 Ga0495687_001004_2768_3427 213
417 3300048091 Ga0495626_0218434 Ga0495626_0218434_17_676 213
418 3300050489 nmdc:mga03683_289133_c1 nmdc:mga03683_289133_c1_43_702 213
419 3300050489 nmdc:mga03683_97608_c1 nmdc:mga03683_97608_c1_142_801 213
420 3300050490 nmdc:mga03n38_292914_c1 nmdc:mga03n38_292914_c1_174_830 213
421 3300050493 nmdc:mga0k408_279467_c1 nmdc:mga0k408_279467_c1_42_701 213
422 3300050496 nmdc:mga07m45_35107_c1 nmdc:mga07m45_35107_c1_1260_1919 213
423 3300053122 Ga0500608_033574 Ga0500608_033574_870_1526 213
424 3300055283 Ga0500661_026656 Ga0500661_026656_18_659 213
425 iso_pu_bacteria 2928115317 2928117804 213
426 iso_pu_bacteria 2643221544 2643742036 214
427 iso_pu_bacteria 2643221585 2643934042 214
428 iso_pu_bacteria 2643221628 2644160024 214
429 iso_pu_bacteria 2643221639 2644220115 214
430 iso_pu_bacteria 2643221646 2644261127 214
431 iso_pu_bacteria 2643221656 2644315529 214
432 iso_pu_bacteria 2831864461 2831868632 214
433 iso_pu_bacteria 2842677519 2842680443 214
434 iso_pu_bacteria 2904449895 2904452286 214
435 iso_pu_bacteria 2904456579 2904458568 214
436 iso_pu_bacteria 2919462493 2919466339 214
437 iso_pu_bacteria 2929520902 2929522214 214
438 iso_pu_bacteria 2945945610 2945946604 214
439 iso_pu_bacteria 2945972063 2945976327 214
440 iso_pu_bacteria 2954767861 2954771370 214
441 iso_pu_bacteria 2508501122 2509110064 215
442 iso_pu_bacteria 2509276019 2509379876 215
443 iso_pu_bacteria 2509276033 2509441800 215
444 iso_pu_bacteria 2510065019 2510136367 215
445 iso_pu_bacteria 2510461076 2510892608 215
446 iso_pu_bacteria 2510917022 2511135354 215
447 iso_pu_bacteria 2512047086 2512530684 215
448 iso_pu_bacteria 2513237084 2513568663 215
449 iso_pu_bacteria 2513237085 2513579872 215
450 iso_pu_bacteria 2513237093 2513630474 215
451 iso_pu_bacteria 2513237101 2513696049 215
452 iso_pu_bacteria 2513237103 2513711228 215
453 iso_pu_bacteria 2513237138 2513871402 215
454 iso_pu_bacteria 2513237144 2513907875 215
455 iso_pu_bacteria 2513237146 2513927536 215
456 iso_pu_bacteria 2513237159 2514001126 215
457 iso_pu_bacteria 2513237162 2514018520 215
458 iso_pu_bacteria 2515075009 2515108689 215
459 iso_pu_bacteria 2515154113 2515632545 215
460 iso_pu_bacteria 2515154114 2515640490 215
461 iso_pu_bacteria 2515154116 2515656604 215
462 iso_pu_bacteria 2515154134 2515738162 215
463 iso_pu_bacteria 2516143018 2516207861 215
464 iso_pu_bacteria 2516653077 2517040611 215
465 iso_pu_bacteria 2516653085 2517080224 215
466 iso_pu_bacteria 2517093000 2517098242 215
467 iso_pu_bacteria 2517287029 2517409747 215
468 iso_pu_bacteria 2529292951 2530649611 215
469 iso_pu_bacteria 2547132374 2548500779 215
470 iso_pu_bacteria 2558860100 2558861698 215
471 iso_pu_bacteria 2582581306 2585267109 215
472 iso_pu_bacteria 2582581307 2585271092 215
473 iso_pu_bacteria 2582581308 2585277434 215
474 iso_pu_bacteria 2582581315 2585323385 215
475 iso_pu_bacteria 2582581865 2585388160 215
476 iso_pu_bacteria 2582581866 2585392796 215
477 iso_pu_bacteria 2585427526 2585530028 215
478 iso_pu_bacteria 2585427527 2585535061 215
479 iso_pu_bacteria 2585427528 2585537372 215
480 iso_pu_bacteria 2585427530 2585555909 215
481 iso_pu_bacteria 2585427531 2585558816 215
482 iso_pu_bacteria 2585427593 2585840234 215
483 iso_pu_bacteria 2585427608 2585898197 215
484 iso_pu_bacteria 2585427609 2585904214 215
485 iso_pu_bacteria 2585428057 2587726417 215
486 iso_pu_bacteria 2585428058 2587731809 215
487 iso_pu_bacteria 2585428062 2587757361 215
488 iso_pu_bacteria 2585428125 2587980669 215
489 iso_pu_bacteria 2588253510 2588295275 215
490 iso_pu_bacteria 2599185170 2599418967 215
491 iso_pu_bacteria 2615840624 2616297829 215
492 iso_pu_bacteria 2615840626 2616308909 215
493 iso_pu_bacteria 2617270742 2617385507 215
494 iso_pu_bacteria 2643221570 2643864250 215
495 iso_pu_bacteria 2643221592 2643970796 215
496 iso_pu_bacteria 2643221609 2644057895 215
497 iso_pu_bacteria 2643221611 2644072931 215
498 iso_pu_bacteria 2643221625 2644138931 215
499 iso_pu_bacteria 2643221648 2644273838 215
500 iso_pu_bacteria 2643221652 2644292054 215
501 iso_pu_bacteria 2643221654 2644302467 215
502 iso_pu_bacteria 2643221689 2644498360 215
503 iso_pu_bacteria 2643221717 2644646669 215
504 iso_pu_bacteria 2657244999 2657685176 215
505 iso_pu_bacteria 2690316117 2692319417 215
506 iso_pu_bacteria 2718217997 2719668645 215
507 iso_pu_bacteria 2718218199 2720489338 215
508 iso_pu_bacteria 2718218232 2720610020 215
509 iso_pu_bacteria 2718218233 2720617443 215
510 iso_pu_bacteria 2718218235 2720628589 215
511 iso_pu_bacteria 2718218269 2720772539 215
512 iso_pu_bacteria 2718218365 2721156320 215
513 iso_pu_bacteria 2721755556 2723029978 215
514 iso_pu_bacteria 2721755684 2723564383 215
515 iso_pu_bacteria 2721755685 2723569975 215
516 iso_pu_bacteria 2721755755 2723846282 215
517 iso_pu_bacteria 2721755819 2724092568 215
518 iso_pu_bacteria 2721755822 2724101522 215
519 iso_pu_bacteria 2721755823 2724112944 215
520 iso_pu_bacteria 2724679232 2725949632 215
521 iso_pu_bacteria 2728369352 2730110511 215
522 iso_pu_bacteria 2728369397 2730295853 215
523 iso_pu_bacteria 2738541333 2739036146 215
524 iso_pu_bacteria 2738543012 2739242171 215
525 iso_pu_bacteria 2751185821 2753460472 215
526 iso_pu_bacteria 2765235942 2766069132 215
527 iso_pu_bacteria 2791355082 2792584601 215
528 iso_pu_bacteria 2791355091 2792621399 215
529 iso_pu_bacteria 2791355092 2792627913 215
530 iso_pu_bacteria 2791355094 2792643288 215
531 iso_pu_bacteria 2791355199 2793082125 215
532 iso_pu_bacteria 2791355253 2793281344 215
533 iso_pu_bacteria 2791355256 2793297805 215
534 iso_pu_bacteria 2791355259 2793312867 215
535 iso_pu_bacteria 2791355261 2793330477 215
536 iso_pu_bacteria 2791355262 2793337535 215
537 iso_pu_bacteria 2791355263 2793344417 215
538 iso_pu_bacteria 2791355265 2793354963 215
539 iso_pu_bacteria 2802429268 2804754430 215
540 iso_pu_bacteria 2802429605 2805927224 215
541 iso_pu_bacteria 2802429633 2806046268 215
542 iso_pu_bacteria 2802429634 2806053198 215
543 iso_pu_bacteria 2802429635 2806059594 215
544 iso_pu_bacteria 2802429636 2806068666 215
545 iso_pu_bacteria 2802429637 2806075088 215
546 iso_pu_bacteria 2816332133 2816470212 215
547 iso_pu_bacteria 2818991448 2819609091 215
548 iso_pu_bacteria 2818991453 2819637675 215
549 iso_pu_bacteria 2828305725 2828306054 215
550 iso_pu_bacteria 2838016132 2838016149 215
551 iso_pu_bacteria 2838035591 2838037346 215
552 iso_pu_bacteria 2838042994 2838044268 215
553 iso_pu_bacteria 2838048938 2838049761 215
554 iso_pu_bacteria 2838061910 2838062028 215
555 iso_pu_bacteria 2838068647 2838068681 215
556 iso_pu_bacteria 2838661181 2838663468 215
557 iso_pu_bacteria 2838680041 2838684536 215
558 iso_pu_bacteria 2838686498 2838690761 215
559 iso_pu_bacteria 2838694306 2838698697 215
560 iso_pu_bacteria 2838707686 2838712422 215
561 iso_pu_bacteria 2838729681 2838735793 215
562 iso_pu_bacteria 2838742623 2838748697 215
563 iso_pu_bacteria 2840764183 2840768759 215
564 iso_pu_bacteria 2841851746 2841858318 215
565 iso_pu_bacteria 2842110456 2842116794 215
566 iso_pu_bacteria 2842118031 2842122821 215
567 iso_pu_bacteria 2842156927 2842160613 215
568 iso_pu_bacteria 2842163707 2842164108 215
569 iso_pu_bacteria 2842180545 2842184229 215
570 iso_pu_bacteria 2842217011 2842219928 215
571 iso_pu_bacteria 2842229732 2842231811 215
572 iso_pu_bacteria 2842237096 2842241834 215
573 iso_pu_bacteria 2842243621 2842249499 215
574 iso_pu_bacteria 2842257432 2842263607 215
575 iso_pu_bacteria 2842264693 2842265019 215
576 iso_pu_bacteria 2842271015 2842274924 215
577 iso_pu_bacteria 2842291075 2842295655 215
578 iso_pu_bacteria 2842304105 2842307628 215
579 iso_pu_bacteria 2842311132 2842315638 215
580 iso_pu_bacteria 2842370503 2842374463 215
581 iso_pu_bacteria 2842377471 2842382059 215
582 iso_pu_bacteria 2842384541 2842389369 215
583 iso_pu_bacteria 2842402390 2842405763 215
584 iso_pu_bacteria 2842409023 2842412347 215
585 iso_pu_bacteria 2842415677 2842418993 215
586 iso_pu_bacteria 2842422224 2842422827 215
587 iso_pu_bacteria 2842428310 2842428927 215
588 iso_pu_bacteria 2842434925 2842435540 215
589 iso_pu_bacteria 2842441272 2842441597 215
590 iso_pu_bacteria 2842447887 2842448361 215
591 iso_pu_bacteria 2842462802 2842463351 215
592 iso_pu_bacteria 2842469257 2842469871 215
593 iso_pu_bacteria 2842489311 2842489720 215
594 iso_pu_bacteria 2842509118 2842511183 215
595 iso_pu_bacteria 2842521101 2842526271 215
596 iso_pu_bacteria 2842698319 2842699608 215
597 iso_pu_bacteria 2844454524 2844460415 215
598 iso_pu_bacteria 2847417321 2847422078 215
599 iso_pu_bacteria 2848992105 2848997057 215
600 iso_pu_bacteria 2850079185 2850084256 215
601 iso_pu_bacteria 2855872281 2855875048 215
602 iso_pu_bacteria 2857516855 2857517960 215
603 iso_pu_bacteria 2874604998 2874610753 215
604 iso_pu_bacteria 2876808645 2876811675 215
605 iso_pu_bacteria 2879110137 2879118835 215
606 iso_pu_bacteria 2885305155 2885305989 215
607 iso_pu_bacteria 2885326080 2885327639 215
608 iso_pu_bacteria 2885334103 2885334927 215
609 iso_pu_bacteria 2886848708 2886852545 215
610 iso_pu_bacteria 2889033259 2889039270 215
611 iso_pu_bacteria 2889790730 2889795688 215
612 iso_pu_bacteria 2889914905 2889919816 215
613 iso_pu_bacteria 2896384573 2896387508 215
614 iso_pu_bacteria 2903748898 2903752806 215
615 iso_pu_bacteria 2913295892 2913296527 215
616 iso_pu_bacteria 2920760137 2920764505 215
617 iso_pu_bacteria 2922361189 2922362085 215
618 iso_pu_bacteria 2922386360 2922388147 215
619 iso_pu_bacteria 2923556063 2923562113 215
620 iso_pu_bacteria 2933016740 2933017305 215
621 iso_pu_bacteria 2933570622 2933573717 215
622 iso_pu_bacteria 2933586486 2933593010 215
623 iso_pu_bacteria 2933599457 2933600299 215
624 iso_pu_bacteria 2935894831 2935898615 215
625 iso_pu_bacteria 2935901341 2935903209 215
626 iso_pu_bacteria 2936367885 2936374448 215
627 iso_pu_bacteria 2936375103 2936378710 215
628 iso_pu_bacteria 2936381700 2936384432 215
629 iso_pu_bacteria 2990710928 2990714851 215
630 iso_pu_bacteria 3000017691 3000020904 215
631 iso_pu_bacteria 3005416602 3005419528 215
632 iso_pu_bacteria 639633055 639644851 215
633 iso_pu_bacteria 643692032 643824005 215
634 iso_pu_bacteria 8005258706 8005259132 215
635 iso_pu_bacteria 8005282627 8005288524 215
636 iso_pu_bacteria 8005301065 8005301073 215
637 iso_pu_bacteria 8005307578 8005307978 215
638 iso_pu_bacteria 8005314921 8005316819 215
639 iso_pu_bacteria 8005376324 8005379748 215
640 iso_pu_bacteria 8005382845 8005383462 215
641 iso_pu_bacteria 8005395548 8005399056 215
642 iso_pu_bacteria 8005430974 8005431444 215
643 iso_pu_bacteria 8005460587 8005467136 215
644 iso_pu_bacteria 8005497431 8005502893 215
645 iso_pu_bacteria 8005556819 8005562418 215
646 iso_pu_bacteria 8005563573 8005566191 215
647 iso_pu_bacteria 8005570704 8005572270 215
648 iso_pu_bacteria 8005619151 8005624043 215
649 iso_pu_bacteria 8005626139 8005629308 215
650 iso_pu_bacteria 8005645114 8005649636 215
651 iso_pu_bacteria 8005668836 8005674323 215
652 iso_pu_bacteria 8005688590 8005689113 215
653 iso_pu_bacteria 8006964411 8006964663 215
654 iso_pu_bacteria 8006984368 8006991987 215
655 iso_pu_bacteria 8006994254 8006999920 215
656 iso_pu_bacteria 8018127388 8018132101 215
657 iso_pu_bacteria 8018163183 8018163466 215
658 iso_pu_bacteria 8019555841 8019563949 215
659 iso_pu_bacteria 8019565922 8019574021 215
660 iso_pu_bacteria 8023680758 8023681857 215
661 iso_pu_bacteria 8024479707 8024482354 215
662 iso_pu_bacteria 8049293176 8049296899 215
663 iso_pu_bacteria 8054460903 8054462493 215
664 iso_pu_bacteria 8054558443 8054561380 215
665 iso_pu_bacteria 8056382006 8056382530 215
666 iso_pu_bacteria 8056673599 8056680336 215
667 iso_pu_bacteria 8057874678 8057878146 215
668 iso_pu_bacteria 2511231002 2511244745 216
669 iso_pu_bacteria 2513020051 2513227304 216
670 iso_pu_bacteria 2599185214 2599622684 216
671 iso_pu_bacteria 2599185226 2599671163 216
672 iso_pu_bacteria 2599185227 2599679800 216
673 iso_pu_bacteria 2599185229 2599691816 216
674 iso_pu_bacteria 2643221658 2644324873 216
675 iso_pu_bacteria 2643221672 2644396743 216
676 iso_pu_bacteria 2643221683 2644467423 216
677 iso_pu_bacteria 2738541277 2738718585 216
678 iso_pu_bacteria 2738541307 2738884711 216
679 iso_pu_bacteria 2738543019 2739280603 216
680 iso_pu_bacteria 2818991446 2819599975 216
681 iso_pu_bacteria 2831265667 2831267149 216
682 iso_pu_bacteria 2838054893 2838056234 216
683 iso_pu_bacteria 2842718218 2842720425 216
684 iso_pu_bacteria 2885198086 2885204826 216
685 iso_pu_bacteria 2885211737 2885218487 216
686 iso_pu_bacteria 2899924645 2899926078 216
687 iso_pu_bacteria 2904541872 2904548653 216
688 iso_pu_bacteria 2919704043 2919708037 216
689 iso_pu_bacteria 2928037797 2928041526 216
690 iso_pu_bacteria 2928044640 2928049090 216
691 iso_pu_bacteria 2928051484 2928052300 216
692 iso_pu_bacteria 2928064002 2928065029 216
693 iso_pu_bacteria 2928070936 2928077432 216
694 iso_pu_bacteria 2928084124 2928087368 216
695 iso_pu_bacteria 2929160207 2929164681 216
696 iso_pu_bacteria 2945909444 2945910708 216
697 iso_pu_bacteria 2945984333 2945987119 216
698 iso_pu_bacteria 2974320154 2974321395 216
699 3300005548 Ga0070665_100241024 Ga0070665_1002410242 217
700 3300006051 Ga0075364_10055117 Ga0075364_100551172 217
701 3300021361 Ga0213872_10034437 Ga0213872_100344373 217
702 3300028794 Ga0307515_10000013 Ga0307515_10000013146 217
703 3300031456 Ga0307513_10240803 Ga0307513_102408033 217
704 3300037312 Ga0395899_0141196 Ga0395899_0141196_659_1312 217
705 3300037418 Ga0395900_0358348 Ga0395900_0358348_376_1029 217
706 3300037466 Ga0395898_0030122 Ga0395898_0030122_620_1273 217
707 3300039447 Ga0436361_0468617 Ga0436361_0468617_14405_15064 217
708 3300041507 Ga0451851_1086331 Ga0451851_1086331_48_707 217
709 3300050491 nmdc:mga00v17_2356_c1 nmdc:mga00v17_2356_c1_1886_2554 217
710 3300053160 Ga0500633_0110267 Ga0500633_0110267_167_826 217
711 3300002773 JGI25152J39213_1000197 JGI25152J39213_100019713 218
712 3300003187 JGI25151J46595_10000472 JGI25151J46595_100004722 218
713 3300003187 JGI25151J46595_10001106 JGI25151J46595_1000110611 218
714 3300003187 JGI25151J46595_10044525 JGI25151J46595_100445253 218
715 3300003187 JGI25151J46595_10046226 JGI25151J46595_100462262 218
716 3300003215 JGI25153J46596_10000205 JGI25153J46596_100002057 218
717 3300003215 JGI25153J46596_10001774 JGI25153J46596_1000177414 218
718 3300003215 JGI25153J46596_10003407 JGI25153J46596_100034072 218
719 3300003354 JGI25160J50197_1003793 JGI25160J50197_10037938 218
720 3300003374 JGI25161J50226_1005024 JGI25161J50226_10050242 218
721 3300003759 Ga0055525_1000172 Ga0055525_100017226 218
722 3300003763 Ga0055529_1000158 Ga0055529_100015892 218
723 3300003771 Ga0055526_1014122 Ga0055526_10141222 218
724 3300003771 Ga0055526_1019724 Ga0055526_10197243 218
725 3300003773 Ga0055537_1000544 Ga0055537_100054410 218
726 3300003775 Ga0055524_1002935 Ga0055524_10029353 218
727 3300003775 Ga0055524_1013618 Ga0055524_10136182 218
728 3300003775 Ga0055524_1053457 Ga0055524_10534571 218
729 3300003784 Ga0055534_1000494 Ga0055534_100049410 218
730 3300003790 Ga0055528_1007944 Ga0055528_10079442 218
731 3300003790 Ga0055528_1021363 Ga0055528_10213632 218
732 3300003792 Ga0055540_1006686 Ga0055540_10066862 218
733 3300003794 Ga0055531_10000001 Ga0055531_10000001424 218
734 3300003794 Ga0055531_10000010 Ga0055531_1000001034 218
735 3300003794 Ga0055531_10007249 Ga0055531_100072494 218
736 3300004625 Ga0055543_1001197 Ga0055543_100119711 218
737 3300004625 Ga0055543_1010217 Ga0055543_10102172 218
738 3300005262 Ga0065165_1000562 Ga0065165_100056219 218
739 3300005262 Ga0065165_1019113 Ga0065165_10191132 218
740 3300005467 Ga0070706_100040108 Ga0070706_1000401083 218
741 3300005535 Ga0070684_100330755 Ga0070684_1003307552 218
742 3300006038 Ga0075365_10000422 Ga0075365_1000042217 218
743 3300006038 Ga0075365_10106151 Ga0075365_101061512 218
744 3300006042 Ga0075368_10009279 Ga0075368_100092794 218
745 3300006042 Ga0075368_10114445 Ga0075368_101144452 218
746 3300006048 Ga0075363_100090857 Ga0075363_1000908572 218
747 3300006051 Ga0075364_10039620 Ga0075364_100396204 218
748 3300006177 Ga0075362_10000553 Ga0075362_1000055310 218
749 3300006177 Ga0075362_10078640 Ga0075362_100786402 218
750 3300006177 Ga0075362_10252766 Ga0075362_102527661 218
751 3300006178 Ga0075367_10006073 Ga0075367_100060735 218
752 3300006178 Ga0075367_10014639 Ga0075367_100146395 218
753 3300006178 Ga0075367_10063502 Ga0075367_100635022 218
754 3300006178 Ga0075367_10087478 Ga0075367_100874783 218
755 3300006186 Ga0075369_10000481 Ga0075369_100004813 218
756 3300006186 Ga0075369_10065967 Ga0075369_100659672 218
757 3300006195 Ga0075366_10001027 Ga0075366_1000102713 218
758 3300006195 Ga0075366_10031124 Ga0075366_100311243 218
759 3300006195 Ga0075366_10333045 Ga0075366_103330451 218
760 3300006353 Ga0075370_10005158 Ga0075370_1000515810 218
761 3300006353 Ga0075370_10011616 Ga0075370_100116164 218
762 3300006353 Ga0075370_10014295 Ga0075370_100142954 218
763 3300006944 Ga0099823_1000003 Ga0099823_100000379 218
764 3300006946 Ga0079104_1005275 Ga0079104_10052752 218
765 3300006948 Ga0099826_10000408 Ga0099826_1000040810 218
766 3300009765 Ga0123341_1000005 Ga0123341_1000005129 218
767 3300009765 Ga0123341_1052592 Ga0123341_10525923 218
768 3300009765 Ga0123341_1052593 Ga0123341_10525933 218
769 3300009766 Ga0123342_1010761 Ga0123342_10107616 218
770 3300009766 Ga0123342_1012900 Ga0123342_10129009 218
771 3300015262 Ga0182007_10022400 Ga0182007_100224002 218
772 3300017792 Ga0163161_10010182 Ga0163161_100101824 218
773 3300021320 Ga0214544_1002525 Ga0214544_100252526 218
774 3300021321 Ga0214542_1000084 Ga0214542_100008487 218
775 3300021321 Ga0214542_1017219 Ga0214542_10172194 218
776 3300021327 Ga0214543_1000018 Ga0214543_10000189 218
777 3300021327 Ga0214543_1000076 Ga0214543_100007687 218
778 3300021361 Ga0213872_10000161 Ga0213872_1000016158 218
779 3300025230 Ga0209563_100044 Ga0209563_10004426 218
780 3300025242 Ga0209258_100110 Ga0209258_10011024 218
781 3300025242 Ga0209258_108045 Ga0209258_1080452 218
782 3300025245 Ga0207425_1001200 Ga0207425_100120012 218
783 3300025253 Ga0209677_108952 Ga0209677_1089522 218
784 3300025256 Ga0209759_1000542 Ga0209759_100054227 218
785 3300025258 Ga0209129_1002487 Ga0209129_10024872 218
786 3300025258 Ga0209129_1018601 Ga0209129_10186011 218
787 3300025263 Ga0209565_1000138 Ga0209565_100013810 218
788 3300025263 Ga0209565_1040609 Ga0209565_10406091 218
789 3300025272 Ga0209455_1000104 Ga0209455_100010424 218
790 3300025273 Ga0209673_1000022 Ga0209673_100002249 218
791 3300025273 Ga0209673_1000064 Ga0209673_100006410 218
792 3300025273 Ga0209673_1004964 Ga0209673_10049646 218
793 3300025273 Ga0209673_1006233 Ga0209673_10062332 218
794 3300025273 Ga0209673_1006331 Ga0209673_10063312 218
795 3300025291 Ga0209675_1000036 Ga0209675_100003610 218
796 3300025291 Ga0209675_1020476 Ga0209675_10204762 218
797 3300025292 Ga0209676_1000092 Ga0209676_100009234 218
798 3300025292 Ga0209676_1028115 Ga0209676_10281151 218
799 3300025294 Ga0209025_1000168 Ga0209025_100016844 218
800 3300025294 Ga0209025_1000228 Ga0209025_100022855 218
801 3300025294 Ga0209025_1000558 Ga0209025_100055869 218
802 3300025294 Ga0209025_1004014 Ga0209025_10040145 218
803 3300025294 Ga0209025_1029896 Ga0209025_10298961 218
804 3300025295 Ga0209564_1000025 Ga0209564_100002526 218
805 3300025295 Ga0209564_1000229 Ga0209564_1000229101 218
806 3300025295 Ga0209564_1000440 Ga0209564_100044018 218
807 3300025295 Ga0209564_1004245 Ga0209564_10042454 218
808 3300025295 Ga0209564_1034839 Ga0209564_10348392 218
809 3300025297 Ga0209758_1000113 Ga0209758_1000113175 218
810 3300025297 Ga0209758_1000167 Ga0209758_100016746 218
811 3300025297 Ga0209758_1000503 Ga0209758_100050367 218
812 3300025297 Ga0209758_1003390 Ga0209758_10033901 218
813 3300025297 Ga0209758_1006104 Ga0209758_10061049 218
814 3300025297 Ga0209758_1014912 Ga0209758_10149123 218
815 3300025298 Ga0209050_1012804 Ga0209050_10128044 218
816 3300025298 Ga0209050_1013000 Ga0209050_10130004 218
817 3300025299 Ga0209256_1000970 Ga0209256_100097018 218
818 3300025299 Ga0209256_1002034 Ga0209256_100203410 218
819 3300025299 Ga0209256_1002250 Ga0209256_100225015 218
820 3300025299 Ga0209256_1002687 Ga0209256_10026872 218
821 3300025299 Ga0209256_1010774 Ga0209256_10107742 218
822 3300025299 Ga0209256_1013155 Ga0209256_10131552 218
823 3300025302 Ga0207426_1000307 Ga0207426_100030731 218
824 3300025303 Ga0209051_1001591 Ga0209051_100159115 218
825 3300025303 Ga0209051_1003757 Ga0209051_10037578 218
826 3300025303 Ga0209051_1030305 Ga0209051_10303052 218
827 3300025303 Ga0209051_1034434 Ga0209051_10344342 218
828 3300025304 Ga0209257_1000033 Ga0209257_1000033513 218
829 3300025304 Ga0209257_1004439 Ga0209257_10044395 218
830 3300025304 Ga0209257_1006726 Ga0209257_10067266 218
831 3300025910 Ga0207684_10044532 Ga0207684_100445322 218
832 3300027111 Ga0209281_1011677 Ga0209281_10116773 218
833 3300027296 Ga0209389_1000243 Ga0209389_100024314 218
834 3300027666 Ga0209282_1000521 Ga0209282_100052111 218
835 3300027866 Ga0209813_10054737 Ga0209813_100547371 218
836 3300027876 Ga0209974_10008262 Ga0209974_100082623 218
837 3300027907 Ga0207428_10462032 Ga0207428_104620322 218
838 3300028794 Ga0307515_10000037 Ga0307515_10000037173 218
839 3300028794 Ga0307515_10080743 Ga0307515_100807435 218
840 3300028794 Ga0307515_10088904 Ga0307515_100889043 218
841 3300028800 Ga0265338_10005140 Ga0265338_100051402 218
842 3300030521 Ga0307511_10039656 Ga0307511_100396564 218
843 3300030733 Ga0314311_1055507 Ga0314311_10555072 218
844 3300030734 Ga0316179_1038668 Ga0316179_10386683 218
845 3300030735 Ga0316178_1036717 Ga0316178_10367175 218
846 3300030742 Ga0316183_1108089 Ga0316183_11080892 218
847 3300030745 Ga0316182_1388324 Ga0316182_13883243 218
848 3300031241 Ga0265325_10035259 Ga0265325_100352592 218
849 3300031242 Ga0265329_10090225 Ga0265329_100902252 218
850 3300031344 Ga0265316_10382938 Ga0265316_103829382 218
851 3300031456 Ga0307513_10006089 Ga0307513_1000608911 218
852 3300031456 Ga0307513_10177010 Ga0307513_101770101 218
853 3300031507 Ga0307509_10135747 Ga0307509_101357473 218
854 3300031548 Ga0307408_100177221 Ga0307408_1001772213 218
855 3300031548 Ga0307408_100236339 Ga0307408_1002363392 218
856 3300031548 Ga0307408_101114743 Ga0307408_1011147431 218
857 3300031712 Ga0265342_10017666 Ga0265342_100176665 218
858 3300031730 Ga0307516_10000114 Ga0307516_1000011434 218
859 3300031730 Ga0307516_10137554 Ga0307516_101375542 218
860 3300031852 Ga0307410_10437014 Ga0307410_104370141 218
861 3300031911 Ga0307412_10130555 Ga0307412_101305552 218
862 3300031995 Ga0307409_100368338 Ga0307409_1003683381 218
863 3300032002 Ga0307416_100833873 Ga0307416_1008338732 218
864 3300032004 Ga0307414_10592096 Ga0307414_105920961 218
865 3300032005 Ga0307411_10000054 Ga0307411_1000005428 218
866 3300035091 Ga0373951_0004305 Ga0373951_0004305_1702_2370 218
867 3300035111 Ga0373923_0028389 Ga0373923_0028389_42_707 218
868 3300035114 Ga0373939_0000086 Ga0373939_0000086_10726_11394 218
869 3300035121 Ga0373960_0000504 Ga0373960_0000504_4288_4956 218
870 3300035691 Ga0373931_0001184 Ga0373931_0001184_5461_6129 218
871 3300035691 Ga0373931_0011123 Ga0373931_0011123_2550_3227 218
872 3300037418 Ga0395900_0373612 Ga0395900_0373612_726_1382 218
873 3300037471 Ga0395905_0000065 Ga0395905_0000065_53457_54113 218
874 3300037471 Ga0395905_0066621 Ga0395905_0066621_342_998 218
875 3300037471 Ga0395905_0074436 Ga0395905_0074436_2301_2957 218
876 3300037471 Ga0395905_0134227 Ga0395905_0134227_464_1120 218
877 3300038443 Ga0395901_0252759 Ga0395901_0252759_1146_1802 218
878 3300039447 Ga0436361_0481133 Ga0436361_0481133_5388_6044 218
879 3300041413 Ga0439465_0004703 Ga0439465_0004703_2015_2686 218
880 3300041413 Ga0439465_0005878 Ga0439465_0005878_2601_3272 218
881 3300041413 Ga0439465_0041150 Ga0439465_0041150_234_890 218
882 3300041462 Ga0451806_070579 Ga0451806_070579_144_815 218
883 3300041492 Ga0451835_0809375 Ga0451835_0809375_1347_2018 218
884 3300041496 Ga0451839_1037155 Ga0451839_1037155_924_1595 218
885 3300041498 Ga0451841_1103848 Ga0451841_1103848_602_1273 218
886 3300041507 Ga0451851_0479940 Ga0451851_0479940_2140_2811 218
887 3300041509 Ga0451843_0061446 Ga0451843_0061446_232_903 218
888 3300041511 Ga0451855_0094398 Ga0451855_0094398_603_1274 218
889 3300042000 Ga0439437_017236 Ga0439437_017236_58_735 218
890 3300042002 Ga0439442_007281 Ga0439442_007281_1006_1662 218
891 3300042006 Ga0439432_036275 Ga0439432_036275_499_1170 218
892 3300042007 Ga0439449_0003860 Ga0439449_0003860_2641_3297 218
893 3300042007 Ga0439449_0038871 Ga0439449_0038871_876_1547 218
894 3300042120 Ga0450917_001441 Ga0450917_001441_604_1281 218
895 3300042126 Ga0450888_000124 Ga0450888_000124_3435_4112 218
896 3300042127 Ga0450890_001321 Ga0450890_001321_1495_2172 218
897 3300042129 Ga0450891_000787 Ga0450891_000787_1343_2020 218
898 3300042137 Ga0450902_017578 Ga0450902_017578_392_1069 218
899 3300042139 Ga0450904_002767 Ga0450904_002767_790_1467 218
900 3300042144 Ga0450889_000412 Ga0450889_000412_1960_2637 218
901 3300042435 Ga0439434_0002848 Ga0439434_0002848_10_666 218
902 3300042531 Ga0450918_000970 Ga0450918_000970_5317_5973 218
903 3300042532 Ga0450893_0007186 Ga0450893_0007186_900_1577 218
904 3300044656 Ga0466969_0023693 Ga0466969_0023693_2378_3040 218
905 3300044684 Ga0466966_0011852 Ga0466966_0011852_4969_5631 218
906 3300044694 Ga0466963_0017134 Ga0466963_0017134_1989_2660 218
907 3300044765 Ga0466970_0142147 Ga0466970_0142147_383_1045 218
908 3300044901 Ga0466960_0170841 Ga0466960_0170841_271_927 218
909 3300045049 Ga0466959_0015914 Ga0466959_0015914_4566_5228 218
910 3300046460 Ga0495638_0042130 Ga0495638_0042130_246_917 218
911 3300046460 Ga0495638_0101417 Ga0495638_0101417_546_1217 218
912 3300046471 Ga0495650_0057741 Ga0495650_0057741_814_1473 218
913 3300046475 Ga0495639_0048050 Ga0495639_0048050_13_681 218
914 3300046492 Ga0495585_0017087 Ga0495585_0017087_1538_2209 218
915 3300046506 Ga0495583_0000376 Ga0495583_0000376_32953_33630 218
916 3300046506 Ga0495583_0066141 Ga0495583_0066141_409_1080 218
917 3300046507 Ga0495606_0001320 Ga0495606_0001320_24562_25239 218
918 3300046507 Ga0495606_0171705 Ga0495606_0171705_226_897 218
919 3300046518 Ga0495631_0073140 Ga0495631_0073140_196_867 218
920 3300046524 Ga0495648_0066509 Ga0495648_0066509_470_1141 218
921 3300046648 Ga0495611_0215781 Ga0495611_0215781_35_706 218
922 3300046660 Ga0495625_0000057 Ga0495625_0000057_9945_10601 218
923 3300046660 Ga0495625_0007412 Ga0495625_0007412_5408_6076 218
924 3300046665 Ga0495661_0123742 Ga0495661_0123742_306_977 218
925 3300046694 Ga0495649_0002087 Ga0495649_0002087_6891_7568 218
926 3300047472 Ga0495686_0028682 Ga0495686_0028682_187_858 218
927 3300047472 Ga0495686_0100520 Ga0495686_0100520_540_1217 218
928 3300048921 Ga0496118_0078889 Ga0496118_0078889_1068_1739 218
929 3300048924 Ga0496121_0290745 Ga0496121_0290745_226_888 218
930 3300048925 Ga0496122_0048835 Ga0496122_0048835_2049_2720 218
931 3300048927 Ga0496124_0006999 Ga0496124_0006999_9810_10481 218
932 3300049459 Ga0495678_020187 Ga0495678_020187_441_1112 218
933 3300049568 Ga0501031_0416502 Ga0501031_0416502_175_837 218
934 3300049571 Ga0501034_0488425 Ga0501034_0488425_260_922 218
935 3300049580 Ga0501046_0030075 Ga0501046_0030075_1251_1922 218
936 3300049582 Ga0501048_0250250 Ga0501048_0250250_216_887 218
937 3300049586 Ga0501070_0472174 Ga0501070_0472174_12_683 218
938 3300049665 Ga0501227_006696 Ga0501227_006696_711_1388 218
939 3300049679 Ga0501249_009632 Ga0501249_009632_1135_1791 218
940 3300049705 Ga0501225_0007904 Ga0501225_0007904_1149_1805 218
941 3300049742 Ga0501080_0072940 Ga0501080_0072940_2134_2805 218
942 3300049759 Ga0501262_000028 Ga0501262_000028_6482_7138 218
943 3300050489 nmdc:mga03683_10366_c1 nmdc:mga03683_10366_c1_1692_2363 218
944 3300050490 nmdc:mga03n38_63322_c1 nmdc:mga03n38_63322_c1_409_1065 218
945 3300050490 nmdc:mga03n38_93120_c1 nmdc:mga03n38_93120_c1_243_914 218
946 3300050492 nmdc:mga0yw44_215370_c1 nmdc:mga0yw44_215370_c1_213_869 218
947 3300050492 nmdc:mga0yw44_4974_c1 nmdc:mga0yw44_4974_c1_1722_2378 218
948 3300050492 nmdc:mga0yw44_8131_c1 nmdc:mga0yw44_8131_c1_1849_2520 218
949 3300050493 nmdc:mga0k408_6388_c1 nmdc:mga0k408_6388_c1_5163_5834 218
950 3300050493 nmdc:mga0k408_74244_c1 nmdc:mga0k408_74244_c1_778_1434 218
951 3300050494 nmdc:mga06z11_258857_c1 nmdc:mga06z11_258857_c1_102_773 218
952 3300050494 nmdc:mga06z11_62697_c1 nmdc:mga06z11_62697_c1_465_1127 218
953 3300050494 nmdc:mga06z11_6540_c1 nmdc:mga06z11_6540_c1_1605_2267 218
954 3300050495 nmdc:mga04h51_27204_c1 nmdc:mga04h51_27204_c1_60_722 218
955 3300050496 nmdc:mga07m45_1812_c1 nmdc:mga07m45_1812_c1_3235_3906 218
956 3300050496 nmdc:mga07m45_3652_c1 nmdc:mga07m45_3652_c1_1326_1982 218
957 3300050496 nmdc:mga07m45_4190_c1 nmdc:mga07m45_4190_c1_1513_2169 218
958 3300050496 nmdc:mga07m45_59_c1 nmdc:mga07m45_59_c1_9299_9955 218
959 3300050516 nmdc:mga0sz30_803_c1 nmdc:mga0sz30_803_c1_8508_9179 218
960 3300053080 Ga0500635_0000121 Ga0500635_0000121_18820_19482 218
961 3300053083 Ga0495655_0032722 Ga0495655_0032722_357_1028 218
962 3300053109 Ga0500569_002595 Ga0500569_002595_246_917 218
963 3300053153 Ga0500616_0119852 Ga0500616_0119852_314_985 218
964 3300053157 Ga0500624_009396 Ga0500624_009396_512_1183 218
965 3300053158 Ga0500627_0151825 Ga0500627_0151825_204_875 218
966 3300053161 Ga0500634_0063235 Ga0500634_0063235_943_1614 218
967 3300053162 Ga0500638_006555 Ga0500638_006555_3821_4483 218
968 3300053730 Ga0500645_030395 Ga0500645_030395_777_1451 218
969 3300003215 JGI25153J46596_10001250 JGI25153J46596_100012503 219
970 3300003320 rootH2_10000536 rootH2_1000053610 219
971 3300003322 rootL2_10001141 rootL2_1000114110 219
972 3300003771 Ga0055526_1003105 Ga0055526_10031058 219
973 3300003771 Ga0055526_1009534 Ga0055526_10095343 219
974 3300003775 Ga0055524_1000162 Ga0055524_100016216 219
975 3300003775 Ga0055524_1031466 Ga0055524_10314662 219
976 3300003790 Ga0055528_1000310 Ga0055528_10003102 219
977 3300003791 Ga0055530_10014342 Ga0055530_100143423 219
978 3300003794 Ga0055531_10002797 Ga0055531_100027979 219
979 3300003794 Ga0055531_10006999 Ga0055531_100069994 219
980 3300005262 Ga0065165_1000086 Ga0065165_100008619 219
981 3300005262 Ga0065165_1001932 Ga0065165_10019327 219
982 3300005331 Ga0070670_100014970 Ga0070670_1000149704 219
983 3300005334 Ga0068869_100017098 Ga0068869_1000170982 219
984 3300005334 Ga0068869_100393692 Ga0068869_1003936922 219
985 3300005337 Ga0070682_100117701 Ga0070682_1001177012 219
986 3300005338 Ga0068868_100017412 Ga0068868_1000174122 219
987 3300005353 Ga0070669_100046539 Ga0070669_1000465392 219
988 3300005353 Ga0070669_100429192 Ga0070669_1004291921 219
989 3300005354 Ga0070675_100001203 Ga0070675_10000120320 219
990 3300005354 Ga0070675_100049209 Ga0070675_1000492094 219
991 3300005355 Ga0070671_100163168 Ga0070671_1001631682 219
992 3300005356 Ga0070674_100193609 Ga0070674_1001936092 219
993 3300005364 Ga0070673_100016661 Ga0070673_1000166612 219
994 3300005364 Ga0070673_100022575 Ga0070673_1000225755 219
995 3300005367 Ga0070667_100022232 Ga0070667_1000222324 219
996 3300005367 Ga0070667_100259381 Ga0070667_1002593812 219
997 3300005456 Ga0070678_100010582 Ga0070678_1000105823 219
998 3300005456 Ga0070678_100036144 Ga0070678_1000361443 219
999 3300005457 Ga0070662_100129502 Ga0070662_1001295021 219
1000 3300005457 Ga0070662_100221172 Ga0070662_1002211722 219
1001 3300005459 Ga0068867_100000493 Ga0068867_1000004936 219
1002 3300005459 Ga0068867_100005605 Ga0068867_1000056055 219
1003 3300005543 Ga0070672_100021950 Ga0070672_1000219503 219
1004 3300005543 Ga0070672_100064902 Ga0070672_1000649023 219
1005 3300005543 Ga0070672_100192249 Ga0070672_1001922491 219
1006 3300005548 Ga0070665_100918783 Ga0070665_1009187831 219
1007 3300005577 Ga0068857_100240371 Ga0068857_1002403712 219
1008 3300005614 Ga0068856_100161633 Ga0068856_1001616333 219
1009 3300005616 Ga0068852_100097836 Ga0068852_1000978363 219
1010 3300005616 Ga0068852_100265737 Ga0068852_1002657372 219
1011 3300005618 Ga0068864_100089931 Ga0068864_1000899313 219
1012 3300005719 Ga0068861_100184160 Ga0068861_1001841602 219
1013 3300005834 Ga0068851_10035165 Ga0068851_100351653 219
1014 3300005834 Ga0068851_10053813 Ga0068851_100538133 219
1015 3300005840 Ga0068870_10039933 Ga0068870_100399333 219
1016 3300005842 Ga0068858_100628430 Ga0068858_1006284302 219
1017 3300006038 Ga0075365_10147503 Ga0075365_101475032 219
1018 3300006048 Ga0075363_100155062 Ga0075363_1001550622 219
1019 3300006177 Ga0075362_10011391 Ga0075362_100113912 219
1020 3300006178 Ga0075367_10006881 Ga0075367_100068812 219
1021 3300006178 Ga0075367_10059790 Ga0075367_100597903 219
1022 3300006195 Ga0075366_10005662 Ga0075366_100056622 219
1023 3300006195 Ga0075366_10114492 Ga0075366_101144922 219
1024 3300006195 Ga0075366_10416103 Ga0075366_104161031 219
1025 3300006237 Ga0097621_100007195 Ga0097621_1000071956 219
1026 3300006353 Ga0075370_10000157 Ga0075370_1000015716 219
1027 3300006353 Ga0075370_10000617 Ga0075370_100006176 219
1028 3300006353 Ga0075370_10008439 Ga0075370_100084393 219
1029 3300006353 Ga0075370_10015438 Ga0075370_100154385 219
1030 3300006353 Ga0075370_10073471 Ga0075370_100734713 219
1031 3300006358 Ga0068871_100040972 Ga0068871_1000409723 219
1032 3300009148 Ga0105243_10011984 Ga0105243_100119845 219
1033 3300009148 Ga0105243_10103847 Ga0105243_101038472 219
1034 3300009148 Ga0105243_10116653 Ga0105243_101166533 219
1035 3300009551 Ga0105238_10594673 Ga0105238_105946732 219
1036 3300011119 Ga0105246_10121353 Ga0105246_101213532 219
1037 3300012475 Ga0157317_1000102 Ga0157317_10001022 219
1038 3300012497 Ga0157319_1000002 Ga0157319_1000002217 219
1039 3300013104 Ga0157370_10327974 Ga0157370_103279742 219
1040 3300013296 Ga0157374_10667812 Ga0157374_106678121 219
1041 3300013306 Ga0163162_10796648 Ga0163162_107966482 219
1042 3300013308 Ga0157375_10023002 Ga0157375_100230022 219
1043 3300013308 Ga0157375_10069823 Ga0157375_100698234 219
1044 3300013308 Ga0157375_10107199 Ga0157375_101071994 219
1045 3300014325 Ga0163163_10505818 Ga0163163_105058182 219
1046 3300014745 Ga0157377_10000092 Ga0157377_1000009258 219
1047 3300014745 Ga0157377_10230770 Ga0157377_102307702 219
1048 3300014969 Ga0157376_10009278 Ga0157376_100092788 219
1049 3300014969 Ga0157376_11015349 Ga0157376_110153491 219
1050 3300025258 Ga0209129_1000382 Ga0209129_100038214 219
1051 3300025273 Ga0209673_1013824 Ga0209673_10138244 219
1052 3300025273 Ga0209673_1017435 Ga0209673_10174352 219
1053 3300025273 Ga0209673_1033472 Ga0209673_10334721 219
1054 3300025292 Ga0209676_1006358 Ga0209676_10063584 219
1055 3300025295 Ga0209564_1000991 Ga0209564_100099114 219
1056 3300025297 Ga0209758_1001078 Ga0209758_100107820 219
1057 3300025298 Ga0209050_1001008 Ga0209050_100100820 219
1058 3300025299 Ga0209256_1000072 Ga0209256_100007223 219
1059 3300025303 Ga0209051_1025604 Ga0209051_10256043 219
1060 3300025304 Ga0209257_1000385 Ga0209257_100038557 219
1061 3300025304 Ga0209257_1006722 Ga0209257_10067224 219
1062 3300025893 Ga0207682_10007704 Ga0207682_100077045 219
1063 3300025907 Ga0207645_10005608 Ga0207645_100056084 219
1064 3300025908 Ga0207643_10102524 Ga0207643_101025242 219
1065 3300025908 Ga0207643_10144060 Ga0207643_101440602 219
1066 3300025920 Ga0207649_10550574 Ga0207649_105505741 219
1067 3300025923 Ga0207681_10178688 Ga0207681_101786882 219
1068 3300025923 Ga0207681_10408180 Ga0207681_104081801 219
1069 3300025925 Ga0207650_10275603 Ga0207650_102756032 219
1070 3300025925 Ga0207650_10845431 Ga0207650_108454311 219
1071 3300025926 Ga0207659_10049889 Ga0207659_100498894 219
1072 3300025933 Ga0207706_10005534 Ga0207706_100055346 219
1073 3300025933 Ga0207706_10116753 Ga0207706_101167533 219
1074 3300025933 Ga0207706_10214533 Ga0207706_102145332 219
1075 3300025935 Ga0207709_10006214 Ga0207709_100062145 219
1076 3300025935 Ga0207709_10067033 Ga0207709_100670332 219
1077 3300025935 Ga0207709_10148407 Ga0207709_101484073 219
1078 3300025937 Ga0207669_10024573 Ga0207669_100245733 219
1079 3300025938 Ga0207704_10310784 Ga0207704_103107842 219
1080 3300025940 Ga0207691_10020976 Ga0207691_100209764 219
1081 3300025940 Ga0207691_10037859 Ga0207691_100378594 219
1082 3300025942 Ga0207689_10074051 Ga0207689_100740514 219
1083 3300025945 Ga0207679_10149371 Ga0207679_101493713 219
1084 3300025949 Ga0207667_10046311 Ga0207667_100463113 219
1085 3300025960 Ga0207651_10015896 Ga0207651_100158965 219
1086 3300025960 Ga0207651_10065575 Ga0207651_100655753 219
1087 3300025960 Ga0207651_10194756 Ga0207651_101947563 219
1088 3300025972 Ga0207668_10212248 Ga0207668_102122482 219
1089 3300025986 Ga0207658_10173841 Ga0207658_101738412 219
1090 3300025986 Ga0207658_10201928 Ga0207658_102019282 219
1091 3300025986 Ga0207658_10205157 Ga0207658_102051572 219
1092 3300026023 Ga0207677_10055198 Ga0207677_100551982 219
1093 3300026023 Ga0207677_10703984 Ga0207677_107039842 219
1094 3300026035 Ga0207703_10578913 Ga0207703_105789132 219
1095 3300026041 Ga0207639_10111926 Ga0207639_101119262 219
1096 3300026041 Ga0207639_10288912 Ga0207639_102889122 219
1097 3300026075 Ga0207708_10129544 Ga0207708_101295443 219
1098 3300026078 Ga0207702_10166512 Ga0207702_101665123 219
1099 3300026089 Ga0207648_10000329 Ga0207648_1000032925 219
1100 3300026089 Ga0207648_10012219 Ga0207648_100122194 219
1101 3300026089 Ga0207648_10291167 Ga0207648_102911672 219
1102 3300026095 Ga0207676_10603462 Ga0207676_106034622 219
1103 3300026095 Ga0207676_10773769 Ga0207676_107737691 219
1104 3300026116 Ga0207674_10100391 Ga0207674_101003914 219
1105 3300026116 Ga0207674_10133324 Ga0207674_101333244 219
1106 3300026118 Ga0207675_100123030 Ga0207675_1001230303 219
1107 3300026121 Ga0207683_10049950 Ga0207683_100499503 219
1108 3300026142 Ga0207698_10070164 Ga0207698_100701642 219
1109 3300028786 Ga0307517_10005247 Ga0307517_100052472 219
1110 3300028786 Ga0307517_10202220 Ga0307517_102022202 219
1111 3300028794 Ga0307515_10044904 Ga0307515_100449044 219
1112 3300028794 Ga0307515_10052836 Ga0307515_100528366 219
1113 3300028794 Ga0307515_10232256 Ga0307515_102322562 219
1114 3300028794 Ga0307515_10481414 Ga0307515_104814142 219
1115 3300031456 Ga0307513_10013518 Ga0307513_100135183 219
1116 3300031456 Ga0307513_10304631 Ga0307513_103046312 219
1117 3300031456 Ga0307513_10357159 Ga0307513_103571592 219
1118 3300031507 Ga0307509_10000577 Ga0307509_1000057742 219
1119 3300031507 Ga0307509_10015812 Ga0307509_100158122 219
1120 3300031507 Ga0307509_10024552 Ga0307509_100245525 219
1121 3300031507 Ga0307509_10098166 Ga0307509_100981664 219
1122 3300031548 Ga0307408_100000016 Ga0307408_10000001697 219
1123 3300031548 Ga0307408_100008251 Ga0307408_1000082518 219
1124 3300031616 Ga0307508_10002454 Ga0307508_1000245418 219
1125 3300031616 Ga0307508_10006724 Ga0307508_100067248 219
1126 3300031616 Ga0307508_10183573 Ga0307508_101835732 219
1127 3300031616 Ga0307508_10261018 Ga0307508_102610182 219
1128 3300031649 Ga0307514_10069582 Ga0307514_100695822 219
1129 3300031730 Ga0307516_10002718 Ga0307516_1000271819 219
1130 3300031730 Ga0307516_10019240 Ga0307516_100192403 219
1131 3300031730 Ga0307516_10166079 Ga0307516_101660792 219
1132 3300031730 Ga0307516_10330165 Ga0307516_103301652 219
1133 3300031730 Ga0307516_10645691 Ga0307516_106456911 219
1134 3300032005 Ga0307411_10130354 Ga0307411_101303542 219
1135 3300033179 Ga0307507_10031298 Ga0307507_100312984 219
1136 3300033180 Ga0307510_10000553 Ga0307510_1000055333 219
1137 3300033180 Ga0307510_10029719 Ga0307510_100297192 219
1138 3300033180 Ga0307510_10091449 Ga0307510_100914495 219
1139 3300033180 Ga0307510_10151804 Ga0307510_101518042 219
1140 3300035114 Ga0373939_0021247 Ga0373939_0021247_54_713 219
1141 3300035691 Ga0373931_0004756 Ga0373931_0004756_3909_4568 219
1142 3300037068 Ga0373925_0693428 Ga0373925_0693428_117_776 219
1143 3300037471 Ga0395905_0012748 Ga0395905_0012748_3509_4183 219
1144 3300037471 Ga0395905_0086537 Ga0395905_0086537_1379_2038 219
1145 3300041443 Ga0451789_0064587 Ga0451789_0064587_205_864 219
1146 3300042127 Ga0450890_001564 Ga0450890_001564_153_878 219
1147 3300042438 Ga0439459_0001403 Ga0439459_0001403_1156_1881 219
1148 3300042439 Ga0439464_0094401 Ga0439464_0094401_51_710 219
1149 3300044693 Ga0466961_0010850 Ga0466961_0010850_481_1140 219
1150 3300044694 Ga0466963_0177928 Ga0466963_0177928_728_1453 219
1151 3300045051 Ga0451576_0092337 Ga0451576_0092337_1084_1755 219
1152 3300045051 Ga0451576_0125447 Ga0451576_0125447_1944_2618 219
1153 3300046454 Ga0495592_0000142 Ga0495592_0000142_61966_62625 219
1154 3300046460 Ga0495638_0027683 Ga0495638_0027683_1044_1703 219
1155 3300046460 Ga0495638_0099172 Ga0495638_0099172_523_1182 219
1156 3300046461 Ga0495641_0152583 Ga0495641_0152583_192_851 219
1157 3300046501 Ga0495607_0000109 Ga0495607_0000109_1669_2331 219
1158 3300046518 Ga0495631_0235917 Ga0495631_0235917_51_710 219
1159 3300046519 Ga0495632_0009650 Ga0495632_0009650_1018_1677 219
1160 3300046526 Ga0495666_0064627 Ga0495666_0064627_445_1104 219
1161 3300046557 Ga0495622_0227374 Ga0495622_0227374_28_687 219
1162 3300046660 Ga0495625_0002261 Ga0495625_0002261_1727_2386 219
1163 3300046683 Ga0495658_0019792 Ga0495658_0019792_1949_2617 219
1164 3300046691 Ga0495670_0012581 Ga0495670_0012581_2042_2770 219
1165 3300046692 Ga0495671_0158219 Ga0495671_0158219_406_1065 219
1166 3300047443 Ga0495687_012020 Ga0495687_012020_1340_1999 219
1167 3300047472 Ga0495686_0072858 Ga0495686_0072858_1160_1819 219
1168 3300047673 Ga0495593_0042953 Ga0495593_0042953_1694_2362 219
1169 3300048089 Ga0495614_0053453 Ga0495614_0053453_204_872 219
1170 3300048911 Ga0496108_0813614 Ga0496108_0813614_23_682 219
1171 3300048912 Ga0496109_0182082 Ga0496109_0182082_1025_1684 219
1172 3300048913 Ga0496110_0490737 Ga0496110_0490737_112_771 219
1173 3300048916 Ga0496113_0104500 Ga0496113_0104500_1511_2170 219
1174 3300048921 Ga0496118_0001422 Ga0496118_0001422_3241_3951 219
1175 3300048927 Ga0496124_0134745 Ga0496124_0134745_721_1380 219
1176 3300048927 Ga0496124_0137998 Ga0496124_0137998_1098_1772 219
1177 3300049652 Ga0501202_006430 Ga0501202_006430_708_1382 219
1178 3300049658 Ga0501211_000285 Ga0501211_000285_1133_1807 219
1179 3300049661 Ga0501217_015236 Ga0501217_015236_41_715 219
1180 3300049662 Ga0501222_001447 Ga0501222_001447_833_1507 219
1181 3300049669 Ga0501235_003072 Ga0501235_003072_465_1139 219
1182 3300049683 Ga0501253_006500 Ga0501253_006500_477_1151 219
1183 3300049704 Ga0501221_007887 Ga0501221_007887_149_823 219
1184 3300049706 Ga0501229_010523 Ga0501229_010523_14_688 219
1185 3300049706 Ga0501229_015362 Ga0501229_015362_14_688 219
1186 3300049757 Ga0501232_000254 Ga0501232_000254_951_1625 219
1187 3300049768 Ga0501271_003968 Ga0501271_003968_235_909 219
1188 3300049769 Ga0501272_001874 Ga0501272_001874_505_1179 219
1189 3300049778 Ga0501282_002251 Ga0501282_002251_807_1481 219
1190 3300050489 nmdc:mga03683_4135_c1 nmdc:mga03683_4135_c1_4042_4701 219
1191 3300050490 nmdc:mga03n38_3262_c1 nmdc:mga03n38_3262_c1_2521_3180 219
1192 3300050492 nmdc:mga0yw44_124115_c1 nmdc:mga0yw44_124115_c1_750_1463 219
1193 3300050493 nmdc:mga0k408_130472_c1 nmdc:mga0k408_130472_c1_541_1200 219
1194 3300050493 nmdc:mga0k408_151135_c1 nmdc:mga0k408_151135_c1_135_794 219
1195 3300050493 nmdc:mga0k408_186197_c1 nmdc:mga0k408_186197_c1_135_794 219
1196 3300050493 nmdc:mga0k408_408488_c1 nmdc:mga0k408_408488_c1_51_725 219
1197 3300050493 nmdc:mga0k408_59185_c1 nmdc:mga0k408_59185_c1_1552_2211 219
1198 3300050494 nmdc:mga06z11_33226_c1 nmdc:mga06z11_33226_c1_1136_1795 219
1199 3300050495 nmdc:mga04h51_9886_c1 nmdc:mga04h51_9886_c1_804_1463 219
1200 3300050496 nmdc:mga07m45_22778_c1 nmdc:mga07m45_22778_c1_514_1173 219
1201 3300050496 nmdc:mga07m45_24703_c1 nmdc:mga07m45_24703_c1_1950_2609 219
1202 3300050496 nmdc:mga07m45_480782_c1 nmdc:mga07m45_480782_c1_37_696 219
1203 3300050496 nmdc:mga07m45_910_c1 nmdc:mga07m45_910_c1_6281_6940 219
1204 3300050516 nmdc:mga0sz30_35107_c1 nmdc:mga0sz30_35107_c1_1187_1846 219
1205 3300050516 nmdc:mga0sz30_73110_c1 nmdc:mga0sz30_73110_c1_484_1143 219
1206 3300053086 Ga0500578_0000122 Ga0500578_0000122_60933_61592 219
1207 3300053088 Ga0500644_0087108 Ga0500644_0087108_241_900 219
1208 3300053090 Ga0500646_0009863 Ga0500646_0009863_784_1443 219
1209 3300053093 Ga0500651_0019783 Ga0500651_0019783_3293_3952 219
1210 3300053108 Ga0500562_066490 Ga0500562_066490_62_721 219
1211 3300053118 Ga0500594_0005684 Ga0500594_0005684_1977_2636 219
1212 3300053121 Ga0500607_040469 Ga0500607_040469_1554_2213 219
1213 3300053129 Ga0500628_001358 Ga0500628_001358_3415_4074 219
1214 3300053130 Ga0500642_0025425 Ga0500642_0025425_1697_2356 219
1215 3300053131 Ga0500652_000127 Ga0500652_000127_3970_4629 219
1216 3300053133 Ga0500655_004596 Ga0500655_004596_782_1441 219
1217 3300053134 Ga0500658_0006149 Ga0500658_0006149_1816_2475 219
1218 3300053136 Ga0500559_0000014 Ga0500559_0000014_119076_119735 219
1219 3300053139 Ga0500568_0025148 Ga0500568_0025148_906_1565 219
1220 3300053142 Ga0500577_0009701 Ga0500577_0009701_1400_2059 219
1221 3300053151 Ga0500604_0002538 Ga0500604_0002538_1050_1709 219
1222 3300053151 Ga0500604_0029488 Ga0500604_0029488_904_1563 219
1223 3300053156 Ga0500622_0000274 Ga0500622_0000274_3995_4654 219
1224 3300053156 Ga0500622_0002493 Ga0500622_0002493_5673_6401 219
1225 3300053156 Ga0500622_0003526 Ga0500622_0003526_7762_8421 219
1226 3300053177 Ga0500636_0235878 Ga0500636_0235878_212_871 219
1227 iso_pu_bacteria 2510917028 2511185832 219
1228 iso_pu_bacteria 2582581867 2585404299 219
1229 iso_pu_bacteria 2585427590 2585823229 219
1230 iso_pu_bacteria 2791355266 2793363692 219
1231 iso_pu_bacteria 2841957949 2841958858 219
1232 3300002705 JGI25156J39149_1000078 JGI25156J39149_100007841 220
1233 3300002738 JGI25154J39366_1000105 JGI25154J39366_100010540 220
1234 3300002739 JGI25158J39367_1010611 JGI25158J39367_10106112 220
1235 3300002741 JGI25157J39369_1000098 JGI25157J39369_100009840 220
1236 3300002774 JGI25150J39212_1001350 JGI25150J39212_10013503 220
1237 3300002774 JGI25150J39212_1001977 JGI25150J39212_10019772 220
1238 3300002774 JGI25150J39212_1008029 JGI25150J39212_10080292 220
1239 3300002987 JGI25159J45721_1000534 JGI25159J45721_10005344 220
1240 3300002987 JGI25159J45721_1001110 JGI25159J45721_100111011 220
1241 3300002987 JGI25159J45721_1008306 JGI25159J45721_10083061 220
1242 3300003187 JGI25151J46595_10005434 JGI25151J46595_100054344 220
1243 3300003187 JGI25151J46595_10006117 JGI25151J46595_100061172 220
1244 3300003187 JGI25151J46595_10036825 JGI25151J46595_100368252 220
1245 3300003187 JGI25151J46595_10043824 JGI25151J46595_100438241 220
1246 3300003215 JGI25153J46596_10013073 JGI25153J46596_100130734 220
1247 3300003354 JGI25160J50197_1000270 JGI25160J50197_10002707 220
1248 3300003354 JGI25160J50197_1021488 JGI25160J50197_10214881 220
1249 3300003374 JGI25161J50226_1000040 JGI25161J50226_100004038 220
1250 3300003760 Ga0055527_1005544 Ga0055527_10055442 220
1251 3300003761 Ga0055535_1000630 Ga0055535_100063016 220
1252 3300003762 Ga0055542_1000009 Ga0055542_1000009407 220
1253 3300003771 Ga0055526_1001173 Ga0055526_100117320 220
1254 3300003773 Ga0055537_1000157 Ga0055537_100015716 220
1255 3300003773 Ga0055537_1005617 Ga0055537_10056173 220
1256 3300003775 Ga0055524_1000077 Ga0055524_100007788 220
1257 3300003781 Ga0055536_1006592 Ga0055536_10065924 220
1258 3300003784 Ga0055534_1021822 Ga0055534_10218222 220
1259 3300003790 Ga0055528_1001471 Ga0055528_100147110 220
1260 3300003791 Ga0055530_10001005 Ga0055530_1000100510 220
1261 3300003792 Ga0055540_1000010 Ga0055540_1000010200 220
1262 3300003792 Ga0055540_1002128 Ga0055540_100212813 220
1263 3300003792 Ga0055540_1003254 Ga0055540_10032542 220
1264 3300003792 Ga0055540_1019150 Ga0055540_10191502 220
1265 3300003794 Ga0055531_10004907 Ga0055531_100049072 220
1266 3300003794 Ga0055531_10008911 Ga0055531_100089113 220
1267 3300003794 Ga0055531_10012389 Ga0055531_100123894 220
1268 3300004625 Ga0055543_1001055 Ga0055543_10010557 220
1269 3300005262 Ga0065165_1014032 Ga0065165_10140323 220
1270 3300005262 Ga0065165_1022764 Ga0065165_10227642 220
1271 3300005331 Ga0070670_100300266 Ga0070670_1003002661 220
1272 3300005338 Ga0068868_100281029 Ga0068868_1002810291 220
1273 3300005353 Ga0070669_100280227 Ga0070669_1002802272 220
1274 3300005355 Ga0070671_100027644 Ga0070671_1000276441 220
1275 3300005366 Ga0070659_100141386 Ga0070659_1001413862 220
1276 3300005367 Ga0070667_100083096 Ga0070667_1000830963 220
1277 3300005455 Ga0070663_100121742 Ga0070663_1001217422 220
1278 3300005457 Ga0070662_100003100 Ga0070662_1000031006 220
1279 3300005467 Ga0070706_100695505 Ga0070706_1006955052 220
1280 3300005539 Ga0068853_100005290 Ga0068853_1000052903 220
1281 3300005539 Ga0068853_100203419 Ga0068853_1002034193 220
1282 3300005539 Ga0068853_100213667 Ga0068853_1002136672 220
1283 3300005539 Ga0068853_100919374 Ga0068853_1009193741 220
1284 3300005548 Ga0070665_100060322 Ga0070665_1000603223 220
1285 3300005564 Ga0070664_100013925 Ga0070664_1000139253 220
1286 3300005578 Ga0068854_100063931 Ga0068854_1000639313 220
1287 3300005617 Ga0068859_100039130 Ga0068859_1000391302 220
1288 3300005834 Ga0068851_10013180 Ga0068851_100131801 220
1289 3300005834 Ga0068851_10350302 Ga0068851_103503021 220
1290 3300006038 Ga0075365_10035846 Ga0075365_100358463 220
1291 3300006038 Ga0075365_10581411 Ga0075365_105814111 220
1292 3300006048 Ga0075363_100132515 Ga0075363_1001325152 220
1293 3300006058 Ga0075432_10016580 Ga0075432_100165803 220
1294 3300006358 Ga0068871_100095533 Ga0068871_1000955332 220
1295 3300006931 Ga0097620_100039125 Ga0097620_1000391252 220
1296 3300006946 Ga0079104_1013084 Ga0079104_10130842 220
1297 3300009036 Ga0105244_10005024 Ga0105244_100050249 220
1298 3300009098 Ga0105245_10030303 Ga0105245_100303033 220
1299 3300009098 Ga0105245_11478432 Ga0105245_114784321 220
1300 3300009148 Ga0105243_10003677 Ga0105243_1000367713 220
1301 3300009148 Ga0105243_10006418 Ga0105243_100064186 220
1302 3300009545 Ga0105237_10214553 Ga0105237_102145532 220
1303 3300013102 Ga0157371_10109718 Ga0157371_101097181 220
1304 3300013104 Ga0157370_10012371 Ga0157370_1001237111 220
1305 3300013296 Ga0157374_10050587 Ga0157374_100505873 220
1306 3300013306 Ga0163162_10231687 Ga0163162_102316872 220
1307 3300013307 Ga0157372_10458714 Ga0157372_104587143 220
1308 3300013308 Ga0157375_10306020 Ga0157375_103060202 220
1309 3300014497 Ga0182008_10004309 Ga0182008_1000430910 220
1310 3300014968 Ga0157379_10096937 Ga0157379_100969374 220
1311 3300015261 Ga0182006_1012628 Ga0182006_10126283 220
1312 3300015262 Ga0182007_10004768 Ga0182007_100047688 220
1313 3300015265 Ga0182005_1021585 Ga0182005_10215852 220
1314 3300015265 Ga0182005_1080520 Ga0182005_10805201 220
1315 3300017792 Ga0163161_10000598 Ga0163161_1000059823 220
1316 3300025206 Ga0209435_100010 Ga0209435_100010341 220
1317 3300025208 Ga0209436_107131 Ga0209436_1071312 220
1318 3300025208 Ga0209436_108437 Ga0209436_1084372 220
1319 3300025228 Ga0209672_103043 Ga0209672_1030432 220
1320 3300025229 Ga0209147_100510 Ga0209147_10051017 220
1321 3300025242 Ga0209258_100009 Ga0209258_100009247 220
1322 3300025245 Ga0207425_1000329 Ga0207425_100032923 220
1323 3300025245 Ga0207425_1000529 Ga0207425_10005298 220
1324 3300025245 Ga0207425_1021848 Ga0207425_10218482 220
1325 3300025246 Ga0209646_1000001 Ga0209646_10000011801 220
1326 3300025250 Ga0209026_1000001 Ga0209026_1000001455 220
1327 3300025254 Ga0209148_1000007 Ga0209148_1000007247 220
1328 3300025256 Ga0209759_1000001 Ga0209759_10000011432 220
1329 3300025258 Ga0209129_1000013 Ga0209129_1000013394 220
1330 3300025263 Ga0209565_1000226 Ga0209565_100022655 220
1331 3300025263 Ga0209565_1000243 Ga0209565_100024360 220
1332 3300025273 Ga0209673_1000309 Ga0209673_100030922 220
1333 3300025273 Ga0209673_1000329 Ga0209673_100032923 220
1334 3300025284 Ga0209130_1000042 Ga0209130_100004282 220
1335 3300025284 Ga0209130_1000255 Ga0209130_100025547 220
1336 3300025284 Ga0209130_1000489 Ga0209130_100048923 220
1337 3300025284 Ga0209130_1001079 Ga0209130_10010795 220
1338 3300025291 Ga0209675_1000238 Ga0209675_10002382 220
1339 3300025291 Ga0209675_1001085 Ga0209675_100108513 220
1340 3300025291 Ga0209675_1001591 Ga0209675_10015918 220
1341 3300025292 Ga0209676_1000004 Ga0209676_1000004254 220
1342 3300025292 Ga0209676_1000007 Ga0209676_1000007226 220
1343 3300025292 Ga0209676_1000162 Ga0209676_1000162128 220
1344 3300025292 Ga0209676_1001101 Ga0209676_100110111 220
1345 3300025294 Ga0209025_1000220 Ga0209025_100022014 220
1346 3300025294 Ga0209025_1000393 Ga0209025_100039380 220
1347 3300025294 Ga0209025_1001915 Ga0209025_100191525 220
1348 3300025294 Ga0209025_1002780 Ga0209025_10027808 220
1349 3300025294 Ga0209025_1008041 Ga0209025_100804110 220
1350 3300025294 Ga0209025_1008724 Ga0209025_10087247 220
1351 3300025294 Ga0209025_1034233 Ga0209025_10342333 220
1352 3300025294 Ga0209025_1041357 Ga0209025_10413573 220
1353 3300025295 Ga0209564_1000222 Ga0209564_100022262 220
1354 3300025295 Ga0209564_1000287 Ga0209564_100028761 220
1355 3300025295 Ga0209564_1001728 Ga0209564_10017282 220
1356 3300025297 Ga0209758_1000134 Ga0209758_1000134104 220
1357 3300025297 Ga0209758_1012867 Ga0209758_10128672 220
1358 3300025297 Ga0209758_1074164 Ga0209758_10741642 220
1359 3300025297 Ga0209758_1076316 Ga0209758_10763162 220
1360 3300025298 Ga0209050_1000002 Ga0209050_1000002764 220
1361 3300025298 Ga0209050_1000003 Ga0209050_10000031282 220
1362 3300025298 Ga0209050_1002574 Ga0209050_100257411 220
1363 3300025298 Ga0209050_1003923 Ga0209050_10039236 220
1364 3300025298 Ga0209050_1005552 Ga0209050_10055529 220
1365 3300025298 Ga0209050_1011437 Ga0209050_10114374 220
1366 3300025299 Ga0209256_1000060 Ga0209256_1000060171 220
1367 3300025299 Ga0209256_1001206 Ga0209256_10012069 220
1368 3300025302 Ga0207426_1000095 Ga0207426_1000095100 220
1369 3300025302 Ga0207426_1000097 Ga0207426_100009788 220
1370 3300025302 Ga0207426_1000100 Ga0207426_1000100171 220
1371 3300025302 Ga0207426_1001088 Ga0207426_10010889 220
1372 3300025303 Ga0209051_1000002 Ga0209051_1000002532 220
1373 3300025303 Ga0209051_1000003 Ga0209051_10000031282 220
1374 3300025303 Ga0209051_1000274 Ga0209051_100027414 220
1375 3300025303 Ga0209051_1000311 Ga0209051_100031176 220
1376 3300025304 Ga0209257_1000002 Ga0209257_1000002673 220
1377 3300025304 Ga0209257_1000020 Ga0209257_1000020226 220
1378 3300025304 Ga0209257_1000286 Ga0209257_100028651 220
1379 3300025304 Ga0209257_1000432 Ga0209257_100043220 220
1380 3300025304 Ga0209257_1006354 Ga0209257_100635410 220
1381 3300025321 Ga0207656_10013042 Ga0207656_100130421 220
1382 3300025728 Ga0207655_1011138 Ga0207655_10111383 220
1383 3300025728 Ga0207655_1063617 Ga0207655_10636171 220
1384 3300025910 Ga0207684_10926067 Ga0207684_109260671 220
1385 3300025914 Ga0207671_10128694 Ga0207671_101286943 220
1386 3300025922 Ga0207646_10056445 Ga0207646_100564453 220
1387 3300025923 Ga0207681_10181707 Ga0207681_101817072 220
1388 3300025924 Ga0207694_10100864 Ga0207694_101008643 220
1389 3300025925 Ga0207650_10230816 Ga0207650_102308161 220
1390 3300025927 Ga0207687_10013919 Ga0207687_100139195 220
1391 3300025931 Ga0207644_10061336 Ga0207644_100613361 220
1392 3300025932 Ga0207690_10061876 Ga0207690_100618763 220
1393 3300025933 Ga0207706_10008079 Ga0207706_1000807911 220
1394 3300025935 Ga0207709_10000205 Ga0207709_1000020564 220
1395 3300025986 Ga0207658_10131850 Ga0207658_101318502 220
1396 3300026023 Ga0207677_10658294 Ga0207677_106582941 220
1397 3300026142 Ga0207698_10112928 Ga0207698_101129281 220
1398 3300028379 Ga0268266_10188799 Ga0268266_101887992 220
1399 3300028794 Ga0307515_10000459 Ga0307515_1000045967 220
1400 3300028794 Ga0307515_10066856 Ga0307515_100668563 220
1401 3300028794 Ga0307515_10264224 Ga0307515_102642242 220
1402 3300031456 Ga0307513_10000011 Ga0307513_10000011222 220
1403 3300031456 Ga0307513_10000017 Ga0307513_1000001763 220
1404 3300031456 Ga0307513_10121327 Ga0307513_101213271 220
1405 3300031456 Ga0307513_10485041 Ga0307513_104850412 220
1406 3300031548 Ga0307408_100027631 Ga0307408_1000276313 220
1407 3300031649 Ga0307514_10000979 Ga0307514_1000097919 220
1408 3300031730 Ga0307516_10004153 Ga0307516_1000415311 220
1409 3300031911 Ga0307412_10011637 Ga0307412_100116375 220
1410 3300032002 Ga0307416_100002355 Ga0307416_1000023558 220
1411 3300038443 Ga0395901_0126807 Ga0395901_0126807_894_1559 220
1412 3300041460 Ga0451802_1050121 Ga0451802_1050121_116_778 220
1413 3300041512 Ga0451853_1740632 Ga0451853_1740632_534_1196 220
1414 3300042007 Ga0439449_0180412 Ga0439449_0180412_54_716 220
1415 3300042115 Ga0450911_000263 Ga0450911_000263_7781_8443 220
1416 3300042127 Ga0450890_021562 Ga0450890_021562_34_711 220
1417 3300042135 Ga0450899_012353 Ga0450899_012353_258_920 220
1418 3300044712 Ga0453684_0052651 Ga0453684_0052651_2762_3445 220
1419 3300045051 Ga0451576_0074794 Ga0451576_0074794_2124_2807 220
1420 3300046454 Ga0495592_0559598 Ga0495592_0559598_17_679 220
1421 3300046512 Ga0495610_0110421 Ga0495610_0110421_95_757 220
1422 3300046513 Ga0495616_0000916 Ga0495616_0000916_3540_4202 220
1423 3300046518 Ga0495631_0000233 Ga0495631_0000233_20805_21467 220
1424 3300046520 Ga0495637_0008199 Ga0495637_0008199_1146_1808 220
1425 3300046524 Ga0495648_0253525 Ga0495648_0253525_53_715 220
1426 3300046539 Ga0495621_0020533 Ga0495621_0020533_472_1134 220
1427 3300046660 Ga0495625_0271290 Ga0495625_0271290_11_673 220
1428 3300046674 Ga0495588_0039983 Ga0495588_0039983_421_1083 220
1429 3300046674 Ga0495588_0301486 Ga0495588_0301486_165_827 220
1430 3300046683 Ga0495658_0039179 Ga0495658_0039179_839_1501 220
1431 3300046691 Ga0495670_0097843 Ga0495670_0097843_37_699 220
1432 3300046692 Ga0495671_0001282 Ga0495671_0001282_7474_8136 220
1433 3300046810 Ga0495660_0128345 Ga0495660_0128345_361_1023 220
1434 3300047321 Ga0495676_0012350 Ga0495676_0012350_5985_6647 220
1435 3300047673 Ga0495593_0037832 Ga0495593_0037832_280_942 220
1436 3300048089 Ga0495614_0006188 Ga0495614_0006188_1032_1694 220
1437 3300048903 Ga0496100_0229336 Ga0496100_0229336_522_1184 220
1438 3300048904 Ga0496101_0067987 Ga0496101_0067987_1669_2331 220
1439 3300048910 Ga0496107_0372121 Ga0496107_0372121_319_981 220
1440 3300048919 Ga0496116_0022162 Ga0496116_0022162_2920_3582 220
1441 3300048919 Ga0496116_0057064 Ga0496116_0057064_1287_1949 220
1442 3300048920 Ga0496117_0038061 Ga0496117_0038061_918_1580 220
1443 3300048920 Ga0496117_0116370 Ga0496117_0116370_36_698 220
1444 3300048921 Ga0496118_0072606 Ga0496118_0072606_629_1291 220
1445 3300048921 Ga0496118_0101001 Ga0496118_0101001_1035_1697 220
1446 3300048924 Ga0496121_0003975 Ga0496121_0003975_11505_12167 220
1447 3300048924 Ga0496121_0066020 Ga0496121_0066020_877_1539 220
1448 3300048925 Ga0496122_0093644 Ga0496122_0093644_1210_1872 220
1449 3300048925 Ga0496122_0113078 Ga0496122_0113078_767_1429 220
1450 3300048926 Ga0496123_0043777 Ga0496123_0043777_1340_2002 220
1451 3300048926 Ga0496123_0094573 Ga0496123_0094573_494_1156 220
1452 3300048927 Ga0496124_0021012 Ga0496124_0021012_925_1587 220
1453 3300048927 Ga0496124_0146586 Ga0496124_0146586_290_952 220
1454 3300048928 Ga0496125_0001478 Ga0496125_0001478_12161_12823 220
1455 3300048928 Ga0496125_0042236 Ga0496125_0042236_2328_2990 220
1456 3300048928 Ga0496125_0115090 Ga0496125_0115090_994_1656 220
1457 3300048928 Ga0496125_0172060 Ga0496125_0172060_173_835 220
1458 3300048929 Ga0496126_0026679 Ga0496126_0026679_4403_5065 220
1459 3300048929 Ga0496126_0249102 Ga0496126_0249102_504_1166 220
1460 3300050491 nmdc:mga00v17_11218_c1 nmdc:mga00v17_11218_c1_2473_3135 220
1461 3300053087 Ga0500643_014230 Ga0500643_014230_1733_2395 220
1462 3300053093 Ga0500651_0000026 Ga0500651_0000026_36250_36912 220
1463 3300053093 Ga0500651_0155388 Ga0500651_0155388_546_1208 220
1464 3300053094 Ga0500566_0113279 Ga0500566_0113279_407_1069 220
1465 3300053094 Ga0500566_0188775 Ga0500566_0188775_298_960 220
1466 3300053107 Ga0500560_062239 Ga0500560_062239_256_918 220
1467 3300053110 Ga0500571_000839 Ga0500571_000839_914_1576 220
1468 3300053117 Ga0500593_000625 Ga0500593_000625_2223_2885 220
1469 3300053118 Ga0500594_0014303 Ga0500594_0014303_820_1482 220
1470 3300053120 Ga0500597_088817 Ga0500597_088817_531_1193 220
1471 3300053121 Ga0500607_004274 Ga0500607_004274_8894_9556 220
1472 3300053121 Ga0500607_107413 Ga0500607_107413_482_1144 220
1473 3300053125 Ga0500618_022011 Ga0500618_022011_323_985 220
1474 3300053128 Ga0500626_071451 Ga0500626_071451_315_977 220
1475 3300053129 Ga0500628_045594 Ga0500628_045594_112_774 220
1476 3300053133 Ga0500655_005059 Ga0500655_005059_379_1041 220
1477 3300053134 Ga0500658_0004281 Ga0500658_0004281_4221_4883 220
1478 3300053139 Ga0500568_0004013 Ga0500568_0004013_3832_4494 220
1479 3300053141 Ga0500574_000537 Ga0500574_000537_2915_3577 220
1480 3300053148 Ga0500590_126648 Ga0500590_126648_463_1125 220
1481 3300053153 Ga0500616_0035141 Ga0500616_0035141_1165_1827 220
1482 3300053153 Ga0500616_0036513 Ga0500616_0036513_435_1097 220
1483 3300053161 Ga0500634_0070361 Ga0500634_0070361_60_722 220
1484 3300053730 Ga0500645_000408 Ga0500645_000408_12072_12734 220
1485 3300053730 Ga0500645_007619 Ga0500645_007619_57_719 220
1486 3300053735 Ga0500596_009403 Ga0500596_009403_701_1363 220
1487 3300059424 Ga0590075_020130 Ga0590075_020130_245_907 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

30

216

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8935 3 211
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8702 3 211
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.8046 24 210
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.775 12 213
7ahd-assembly1.cif.gz_B opua (e190q) occluded 0.7541 23 209
ID Description Score Start End Superfamily
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9352 8 210 1.10.3720.10
af_P0AEU3_9_230_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9351 20 212 1.10.3720.10
af_P0AEQ6_1_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9299 3 210 1.10.3720.10
af_P0AE34_6_232_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9093 17 210 1.10.3720.10
af_P52094_1_222_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.901 15 211 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A0F3IWV9-F1-model_v4 Polar amino acid ABC transporter permease 0.9826 1 220 GO:0006865
GO:0022857
GO:0043190
AF-A0A259CHP0-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9816 4 220 GO:0006865
GO:0022857
GO:0043190
AF-A0A643FHC0-F1-model_v4 Amino acid ABC transporter permease 0.9794 1 217 GO:0006865
GO:0022857
GO:0043190
AF-A0A246J0R3-F1-model_v4 Polar amino acid ABC transporter permease 0.9749 3 219 GO:0006865
GO:0022857
GO:0043190
AF-A0A850JWF9-F1-model_v4 Amino acid ABC transporter permease 0.9716 1 212 GO:0006865
GO:0022857
GO:0043190

Feature Viewer

pLDDT pTM Quality
93.41 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map