F494338
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1491 | 538 | 2982 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300053119|Ga0500595_001717|Ga0500595_001717_7826_8311 |
| Length | 161 |
| Sequence | MVWRHSTGRRLEQRQSGLCPDFKANKEFSMTRELFWLTLTVILTGLLWVPYVLNRCQVRGLGGAMANPSRNDKPHAEWATRLMFAHDNAVENLVIFAPLVLILAEIDYSSKWTVYACAVYFWSRVAHLIVYALGLPVFRTLAFTVGFLAQAVLALGIFKIV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 13 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 98 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 99 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 102 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 121 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 138 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 141 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 144 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 145 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 213 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 214 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 215 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 222 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 223 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 225 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 226 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 229 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 230 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 233 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 239 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 240 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 243 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 244 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 245 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 246 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 247 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 248 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 250 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 251 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 253 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 254 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 255 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 256 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 257 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 258 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 259 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 260 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 261 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 262 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 263 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 264 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 266 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 269 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 270 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 271 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 274 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 277 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 279 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 285 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 286 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 287 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 288 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 289 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 290 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 291 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 292 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 293 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 295 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 296 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 297 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 298 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 299 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 300 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 301 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 302 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 303 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 304 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 305 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 314 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 315 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 316 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 317 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 318 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 319 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 320 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 321 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 322 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 323 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 324 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 325 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 326 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 327 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 415 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 416 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 417 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 418 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 419 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 420 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 423 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 424 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 425 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 426 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 427 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 428 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 429 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 430 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 431 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 432 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 433 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 434 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 435 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 458 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 459 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 467 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 468 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 469 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 470 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 471 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 472 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 479 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 482 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 486 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 487 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 488 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 489 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 490 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 491 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 492 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 493 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 494 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 495 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 496 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 497 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 498 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 499 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 500 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 501 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 502 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 503 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 504 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 505 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 506 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 507 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 508 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 509 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 510 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 511 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 512 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 513 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 514 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 515 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 516 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 517 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 518 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 519 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 520 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 521 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 522 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 523 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 524 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 525 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 526 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 527 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 528 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 530 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 531 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 532 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 533 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 534 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 535 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 536 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 537 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 538 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.79 |
| Metatranscriptomes | 0.67 |
| Isolates | 0.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.65 |
| Nodule | 0.94 |
| Rhizoplane | 6.57 |
| Rhizosphere | 77.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500595_001717 | 3300053119 | Bacteria | 11435 |
| 2 | LJQas_1006151 | 3300000549 | Bacteria | 1502 |
| 3 | JGI24736J21556_1019063 | 3300001904 | Bacteria | 1085 |
| 4 | JGI24739J22299_10029071 | 3300001989 | Bacteria | 1925 |
| 5 | JGI24737J22298_10026448 | 3300001990 | Bacteria | 1832 |
| 6 | JGI24735J21928_10036631 | 3300002067 | Bacteria | 1439 |
| 7 | JGI24735J21928_10069308 | 3300002067 | Bacteria | 1011 |
| 8 | JGI24748J21848_1054316 | 3300002074 | Bacteria | 527 |
| 9 | JGI24744J21845_10024791 | 3300002077 | Bacteria | 1172 |
| 10 | JGI25406J46586_10020393 | 3300003203 | Bacteria | 2681 |
| 11 | JGI25406J46586_10143480 | 3300003203 | Bacteria | 698 |
| 12 | JGI25406J46586_10151684 | 3300003203 | Bacteria | 676 |
| 13 | JGI25153J46596_10001436 | 3300003215 | Bacteria | 14265 |
| 14 | rootH2_10047101 | 3300003320 | Bacteria | 1830 |
| 15 | JGI25404J52841_10002090 | 3300003659 | Bacteria | 3703 |
| 16 | JGI25404J52841_10004756 | 3300003659 | Bacteria | 2774 |
| 17 | JGI25404J52841_10019050 | 3300003659 | Bacteria | 1487 |
| 18 | JGI25404J52841_10087493 | 3300003659 | Bacteria | 651 |
| 19 | JGI25405J52794_10049357 | 3300003911 | Bacteria | 900 |
| 20 | Ga0070658_10019300 | 3300005327 | Bacteria | 5460 |
| 21 | Ga0070683_100005606 | 3300005329 | Bacteria | 10489 |
| 22 | Ga0070683_100045273 | 3300005329 | Bacteria | 4061 |
| 23 | Ga0070683_100198250 | 3300005329 | Bacteria | 1906 |
| 24 | Ga0070683_100565967 | 3300005329 | Bacteria | 1087 |
| 25 | Ga0070683_100689860 | 3300005329 | Bacteria | 978 |
| 26 | Ga0070690_100395641 | 3300005330 | Bacteria | 1013 |
| 27 | Ga0068869_100216002 | 3300005334 | Bacteria | 1518 |
| 28 | Ga0070680_100015488 | 3300005336 | Bacteria | 5980 |
| 29 | Ga0070680_100021554 | 3300005336 | Bacteria | 5122 |
| 30 | Ga0070680_100147196 | 3300005336 | Bacteria | 1976 |
| 31 | Ga0070680_100224979 | 3300005336 | Bacteria | 1584 |
| 32 | Ga0070682_100073268 | 3300005337 | Bacteria | 2197 |
| 33 | Ga0070682_100151081 | 3300005337 | Bacteria | 1594 |
| 34 | Ga0068868_100014248 | 3300005338 | Bacteria | 5855 |
| 35 | Ga0068868_100354073 | 3300005338 | Bacteria | 1258 |
| 36 | Ga0070660_100062081 | 3300005339 | Bacteria | 2902 |
| 37 | Ga0070660_100265903 | 3300005339 | Bacteria | 1401 |
| 38 | Ga0070660_100587922 | 3300005339 | Bacteria | 930 |
| 39 | Ga0070660_101004132 | 3300005339 | Bacteria | 705 |
| 40 | Ga0070691_10086951 | 3300005341 | Bacteria | 1537 |
| 41 | Ga0070691_10509905 | 3300005341 | Bacteria | 697 |
| 42 | Ga0070661_100014484 | 3300005344 | Bacteria | 5555 |
| 43 | Ga0070661_100462185 | 3300005344 | Bacteria | 1011 |
| 44 | Ga0070661_100611875 | 3300005344 | Bacteria | 882 |
| 45 | Ga0070668_100024739 | 3300005347 | Bacteria | 4551 |
| 46 | Ga0070668_100191433 | 3300005347 | Bacteria | 1675 |
| 47 | Ga0070668_100288894 | 3300005347 | Bacteria | 1372 |
| 48 | Ga0070668_100819924 | 3300005347 | Bacteria | 828 |
| 49 | Ga0070668_101286160 | 3300005347 | Bacteria | 664 |
| 50 | Ga0070675_101004799 | 3300005354 | Bacteria | 766 |
| 51 | Ga0070671_101279121 | 3300005355 | Bacteria | 647 |
| 52 | Ga0070674_100047261 | 3300005356 | Bacteria | 2947 |
| 53 | Ga0070674_100940775 | 3300005356 | Bacteria | 755 |
| 54 | Ga0070673_100285973 | 3300005364 | Bacteria | 1448 |
| 55 | Ga0070688_100121601 | 3300005365 | Bacteria | 1750 |
| 56 | Ga0070688_100484082 | 3300005365 | Bacteria | 931 |
| 57 | Ga0070688_101100318 | 3300005365 | Bacteria | 635 |
| 58 | Ga0070659_100368928 | 3300005366 | Bacteria | 1207 |
| 59 | Ga0070659_100503508 | 3300005366 | Bacteria | 1032 |
| 60 | Ga0070659_101753354 | 3300005366 | Bacteria | 556 |
| 61 | Ga0070667_100435563 | 3300005367 | Bacteria | 1197 |
| 62 | Ga0070667_100731178 | 3300005367 | Bacteria | 917 |
| 63 | Ga0070667_101284482 | 3300005367 | Bacteria | 686 |
| 64 | Ga0070703_10231566 | 3300005406 | Bacteria | 740 |
| 65 | Ga0070709_10000102 | 3300005434 | Bacteria | 60511 |
| 66 | Ga0070709_10005140 | 3300005434 | Bacteria | 7079 |
| 67 | Ga0070709_10195133 | 3300005434 | Bacteria | 1431 |
| 68 | Ga0070709_10311965 | 3300005434 | Bacteria | 1152 |
| 69 | Ga0070709_10492366 | 3300005434 | Bacteria | 930 |
| 70 | Ga0070709_10599692 | 3300005434 | Bacteria | 848 |
| 71 | Ga0070709_10706596 | 3300005434 | Bacteria | 785 |
| 72 | Ga0070714_100001753 | 3300005435 | Bacteria | 15824 |
| 73 | Ga0070714_100022895 | 3300005435 | Bacteria | 5126 |
| 74 | Ga0070714_100030514 | 3300005435 | Bacteria | 4487 |
| 75 | Ga0070714_100036394 | 3300005435 | Bacteria | 4129 |
| 76 | Ga0070714_100148831 | 3300005435 | Bacteria | 2108 |
| 77 | Ga0070714_100877368 | 3300005435 | Bacteria | 871 |
| 78 | Ga0070714_101566761 | 3300005435 | Bacteria | 644 |
| 79 | Ga0070713_100002970 | 3300005436 | Bacteria | 11136 |
| 80 | Ga0070713_100005921 | 3300005436 | Bacteria | 8407 |
| 81 | Ga0070713_100015544 | 3300005436 | Bacteria | 5698 |
| 82 | Ga0070713_100045016 | 3300005436 | Bacteria | 3614 |
| 83 | Ga0070713_100140491 | 3300005436 | Bacteria | 2139 |
| 84 | Ga0070713_100258975 | 3300005436 | Bacteria | 1589 |
| 85 | Ga0070713_100956802 | 3300005436 | Bacteria | 825 |
| 86 | Ga0070710_10000526 | 3300005437 | Bacteria | 18024 |
| 87 | Ga0070710_10019960 | 3300005437 | Bacteria | 3471 |
| 88 | Ga0070710_10052085 | 3300005437 | Bacteria | 2301 |
| 89 | Ga0070710_10202213 | 3300005437 | Bacteria | 1255 |
| 90 | Ga0070710_10286858 | 3300005437 | Bacteria | 1070 |
| 91 | Ga0070701_10369705 | 3300005438 | Bacteria | 901 |
| 92 | Ga0070711_100002160 | 3300005439 | Bacteria | 11157 |
| 93 | Ga0070711_100009157 | 3300005439 | Bacteria | 6085 |
| 94 | Ga0070711_100021560 | 3300005439 | Bacteria | 4168 |
| 95 | Ga0070711_100091166 | 3300005439 | Bacteria | 2196 |
| 96 | Ga0070711_100224437 | 3300005439 | Bacteria | 1462 |
| 97 | Ga0070711_100341792 | 3300005439 | Bacteria | 1201 |
| 98 | Ga0070711_100963038 | 3300005439 | Bacteria | 731 |
| 99 | Ga0070705_100201702 | 3300005440 | Bacteria | 1364 |
| 100 | Ga0070705_100673025 | 3300005440 | Bacteria | 810 |
| 101 | Ga0070700_100093566 | 3300005441 | Bacteria | 1966 |
| 102 | Ga0070708_100098711 | 3300005445 | Bacteria | 2671 |
| 103 | Ga0070663_100038273 | 3300005455 | Bacteria | 3345 |
| 104 | Ga0070663_100056577 | 3300005455 | Bacteria | 2811 |
| 105 | Ga0070663_100248007 | 3300005455 | Bacteria | 1408 |
| 106 | Ga0070663_100284375 | 3300005455 | Bacteria | 1319 |
| 107 | Ga0070663_100461541 | 3300005455 | Bacteria | 1049 |
| 108 | Ga0070678_100070698 | 3300005456 | Bacteria | 2611 |
| 109 | Ga0070678_100122013 | 3300005456 | Bacteria | 2056 |
| 110 | Ga0070678_101595481 | 3300005456 | Bacteria | 612 |
| 111 | Ga0070662_100022874 | 3300005457 | Bacteria | 4286 |
| 112 | Ga0070662_100103986 | 3300005457 | Bacteria | 2154 |
| 113 | Ga0070662_100364458 | 3300005457 | Bacteria | 1186 |
| 114 | Ga0070662_100483133 | 3300005457 | Bacteria | 1031 |
| 115 | Ga0070681_10023500 | 3300005458 | Bacteria | 6201 |
| 116 | Ga0070681_10032157 | 3300005458 | Bacteria | 5266 |
| 117 | Ga0070681_10058028 | 3300005458 | Bacteria | 3851 |
| 118 | Ga0070681_10084358 | 3300005458 | Bacteria | 3129 |
| 119 | Ga0070681_10570220 | 3300005458 | Bacteria | 1046 |
| 120 | Ga0070681_10845435 | 3300005458 | Bacteria | 833 |
| 121 | Ga0070685_10661708 | 3300005466 | Bacteria | 758 |
| 122 | Ga0070706_100500165 | 3300005467 | Bacteria | 1131 |
| 123 | Ga0070706_100777464 | 3300005467 | Bacteria | 887 |
| 124 | Ga0070707_100062447 | 3300005468 | Bacteria | 3574 |
| 125 | Ga0070707_100183859 | 3300005468 | Bacteria | 2038 |
| 126 | Ga0070707_101990451 | 3300005468 | Bacteria | 548 |
| 127 | Ga0070698_100220036 | 3300005471 | Bacteria | 1832 |
| 128 | Ga0070699_100501396 | 3300005518 | Bacteria | 1103 |
| 129 | Ga0070699_101198594 | 3300005518 | Bacteria | 696 |
| 130 | Ga0070679_100013119 | 3300005530 | Bacteria | 7935 |
| 131 | Ga0070679_100026603 | 3300005530 | Bacteria | 5687 |
| 132 | Ga0070679_100069248 | 3300005530 | Bacteria | 3519 |
| 133 | Ga0070679_100104027 | 3300005530 | Bacteria | 2826 |
| 134 | Ga0070679_100135854 | 3300005530 | Bacteria | 2440 |
| 135 | Ga0070679_100536659 | 3300005530 | Bacteria | 1114 |
| 136 | Ga0070679_101205562 | 3300005530 | Bacteria | 702 |
| 137 | Ga0070684_100013256 | 3300005535 | Bacteria | 6641 |
| 138 | Ga0070684_100024555 | 3300005535 | Bacteria | 5057 |
| 139 | Ga0070684_100326270 | 3300005535 | Bacteria | 1410 |
| 140 | Ga0070697_100091314 | 3300005536 | Bacteria | 2518 |
| 141 | Ga0070697_100446253 | 3300005536 | Bacteria | 1127 |
| 142 | Ga0068853_100010809 | 3300005539 | Bacteria | 7394 |
| 143 | Ga0068853_100015334 | 3300005539 | Bacteria | 6297 |
| 144 | Ga0068853_100751722 | 3300005539 | Bacteria | 932 |
| 145 | Ga0068853_101244637 | 3300005539 | Bacteria | 719 |
| 146 | Ga0068853_101941198 | 3300005539 | Bacteria | 571 |
| 147 | Ga0070672_100264678 | 3300005543 | Bacteria | 1451 |
| 148 | Ga0070672_100435239 | 3300005543 | Bacteria | 1128 |
| 149 | Ga0070672_100674309 | 3300005543 | Bacteria | 904 |
| 150 | Ga0070686_101525500 | 3300005544 | Bacteria | 564 |
| 151 | Ga0070695_101049690 | 3300005545 | Bacteria | 665 |
| 152 | Ga0070693_100149715 | 3300005547 | Bacteria | 1477 |
| 153 | Ga0070665_100067345 | 3300005548 | Bacteria | 3590 |
| 154 | Ga0070665_100232545 | 3300005548 | Bacteria | 1843 |
| 155 | Ga0070665_100633109 | 3300005548 | Bacteria | 1083 |
| 156 | Ga0070665_100752588 | 3300005548 | Bacteria | 987 |
| 157 | Ga0070665_100803270 | 3300005548 | Bacteria | 954 |
| 158 | Ga0070704_100975041 | 3300005549 | Bacteria | 766 |
| 159 | Ga0068855_100013700 | 3300005563 | Bacteria | 9779 |
| 160 | Ga0068855_100014164 | 3300005563 | Bacteria | 9608 |
| 161 | Ga0068855_100033333 | 3300005563 | Bacteria | 6147 |
| 162 | Ga0068855_100221967 | 3300005563 | Bacteria | 2118 |
| 163 | Ga0068855_100750342 | 3300005563 | Bacteria | 1041 |
| 164 | Ga0068855_100850357 | 3300005563 | Bacteria | 967 |
| 165 | Ga0068855_101088469 | 3300005563 | Bacteria | 836 |
| 166 | Ga0068855_101123183 | 3300005563 | Bacteria | 821 |
| 167 | Ga0068855_101554138 | 3300005563 | Bacteria | 678 |
| 168 | Ga0068855_102398272 | 3300005563 | Bacteria | 526 |
| 169 | Ga0070664_100662320 | 3300005564 | Bacteria | 971 |
| 170 | Ga0068857_100004954 | 3300005577 | Bacteria | 11311 |
| 171 | Ga0068857_100025795 | 3300005577 | Bacteria | 5175 |
| 172 | Ga0068857_100038647 | 3300005577 | Bacteria | 4226 |
| 173 | Ga0068857_100153608 | 3300005577 | Bacteria | 2086 |
| 174 | Ga0068857_100838610 | 3300005577 | Bacteria | 879 |
| 175 | Ga0068857_101369238 | 3300005577 | Bacteria | 688 |
| 176 | Ga0068854_100026378 | 3300005578 | Bacteria | 3993 |
| 177 | Ga0068854_100631408 | 3300005578 | Bacteria | 918 |
| 178 | Ga0068856_100000451 | 3300005614 | Bacteria | 45442 |
| 179 | Ga0068856_100000659 | 3300005614 | Bacteria | 37359 |
| 180 | Ga0068856_100012689 | 3300005614 | Bacteria | 8158 |
| 181 | Ga0068856_100521784 | 3300005614 | Bacteria | 1209 |
| 182 | Ga0068856_100884698 | 3300005614 | Bacteria | 912 |
| 183 | Ga0068856_101305904 | 3300005614 | Bacteria | 741 |
| 184 | Ga0070702_100124167 | 3300005615 | Bacteria | 1620 |
| 185 | Ga0070702_101135733 | 3300005615 | Bacteria | 626 |
| 186 | Ga0068852_100071562 | 3300005616 | Bacteria | 3045 |
| 187 | Ga0068852_100139508 | 3300005616 | Bacteria | 2242 |
| 188 | Ga0068852_100268538 | 3300005616 | Bacteria | 1641 |
| 189 | Ga0068852_100427848 | 3300005616 | Bacteria | 1307 |
| 190 | Ga0068852_100507167 | 3300005616 | Bacteria | 1202 |
| 191 | Ga0068852_102437874 | 3300005616 | Bacteria | 544 |
| 192 | Ga0068859_100420450 | 3300005617 | Bacteria | 1433 |
| 193 | Ga0068859_100737395 | 3300005617 | Bacteria | 1074 |
| 194 | Ga0068864_100027097 | 3300005618 | Bacteria | 4836 |
| 195 | Ga0068864_100289129 | 3300005618 | Bacteria | 1532 |
| 196 | Ga0068864_100708627 | 3300005618 | Bacteria | 984 |
| 197 | Ga0068866_10212862 | 3300005718 | Bacteria | 1162 |
| 198 | Ga0068866_10217413 | 3300005718 | Bacteria | 1151 |
| 199 | Ga0068861_100202126 | 3300005719 | Bacteria | 1668 |
| 200 | Ga0068861_100588907 | 3300005719 | Bacteria | 1019 |
| 201 | Ga0068851_10044153 | 3300005834 | Bacteria | 2248 |
| 202 | Ga0068851_10045043 | 3300005834 | Bacteria | 2229 |
| 203 | Ga0068851_10057892 | 3300005834 | Bacteria | 1979 |
| 204 | Ga0068851_10571996 | 3300005834 | Bacteria | 685 |
| 205 | Ga0068863_100592395 | 3300005841 | Bacteria | 1097 |
| 206 | Ga0068858_100084248 | 3300005842 | Bacteria | 2957 |
| 207 | Ga0068858_100196916 | 3300005842 | Bacteria | 1904 |
| 208 | Ga0068858_100428840 | 3300005842 | Bacteria | 1272 |
| 209 | Ga0068858_100638292 | 3300005842 | Bacteria | 1034 |
| 210 | Ga0068860_100008418 | 3300005843 | Bacteria | 10274 |
| 211 | Ga0068860_100360322 | 3300005843 | Bacteria | 1432 |
| 212 | Ga0068860_100677982 | 3300005843 | Bacteria | 1040 |
| 213 | Ga0068862_100158586 | 3300005844 | Bacteria | 2018 |
| 214 | Ga0068862_100174424 | 3300005844 | Bacteria | 1926 |
| 215 | Ga0068862_100325654 | 3300005844 | Bacteria | 1419 |
| 216 | Ga0068862_101177839 | 3300005844 | Bacteria | 764 |
| 217 | Ga0081455_10003511 | 3300005937 | Bacteria | 18010 |
| 218 | Ga0081455_10007726 | 3300005937 | Bacteria | 11281 |
| 219 | Ga0081455_10012558 | 3300005937 | Bacteria | 8448 |
| 220 | Ga0081455_10021916 | 3300005937 | Bacteria | 5984 |
| 221 | Ga0081455_10025903 | 3300005937 | Bacteria | 5405 |
| 222 | Ga0081455_10037165 | 3300005937 | Bacteria | 4328 |
| 223 | Ga0081455_10496219 | 3300005937 | Bacteria | 821 |
| 224 | Ga0081538_10016160 | 3300005981 | Bacteria | 5738 |
| 225 | Ga0081540_1001538 | 3300005983 | Bacteria | 19791 |
| 226 | Ga0081540_1002078 | 3300005983 | Bacteria | 16705 |
| 227 | Ga0081540_1003660 | 3300005983 | Bacteria | 12052 |
| 228 | Ga0081540_1008178 | 3300005983 | Bacteria | 7331 |
| 229 | Ga0081540_1008898 | 3300005983 | Bacteria | 6964 |
| 230 | Ga0081540_1014574 | 3300005983 | Bacteria | 5027 |
| 231 | Ga0081540_1032957 | 3300005983 | Bacteria | 2820 |
| 232 | Ga0081540_1086701 | 3300005983 | Bacteria | 1390 |
| 233 | Ga0081540_1134711 | 3300005983 | Bacteria | 1002 |
| 234 | Ga0081540_1305108 | 3300005983 | Bacteria | 547 |
| 235 | Ga0081539_10000080 | 3300005985 | Bacteria | 222745 |
| 236 | Ga0081539_10000498 | 3300005985 | Bacteria | 82216 |
| 237 | Ga0081539_10011910 | 3300005985 | Bacteria | 6791 |
| 238 | Ga0081539_10028294 | 3300005985 | Bacteria | 3527 |
| 239 | Ga0081539_10071100 | 3300005985 | Bacteria | 1865 |
| 240 | Ga0081539_10194479 | 3300005985 | Bacteria | 942 |
| 241 | Ga0070717_10010508 | 3300006028 | Bacteria | 6993 |
| 242 | Ga0070717_10018723 | 3300006028 | Bacteria | 5415 |
| 243 | Ga0070717_10046983 | 3300006028 | Bacteria | 3535 |
| 244 | Ga0070717_10053340 | 3300006028 | Bacteria | 3333 |
| 245 | Ga0070717_10333654 | 3300006028 | Bacteria | 1353 |
| 246 | Ga0070717_10445232 | 3300006028 | Bacteria | 1167 |
| 247 | Ga0070717_11002044 | 3300006028 | Bacteria | 761 |
| 248 | Ga0075365_10021569 | 3300006038 | Bacteria | 4020 |
| 249 | Ga0075365_10176696 | 3300006038 | Bacteria | 1492 |
| 250 | Ga0075365_10379106 | 3300006038 | Bacteria | 998 |
| 251 | Ga0075368_10247084 | 3300006042 | Bacteria | 762 |
| 252 | Ga0075363_100357461 | 3300006048 | Bacteria | 854 |
| 253 | Ga0075363_100497625 | 3300006048 | Bacteria | 724 |
| 254 | Ga0070716_100001641 | 3300006173 | Bacteria | 10099 |
| 255 | Ga0070716_100002831 | 3300006173 | Bacteria | 8072 |
| 256 | Ga0070716_100665850 | 3300006173 | Bacteria | 791 |
| 257 | Ga0070716_100844507 | 3300006173 | Bacteria | 712 |
| 258 | Ga0070716_101609299 | 3300006173 | Bacteria | 534 |
| 259 | Ga0070712_100026574 | 3300006175 | Bacteria | 3857 |
| 260 | Ga0070712_100153424 | 3300006175 | Bacteria | 1771 |
| 261 | Ga0070712_101414810 | 3300006175 | Bacteria | 607 |
| 262 | Ga0075362_10187526 | 3300006177 | Bacteria | 1004 |
| 263 | Ga0075362_10195509 | 3300006177 | Bacteria | 983 |
| 264 | Ga0075367_10023235 | 3300006178 | Bacteria | 3486 |
| 265 | Ga0075367_10373781 | 3300006178 | Bacteria | 900 |
| 266 | Ga0075367_10437006 | 3300006178 | Bacteria | 829 |
| 267 | Ga0075367_10440525 | 3300006178 | Bacteria | 825 |
| 268 | Ga0075366_10165600 | 3300006195 | Bacteria | 1340 |
| 269 | Ga0075366_10243110 | 3300006195 | Bacteria | 1097 |
| 270 | Ga0075366_10837026 | 3300006195 | Bacteria | 573 |
| 271 | Ga0075366_10977563 | 3300006195 | Bacteria | 528 |
| 272 | Ga0097621_100061477 | 3300006237 | Bacteria | 3081 |
| 273 | Ga0097621_100196156 | 3300006237 | Bacteria | 1751 |
| 274 | Ga0097621_100205780 | 3300006237 | Bacteria | 1710 |
| 275 | Ga0097621_101842056 | 3300006237 | Bacteria | 577 |
| 276 | Ga0097621_101889315 | 3300006237 | Bacteria | 570 |
| 277 | Ga0075370_10362605 | 3300006353 | Bacteria | 867 |
| 278 | Ga0068871_100305229 | 3300006358 | Bacteria | 1398 |
| 279 | Ga0068871_100704021 | 3300006358 | Bacteria | 925 |
| 280 | Ga0068871_100857972 | 3300006358 | Bacteria | 840 |
| 281 | Ga0068871_100949221 | 3300006358 | Bacteria | 799 |
| 282 | Ga0075434_100452156 | 3300006871 | Bacteria | 1306 |
| 283 | Ga0075429_100897583 | 3300006880 | Bacteria | 776 |
| 284 | Ga0068865_100050924 | 3300006881 | Bacteria | 2863 |
| 285 | Ga0068865_100180232 | 3300006881 | Bacteria | 1626 |
| 286 | Ga0097620_100420422 | 3300006931 | Bacteria | 1433 |
| 287 | Ga0097620_100737365 | 3300006931 | Bacteria | 1074 |
| 288 | Ga0099825_1039359 | 3300006941 | Bacteria | 1456 |
| 289 | Ga0099824_1006683 | 3300006942 | Bacteria | 15693 |
| 290 | Ga0099822_1000418 | 3300006943 | Bacteria | 38171 |
| 291 | Ga0075435_100724066 | 3300007076 | Bacteria | 865 |
| 292 | Ga0099794_10029452 | 3300007265 | Bacteria | 2558 |
| 293 | Ga0099794_10111805 | 3300007265 | Bacteria | 1369 |
| 294 | Ga0099794_10128782 | 3300007265 | Bacteria | 1277 |
| 295 | Ga0099794_10458609 | 3300007265 | Bacteria | 669 |
| 296 | Ga0099794_10474923 | 3300007265 | Bacteria | 657 |
| 297 | Ga0099795_10080174 | 3300007788 | Bacteria | 1248 |
| 298 | Ga0099795_10096198 | 3300007788 | Bacteria | 1155 |
| 299 | Ga0099795_10128064 | 3300007788 | Bacteria | 1021 |
| 300 | Ga0099795_10308116 | 3300007788 | Bacteria | 698 |
| 301 | Ga0099795_10335215 | 3300007788 | Bacteria | 673 |
| 302 | Ga0099795_10385831 | 3300007788 | Bacteria | 633 |
| 303 | Ga0105251_10560716 | 3300009011 | Bacteria | 539 |
| 304 | Ga0105244_10421508 | 3300009036 | Bacteria | 614 |
| 305 | Ga0105250_10018383 | 3300009092 | Bacteria | 2831 |
| 306 | Ga0105240_10010878 | 3300009093 | Bacteria | 12743 |
| 307 | Ga0105240_10026626 | 3300009093 | Bacteria | 7588 |
| 308 | Ga0105240_10097500 | 3300009093 | Bacteria | 3582 |
| 309 | Ga0105240_10155163 | 3300009093 | Bacteria | 2724 |
| 310 | Ga0105240_10236739 | 3300009093 | Bacteria | 2119 |
| 311 | Ga0105240_10427922 | 3300009093 | Bacteria | 1486 |
| 312 | Ga0105240_10608267 | 3300009093 | Bacteria | 1202 |
| 313 | Ga0111539_10174814 | 3300009094 | Bacteria | 2508 |
| 314 | Ga0111539_10439612 | 3300009094 | Bacteria | 1519 |
| 315 | Ga0105245_10026065 | 3300009098 | Bacteria | 5144 |
| 316 | Ga0105245_11121040 | 3300009098 | Bacteria | 833 |
| 317 | Ga0105247_10044664 | 3300009101 | Bacteria | 2718 |
| 318 | Ga0105247_10144089 | 3300009101 | Bacteria | 1564 |
| 319 | Ga0105247_10203570 | 3300009101 | Bacteria | 1331 |
| 320 | Ga0105247_10867839 | 3300009101 | Bacteria | 694 |
| 321 | Ga0105247_11646848 | 3300009101 | Bacteria | 529 |
| 322 | Ga0105243_10059410 | 3300009148 | Bacteria | 3051 |
| 323 | Ga0105243_10659051 | 3300009148 | Bacteria | 1015 |
| 324 | Ga0105241_10000375 | 3300009174 | Bacteria | 34023 |
| 325 | Ga0105241_10237331 | 3300009174 | Bacteria | 1540 |
| 326 | Ga0105241_10565195 | 3300009174 | Bacteria | 1023 |
| 327 | Ga0105241_11255179 | 3300009174 | Bacteria | 704 |
| 328 | Ga0105242_10093388 | 3300009176 | Bacteria | 2536 |
| 329 | Ga0105242_10248578 | 3300009176 | Bacteria | 1602 |
| 330 | Ga0105242_10381833 | 3300009176 | Bacteria | 1310 |
| 331 | Ga0105242_10477824 | 3300009176 | Bacteria | 1180 |
| 332 | Ga0105242_10791971 | 3300009176 | Bacteria | 937 |
| 333 | Ga0105248_10049495 | 3300009177 | Bacteria | 4713 |
| 334 | Ga0105237_10006382 | 3300009545 | Bacteria | 13085 |
| 335 | Ga0105237_10008299 | 3300009545 | Bacteria | 11270 |
| 336 | Ga0105237_10024116 | 3300009545 | Bacteria | 6224 |
| 337 | Ga0105237_10080055 | 3300009545 | Bacteria | 3257 |
| 338 | Ga0105237_10101460 | 3300009545 | Bacteria | 2870 |
| 339 | Ga0105237_10148579 | 3300009545 | Bacteria | 2339 |
| 340 | Ga0105237_10211233 | 3300009545 | Bacteria | 1941 |
| 341 | Ga0105237_10219117 | 3300009545 | Bacteria | 1903 |
| 342 | Ga0105237_10251855 | 3300009545 | Bacteria | 1768 |
| 343 | Ga0105237_10644966 | 3300009545 | Bacteria | 1066 |
| 344 | Ga0105237_11559825 | 3300009545 | Bacteria | 667 |
| 345 | Ga0105237_11821153 | 3300009545 | Bacteria | 616 |
| 346 | Ga0105238_10000885 | 3300009551 | Bacteria | 30833 |
| 347 | Ga0105238_10005609 | 3300009551 | Bacteria | 12405 |
| 348 | Ga0105238_10006417 | 3300009551 | Bacteria | 11705 |
| 349 | Ga0105238_10091024 | 3300009551 | Bacteria | 3038 |
| 350 | Ga0105238_10620117 | 3300009551 | Bacteria | 1090 |
| 351 | Ga0105238_10982261 | 3300009551 | Bacteria | 865 |
| 352 | Ga0105238_11066667 | 3300009551 | Bacteria | 830 |
| 353 | Ga0105238_11231957 | 3300009551 | Bacteria | 773 |
| 354 | Ga0105238_11351498 | 3300009551 | Bacteria | 739 |
| 355 | Ga0105249_10079454 | 3300009553 | Bacteria | 3045 |
| 356 | Ga0105249_10682842 | 3300009553 | Bacteria | 1086 |
| 357 | Ga0105249_11678457 | 3300009553 | Bacteria | 708 |
| 358 | Ga0105249_12466770 | 3300009553 | Bacteria | 592 |
| 359 | Ga0099796_10008097 | 3300010159 | Bacteria | 2786 |
| 360 | Ga0099796_10127663 | 3300010159 | Bacteria | 983 |
| 361 | Ga0105239_10011070 | 3300010375 | Bacteria | 10068 |
| 362 | Ga0105239_10020488 | 3300010375 | Bacteria | 7294 |
| 363 | Ga0105239_10024299 | 3300010375 | Bacteria | 6674 |
| 364 | Ga0105239_10132834 | 3300010375 | Bacteria | 2770 |
| 365 | Ga0105239_10407574 | 3300010375 | Bacteria | 1539 |
| 366 | Ga0105239_10537658 | 3300010375 | Bacteria | 1330 |
| 367 | Ga0105239_10547699 | 3300010375 | Bacteria | 1317 |
| 368 | Ga0105239_10573942 | 3300010375 | Bacteria | 1285 |
| 369 | Ga0105239_10628018 | 3300010375 | Bacteria | 1226 |
| 370 | Ga0105239_10686103 | 3300010375 | Bacteria | 1171 |
| 371 | Ga0105246_10118216 | 3300011119 | Bacteria | 1960 |
| 372 | Ga0105246_10512111 | 3300011119 | Bacteria | 1021 |
| 373 | Ga0105246_10953329 | 3300011119 | Bacteria | 773 |
| 374 | Ga0105246_11725248 | 3300011119 | Bacteria | 596 |
| 375 | Ga0157337_1021823 | 3300012483 | Bacteria | 597 |
| 376 | Ga0157338_1069532 | 3300012515 | Bacteria | 547 |
| 377 | Ga0157373_10438767 | 3300013100 | Bacteria | 939 |
| 378 | Ga0157371_10080655 | 3300013102 | Bacteria | 2304 |
| 379 | Ga0157370_10163226 | 3300013104 | Bacteria | 2073 |
| 380 | Ga0157370_10231909 | 3300013104 | Bacteria | 1708 |
| 381 | Ga0157370_10270046 | 3300013104 | Bacteria | 1571 |
| 382 | Ga0157370_10441653 | 3300013104 | Bacteria | 1196 |
| 383 | Ga0157370_11983552 | 3300013104 | Bacteria | 522 |
| 384 | Ga0157369_10003699 | 3300013105 | Bacteria | 18177 |
| 385 | Ga0157369_10011122 | 3300013105 | Bacteria | 10232 |
| 386 | Ga0157369_10016823 | 3300013105 | Bacteria | 8219 |
| 387 | Ga0157369_10685838 | 3300013105 | Bacteria | 1055 |
| 388 | Ga0157369_10715551 | 3300013105 | Bacteria | 1031 |
| 389 | Ga0157374_10071289 | 3300013296 | Bacteria | 3276 |
| 390 | Ga0157374_10290805 | 3300013296 | Bacteria | 1615 |
| 391 | Ga0157374_10581877 | 3300013296 | Bacteria | 1129 |
| 392 | Ga0157378_10529471 | 3300013297 | Bacteria | 1181 |
| 393 | Ga0157378_10808792 | 3300013297 | Bacteria | 963 |
| 394 | Ga0157378_11035404 | 3300013297 | Bacteria | 856 |
| 395 | Ga0157378_13056578 | 3300013297 | Bacteria | 519 |
| 396 | Ga0163162_10104898 | 3300013306 | Bacteria | 2921 |
| 397 | Ga0163162_10132431 | 3300013306 | Bacteria | 2602 |
| 398 | Ga0163162_10195168 | 3300013306 | Bacteria | 2153 |
| 399 | Ga0163162_10355076 | 3300013306 | Bacteria | 1598 |
| 400 | Ga0163162_13197226 | 3300013306 | Bacteria | 526 |
| 401 | Ga0157372_10371500 | 3300013307 | Bacteria | 1666 |
| 402 | Ga0157372_10616929 | 3300013307 | Bacteria | 1264 |
| 403 | Ga0157372_10662518 | 3300013307 | Bacteria | 1215 |
| 404 | Ga0157372_10821001 | 3300013307 | Bacteria | 1080 |
| 405 | Ga0157372_11039526 | 3300013307 | Bacteria | 948 |
| 406 | Ga0157372_11828009 | 3300013307 | Bacteria | 699 |
| 407 | Ga0157375_10078938 | 3300013308 | Bacteria | 3326 |
| 408 | Ga0157375_10097357 | 3300013308 | Bacteria | 3016 |
| 409 | Ga0157375_10123103 | 3300013308 | Bacteria | 2706 |
| 410 | Ga0157375_12341988 | 3300013308 | Bacteria | 637 |
| 411 | Ga0157375_13145741 | 3300013308 | Bacteria | 551 |
| 412 | Ga0163163_10019375 | 3300014325 | Bacteria | 6390 |
| 413 | Ga0163163_10140744 | 3300014325 | Bacteria | 2455 |
| 414 | Ga0163163_10294331 | 3300014325 | Bacteria | 1676 |
| 415 | Ga0163163_10522793 | 3300014325 | Bacteria | 1249 |
| 416 | Ga0157380_10967694 | 3300014326 | Bacteria | 882 |
| 417 | Ga0157380_11005044 | 3300014326 | Bacteria | 868 |
| 418 | Ga0157380_12459464 | 3300014326 | Bacteria | 586 |
| 419 | Ga0182008_10151999 | 3300014497 | Bacteria | 1161 |
| 420 | Ga0182008_10447148 | 3300014497 | Bacteria | 702 |
| 421 | Ga0157379_10072179 | 3300014968 | Bacteria | 3088 |
| 422 | Ga0157379_10128607 | 3300014968 | Bacteria | 2279 |
| 423 | Ga0157379_10309838 | 3300014968 | Bacteria | 1440 |
| 424 | Ga0157379_10865094 | 3300014968 | Bacteria | 856 |
| 425 | Ga0157376_10264396 | 3300014969 | Bacteria | 1613 |
| 426 | Ga0157376_11237193 | 3300014969 | Bacteria | 775 |
| 427 | Ga0206356_10824015 | 3300020070 | Bacteria | 1604 |
| 428 | Ga0206355_1375172 | 3300020076 | Bacteria | 906 |
| 429 | Ga0206350_10271927 | 3300020080 | Bacteria | 993 |
| 430 | Ga0206354_10310108 | 3300020081 | Bacteria | 2400 |
| 431 | Ga0213873_10086560 | 3300021358 | Bacteria | 884 |
| 432 | Ga0213873_10107998 | 3300021358 | Bacteria | 806 |
| 433 | Ga0213874_10110235 | 3300021377 | Bacteria | 925 |
| 434 | Ga0213874_10138265 | 3300021377 | Bacteria | 842 |
| 435 | Ga0213876_10018891 | 3300021384 | Bacteria | 3640 |
| 436 | Ga0213876_10108795 | 3300021384 | Bacteria | 1471 |
| 437 | Ga0213876_10118908 | 3300021384 | Bacteria | 1403 |
| 438 | Ga0213876_10203730 | 3300021384 | Bacteria | 1052 |
| 439 | Ga0213876_10701295 | 3300021384 | Bacteria | 538 |
| 440 | Ga0213875_10069234 | 3300021388 | Bacteria | 1648 |
| 441 | Ga0213871_10008840 | 3300021441 | Bacteria | 2235 |
| 442 | Ga0213871_10110776 | 3300021441 | Bacteria | 811 |
| 443 | Ga0224712_10110279 | 3300022467 | Bacteria | 1179 |
| 444 | Ga0209148_1010916 | 3300025254 | Bacteria | 1704 |
| 445 | Ga0209233_1006072 | 3300025261 | Bacteria | 3931 |
| 446 | Ga0209455_1007118 | 3300025272 | Bacteria | 3200 |
| 447 | Ga0209455_1014353 | 3300025272 | Bacteria | 1795 |
| 448 | Ga0209758_1002215 | 3300025297 | Bacteria | 20262 |
| 449 | Ga0209758_1032638 | 3300025297 | Bacteria | 2108 |
| 450 | Ga0209758_1071592 | 3300025297 | Bacteria | 1088 |
| 451 | Ga0207697_10027916 | 3300025315 | Bacteria | 2307 |
| 452 | Ga0207656_10056016 | 3300025321 | Bacteria | 1717 |
| 453 | Ga0207656_10072434 | 3300025321 | Bacteria | 1534 |
| 454 | Ga0207656_10076710 | 3300025321 | Bacteria | 1495 |
| 455 | Ga0207696_1032698 | 3300025711 | Bacteria | 1564 |
| 456 | Ga0207653_10017200 | 3300025885 | Bacteria | 2274 |
| 457 | Ga0207692_10000386 | 3300025898 | Bacteria | 15209 |
| 458 | Ga0207692_10176207 | 3300025898 | Bacteria | 1243 |
| 459 | Ga0207692_10370189 | 3300025898 | Bacteria | 887 |
| 460 | Ga0207692_10769614 | 3300025898 | Bacteria | 628 |
| 461 | Ga0207642_10090211 | 3300025899 | Bacteria | 1512 |
| 462 | Ga0207642_10234165 | 3300025899 | Bacteria | 1033 |
| 463 | Ga0207710_10043541 | 3300025900 | Bacteria | 1997 |
| 464 | Ga0207710_10060054 | 3300025900 | Bacteria | 1722 |
| 465 | Ga0207710_10199320 | 3300025900 | Bacteria | 988 |
| 466 | Ga0207710_10491124 | 3300025900 | Bacteria | 636 |
| 467 | Ga0207688_10013695 | 3300025901 | Bacteria | 4408 |
| 468 | Ga0207688_10102252 | 3300025901 | Bacteria | 1656 |
| 469 | Ga0207688_10364613 | 3300025901 | Bacteria | 892 |
| 470 | Ga0207647_10015721 | 3300025904 | Bacteria | 5182 |
| 471 | Ga0207647_10251620 | 3300025904 | Bacteria | 1013 |
| 472 | Ga0207685_10002099 | 3300025905 | Bacteria | 4460 |
| 473 | Ga0207699_10000411 | 3300025906 | Bacteria | 21990 |
| 474 | Ga0207699_10003008 | 3300025906 | Bacteria | 8013 |
| 475 | Ga0207699_10072963 | 3300025906 | Bacteria | 2104 |
| 476 | Ga0207699_10243468 | 3300025906 | Bacteria | 1237 |
| 477 | Ga0207699_10482407 | 3300025906 | Bacteria | 893 |
| 478 | Ga0207699_10615968 | 3300025906 | Bacteria | 791 |
| 479 | Ga0207699_10861262 | 3300025906 | Bacteria | 668 |
| 480 | Ga0207645_10600053 | 3300025907 | Bacteria | 747 |
| 481 | Ga0207705_10049208 | 3300025909 | Bacteria | 3034 |
| 482 | Ga0207705_11462528 | 3300025909 | Bacteria | 518 |
| 483 | Ga0207684_10420975 | 3300025910 | Bacteria | 1148 |
| 484 | Ga0207684_10689409 | 3300025910 | Bacteria | 869 |
| 485 | Ga0207684_10879702 | 3300025910 | Bacteria | 754 |
| 486 | Ga0207654_10000629 | 3300025911 | Bacteria | 19897 |
| 487 | Ga0207654_10061939 | 3300025911 | Bacteria | 2190 |
| 488 | Ga0207654_10787675 | 3300025911 | Bacteria | 686 |
| 489 | Ga0207654_10853485 | 3300025911 | Bacteria | 659 |
| 490 | Ga0207707_10001473 | 3300025912 | Bacteria | 21780 |
| 491 | Ga0207707_10013690 | 3300025912 | Bacteria | 7074 |
| 492 | Ga0207707_10015990 | 3300025912 | Bacteria | 6544 |
| 493 | Ga0207707_10097004 | 3300025912 | Bacteria | 2576 |
| 494 | Ga0207707_10118392 | 3300025912 | Bacteria | 2315 |
| 495 | Ga0207707_10132231 | 3300025912 | Bacteria | 2182 |
| 496 | Ga0207707_10154042 | 3300025912 | Bacteria | 2010 |
| 497 | Ga0207707_10262126 | 3300025912 | Bacteria | 1500 |
| 498 | Ga0207695_10001265 | 3300025913 | Bacteria | 42969 |
| 499 | Ga0207695_10039200 | 3300025913 | Bacteria | 5093 |
| 500 | Ga0207695_10039689 | 3300025913 | Bacteria | 5057 |
| 501 | Ga0207695_10149556 | 3300025913 | Bacteria | 2275 |
| 502 | Ga0207695_10177166 | 3300025913 | Bacteria | 2054 |
| 503 | Ga0207695_10226999 | 3300025913 | Bacteria | 1773 |
| 504 | Ga0207671_10005731 | 3300025914 | Bacteria | 11325 |
| 505 | Ga0207671_10015794 | 3300025914 | Bacteria | 5893 |
| 506 | Ga0207671_10094235 | 3300025914 | Bacteria | 2260 |
| 507 | Ga0207671_10101843 | 3300025914 | Bacteria | 2176 |
| 508 | Ga0207671_10153115 | 3300025914 | Bacteria | 1782 |
| 509 | Ga0207671_10194177 | 3300025914 | Bacteria | 1584 |
| 510 | Ga0207671_10360592 | 3300025914 | Bacteria | 1153 |
| 511 | Ga0207671_10418282 | 3300025914 | Bacteria | 1066 |
| 512 | Ga0207671_10438451 | 3300025914 | Bacteria | 1040 |
| 513 | Ga0207671_10656257 | 3300025914 | Bacteria | 835 |
| 514 | Ga0207671_11154680 | 3300025914 | Bacteria | 607 |
| 515 | Ga0207671_11180234 | 3300025914 | Bacteria | 599 |
| 516 | Ga0207693_10003644 | 3300025915 | Bacteria | 13157 |
| 517 | Ga0207693_10039807 | 3300025915 | Bacteria | 3701 |
| 518 | Ga0207693_10092044 | 3300025915 | Bacteria | 2377 |
| 519 | Ga0207663_10000897 | 3300025916 | Bacteria | 13571 |
| 520 | Ga0207663_10010802 | 3300025916 | Bacteria | 4875 |
| 521 | Ga0207663_10053778 | 3300025916 | Bacteria | 2517 |
| 522 | Ga0207663_10154973 | 3300025916 | Bacteria | 1610 |
| 523 | Ga0207663_10171764 | 3300025916 | Bacteria | 1540 |
| 524 | Ga0207663_10694508 | 3300025916 | Bacteria | 805 |
| 525 | Ga0207660_10003205 | 3300025917 | Bacteria | 10703 |
| 526 | Ga0207660_10022034 | 3300025917 | Bacteria | 4290 |
| 527 | Ga0207660_10158340 | 3300025917 | Bacteria | 1745 |
| 528 | Ga0207660_10633529 | 3300025917 | Bacteria | 871 |
| 529 | Ga0207657_10011790 | 3300025919 | Bacteria | 8655 |
| 530 | Ga0207657_10318372 | 3300025919 | Bacteria | 1230 |
| 531 | Ga0207657_11231774 | 3300025919 | Bacteria | 568 |
| 532 | Ga0207649_10595718 | 3300025920 | Bacteria | 850 |
| 533 | Ga0207652_10006959 | 3300025921 | Bacteria | 9111 |
| 534 | Ga0207652_10012754 | 3300025921 | Bacteria | 6794 |
| 535 | Ga0207652_10038366 | 3300025921 | Bacteria | 4061 |
| 536 | Ga0207652_10129055 | 3300025921 | Bacteria | 2254 |
| 537 | Ga0207652_10325541 | 3300025921 | Bacteria | 1388 |
| 538 | Ga0207652_11025320 | 3300025921 | Bacteria | 724 |
| 539 | Ga0207646_10077709 | 3300025922 | Bacteria | 2966 |
| 540 | Ga0207646_11560447 | 3300025922 | Bacteria | 570 |
| 541 | Ga0207681_10050253 | 3300025923 | Bacteria | 2821 |
| 542 | Ga0207694_10000082 | 3300025924 | Bacteria | 109787 |
| 543 | Ga0207694_10025115 | 3300025924 | Bacteria | 4527 |
| 544 | Ga0207694_10031933 | 3300025924 | Bacteria | 4026 |
| 545 | Ga0207694_10032555 | 3300025924 | Bacteria | 3991 |
| 546 | Ga0207694_10161959 | 3300025924 | Bacteria | 1807 |
| 547 | Ga0207694_10706418 | 3300025924 | Bacteria | 850 |
| 548 | Ga0207694_11325223 | 3300025924 | Bacteria | 609 |
| 549 | Ga0207694_11390093 | 3300025924 | Bacteria | 593 |
| 550 | Ga0207650_10247985 | 3300025925 | Bacteria | 1441 |
| 551 | Ga0207687_10029908 | 3300025927 | Bacteria | 3667 |
| 552 | Ga0207687_10105185 | 3300025927 | Bacteria | 2085 |
| 553 | Ga0207687_10918961 | 3300025927 | Bacteria | 749 |
| 554 | Ga0207700_10003087 | 3300025928 | Bacteria | 9611 |
| 555 | Ga0207700_10006990 | 3300025928 | Bacteria | 6867 |
| 556 | Ga0207700_10010852 | 3300025928 | Bacteria | 5779 |
| 557 | Ga0207700_10011089 | 3300025928 | Bacteria | 5731 |
| 558 | Ga0207700_10021835 | 3300025928 | Bacteria | 4380 |
| 559 | Ga0207700_10029340 | 3300025928 | Bacteria | 3880 |
| 560 | Ga0207700_10102684 | 3300025928 | Bacteria | 2284 |
| 561 | Ga0207700_10613897 | 3300025928 | Bacteria | 968 |
| 562 | Ga0207700_10862135 | 3300025928 | Bacteria | 810 |
| 563 | Ga0207664_10004435 | 3300025929 | Bacteria | 9504 |
| 564 | Ga0207664_10070887 | 3300025929 | Bacteria | 2806 |
| 565 | Ga0207664_10140973 | 3300025929 | Bacteria | 2039 |
| 566 | Ga0207664_10271666 | 3300025929 | Bacteria | 1485 |
| 567 | Ga0207664_10553805 | 3300025929 | Bacteria | 1032 |
| 568 | Ga0207664_10705276 | 3300025929 | Bacteria | 907 |
| 569 | Ga0207664_11206854 | 3300025929 | Bacteria | 675 |
| 570 | Ga0207690_10945993 | 3300025932 | Bacteria | 716 |
| 571 | Ga0207706_10080562 | 3300025933 | Bacteria | 2863 |
| 572 | Ga0207706_10098139 | 3300025933 | Bacteria | 2577 |
| 573 | Ga0207706_10171143 | 3300025933 | Bacteria | 1908 |
| 574 | Ga0207706_10460652 | 3300025933 | Bacteria | 1099 |
| 575 | Ga0207686_10065126 | 3300025934 | Bacteria | 2323 |
| 576 | Ga0207686_10675169 | 3300025934 | Bacteria | 819 |
| 577 | Ga0207709_10065212 | 3300025935 | Bacteria | 2289 |
| 578 | Ga0207709_10471578 | 3300025935 | Bacteria | 974 |
| 579 | Ga0207670_10187476 | 3300025936 | Bacteria | 1563 |
| 580 | Ga0207670_10771539 | 3300025936 | Bacteria | 800 |
| 581 | Ga0207669_10032231 | 3300025937 | Bacteria | 2940 |
| 582 | Ga0207669_10579773 | 3300025937 | Bacteria | 909 |
| 583 | Ga0207669_10719273 | 3300025937 | Bacteria | 822 |
| 584 | Ga0207704_10330524 | 3300025938 | Bacteria | 1179 |
| 585 | Ga0207665_10001244 | 3300025939 | Bacteria | 17182 |
| 586 | Ga0207665_10003077 | 3300025939 | Bacteria | 11195 |
| 587 | Ga0207665_10129259 | 3300025939 | Bacteria | 1791 |
| 588 | Ga0207665_10287312 | 3300025939 | Bacteria | 1226 |
| 589 | Ga0207665_10689963 | 3300025939 | Bacteria | 802 |
| 590 | Ga0207691_10273607 | 3300025940 | Bacteria | 1454 |
| 591 | Ga0207691_10610493 | 3300025940 | Bacteria | 923 |
| 592 | Ga0207711_10468581 | 3300025941 | Bacteria | 1173 |
| 593 | Ga0207711_10501381 | 3300025941 | Bacteria | 1131 |
| 594 | Ga0207661_10003495 | 3300025944 | Bacteria | 10912 |
| 595 | Ga0207661_10010884 | 3300025944 | Bacteria | 6566 |
| 596 | Ga0207661_10100708 | 3300025944 | Bacteria | 2425 |
| 597 | Ga0207661_10956302 | 3300025944 | Bacteria | 789 |
| 598 | Ga0207679_10461889 | 3300025945 | Bacteria | 1127 |
| 599 | Ga0207667_10006677 | 3300025949 | Bacteria | 13949 |
| 600 | Ga0207667_10008474 | 3300025949 | Bacteria | 12209 |
| 601 | Ga0207667_10009542 | 3300025949 | Bacteria | 11419 |
| 602 | Ga0207667_10109324 | 3300025949 | Bacteria | 2851 |
| 603 | Ga0207667_10120372 | 3300025949 | Bacteria | 2705 |
| 604 | Ga0207667_10261496 | 3300025949 | Bacteria | 1770 |
| 605 | Ga0207667_10324817 | 3300025949 | Bacteria | 1571 |
| 606 | Ga0207667_10513264 | 3300025949 | Bacteria | 1215 |
| 607 | Ga0207667_10557116 | 3300025949 | Bacteria | 1159 |
| 608 | Ga0207667_10559959 | 3300025949 | Bacteria | 1156 |
| 609 | Ga0207667_11554073 | 3300025949 | Bacteria | 631 |
| 610 | Ga0207651_10284249 | 3300025960 | Bacteria | 1369 |
| 611 | Ga0207651_10297316 | 3300025960 | Bacteria | 1341 |
| 612 | Ga0207712_10534468 | 3300025961 | Bacteria | 1006 |
| 613 | Ga0207712_10654023 | 3300025961 | Bacteria | 914 |
| 614 | Ga0207712_11556679 | 3300025961 | Bacteria | 592 |
| 615 | Ga0207668_10062419 | 3300025972 | Bacteria | 2623 |
| 616 | Ga0207668_10377764 | 3300025972 | Bacteria | 1192 |
| 617 | Ga0207668_10405016 | 3300025972 | Bacteria | 1154 |
| 618 | Ga0207640_10023703 | 3300025981 | Bacteria | 3692 |
| 619 | Ga0207640_10956990 | 3300025981 | Bacteria | 751 |
| 620 | Ga0207640_11103959 | 3300025981 | Bacteria | 702 |
| 621 | Ga0207658_10453227 | 3300025986 | Bacteria | 1136 |
| 622 | Ga0207658_10643294 | 3300025986 | Bacteria | 955 |
| 623 | Ga0207658_11865055 | 3300025986 | Bacteria | 548 |
| 624 | Ga0207677_10196330 | 3300026023 | Bacteria | 1600 |
| 625 | Ga0207677_10323936 | 3300026023 | Bacteria | 1282 |
| 626 | Ga0207703_10155612 | 3300026035 | Bacteria | 1997 |
| 627 | Ga0207703_10201766 | 3300026035 | Bacteria | 1768 |
| 628 | Ga0207703_10306009 | 3300026035 | Bacteria | 1451 |
| 629 | Ga0207703_10401115 | 3300026035 | Bacteria | 1272 |
| 630 | Ga0207703_11665711 | 3300026035 | Bacteria | 614 |
| 631 | Ga0207703_12296747 | 3300026035 | Bacteria | 515 |
| 632 | Ga0207639_10003792 | 3300026041 | Bacteria | 10175 |
| 633 | Ga0207639_10171290 | 3300026041 | Bacteria | 1839 |
| 634 | Ga0207639_10183444 | 3300026041 | Bacteria | 1782 |
| 635 | Ga0207639_10443502 | 3300026041 | Bacteria | 1177 |
| 636 | Ga0207639_10465134 | 3300026041 | Bacteria | 1150 |
| 637 | Ga0207639_10651857 | 3300026041 | Bacteria | 974 |
| 638 | Ga0207639_11205679 | 3300026041 | Bacteria | 710 |
| 639 | Ga0207639_11437911 | 3300026041 | Bacteria | 647 |
| 640 | Ga0207678_10113995 | 3300026067 | Bacteria | 2306 |
| 641 | Ga0207678_10200272 | 3300026067 | Bacteria | 1707 |
| 642 | Ga0207678_10219791 | 3300026067 | Bacteria | 1626 |
| 643 | Ga0207678_10322042 | 3300026067 | Bacteria | 1330 |
| 644 | Ga0207708_10104541 | 3300026075 | Bacteria | 2194 |
| 645 | Ga0207708_10175317 | 3300026075 | Bacteria | 1700 |
| 646 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 647 | Ga0207702_10000478 | 3300026078 | Bacteria | 44978 |
| 648 | Ga0207702_10061546 | 3300026078 | Bacteria | 3202 |
| 649 | Ga0207702_10195697 | 3300026078 | Bacteria | 1871 |
| 650 | Ga0207702_10391416 | 3300026078 | Bacteria | 1338 |
| 651 | Ga0207702_10990687 | 3300026078 | Bacteria | 834 |
| 652 | Ga0207702_11263645 | 3300026078 | Bacteria | 732 |
| 653 | Ga0207641_10896810 | 3300026088 | Bacteria | 880 |
| 654 | Ga0207641_11050143 | 3300026088 | Bacteria | 812 |
| 655 | Ga0207648_10021511 | 3300026089 | Bacteria | 5798 |
| 656 | Ga0207648_10995497 | 3300026089 | Bacteria | 785 |
| 657 | Ga0207676_10089392 | 3300026095 | Bacteria | 2524 |
| 658 | Ga0207676_10116170 | 3300026095 | Bacteria | 2248 |
| 659 | Ga0207676_10849018 | 3300026095 | Bacteria | 893 |
| 660 | Ga0207676_12492721 | 3300026095 | Bacteria | 514 |
| 661 | Ga0207674_10007536 | 3300026116 | Bacteria | 12680 |
| 662 | Ga0207674_10011165 | 3300026116 | Bacteria | 10100 |
| 663 | Ga0207674_10028212 | 3300026116 | Bacteria | 5927 |
| 664 | Ga0207674_10034482 | 3300026116 | Bacteria | 5290 |
| 665 | Ga0207674_10103770 | 3300026116 | Bacteria | 2822 |
| 666 | Ga0207674_10648307 | 3300026116 | Bacteria | 1020 |
| 667 | Ga0207675_100404646 | 3300026118 | Bacteria | 1345 |
| 668 | Ga0207675_101322776 | 3300026118 | Bacteria | 741 |
| 669 | Ga0207683_10104603 | 3300026121 | Bacteria | 2530 |
| 670 | Ga0207683_10198179 | 3300026121 | Bacteria | 1825 |
| 671 | Ga0207683_10365184 | 3300026121 | Bacteria | 1326 |
| 672 | Ga0207683_10783150 | 3300026121 | Bacteria | 885 |
| 673 | Ga0207683_10960871 | 3300026121 | Bacteria | 793 |
| 674 | Ga0207698_10122325 | 3300026142 | Bacteria | 2205 |
| 675 | Ga0207698_10225106 | 3300026142 | Bacteria | 1698 |
| 676 | Ga0207698_10417946 | 3300026142 | Bacteria | 1286 |
| 677 | Ga0207698_10505617 | 3300026142 | Bacteria | 1177 |
| 678 | Ga0207698_10535508 | 3300026142 | Bacteria | 1145 |
| 679 | Ga0207698_10777761 | 3300026142 | Bacteria | 958 |
| 680 | Ga0207698_10909777 | 3300026142 | Bacteria | 887 |
| 681 | Ga0209589_1000003 | 3300027357 | Bacteria | 629130 |
| 682 | Ga0209489_100003 | 3300027361 | Bacteria | 663105 |
| 683 | Ga0209700_100003 | 3300027363 | Bacteria | 663105 |
| 684 | Ga0209179_1033288 | 3300027512 | Bacteria | 1065 |
| 685 | Ga0209179_1067049 | 3300027512 | Bacteria | 783 |
| 686 | Ga0209179_1089564 | 3300027512 | Bacteria | 682 |
| 687 | Ga0209179_1133571 | 3300027512 | Bacteria | 555 |
| 688 | Ga0209588_1023809 | 3300027671 | Bacteria | 1932 |
| 689 | Ga0209813_10177077 | 3300027866 | Bacteria | 778 |
| 690 | Ga0268266_10162678 | 3300028379 | Bacteria | 2020 |
| 691 | Ga0268266_10215025 | 3300028379 | Bacteria | 1764 |
| 692 | Ga0268266_10264045 | 3300028379 | Bacteria | 1596 |
| 693 | Ga0268266_10726009 | 3300028379 | Bacteria | 958 |
| 694 | Ga0268266_10744311 | 3300028379 | Bacteria | 946 |
| 695 | Ga0268266_11606005 | 3300028379 | Bacteria | 626 |
| 696 | Ga0268266_11809873 | 3300028379 | Bacteria | 585 |
| 697 | Ga0268265_10517250 | 3300028380 | Bacteria | 1127 |
| 698 | Ga0268265_10587354 | 3300028380 | Bacteria | 1062 |
| 699 | Ga0268265_10701635 | 3300028380 | Bacteria | 978 |
| 700 | Ga0268264_10000043 | 3300028381 | Bacteria | 371761 |
| 701 | Ga0268264_10497575 | 3300028381 | Bacteria | 1188 |
| 702 | Ga0265337_1018947 | 3300028556 | Bacteria | 2177 |
| 703 | Ga0265319_1012285 | 3300028563 | Bacteria | 3469 |
| 704 | Ga0265334_10023180 | 3300028573 | Bacteria | 2525 |
| 705 | Ga0265334_10086784 | 3300028573 | Bacteria | 1146 |
| 706 | Ga0265318_10003124 | 3300028577 | Bacteria | 8474 |
| 707 | Ga0265323_10001316 | 3300028653 | Bacteria | 12360 |
| 708 | Ga0265322_10003976 | 3300028654 | Bacteria | 4428 |
| 709 | Ga0265336_10000579 | 3300028666 | Bacteria | 20640 |
| 710 | Ga0307517_10215992 | 3300028786 | Bacteria | 1173 |
| 711 | Ga0307515_10055010 | 3300028794 | Bacteria | 5827 |
| 712 | Ga0265338_10001398 | 3300028800 | Bacteria | 39299 |
| 713 | Ga0265324_10010613 | 3300029957 | Bacteria | 3543 |
| 714 | Ga0307511_10101511 | 3300030521 | Bacteria | 1885 |
| 715 | Ga0307511_10119276 | 3300030521 | Bacteria | 1640 |
| 716 | Ga0265762_1068277 | 3300030760 | Bacteria | 742 |
| 717 | Ga0265763_1017816 | 3300030763 | Bacteria | 723 |
| 718 | Ga0265770_1083041 | 3300030878 | Bacteria | 629 |
| 719 | Ga0265330_10021534 | 3300031235 | Bacteria | 2940 |
| 720 | Ga0265330_10029380 | 3300031235 | Bacteria | 2473 |
| 721 | Ga0265332_10043626 | 3300031238 | Bacteria | 1936 |
| 722 | Ga0265332_10087499 | 3300031238 | Bacteria | 1319 |
| 723 | Ga0265325_10029462 | 3300031241 | Bacteria | 2950 |
| 724 | Ga0265340_10002366 | 3300031247 | Bacteria | 10731 |
| 725 | Ga0265339_10009369 | 3300031249 | Bacteria | 6160 |
| 726 | Ga0265339_10019907 | 3300031249 | Bacteria | 3929 |
| 727 | Ga0265339_10119706 | 3300031249 | Bacteria | 1355 |
| 728 | Ga0265339_10325624 | 3300031249 | Bacteria | 728 |
| 729 | Ga0265339_10539454 | 3300031249 | Bacteria | 537 |
| 730 | Ga0265331_10038825 | 3300031250 | Bacteria | 2325 |
| 731 | Ga0265331_10112707 | 3300031250 | Bacteria | 1247 |
| 732 | Ga0265316_10090463 | 3300031344 | Bacteria | 2335 |
| 733 | Ga0265316_10182294 | 3300031344 | Bacteria | 1563 |
| 734 | Ga0307513_10462563 | 3300031456 | Bacteria | 991 |
| 735 | Ga0307513_10547481 | 3300031456 | Bacteria | 870 |
| 736 | Ga0307513_11044200 | 3300031456 | Bacteria | 528 |
| 737 | Ga0307509_10224089 | 3300031507 | Bacteria | 1689 |
| 738 | Ga0307509_10233876 | 3300031507 | Bacteria | 1637 |
| 739 | Ga0307509_10264488 | 3300031507 | Bacteria | 1492 |
| 740 | Ga0307509_10510776 | 3300031507 | Bacteria | 884 |
| 741 | Ga0307509_10744184 | 3300031507 | Bacteria | 646 |
| 742 | Ga0307408_100878894 | 3300031548 | Bacteria | 819 |
| 743 | Ga0265313_10126662 | 3300031595 | Bacteria | 1110 |
| 744 | Ga0265313_10284172 | 3300031595 | Bacteria | 668 |
| 745 | Ga0307508_10001059 | 3300031616 | Bacteria | 31801 |
| 746 | Ga0307508_10007228 | 3300031616 | Bacteria | 10340 |
| 747 | Ga0307508_10060565 | 3300031616 | Bacteria | 3346 |
| 748 | Ga0307508_10351820 | 3300031616 | Bacteria | 1065 |
| 749 | Ga0265314_10008943 | 3300031711 | Bacteria | 8530 |
| 750 | Ga0265342_10002731 | 3300031712 | Bacteria | 15016 |
| 751 | Ga0265342_10031442 | 3300031712 | Bacteria | 3282 |
| 752 | Ga0265342_10216379 | 3300031712 | Bacteria | 1034 |
| 753 | Ga0307516_10015493 | 3300031730 | Bacteria | 8019 |
| 754 | Ga0307516_10063699 | 3300031730 | Bacteria | 3568 |
| 755 | Ga0307516_10096643 | 3300031730 | Bacteria | 2774 |
| 756 | Ga0307516_10135644 | 3300031730 | Bacteria | 2236 |
| 757 | Ga0307516_10145136 | 3300031730 | Bacteria | 2139 |
| 758 | Ga0307516_10152987 | 3300031730 | Bacteria | 2065 |
| 759 | Ga0307516_10176035 | 3300031730 | Bacteria | 1876 |
| 760 | Ga0307516_10252540 | 3300031730 | Bacteria | 1457 |
| 761 | Ga0307516_10547677 | 3300031730 | Bacteria | 811 |
| 762 | Ga0307405_10745487 | 3300031731 | Bacteria | 815 |
| 763 | Ga0307406_10829845 | 3300031901 | Bacteria | 782 |
| 764 | Ga0307412_10235492 | 3300031911 | Bacteria | 1413 |
| 765 | Ga0307409_100308665 | 3300031995 | Bacteria | 1475 |
| 766 | Ga0307409_101601930 | 3300031995 | Bacteria | 679 |
| 767 | Ga0307416_100901219 | 3300032002 | Bacteria | 984 |
| 768 | Ga0307416_100987456 | 3300032002 | Bacteria | 945 |
| 769 | Ga0307414_10389249 | 3300032004 | Bacteria | 1208 |
| 770 | Ga0307411_11280264 | 3300032005 | Bacteria | 667 |
| 771 | Ga0307415_100980503 | 3300032126 | Bacteria | 784 |
| 772 | Ga0307507_10088859 | 3300033179 | Bacteria | 2663 |
| 773 | Ga0307510_10010241 | 3300033180 | Bacteria | 11147 |
| 774 | Ga0307510_10019329 | 3300033180 | Bacteria | 7992 |
| 775 | Ga0307510_10109337 | 3300033180 | Bacteria | 2514 |
| 776 | Ga0307510_10230706 | 3300033180 | Bacteria | 1354 |
| 777 | Ga0307510_10340909 | 3300033180 | Bacteria | 951 |
| 778 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 779 | Ga0316215_1000526 | 3300033544 | Bacteria | 4216 |
| 780 | Ga0373926_0003514 | 3300035083 | Bacteria | 5070 |
| 781 | Ga0373928_0002944 | 3300035084 | Bacteria | 3282 |
| 782 | Ga0373929_0198895 | 3300035085 | Bacteria | 561 |
| 783 | Ga0373934_0012801 | 3300035086 | Bacteria | 3169 |
| 784 | Ga0373934_0018581 | 3300035086 | Bacteria | 2661 |
| 785 | Ga0373934_0278486 | 3300035086 | Bacteria | 693 |
| 786 | Ga0373940_0114722 | 3300035088 | Bacteria | 830 |
| 787 | Ga0373944_0200611 | 3300035089 | Bacteria | 722 |
| 788 | Ga0373949_0310641 | 3300035090 | Bacteria | 503 |
| 789 | Ga0373952_0180603 | 3300035092 | Bacteria | 608 |
| 790 | Ga0373923_0001405 | 3300035111 | Bacteria | 6867 |
| 791 | Ga0373923_0033984 | 3300035111 | Bacteria | 2067 |
| 792 | Ga0373932_0113753 | 3300035112 | Bacteria | 895 |
| 793 | Ga0373936_0011153 | 3300035113 | Bacteria | 3396 |
| 794 | Ga0373936_0014114 | 3300035113 | Bacteria | 3052 |
| 795 | Ga0373936_0021286 | 3300035113 | Bacteria | 2521 |
| 796 | Ga0373936_0255164 | 3300035113 | Bacteria | 784 |
| 797 | Ga0373941_0177706 | 3300035115 | Bacteria | 797 |
| 798 | Ga0373953_0001516 | 3300035117 | Bacteria | 6744 |
| 799 | Ga0373953_0042708 | 3300035117 | Bacteria | 1808 |
| 800 | Ga0373953_0046928 | 3300035117 | Bacteria | 1736 |
| 801 | Ga0373953_0135714 | 3300035117 | Bacteria | 1051 |
| 802 | Ga0373953_0178273 | 3300035117 | Bacteria | 916 |
| 803 | Ga0373953_0267192 | 3300035117 | Bacteria | 745 |
| 804 | Ga0373954_0000132 | 3300035118 | Bacteria | 25640 |
| 805 | Ga0373954_0012512 | 3300035118 | Bacteria | 3773 |
| 806 | Ga0373954_0120546 | 3300035118 | Bacteria | 1273 |
| 807 | Ga0373954_0165687 | 3300035118 | Bacteria | 1082 |
| 808 | Ga0373956_0041475 | 3300035119 | Bacteria | 2043 |
| 809 | Ga0373956_0417455 | 3300035119 | Bacteria | 640 |
| 810 | Ga0373957_0000168 | 3300035120 | Bacteria | 16641 |
| 811 | Ga0373957_0024164 | 3300035120 | Bacteria | 2180 |
| 812 | Ga0373957_0115560 | 3300035120 | Bacteria | 1083 |
| 813 | Ga0373960_0116131 | 3300035121 | Bacteria | 884 |
| 814 | Ga0373960_0347968 | 3300035121 | Bacteria | 561 |
| 815 | Ga0373943_0033585 | 3300035170 | Bacteria | 2445 |
| 816 | Ga0373943_0053207 | 3300035170 | Bacteria | 1998 |
| 817 | Ga0373943_0121474 | 3300035170 | Bacteria | 1388 |
| 818 | Ga0373943_0407583 | 3300035170 | Bacteria | 785 |
| 819 | Ga0373946_0003228 | 3300035171 | Bacteria | 5789 |
| 820 | Ga0373946_0074634 | 3300035171 | Bacteria | 1472 |
| 821 | Ga0373946_0078850 | 3300035171 | Bacteria | 1438 |
| 822 | Ga0373955_0001612 | 3300035172 | Bacteria | 9670 |
| 823 | Ga0373955_0007649 | 3300035172 | Bacteria | 4978 |
| 824 | Ga0373955_0055600 | 3300035172 | Bacteria | 2168 |
| 825 | Ga0373955_0304498 | 3300035172 | Bacteria | 961 |
| 826 | Ga0373942_0008063 | 3300035207 | Bacteria | 2450 |
| 827 | Ga0373962_0303142 | 3300035242 | Bacteria | 567 |
| 828 | Ga0373924_0006263 | 3300035410 | Bacteria | 4256 |
| 829 | Ga0373924_0017596 | 3300035410 | Bacteria | 2744 |
| 830 | Ga0373924_0047743 | 3300035410 | Bacteria | 1767 |
| 831 | Ga0373924_0203407 | 3300035410 | Bacteria | 874 |
| 832 | Ga0373931_0004299 | 3300035691 | Bacteria | 6490 |
| 833 | Ga0373931_0063897 | 3300035691 | Bacteria | 1991 |
| 834 | Ga0373935_0000435 | 3300035692 | Bacteria | 21766 |
| 835 | Ga0373935_0019538 | 3300035692 | Bacteria | 4132 |
| 836 | Ga0373935_0391622 | 3300035692 | Bacteria | 996 |
| 837 | Ga0373935_0585129 | 3300035692 | Bacteria | 815 |
| 838 | Ga0373935_0770135 | 3300035692 | Bacteria | 710 |
| 839 | Ga0373927_0002587 | 3300035695 | Bacteria | 13194 |
| 840 | Ga0373927_0008673 | 3300035695 | Bacteria | 6833 |
| 841 | Ga0373927_0010027 | 3300035695 | Bacteria | 6346 |
| 842 | Ga0373927_0027124 | 3300035695 | Bacteria | 3742 |
| 843 | Ga0373927_0106796 | 3300035695 | Bacteria | 1823 |
| 844 | Ga0373927_0462735 | 3300035695 | Bacteria | 838 |
| 845 | Ga0373927_0493178 | 3300035695 | Bacteria | 809 |
| 846 | Ga0373927_0575714 | 3300035695 | Bacteria | 744 |
| 847 | Ga0373927_0661197 | 3300035695 | Bacteria | 690 |
| 848 | Ga0373927_0832459 | 3300035695 | Bacteria | 609 |
| 849 | Ga0373933_0000243 | 3300035724 | Bacteria | 35861 |
| 850 | Ga0373933_0069361 | 3300035724 | Bacteria | 2143 |
| 851 | Ga0373933_0218792 | 3300035724 | Bacteria | 1221 |
| 852 | Ga0373947_0007586 | 3300035725 | Bacteria | 6278 |
| 853 | Ga0373947_0012060 | 3300035725 | Bacteria | 4949 |
| 854 | Ga0373947_0024670 | 3300035725 | Bacteria | 3505 |
| 855 | Ga0373947_0038731 | 3300035725 | Bacteria | 2834 |
| 856 | Ga0373947_0186019 | 3300035725 | Bacteria | 1354 |
| 857 | Ga0373947_0355932 | 3300035725 | Bacteria | 983 |
| 858 | Ga0373947_0436874 | 3300035725 | Bacteria | 886 |
| 859 | Ga0373947_0608518 | 3300035725 | Bacteria | 745 |
| 860 | Ga0373947_1198408 | 3300035725 | Bacteria | 517 |
| 861 | Ga0373937_0039688 | 3300036401 | Bacteria | 4290 |
| 862 | Ga0373937_0196956 | 3300036401 | Bacteria | 1893 |
| 863 | Ga0373937_0244436 | 3300036401 | Bacteria | 1691 |
| 864 | Ga0373937_0667895 | 3300036401 | Bacteria | 985 |
| 865 | Ga0373937_0728048 | 3300036401 | Bacteria | 939 |
| 866 | Ga0310109_054355 | 3300036534 | Bacteria | 514 |
| 867 | Ga0373925_0001774 | 3300037068 | Bacteria | 18013 |
| 868 | Ga0373925_0045958 | 3300037068 | Bacteria | 3245 |
| 869 | Ga0373925_0054102 | 3300037068 | Bacteria | 3001 |
| 870 | Ga0373925_0067551 | 3300037068 | Bacteria | 2697 |
| 871 | Ga0373925_0483407 | 3300037068 | Bacteria | 1016 |
| 872 | Ga0373925_0593208 | 3300037068 | Bacteria | 912 |
| 873 | Ga0373925_0807177 | 3300037068 | Bacteria | 774 |
| 874 | Ga0373925_0943314 | 3300037068 | Bacteria | 711 |
| 875 | Ga0395900_0072533 | 3300037418 | Bacteria | 3540 |
| 876 | Ga0395900_0809546 | 3300037418 | Bacteria | 864 |
| 877 | Ga0395898_1678239 | 3300037466 | Bacteria | 558 |
| 878 | Ga0395905_0022828 | 3300037471 | Bacteria | 5915 |
| 879 | Ga0395905_1235047 | 3300037471 | Bacteria | 651 |
| 880 | Ga0436364_0235897 | 3300037853 | Bacteria | 1865 |
| 881 | Ga0436364_0740920 | 3300037853 | Bacteria | 1150 |
| 882 | Ga0436364_1140579 | 3300037853 | Bacteria | 2910 |
| 883 | Ga0395901_0797843 | 3300038443 | Bacteria | 933 |
| 884 | Ga0395901_0997229 | 3300038443 | Bacteria | 814 |
| 885 | Ga0436365_0090210 | 3300039437 | Bacteria | 695 |
| 886 | Ga0436365_0136317 | 3300039437 | Bacteria | 1400 |
| 887 | Ga0436365_0186711 | 3300039437 | Bacteria | 9695 |
| 888 | Ga0436365_0482256 | 3300039437 | Bacteria | 5841 |
| 889 | Ga0436365_0948552 | 3300039437 | Bacteria | 536 |
| 890 | Ga0436365_0996952 | 3300039437 | Bacteria | 554 |
| 891 | Ga0436365_1250872 | 3300039437 | Bacteria | 1039 |
| 892 | Ga0436365_1444108 | 3300039437 | Bacteria | 949 |
| 893 | Ga0436365_1455192 | 3300039437 | Bacteria | 969 |
| 894 | Ga0436365_1458230 | 3300039437 | Bacteria | 513 |
| 895 | Ga0436360_0485622 | 3300039438 | Bacteria | 4101 |
| 896 | Ga0436360_0577390 | 3300039438 | Bacteria | 611 |
| 897 | Ga0436360_0979855 | 3300039438 | Bacteria | 1072 |
| 898 | Ga0436360_1055908 | 3300039438 | Bacteria | 610 |
| 899 | Ga0436360_1355672 | 3300039438 | Bacteria | 1307 |
| 900 | Ga0436361_0350312 | 3300039447 | Bacteria | 1229 |
| 901 | Ga0436361_0886899 | 3300039447 | Bacteria | 1688 |
| 902 | Ga0436361_0915746 | 3300039447 | Bacteria | 1009 |
| 903 | Ga0436361_0924062 | 3300039447 | Bacteria | 1326 |
| 904 | Ga0436361_1001085 | 3300039447 | Bacteria | 1420 |
| 905 | Ga0436361_1175390 | 3300039447 | Bacteria | 638 |
| 906 | Ga0436363_1278748 | 3300039450 | Bacteria | 680 |
| 907 | Ga0436363_1347498 | 3300039450 | Bacteria | 5320 |
| 908 | Ga0436362_0377775 | 3300039453 | Bacteria | 2257 |
| 909 | Ga0436362_0382758 | 3300039453 | Bacteria | 507 |
| 910 | Ga0436362_0610597 | 3300039453 | Bacteria | 1147 |
| 911 | Ga0436362_1238292 | 3300039453 | Bacteria | 1159 |
| 912 | Ga0439465_0103614 | 3300041413 | Bacteria | 984 |
| 913 | Ga0451791_1702097 | 3300041451 | Bacteria | 938 |
| 914 | Ga0451793_0207987 | 3300041452 | Bacteria | 1263 |
| 915 | Ga0451797_1118947 | 3300041453 | Bacteria | 674 |
| 916 | Ga0451795_0620610 | 3300041456 | Bacteria | 732 |
| 917 | Ga0451798_0117060 | 3300041458 | Bacteria | 1076 |
| 918 | Ga0451800_1531708 | 3300041459 | Bacteria | 694 |
| 919 | Ga0451802_1867047 | 3300041460 | Bacteria | 552 |
| 920 | Ga0451807_0039385 | 3300041486 | Bacteria | 607 |
| 921 | Ga0451807_1920733 | 3300041486 | Bacteria | 629 |
| 922 | Ga0451841_1263376 | 3300041498 | Bacteria | 612 |
| 923 | Ga0451851_0996538 | 3300041507 | Bacteria | 696 |
| 924 | Ga0451855_0429867 | 3300041511 | Bacteria | 608 |
| 925 | Ga0451853_3357421 | 3300041512 | Bacteria | 690 |
| 926 | Ga0451853_3867451 | 3300041512 | Bacteria | 870 |
| 927 | Ga0466966_0094483 | 3300044684 | Bacteria | 1853 |
| 928 | Ga0466966_0099429 | 3300044684 | Bacteria | 1800 |
| 929 | Ga0466961_0898865 | 3300044693 | Bacteria | 527 |
| 930 | Ga0466963_0306964 | 3300044694 | Bacteria | 1116 |
| 931 | Ga0466963_0362647 | 3300044694 | Bacteria | 1021 |
| 932 | Ga0466963_0915584 | 3300044694 | Bacteria | 618 |
| 933 | Ga0466964_0096969 | 3300044706 | Bacteria | 1293 |
| 934 | Ga0466971_0147944 | 3300044719 | Bacteria | 1096 |
| 935 | Ga0466968_0284005 | 3300044735 | Bacteria | 793 |
| 936 | Ga0466970_0086575 | 3300044765 | Bacteria | 1698 |
| 937 | Ga0466957_0297805 | 3300044842 | Bacteria | 1083 |
| 938 | Ga0466957_0407907 | 3300044842 | Bacteria | 930 |
| 939 | Ga0466957_1375010 | 3300044842 | Bacteria | 513 |
| 940 | Ga0466959_0011001 | 3300045049 | Bacteria | 6494 |
| 941 | Ga0466967_0093443 | 3300045976 | Bacteria | 2737 |
| 942 | Ga0466967_0139617 | 3300045976 | Bacteria | 2256 |
| 943 | Ga0466967_0154900 | 3300045976 | Bacteria | 2145 |
| 944 | Ga0466967_0272497 | 3300045976 | Bacteria | 1622 |
| 945 | Ga0466967_1731067 | 3300045976 | Bacteria | 622 |
| 946 | Ga0466967_2361388 | 3300045976 | Bacteria | 527 |
| 947 | Ga0495617_175702 | 3300046452 | Bacteria | 675 |
| 948 | Ga0495627_162677 | 3300046453 | Bacteria | 621 |
| 949 | Ga0495592_0000316 | 3300046454 | Bacteria | 40498 |
| 950 | Ga0495592_0047468 | 3300046454 | Bacteria | 3198 |
| 951 | Ga0495592_0049440 | 3300046454 | Bacteria | 3126 |
| 952 | Ga0495592_0181288 | 3300046454 | Bacteria | 1434 |
| 953 | Ga0495603_0001446 | 3300046455 | Bacteria | 13824 |
| 954 | Ga0495603_0022841 | 3300046455 | Bacteria | 3785 |
| 955 | Ga0495603_0048318 | 3300046455 | Bacteria | 2533 |
| 956 | Ga0495603_0145569 | 3300046455 | Bacteria | 1377 |
| 957 | Ga0495603_0195978 | 3300046455 | Bacteria | 1168 |
| 958 | Ga0495603_0501199 | 3300046455 | Bacteria | 695 |
| 959 | Ga0495629_0000176 | 3300046459 | Bacteria | 56922 |
| 960 | Ga0495629_0008069 | 3300046459 | Bacteria | 7750 |
| 961 | Ga0495629_0115694 | 3300046459 | Bacteria | 1869 |
| 962 | Ga0495638_0161606 | 3300046460 | Bacteria | 1292 |
| 963 | Ga0495638_0167148 | 3300046460 | Bacteria | 1264 |
| 964 | Ga0495641_0007242 | 3300046461 | Bacteria | 6978 |
| 965 | Ga0495641_0246112 | 3300046461 | Bacteria | 804 |
| 966 | Ga0495651_0002336 | 3300046462 | Bacteria | 14646 |
| 967 | Ga0495651_0034663 | 3300046462 | Bacteria | 3934 |
| 968 | Ga0495651_0036289 | 3300046462 | Bacteria | 3837 |
| 969 | Ga0495651_0133363 | 3300046462 | Bacteria | 1811 |
| 970 | Ga0495653_0002333 | 3300046463 | Bacteria | 15062 |
| 971 | Ga0495653_0048677 | 3300046463 | Bacteria | 3271 |
| 972 | Ga0495653_0677016 | 3300046463 | Bacteria | 628 |
| 973 | Ga0495650_0114507 | 3300046471 | Bacteria | 998 |
| 974 | Ga0495580_0001310 | 3300046472 | Bacteria | 21988 |
| 975 | Ga0495580_0026506 | 3300046472 | Bacteria | 4225 |
| 976 | Ga0495580_0241022 | 3300046472 | Bacteria | 1240 |
| 977 | Ga0495580_0433341 | 3300046472 | Bacteria | 883 |
| 978 | Ga0495582_0000545 | 3300046473 | Bacteria | 20797 |
| 979 | Ga0495582_0019184 | 3300046473 | Bacteria | 3741 |
| 980 | Ga0495582_0325338 | 3300046473 | Bacteria | 885 |
| 981 | Ga0495605_0328411 | 3300046474 | Bacteria | 644 |
| 982 | Ga0495639_0010592 | 3300046475 | Bacteria | 3970 |
| 983 | Ga0495639_0089834 | 3300046475 | Bacteria | 1440 |
| 984 | Ga0495639_0103776 | 3300046475 | Bacteria | 1344 |
| 985 | Ga0495639_0272352 | 3300046475 | Bacteria | 840 |
| 986 | Ga0495662_0003999 | 3300046476 | Bacteria | 7428 |
| 987 | Ga0495662_0171896 | 3300046476 | Bacteria | 1068 |
| 988 | Ga0495664_0016518 | 3300046477 | Bacteria | 4207 |
| 989 | Ga0495664_0022116 | 3300046477 | Bacteria | 3681 |
| 990 | Ga0495664_0112353 | 3300046477 | Bacteria | 1645 |
| 991 | Ga0495664_0123109 | 3300046477 | Bacteria | 1568 |
| 992 | Ga0495664_0140249 | 3300046477 | Bacteria | 1465 |
| 993 | Ga0495664_0267503 | 3300046477 | Bacteria | 1033 |
| 994 | Ga0495664_0761221 | 3300046477 | Bacteria | 570 |
| 995 | Ga0495584_0493114 | 3300046491 | Bacteria | 624 |
| 996 | Ga0495585_0035267 | 3300046492 | Bacteria | 2828 |
| 997 | Ga0495585_0180295 | 3300046492 | Bacteria | 1086 |
| 998 | Ga0495585_0279772 | 3300046492 | Bacteria | 825 |
| 999 | Ga0495594_0000020 | 3300046499 | Bacteria | 80534 |
| 1000 | Ga0495594_0087977 | 3300046499 | Bacteria | 1739 |
| 1001 | Ga0495594_0249012 | 3300046499 | Bacteria | 1012 |
| 1002 | Ga0495594_0313122 | 3300046499 | Bacteria | 894 |
| 1003 | Ga0495594_0511637 | 3300046499 | Bacteria | 682 |
| 1004 | Ga0495594_0536512 | 3300046499 | Bacteria | 664 |
| 1005 | Ga0495583_0212960 | 3300046506 | Bacteria | 783 |
| 1006 | Ga0495606_0003820 | 3300046507 | Bacteria | 15624 |
| 1007 | Ga0495606_0320351 | 3300046507 | Bacteria | 833 |
| 1008 | Ga0495606_0328870 | 3300046507 | Bacteria | 818 |
| 1009 | Ga0495606_0402991 | 3300046507 | Bacteria | 712 |
| 1010 | Ga0495608_0005003 | 3300046511 | Bacteria | 9486 |
| 1011 | Ga0495608_0076801 | 3300046511 | Bacteria | 2174 |
| 1012 | Ga0495610_0070605 | 3300046512 | Bacteria | 1630 |
| 1013 | Ga0495610_0181975 | 3300046512 | Bacteria | 873 |
| 1014 | Ga0495616_0060187 | 3300046513 | Bacteria | 1866 |
| 1015 | Ga0495618_0078963 | 3300046514 | Bacteria | 2098 |
| 1016 | Ga0495618_0125439 | 3300046514 | Bacteria | 1644 |
| 1017 | Ga0495618_0174603 | 3300046514 | Bacteria | 1366 |
| 1018 | Ga0495618_0324373 | 3300046514 | Bacteria | 953 |
| 1019 | Ga0495620_0251452 | 3300046515 | Bacteria | 674 |
| 1020 | Ga0495620_0256667 | 3300046515 | Bacteria | 666 |
| 1021 | Ga0495628_0010144 | 3300046516 | Bacteria | 8010 |
| 1022 | Ga0495628_0058137 | 3300046516 | Bacteria | 3040 |
| 1023 | Ga0495628_0075750 | 3300046516 | Bacteria | 2620 |
| 1024 | Ga0495628_1190507 | 3300046516 | Bacteria | 517 |
| 1025 | Ga0495630_0044087 | 3300046517 | Bacteria | 3333 |
| 1026 | Ga0495630_0274763 | 3300046517 | Bacteria | 1287 |
| 1027 | Ga0495630_0904493 | 3300046517 | Bacteria | 672 |
| 1028 | Ga0495630_1100710 | 3300046517 | Bacteria | 602 |
| 1029 | Ga0495631_0025372 | 3300046518 | Bacteria | 2730 |
| 1030 | Ga0495631_0162612 | 3300046518 | Bacteria | 958 |
| 1031 | Ga0495631_0363391 | 3300046518 | Bacteria | 616 |
| 1032 | Ga0495632_0138676 | 3300046519 | Bacteria | 1129 |
| 1033 | Ga0495632_0150187 | 3300046519 | Bacteria | 1077 |
| 1034 | Ga0495632_0296297 | 3300046519 | Bacteria | 718 |
| 1035 | Ga0495637_0336925 | 3300046520 | Bacteria | 531 |
| 1036 | Ga0495644_0078643 | 3300046523 | Bacteria | 1242 |
| 1037 | Ga0495644_0318893 | 3300046523 | Bacteria | 610 |
| 1038 | Ga0495644_0430845 | 3300046523 | Bacteria | 524 |
| 1039 | Ga0495648_0028869 | 3300046524 | Bacteria | 3688 |
| 1040 | Ga0495648_0093578 | 3300046524 | Bacteria | 1676 |
| 1041 | Ga0495666_0010941 | 3300046526 | Bacteria | 4525 |
| 1042 | Ga0495652_0004857 | 3300046529 | Bacteria | 12762 |
| 1043 | Ga0495652_0047989 | 3300046529 | Bacteria | 3661 |
| 1044 | Ga0495652_0355006 | 3300046529 | Bacteria | 1049 |
| 1045 | Ga0495652_0979629 | 3300046529 | Bacteria | 554 |
| 1046 | Ga0495654_0090172 | 3300046530 | Bacteria | 1424 |
| 1047 | Ga0495665_0000170 | 3300046531 | Bacteria | 32921 |
| 1048 | Ga0495665_0137466 | 3300046531 | Bacteria | 1278 |
| 1049 | Ga0495640_0002547 | 3300046533 | Bacteria | 14649 |
| 1050 | Ga0495640_0010374 | 3300046533 | Bacteria | 7205 |
| 1051 | Ga0495640_0094459 | 3300046533 | Bacteria | 1969 |
| 1052 | Ga0495640_0593690 | 3300046533 | Bacteria | 669 |
| 1053 | Ga0495640_0856612 | 3300046533 | Bacteria | 540 |
| 1054 | Ga0495587_0001071 | 3300046536 | Bacteria | 17994 |
| 1055 | Ga0495587_0031364 | 3300046536 | Bacteria | 3218 |
| 1056 | Ga0495587_0602018 | 3300046536 | Bacteria | 605 |
| 1057 | Ga0495598_0013908 | 3300046537 | Bacteria | 2004 |
| 1058 | Ga0495609_0309606 | 3300046538 | Bacteria | 642 |
| 1059 | Ga0495609_0427873 | 3300046538 | Bacteria | 528 |
| 1060 | Ga0495621_0043795 | 3300046539 | Bacteria | 1580 |
| 1061 | Ga0495645_0003790 | 3300046543 | Bacteria | 10277 |
| 1062 | Ga0495645_0011662 | 3300046543 | Bacteria | 6188 |
| 1063 | Ga0495622_0002079 | 3300046557 | Bacteria | 9785 |
| 1064 | Ga0495622_0028006 | 3300046557 | Bacteria | 2630 |
| 1065 | Ga0495622_0229126 | 3300046557 | Bacteria | 821 |
| 1066 | Ga0495667_0007097 | 3300046559 | Bacteria | 7598 |
| 1067 | Ga0495667_0046148 | 3300046559 | Bacteria | 2882 |
| 1068 | Ga0495667_0558964 | 3300046559 | Bacteria | 714 |
| 1069 | Ga0495656_0050030 | 3300046615 | Bacteria | 1782 |
| 1070 | Ga0495656_0114997 | 3300046615 | Bacteria | 1263 |
| 1071 | Ga0495668_0041329 | 3300046616 | Bacteria | 2568 |
| 1072 | Ga0495668_0250745 | 3300046616 | Bacteria | 969 |
| 1073 | Ga0495668_0304781 | 3300046616 | Bacteria | 873 |
| 1074 | Ga0495668_0439123 | 3300046616 | Bacteria | 718 |
| 1075 | Ga0495634_0000998 | 3300046642 | Bacteria | 26678 |
| 1076 | Ga0495634_0019197 | 3300046642 | Bacteria | 4859 |
| 1077 | Ga0495634_0111197 | 3300046642 | Bacteria | 1761 |
| 1078 | Ga0495634_0402870 | 3300046642 | Bacteria | 812 |
| 1079 | Ga0495611_0040906 | 3300046648 | Bacteria | 2067 |
| 1080 | Ga0495611_0379933 | 3300046648 | Bacteria | 647 |
| 1081 | Ga0495625_0260674 | 3300046660 | Bacteria | 1122 |
| 1082 | Ga0495625_0400839 | 3300046660 | Bacteria | 857 |
| 1083 | Ga0495635_0000040 | 3300046663 | Bacteria | 86519 |
| 1084 | Ga0495635_0030879 | 3300046663 | Bacteria | 3722 |
| 1085 | Ga0495635_0084818 | 3300046663 | Bacteria | 2167 |
| 1086 | Ga0495635_0177498 | 3300046663 | Bacteria | 1448 |
| 1087 | Ga0495659_0031086 | 3300046664 | Bacteria | 1861 |
| 1088 | Ga0495659_0049398 | 3300046664 | Bacteria | 1527 |
| 1089 | Ga0495661_0108816 | 3300046665 | Bacteria | 1548 |
| 1090 | Ga0495588_0010035 | 3300046674 | Bacteria | 4389 |
| 1091 | Ga0495588_0063546 | 3300046674 | Bacteria | 1914 |
| 1092 | Ga0495588_0257880 | 3300046674 | Bacteria | 919 |
| 1093 | Ga0495657_0000218 | 3300046675 | Bacteria | 51627 |
| 1094 | Ga0495657_0204325 | 3300046675 | Bacteria | 1203 |
| 1095 | Ga0495657_0460422 | 3300046675 | Bacteria | 744 |
| 1096 | Ga0495657_0640031 | 3300046675 | Bacteria | 614 |
| 1097 | Ga0495599_0000256 | 3300046678 | Bacteria | 33627 |
| 1098 | Ga0495599_0044271 | 3300046678 | Bacteria | 2792 |
| 1099 | Ga0495599_0049469 | 3300046678 | Bacteria | 2635 |
| 1100 | Ga0495599_0097164 | 3300046678 | Bacteria | 1836 |
| 1101 | Ga0495623_0013540 | 3300046679 | Bacteria | 5288 |
| 1102 | Ga0495623_0085754 | 3300046679 | Bacteria | 1942 |
| 1103 | Ga0495623_0422695 | 3300046679 | Bacteria | 714 |
| 1104 | Ga0495623_0597224 | 3300046679 | Bacteria | 574 |
| 1105 | Ga0495646_0003573 | 3300046680 | Bacteria | 9701 |
| 1106 | Ga0495646_0083110 | 3300046680 | Bacteria | 1862 |
| 1107 | Ga0495646_0534592 | 3300046680 | Bacteria | 600 |
| 1108 | Ga0495647_0001303 | 3300046681 | Bacteria | 7665 |
| 1109 | Ga0495647_0065497 | 3300046681 | Bacteria | 1443 |
| 1110 | Ga0495647_0128312 | 3300046681 | Bacteria | 1072 |
| 1111 | Ga0495647_0218145 | 3300046681 | Bacteria | 841 |
| 1112 | Ga0495658_0002344 | 3300046683 | Bacteria | 9568 |
| 1113 | Ga0495669_0004164 | 3300046684 | Bacteria | 5947 |
| 1114 | Ga0495669_0052804 | 3300046684 | Bacteria | 1827 |
| 1115 | Ga0495669_0101358 | 3300046684 | Bacteria | 1337 |
| 1116 | Ga0495669_0210326 | 3300046684 | Bacteria | 931 |
| 1117 | Ga0495669_0274305 | 3300046684 | Bacteria | 811 |
| 1118 | Ga0495669_0393434 | 3300046684 | Bacteria | 671 |
| 1119 | Ga0495613_0017244 | 3300046689 | Bacteria | 5380 |
| 1120 | Ga0495613_0148878 | 3300046689 | Bacteria | 1670 |
| 1121 | Ga0495613_0276398 | 3300046689 | Bacteria | 1167 |
| 1122 | Ga0495613_0759863 | 3300046689 | Bacteria | 635 |
| 1123 | Ga0495624_0009089 | 3300046690 | Bacteria | 6894 |
| 1124 | Ga0495624_0037826 | 3300046690 | Bacteria | 3103 |
| 1125 | Ga0495624_0295698 | 3300046690 | Bacteria | 977 |
| 1126 | Ga0495624_0523356 | 3300046690 | Bacteria | 709 |
| 1127 | Ga0495670_0082771 | 3300046691 | Bacteria | 1636 |
| 1128 | Ga0495670_0170470 | 3300046691 | Bacteria | 1146 |
| 1129 | Ga0495671_0074187 | 3300046692 | Bacteria | 1669 |
| 1130 | Ga0495671_0153623 | 3300046692 | Bacteria | 1120 |
| 1131 | Ga0495649_0276088 | 3300046694 | Bacteria | 859 |
| 1132 | Ga0495589_0243042 | 3300046794 | Bacteria | 842 |
| 1133 | Ga0495589_0381400 | 3300046794 | Bacteria | 648 |
| 1134 | Ga0495600_0000541 | 3300046809 | Bacteria | 19518 |
| 1135 | Ga0495600_0067787 | 3300046809 | Bacteria | 2332 |
| 1136 | Ga0495600_0086718 | 3300046809 | Bacteria | 2042 |
| 1137 | Ga0495581_0003140 | 3300047315 | Bacteria | 9453 |
| 1138 | Ga0495581_0023393 | 3300047315 | Bacteria | 3580 |
| 1139 | Ga0495581_0061621 | 3300047315 | Bacteria | 2168 |
| 1140 | Ga0495581_0066144 | 3300047315 | Bacteria | 2090 |
| 1141 | Ga0495581_0623858 | 3300047315 | Bacteria | 624 |
| 1142 | Ga0495604_0001811 | 3300047317 | Bacteria | 17417 |
| 1143 | Ga0495604_0343396 | 3300047317 | Bacteria | 993 |
| 1144 | Ga0495604_0402588 | 3300047317 | Bacteria | 901 |
| 1145 | Ga0495604_0521387 | 3300047317 | Bacteria | 769 |
| 1146 | Ga0495604_0594829 | 3300047317 | Bacteria | 710 |
| 1147 | Ga0495636_0464653 | 3300047318 | Bacteria | 609 |
| 1148 | Ga0495674_0000600 | 3300047319 | Bacteria | 33795 |
| 1149 | Ga0495674_0077886 | 3300047319 | Bacteria | 2850 |
| 1150 | Ga0495674_0634500 | 3300047319 | Bacteria | 843 |
| 1151 | Ga0495674_0750856 | 3300047319 | Bacteria | 762 |
| 1152 | Ga0495672_0007934 | 3300047320 | Bacteria | 7915 |
| 1153 | Ga0495672_0200728 | 3300047320 | Bacteria | 997 |
| 1154 | Ga0495672_0260818 | 3300047320 | Bacteria | 836 |
| 1155 | Ga0495676_0037688 | 3300047321 | Bacteria | 4021 |
| 1156 | Ga0495676_0046483 | 3300047321 | Bacteria | 3522 |
| 1157 | Ga0495676_0049266 | 3300047321 | Bacteria | 3389 |
| 1158 | Ga0495676_0320194 | 3300047321 | Bacteria | 1042 |
| 1159 | Ga0495680_0011919 | 3300047322 | Bacteria | 7672 |
| 1160 | Ga0495680_0059137 | 3300047322 | Bacteria | 2960 |
| 1161 | Ga0495680_0080401 | 3300047322 | Bacteria | 2463 |
| 1162 | Ga0495680_0396202 | 3300047322 | Bacteria | 954 |
| 1163 | Ga0495680_0433135 | 3300047322 | Bacteria | 903 |
| 1164 | Ga0495680_0501396 | 3300047322 | Bacteria | 824 |
| 1165 | Ga0495683_0058376 | 3300047323 | Bacteria | 1917 |
| 1166 | Ga0495683_0088393 | 3300047323 | Bacteria | 1504 |
| 1167 | Ga0495683_0158602 | 3300047323 | Bacteria | 1048 |
| 1168 | Ga0495675_0055004 | 3300047444 | Bacteria | 2524 |
| 1169 | Ga0495677_0123238 | 3300047445 | Bacteria | 989 |
| 1170 | Ga0495677_0362708 | 3300047445 | Bacteria | 572 |
| 1171 | Ga0495679_050073 | 3300047446 | Bacteria | 1258 |
| 1172 | Ga0495685_282846 | 3300047447 | Bacteria | 523 |
| 1173 | Ga0495673_0064876 | 3300047469 | Bacteria | 1552 |
| 1174 | Ga0495673_0091021 | 3300047469 | Bacteria | 1246 |
| 1175 | Ga0495673_0260515 | 3300047469 | Bacteria | 631 |
| 1176 | Ga0495684_0000023 | 3300047471 | Bacteria | 133626 |
| 1177 | Ga0495684_0035362 | 3300047471 | Bacteria | 3831 |
| 1178 | Ga0495684_0041506 | 3300047471 | Bacteria | 3526 |
| 1179 | Ga0495593_0003332 | 3300047673 | Bacteria | 9624 |
| 1180 | Ga0495593_0005773 | 3300047673 | Bacteria | 7300 |
| 1181 | Ga0495593_0086730 | 3300047673 | Bacteria | 1614 |
| 1182 | Ga0495602_0008270 | 3300048088 | Bacteria | 10865 |
| 1183 | Ga0495602_0079174 | 3300048088 | Bacteria | 2773 |
| 1184 | Ga0495602_0222208 | 3300048088 | Bacteria | 1425 |
| 1185 | Ga0495602_0480250 | 3300048088 | Bacteria | 872 |
| 1186 | Ga0495614_0513275 | 3300048089 | Bacteria | 571 |
| 1187 | Ga0496100_0005982 | 3300048903 | Bacteria | 6600 |
| 1188 | Ga0496100_0162736 | 3300048903 | Bacteria | 1601 |
| 1189 | Ga0496100_0386942 | 3300048903 | Bacteria | 1063 |
| 1190 | Ga0496101_0025777 | 3300048904 | Bacteria | 4081 |
| 1191 | Ga0496101_0038511 | 3300048904 | Bacteria | 3396 |
| 1192 | Ga0496101_0224261 | 3300048904 | Bacteria | 1459 |
| 1193 | Ga0496101_0637589 | 3300048904 | Bacteria | 842 |
| 1194 | Ga0496102_0008125 | 3300048905 | Bacteria | 8979 |
| 1195 | Ga0496102_0156905 | 3300048905 | Bacteria | 2139 |
| 1196 | Ga0496102_0275430 | 3300048905 | Bacteria | 1586 |
| 1197 | Ga0496102_0311979 | 3300048905 | Bacteria | 1482 |
| 1198 | Ga0496102_0558399 | 3300048905 | Bacteria | 1068 |
| 1199 | Ga0496103_0042708 | 3300048906 | Bacteria | 2791 |
| 1200 | Ga0496103_0126537 | 3300048906 | Bacteria | 1630 |
| 1201 | Ga0496104_0020842 | 3300048907 | Bacteria | 6011 |
| 1202 | Ga0496104_0029258 | 3300048907 | Bacteria | 5109 |
| 1203 | Ga0496104_0075547 | 3300048907 | Bacteria | 3208 |
| 1204 | Ga0496104_0370557 | 3300048907 | Bacteria | 1345 |
| 1205 | Ga0496104_0393197 | 3300048907 | Bacteria | 1298 |
| 1206 | Ga0496105_0008473 | 3300048908 | Bacteria | 7989 |
| 1207 | Ga0496105_0054973 | 3300048908 | Bacteria | 3287 |
| 1208 | Ga0496105_0255995 | 3300048908 | Bacteria | 1417 |
| 1209 | Ga0496105_0275710 | 3300048908 | Bacteria | 1357 |
| 1210 | Ga0496105_0320305 | 3300048908 | Bacteria | 1243 |
| 1211 | Ga0496105_0805733 | 3300048908 | Bacteria | 714 |
| 1212 | Ga0496106_0008202 | 3300048909 | Bacteria | 7720 |
| 1213 | Ga0496106_0041693 | 3300048909 | Bacteria | 3440 |
| 1214 | Ga0496106_0046901 | 3300048909 | Bacteria | 3250 |
| 1215 | Ga0496106_0050608 | 3300048909 | Bacteria | 3131 |
| 1216 | Ga0496106_0061464 | 3300048909 | Bacteria | 2850 |
| 1217 | Ga0496106_0075215 | 3300048909 | Bacteria | 2587 |
| 1218 | Ga0496106_1198276 | 3300048909 | Bacteria | 592 |
| 1219 | Ga0496107_0022899 | 3300048910 | Bacteria | 4416 |
| 1220 | Ga0496107_0035705 | 3300048910 | Bacteria | 3564 |
| 1221 | Ga0496107_0065602 | 3300048910 | Bacteria | 2632 |
| 1222 | Ga0496107_0168783 | 3300048910 | Bacteria | 1623 |
| 1223 | Ga0496107_0176583 | 3300048910 | Bacteria | 1586 |
| 1224 | Ga0496107_0216401 | 3300048910 | Bacteria | 1425 |
| 1225 | Ga0496107_0612891 | 3300048910 | Bacteria | 804 |
| 1226 | Ga0496107_0636235 | 3300048910 | Bacteria | 787 |
| 1227 | Ga0496108_0003213 | 3300048911 | Bacteria | 13143 |
| 1228 | Ga0496108_0010940 | 3300048911 | Bacteria | 7368 |
| 1229 | Ga0496108_0012155 | 3300048911 | Bacteria | 7001 |
| 1230 | Ga0496108_0039596 | 3300048911 | Bacteria | 3928 |
| 1231 | Ga0496108_0053217 | 3300048911 | Bacteria | 3394 |
| 1232 | Ga0496108_1352100 | 3300048911 | Bacteria | 597 |
| 1233 | Ga0496109_0002585 | 3300048912 | Bacteria | 15162 |
| 1234 | Ga0496109_0016135 | 3300048912 | Bacteria | 6528 |
| 1235 | Ga0496109_0025566 | 3300048912 | Bacteria | 5263 |
| 1236 | Ga0496109_0260761 | 3300048912 | Bacteria | 1632 |
| 1237 | Ga0496109_0507382 | 3300048912 | Bacteria | 1138 |
| 1238 | Ga0496109_1310615 | 3300048912 | Bacteria | 660 |
| 1239 | Ga0496110_0005094 | 3300048913 | Bacteria | 10266 |
| 1240 | Ga0496110_0009693 | 3300048913 | Bacteria | 7800 |
| 1241 | Ga0496110_0011502 | 3300048913 | Bacteria | 7245 |
| 1242 | Ga0496110_0090813 | 3300048913 | Bacteria | 2731 |
| 1243 | Ga0496110_0109266 | 3300048913 | Bacteria | 2483 |
| 1244 | Ga0496110_0215738 | 3300048913 | Bacteria | 1745 |
| 1245 | Ga0496110_0298264 | 3300048913 | Bacteria | 1468 |
| 1246 | Ga0496110_1152860 | 3300048913 | Bacteria | 684 |
| 1247 | Ga0496111_0041081 | 3300048914 | Bacteria | 3318 |
| 1248 | Ga0496111_0152865 | 3300048914 | Bacteria | 1712 |
| 1249 | Ga0496111_0164446 | 3300048914 | Bacteria | 1648 |
| 1250 | Ga0496111_0165666 | 3300048914 | Bacteria | 1641 |
| 1251 | Ga0496111_0204773 | 3300048914 | Bacteria | 1466 |
| 1252 | Ga0496111_0266366 | 3300048914 | Bacteria | 1271 |
| 1253 | Ga0496112_0000031 | 3300048915 | Bacteria | 120022 |
| 1254 | Ga0496112_0002881 | 3300048915 | Bacteria | 13996 |
| 1255 | Ga0496112_0055524 | 3300048915 | Bacteria | 3894 |
| 1256 | Ga0496112_0118015 | 3300048915 | Bacteria | 2623 |
| 1257 | Ga0496112_0189893 | 3300048915 | Bacteria | 2016 |
| 1258 | Ga0496112_0366845 | 3300048915 | Bacteria | 1381 |
| 1259 | Ga0496113_0006041 | 3300048916 | Bacteria | 7629 |
| 1260 | Ga0496113_0014440 | 3300048916 | Bacteria | 5387 |
| 1261 | Ga0496113_0039454 | 3300048916 | Bacteria | 3475 |
| 1262 | Ga0496113_1074691 | 3300048916 | Bacteria | 632 |
| 1263 | Ga0496114_0028470 | 3300048917 | Bacteria | 4586 |
| 1264 | Ga0496114_0090800 | 3300048917 | Bacteria | 2593 |
| 1265 | Ga0496114_0271973 | 3300048917 | Bacteria | 1493 |
| 1266 | Ga0496114_0631052 | 3300048917 | Bacteria | 944 |
| 1267 | Ga0496114_1571325 | 3300048917 | Bacteria | 546 |
| 1268 | Ga0496115_0010614 | 3300048918 | Bacteria | 6888 |
| 1269 | Ga0496115_0038527 | 3300048918 | Bacteria | 3793 |
| 1270 | Ga0496115_0068732 | 3300048918 | Bacteria | 2868 |
| 1271 | Ga0496115_0138134 | 3300048918 | Bacteria | 2010 |
| 1272 | Ga0496115_0158378 | 3300048918 | Bacteria | 1871 |
| 1273 | Ga0496115_0172524 | 3300048918 | Bacteria | 1788 |
| 1274 | Ga0496115_0234195 | 3300048918 | Bacteria | 1514 |
| 1275 | Ga0496115_0616443 | 3300048918 | Bacteria | 861 |
| 1276 | Ga0496118_0001670 | 3300048921 | Bacteria | 32550 |
| 1277 | Ga0496118_0043015 | 3300048921 | Bacteria | 3556 |
| 1278 | Ga0496119_0064309 | 3300048922 | Bacteria | 2179 |
| 1279 | Ga0496119_0405635 | 3300048922 | Bacteria | 649 |
| 1280 | Ga0496120_0093413 | 3300048923 | Bacteria | 1603 |
| 1281 | Ga0496120_0129130 | 3300048923 | Bacteria | 1297 |
| 1282 | Ga0496121_0000183 | 3300048924 | Bacteria | 139168 |
| 1283 | Ga0496121_0001473 | 3300048924 | Bacteria | 39642 |
| 1284 | Ga0496121_0002518 | 3300048924 | Bacteria | 27800 |
| 1285 | Ga0496121_0157177 | 3300048924 | Bacteria | 1667 |
| 1286 | Ga0496121_0219605 | 3300048924 | Bacteria | 1340 |
| 1287 | Ga0496121_0381970 | 3300048924 | Bacteria | 928 |
| 1288 | Ga0496124_0001382 | 3300048927 | Bacteria | 36359 |
| 1289 | Ga0496124_0016454 | 3300048927 | Bacteria | 7028 |
| 1290 | Ga0496124_0299139 | 3300048927 | Bacteria | 1163 |
| 1291 | Ga0496125_0048308 | 3300048928 | Bacteria | 3550 |
| 1292 | Ga0496125_0060785 | 3300048928 | Bacteria | 3034 |
| 1293 | Ga0496126_0004491 | 3300048929 | Bacteria | 16643 |
| 1294 | Ga0496126_0013413 | 3300048929 | Bacteria | 8338 |
| 1295 | Ga0496126_0063841 | 3300048929 | Bacteria | 3300 |
| 1296 | Ga0496126_0115146 | 3300048929 | Bacteria | 2338 |
| 1297 | Ga0496126_0129927 | 3300048929 | Bacteria | 2177 |
| 1298 | Ga0496126_0223766 | 3300048929 | Bacteria | 1579 |
| 1299 | Ga0496126_0242172 | 3300048929 | Bacteria | 1506 |
| 1300 | Ga0496126_0394707 | 3300048929 | Bacteria | 1123 |
| 1301 | Ga0496126_0498782 | 3300048929 | Bacteria | 973 |
| 1302 | Ga0496126_0534124 | 3300048929 | Bacteria | 933 |
| 1303 | Ga0496126_0643537 | 3300048929 | Bacteria | 830 |
| 1304 | Ga0495678_065656 | 3300049459 | Bacteria | 1346 |
| 1305 | Ga0495682_0171067 | 3300049460 | Bacteria | 773 |
| 1306 | Ga0501031_0000442 | 3300049568 | Bacteria | 23895 |
| 1307 | Ga0501032_0000773 | 3300049569 | Bacteria | 25943 |
| 1308 | Ga0501033_0000025 | 3300049570 | Bacteria | 173634 |
| 1309 | Ga0501033_0336470 | 3300049570 | Bacteria | 1059 |
| 1310 | Ga0501034_0000021 | 3300049571 | Bacteria | 266023 |
| 1311 | Ga0501036_0000069 | 3300049572 | Bacteria | 64331 |
| 1312 | Ga0501037_0000034 | 3300049573 | Bacteria | 126321 |
| 1313 | Ga0501038_0000537 | 3300049574 | Bacteria | 33396 |
| 1314 | Ga0501039_0000198 | 3300049575 | Bacteria | 43456 |
| 1315 | Ga0501042_0670899 | 3300049578 | Bacteria | 754 |
| 1316 | Ga0501043_0001044 | 3300049579 | Bacteria | 24351 |
| 1317 | Ga0501046_0011176 | 3300049580 | Bacteria | 7691 |
| 1318 | Ga0501047_0000587 | 3300049581 | Bacteria | 38665 |
| 1319 | Ga0501047_0047916 | 3300049581 | Bacteria | 4128 |
| 1320 | Ga0501047_0748050 | 3300049581 | Bacteria | 794 |
| 1321 | Ga0501048_0008991 | 3300049582 | Bacteria | 7520 |
| 1322 | Ga0501067_0000331 | 3300049583 | Bacteria | 25804 |
| 1323 | Ga0501067_0056192 | 3300049583 | Bacteria | 2181 |
| 1324 | Ga0501068_0000039 | 3300049584 | Bacteria | 48466 |
| 1325 | Ga0501069_0000910 | 3300049585 | Bacteria | 14124 |
| 1326 | Ga0501069_0029131 | 3300049585 | Bacteria | 3030 |
| 1327 | Ga0501069_0410822 | 3300049585 | Bacteria | 802 |
| 1328 | Ga0501070_0033515 | 3300049586 | Bacteria | 4298 |
| 1329 | Ga0501070_0140507 | 3300049586 | Bacteria | 1994 |
| 1330 | Ga0501070_0282353 | 3300049586 | Bacteria | 1354 |
| 1331 | Ga0501070_0306690 | 3300049586 | Bacteria | 1292 |
| 1332 | Ga0501072_0007314 | 3300049588 | Bacteria | 8375 |
| 1333 | Ga0501072_0250013 | 3300049588 | Bacteria | 1412 |
| 1334 | Ga0501073_0000236 | 3300049589 | Bacteria | 36413 |
| 1335 | Ga0501073_0069491 | 3300049589 | Bacteria | 2454 |
| 1336 | Ga0501074_0000048 | 3300049590 | Bacteria | 56982 |
| 1337 | Ga0501074_0030647 | 3300049590 | Bacteria | 3898 |
| 1338 | Ga0501257_204124 | 3300049686 | Bacteria | 569 |
| 1339 | Ga0501225_0182944 | 3300049705 | Bacteria | 656 |
| 1340 | Ga0501079_0011390 | 3300049741 | Bacteria | 6788 |
| 1341 | Ga0501079_0828095 | 3300049741 | Bacteria | 729 |
| 1342 | Ga0501080_0034680 | 3300049742 | Bacteria | 4712 |
| 1343 | Ga0501080_0278675 | 3300049742 | Bacteria | 1520 |
| 1344 | Ga0501080_0472463 | 3300049742 | Bacteria | 1122 |
| 1345 | Ga0501081_1022083 | 3300049743 | Bacteria | 625 |
| 1346 | Ga0501083_0030815 | 3300049744 | Bacteria | 3681 |
| 1347 | Ga0501035_0000865 | 3300049822 | Bacteria | 32300 |
| 1348 | Ga0501044_0000028 | 3300049823 | Bacteria | 179203 |
| 1349 | Ga0501044_0070718 | 3300049823 | Bacteria | 3549 |
| 1350 | Ga0501044_0180205 | 3300049823 | Bacteria | 2080 |
| 1351 | Ga0501044_0777983 | 3300049823 | Bacteria | 838 |
| 1352 | Ga0501045_0191681 | 3300049824 | Bacteria | 1523 |
| 1353 | nmdc:mga03683_245279_c1 | 3300050489 | Bacteria | 831 |
| 1354 | nmdc:mga03683_555581_c1 | 3300050489 | Bacteria | 559 |
| 1355 | nmdc:mga0yw44_172489_c1 | 3300050492 | Bacteria | 552 |
| 1356 | nmdc:mga0yw44_343361_c1 | 3300050492 | Bacteria | 1004 |
| 1357 | nmdc:mga0k408_184235_c2 | 3300050493 | Bacteria | 502 |
| 1358 | nmdc:mga0k408_29543_c1 | 3300050493 | Bacteria | 3121 |
| 1359 | nmdc:mga0k408_611302_c1 | 3300050493 | Bacteria | 642 |
| 1360 | nmdc:mga0k408_695351_c1 | 3300050493 | Bacteria | 596 |
| 1361 | nmdc:mga06z11_191886_c1 | 3300050494 | Bacteria | 1183 |
| 1362 | nmdc:mga06z11_298778_c1 | 3300050494 | Bacteria | 957 |
| 1363 | nmdc:mga04h51_171599_c1 | 3300050495 | Bacteria | 840 |
| 1364 | nmdc:mga07m45_103042_c1 | 3300050496 | Bacteria | 1640 |
| 1365 | nmdc:mga07m45_479438_c1 | 3300050496 | Bacteria | 721 |
| 1366 | nmdc:mga07m45_907950_c1 | 3300050496 | Bacteria | 504 |
| 1367 | nmdc:mga06r32_564965_c1 | 3300050510 | Bacteria | 1110 |
| 1368 | nmdc:mga08y16_314653_c1 | 3300050511 | Bacteria | 1612 |
| 1369 | nmdc:mga0n895_158416_c1 | 3300050512 | Bacteria | 2295 |
| 1370 | nmdc:mga0n895_354924_c1 | 3300050512 | Bacteria | 1485 |
| 1371 | nmdc:mga0rr50_700405_c1 | 3300050513 | Bacteria | 864 |
| 1372 | nmdc:mga08x19_104020_c1 | 3300050514 | Bacteria | 1886 |
| 1373 | nmdc:mga0a205_1029238_c1 | 3300050515 | Bacteria | 670 |
| 1374 | nmdc:mga0sz30_202315_c1 | 3300050516 | Bacteria | 882 |
| 1375 | nmdc:mga0sz30_345707_c1 | 3300050516 | Bacteria | 664 |
| 1376 | Ga0495601_0032809 | 3300053077 | Bacteria | 3234 |
| 1377 | Ga0495601_0047559 | 3300053077 | Bacteria | 2701 |
| 1378 | Ga0495601_0050146 | 3300053077 | Bacteria | 2632 |
| 1379 | Ga0495601_0221914 | 3300053077 | Bacteria | 1235 |
| 1380 | Ga0495612_0086620 | 3300053078 | Bacteria | 1321 |
| 1381 | Ga0495612_0163605 | 3300053078 | Bacteria | 972 |
| 1382 | Ga0500635_0003272 | 3300053080 | Bacteria | 4065 |
| 1383 | Ga0500635_0024104 | 3300053080 | Bacteria | 1905 |
| 1384 | Ga0500635_0033210 | 3300053080 | Bacteria | 1682 |
| 1385 | Ga0495655_0134726 | 3300053083 | Bacteria | 764 |
| 1386 | Ga0495595_0000634 | 3300053084 | Bacteria | 13368 |
| 1387 | Ga0495595_0096720 | 3300053084 | Bacteria | 1422 |
| 1388 | Ga0495595_0245576 | 3300053084 | Bacteria | 896 |
| 1389 | Ga0495595_0574087 | 3300053084 | Bacteria | 576 |
| 1390 | Ga0495619_0000697 | 3300053085 | Bacteria | 21975 |
| 1391 | Ga0495619_0013615 | 3300053085 | Bacteria | 5126 |
| 1392 | Ga0495619_0072468 | 3300053085 | Bacteria | 2307 |
| 1393 | Ga0495619_0531461 | 3300053085 | Bacteria | 808 |
| 1394 | Ga0495619_0639362 | 3300053085 | Bacteria | 726 |
| 1395 | Ga0500578_0261630 | 3300053086 | Bacteria | 1039 |
| 1396 | Ga0500578_0319122 | 3300053086 | Bacteria | 916 |
| 1397 | Ga0500647_0055764 | 3300053091 | Bacteria | 1901 |
| 1398 | Ga0500647_0291114 | 3300053091 | Bacteria | 702 |
| 1399 | Ga0500583_0073951 | 3300053092 | Bacteria | 1635 |
| 1400 | Ga0500583_0417295 | 3300053092 | Bacteria | 641 |
| 1401 | Ga0500651_0030288 | 3300053093 | Bacteria | 3404 |
| 1402 | Ga0500651_0030472 | 3300053093 | Bacteria | 3394 |
| 1403 | Ga0500651_0156988 | 3300053093 | Bacteria | 1362 |
| 1404 | Ga0500566_0000010 | 3300053094 | Bacteria | 119976 |
| 1405 | Ga0500566_0051918 | 3300053094 | Bacteria | 2344 |
| 1406 | Ga0500566_0490302 | 3300053094 | Bacteria | 531 |
| 1407 | Ga0500640_000055 | 3300053095 | Bacteria | 17705 |
| 1408 | Ga0500641_0093867 | 3300053096 | Bacteria | 1282 |
| 1409 | Ga0500654_142441 | 3300053099 | Bacteria | 869 |
| 1410 | Ga0500554_000560 | 3300053102 | Bacteria | 7634 |
| 1411 | Ga0500554_027963 | 3300053102 | Bacteria | 1635 |
| 1412 | Ga0500556_0073406 | 3300053104 | Bacteria | 1281 |
| 1413 | Ga0500556_0151239 | 3300053104 | Bacteria | 915 |
| 1414 | Ga0500569_006916 | 3300053109 | Bacteria | 2517 |
| 1415 | Ga0500572_000088 | 3300053111 | Bacteria | 29518 |
| 1416 | Ga0500572_001292 | 3300053111 | Bacteria | 6993 |
| 1417 | Ga0500591_200314 | 3300053115 | Bacteria | 691 |
| 1418 | Ga0500595_000967 | 3300053119 | Bacteria | 16141 |
| 1419 | Ga0500595_002830 | 3300053119 | Bacteria | 8341 |
| 1420 | Ga0500595_006501 | 3300053119 | Bacteria | 4949 |
| 1421 | Ga0500595_008515 | 3300053119 | Bacteria | 4186 |
| 1422 | Ga0500608_061747 | 3300053122 | Bacteria | 1790 |
| 1423 | Ga0500608_112922 | 3300053122 | Bacteria | 1243 |
| 1424 | Ga0500614_000734 | 3300053123 | Bacteria | 8346 |
| 1425 | Ga0500655_065207 | 3300053133 | Bacteria | 737 |
| 1426 | Ga0500658_0069848 | 3300053134 | Bacteria | 1479 |
| 1427 | Ga0500658_0221356 | 3300053134 | Bacteria | 868 |
| 1428 | Ga0500559_0001744 | 3300053136 | Bacteria | 11938 |
| 1429 | Ga0500559_0024871 | 3300053136 | Bacteria | 2548 |
| 1430 | Ga0500559_0088109 | 3300053136 | Bacteria | 1418 |
| 1431 | Ga0500568_0023381 | 3300053139 | Bacteria | 2629 |
| 1432 | Ga0500568_0093224 | 3300053139 | Bacteria | 1135 |
| 1433 | Ga0500568_0119209 | 3300053139 | Bacteria | 984 |
| 1434 | Ga0500573_0147868 | 3300053140 | Bacteria | 1288 |
| 1435 | Ga0500577_0118571 | 3300053142 | Bacteria | 1099 |
| 1436 | Ga0500588_0017368 | 3300053146 | Bacteria | 1877 |
| 1437 | Ga0500589_046444 | 3300053147 | Bacteria | 2022 |
| 1438 | Ga0500590_105444 | 3300053148 | Bacteria | 1346 |
| 1439 | Ga0500590_176307 | 3300053148 | Bacteria | 934 |
| 1440 | Ga0500590_189746 | 3300053148 | Bacteria | 882 |
| 1441 | Ga0500603_000342 | 3300053150 | Bacteria | 12168 |
| 1442 | Ga0500603_004423 | 3300053150 | Bacteria | 3008 |
| 1443 | Ga0500603_013232 | 3300053150 | Bacteria | 1910 |
| 1444 | Ga0500603_133042 | 3300053150 | Bacteria | 761 |
| 1445 | Ga0500603_148305 | 3300053150 | Bacteria | 726 |
| 1446 | Ga0500604_0009862 | 3300053151 | Bacteria | 2547 |
| 1447 | Ga0500619_188296 | 3300053154 | Bacteria | 695 |
| 1448 | Ga0500622_0074138 | 3300053156 | Bacteria | 1715 |
| 1449 | Ga0500627_0092869 | 3300053158 | Bacteria | 1351 |
| 1450 | Ga0500627_0415377 | 3300053158 | Bacteria | 571 |
| 1451 | Ga0500630_003317 | 3300053159 | Bacteria | 7798 |
| 1452 | Ga0500634_0171056 | 3300053161 | Bacteria | 989 |
| 1453 | Ga0500638_000712 | 3300053162 | Bacteria | 8912 |
| 1454 | Ga0500638_093941 | 3300053162 | Bacteria | 1408 |
| 1455 | Ga0500638_159196 | 3300053162 | Bacteria | 996 |
| 1456 | Ga0500638_162057 | 3300053162 | Bacteria | 983 |
| 1457 | Ga0500638_353576 | 3300053162 | Bacteria | 544 |
| 1458 | Ga0500639_000001 | 3300053163 | Bacteria | 244795 |
| 1459 | Ga0500639_056128 | 3300053163 | Bacteria | 2040 |
| 1460 | Ga0500639_057167 | 3300053163 | Bacteria | 2018 |
| 1461 | Ga0500636_0078193 | 3300053177 | Bacteria | 1909 |
| 1462 | Ga0500636_0091378 | 3300053177 | Bacteria | 1743 |
| 1463 | Ga0500636_0194916 | 3300053177 | Bacteria | 1076 |
| 1464 | Ga0500636_0303041 | 3300053177 | Bacteria | 785 |
| 1465 | Ga0500636_0398726 | 3300053177 | Bacteria | 639 |
| 1466 | Ga0500637_0002851 | 3300053178 | Bacteria | 7795 |
| 1467 | Ga0500637_0005100 | 3300053178 | Bacteria | 6325 |
| 1468 | Ga0500637_0035858 | 3300053178 | Bacteria | 2783 |
| 1469 | Ga0500637_0364416 | 3300053178 | Bacteria | 763 |
| 1470 | Ga0500576_254031 | 3300053725 | Bacteria | 544 |
| 1471 | Ga0500609_008206 | 3300053731 | Bacteria | 1409 |
| 1472 | Ga0500552_006330 | 3300053733 | Bacteria | 1325 |
| 1473 | Ga0500596_006761 | 3300053735 | Bacteria | 1918 |
| 1474 | Ga0500596_007614 | 3300053735 | Bacteria | 1763 |
| 1475 | Ga0500601_006758 | 3300053737 | Bacteria | 1267 |
| 1476 | Ga0500587_017740 | 3300053739 | Bacteria | 914 |
| 1477 | Ga0501084_0001432 | 3300054114 | Bacteria | 18932 |
| 1478 | Ga0500661_000387 | 3300055283 | Bacteria | 8106 |
| 1479 | Ga0587115_088134 | 3300059626 | Bacteria | 560 |
| 1480 | Ga0501082_0011376 | 3300060353 | Bacteria | 7654 |
| 1481 | Ga0501082_0485625 | 3300060353 | Bacteria | 1080 |
| 1482 | Ga0501082_1589670 | 3300060353 | Bacteria | 571 |
| 1483 | Ga0466962_0140275 | 3300061719 | Bacteria | 1171 |
| 1484 | 2509150379 | 2508501128 | Bacteria | 8613869 |
| 1485 | 2513692387 | 2513237101 | Bacteria | 7952346 |
| 1486 | 2513893561 | 2513237141 | Bacteria | 8496279 |
| 1487 | 2876809028 | 2876808645 | Bacteria | 8824342 |
| 1488 | 2879115405 | 2879110137 | Bacteria | 8907982 |
| 1489 | 2922390852 | 2922386360 | Bacteria | 7017218 |
| 1490 | 8006965605 | 8006964411 | Bacteria | 8966052 |
| 1491 | 8056673996 | 8056673599 | Bacteria | 7871253 |
| 1492 | Ga0500595_001717 | |||
| 1493 | LJQas_1006151 | |||
| 1494 | JGI24736J21556_1019063 | |||
| 1495 | JGI24739J22299_10029071 | |||
| 1496 | JGI24737J22298_10026448 | |||
| 1497 | JGI24735J21928_10036631 | |||
| 1498 | JGI24735J21928_10069308 | |||
| 1499 | JGI24748J21848_1054316 | |||
| 1500 | JGI24744J21845_10024791 | |||
| 1501 | JGI25406J46586_10020393 | |||
| 1502 | JGI25406J46586_10143480 | |||
| 1503 | JGI25406J46586_10151684 | |||
| 1504 | JGI25153J46596_10001436 | |||
| 1505 | rootH2_10047101 | |||
| 1506 | JGI25404J52841_10002090 | |||
| 1507 | JGI25404J52841_10004756 | |||
| 1508 | JGI25404J52841_10019050 | |||
| 1509 | JGI25404J52841_10087493 | |||
| 1510 | JGI25405J52794_10049357 | |||
| 1511 | Ga0070658_10019300 | |||
| 1512 | Ga0070683_100005606 | |||
| 1513 | Ga0070683_100045273 | |||
| 1514 | Ga0070683_100198250 | |||
| 1515 | Ga0070683_100565967 | |||
| 1516 | Ga0070683_100689860 | |||
| 1517 | Ga0070690_100395641 | |||
| 1518 | Ga0068869_100216002 | |||
| 1519 | Ga0070680_100015488 | |||
| 1520 | Ga0070680_100021554 | |||
| 1521 | Ga0070680_100147196 | |||
| 1522 | Ga0070680_100224979 | |||
| 1523 | Ga0070682_100073268 | |||
| 1524 | Ga0070682_100151081 | |||
| 1525 | Ga0068868_100014248 | |||
| 1526 | Ga0068868_100354073 | |||
| 1527 | Ga0070660_100062081 | |||
| 1528 | Ga0070660_100265903 | |||
| 1529 | Ga0070660_100587922 | |||
| 1530 | Ga0070660_101004132 | |||
| 1531 | Ga0070691_10086951 | |||
| 1532 | Ga0070691_10509905 | |||
| 1533 | Ga0070661_100014484 | |||
| 1534 | Ga0070661_100462185 | |||
| 1535 | Ga0070661_100611875 | |||
| 1536 | Ga0070668_100024739 | |||
| 1537 | Ga0070668_100191433 | |||
| 1538 | Ga0070668_100288894 | |||
| 1539 | Ga0070668_100819924 | |||
| 1540 | Ga0070668_101286160 | |||
| 1541 | Ga0070675_101004799 | |||
| 1542 | Ga0070671_101279121 | |||
| 1543 | Ga0070674_100047261 | |||
| 1544 | Ga0070674_100940775 | |||
| 1545 | Ga0070673_100285973 | |||
| 1546 | Ga0070688_100121601 | |||
| 1547 | Ga0070688_100484082 | |||
| 1548 | Ga0070688_101100318 | |||
| 1549 | Ga0070659_100368928 | |||
| 1550 | Ga0070659_100503508 | |||
| 1551 | Ga0070659_101753354 | |||
| 1552 | Ga0070667_100435563 | |||
| 1553 | Ga0070667_100731178 | |||
| 1554 | Ga0070667_101284482 | |||
| 1555 | Ga0070703_10231566 | |||
| 1556 | Ga0070709_10000102 | |||
| 1557 | Ga0070709_10005140 | |||
| 1558 | Ga0070709_10195133 | |||
| 1559 | Ga0070709_10311965 | |||
| 1560 | Ga0070709_10492366 | |||
| 1561 | Ga0070709_10599692 | |||
| 1562 | Ga0070709_10706596 | |||
| 1563 | Ga0070714_100001753 | |||
| 1564 | Ga0070714_100022895 | |||
| 1565 | Ga0070714_100030514 | |||
| 1566 | Ga0070714_100036394 | |||
| 1567 | Ga0070714_100148831 | |||
| 1568 | Ga0070714_100877368 | |||
| 1569 | Ga0070714_101566761 | |||
| 1570 | Ga0070713_100002970 | |||
| 1571 | Ga0070713_100005921 | |||
| 1572 | Ga0070713_100015544 | |||
| 1573 | Ga0070713_100045016 | |||
| 1574 | Ga0070713_100140491 | |||
| 1575 | Ga0070713_100258975 | |||
| 1576 | Ga0070713_100956802 | |||
| 1577 | Ga0070710_10000526 | |||
| 1578 | Ga0070710_10019960 | |||
| 1579 | Ga0070710_10052085 | |||
| 1580 | Ga0070710_10202213 | |||
| 1581 | Ga0070710_10286858 | |||
| 1582 | Ga0070701_10369705 | |||
| 1583 | Ga0070711_100002160 | |||
| 1584 | Ga0070711_100009157 | |||
| 1585 | Ga0070711_100021560 | |||
| 1586 | Ga0070711_100091166 | |||
| 1587 | Ga0070711_100224437 | |||
| 1588 | Ga0070711_100341792 | |||
| 1589 | Ga0070711_100963038 | |||
| 1590 | Ga0070705_100201702 | |||
| 1591 | Ga0070705_100673025 | |||
| 1592 | Ga0070700_100093566 | |||
| 1593 | Ga0070708_100098711 | |||
| 1594 | Ga0070663_100038273 | |||
| 1595 | Ga0070663_100056577 | |||
| 1596 | Ga0070663_100248007 | |||
| 1597 | Ga0070663_100284375 | |||
| 1598 | Ga0070663_100461541 | |||
| 1599 | Ga0070678_100070698 | |||
| 1600 | Ga0070678_100122013 | |||
| 1601 | Ga0070678_101595481 | |||
| 1602 | Ga0070662_100022874 | |||
| 1603 | Ga0070662_100103986 | |||
| 1604 | Ga0070662_100364458 | |||
| 1605 | Ga0070662_100483133 | |||
| 1606 | Ga0070681_10023500 | |||
| 1607 | Ga0070681_10032157 | |||
| 1608 | Ga0070681_10058028 | |||
| 1609 | Ga0070681_10084358 | |||
| 1610 | Ga0070681_10570220 | |||
| 1611 | Ga0070681_10845435 | |||
| 1612 | Ga0070685_10661708 | |||
| 1613 | Ga0070706_100500165 | |||
| 1614 | Ga0070706_100777464 | |||
| 1615 | Ga0070707_100062447 | |||
| 1616 | Ga0070707_100183859 | |||
| 1617 | Ga0070707_101990451 | |||
| 1618 | Ga0070698_100220036 | |||
| 1619 | Ga0070699_100501396 | |||
| 1620 | Ga0070699_101198594 | |||
| 1621 | Ga0070679_100013119 | |||
| 1622 | Ga0070679_100026603 | |||
| 1623 | Ga0070679_100069248 | |||
| 1624 | Ga0070679_100104027 | |||
| 1625 | Ga0070679_100135854 | |||
| 1626 | Ga0070679_100536659 | |||
| 1627 | Ga0070679_101205562 | |||
| 1628 | Ga0070684_100013256 | |||
| 1629 | Ga0070684_100024555 | |||
| 1630 | Ga0070684_100326270 | |||
| 1631 | Ga0070697_100091314 | |||
| 1632 | Ga0070697_100446253 | |||
| 1633 | Ga0068853_100010809 | |||
| 1634 | Ga0068853_100015334 | |||
| 1635 | Ga0068853_100751722 | |||
| 1636 | Ga0068853_101244637 | |||
| 1637 | Ga0068853_101941198 | |||
| 1638 | Ga0070672_100264678 | |||
| 1639 | Ga0070672_100435239 | |||
| 1640 | Ga0070672_100674309 | |||
| 1641 | Ga0070686_101525500 | |||
| 1642 | Ga0070695_101049690 | |||
| 1643 | Ga0070693_100149715 | |||
| 1644 | Ga0070665_100067345 | |||
| 1645 | Ga0070665_100232545 | |||
| 1646 | Ga0070665_100633109 | |||
| 1647 | Ga0070665_100752588 | |||
| 1648 | Ga0070665_100803270 | |||
| 1649 | Ga0070704_100975041 | |||
| 1650 | Ga0068855_100013700 | |||
| 1651 | Ga0068855_100014164 | |||
| 1652 | Ga0068855_100033333 | |||
| 1653 | Ga0068855_100221967 | |||
| 1654 | Ga0068855_100750342 | |||
| 1655 | Ga0068855_100850357 | |||
| 1656 | Ga0068855_101088469 | |||
| 1657 | Ga0068855_101123183 | |||
| 1658 | Ga0068855_101554138 | |||
| 1659 | Ga0068855_102398272 | |||
| 1660 | Ga0070664_100662320 | |||
| 1661 | Ga0068857_100004954 | |||
| 1662 | Ga0068857_100025795 | |||
| 1663 | Ga0068857_100038647 | |||
| 1664 | Ga0068857_100153608 | |||
| 1665 | Ga0068857_100838610 | |||
| 1666 | Ga0068857_101369238 | |||
| 1667 | Ga0068854_100026378 | |||
| 1668 | Ga0068854_100631408 | |||
| 1669 | Ga0068856_100000451 | |||
| 1670 | Ga0068856_100000659 | |||
| 1671 | Ga0068856_100012689 | |||
| 1672 | Ga0068856_100521784 | |||
| 1673 | Ga0068856_100884698 | |||
| 1674 | Ga0068856_101305904 | |||
| 1675 | Ga0070702_100124167 | |||
| 1676 | Ga0070702_101135733 | |||
| 1677 | Ga0068852_100071562 | |||
| 1678 | Ga0068852_100139508 | |||
| 1679 | Ga0068852_100268538 | |||
| 1680 | Ga0068852_100427848 | |||
| 1681 | Ga0068852_100507167 | |||
| 1682 | Ga0068852_102437874 | |||
| 1683 | Ga0068859_100420450 | |||
| 1684 | Ga0068859_100737395 | |||
| 1685 | Ga0068864_100027097 | |||
| 1686 | Ga0068864_100289129 | |||
| 1687 | Ga0068864_100708627 | |||
| 1688 | Ga0068866_10212862 | |||
| 1689 | Ga0068866_10217413 | |||
| 1690 | Ga0068861_100202126 | |||
| 1691 | Ga0068861_100588907 | |||
| 1692 | Ga0068851_10044153 | |||
| 1693 | Ga0068851_10045043 | |||
| 1694 | Ga0068851_10057892 | |||
| 1695 | Ga0068851_10571996 | |||
| 1696 | Ga0068863_100592395 | |||
| 1697 | Ga0068858_100084248 | |||
| 1698 | Ga0068858_100196916 | |||
| 1699 | Ga0068858_100428840 | |||
| 1700 | Ga0068858_100638292 | |||
| 1701 | Ga0068860_100008418 | |||
| 1702 | Ga0068860_100360322 | |||
| 1703 | Ga0068860_100677982 | |||
| 1704 | Ga0068862_100158586 | |||
| 1705 | Ga0068862_100174424 | |||
| 1706 | Ga0068862_100325654 | |||
| 1707 | Ga0068862_101177839 | |||
| 1708 | Ga0081455_10003511 | |||
| 1709 | Ga0081455_10007726 | |||
| 1710 | Ga0081455_10012558 | |||
| 1711 | Ga0081455_10021916 | |||
| 1712 | Ga0081455_10025903 | |||
| 1713 | Ga0081455_10037165 | |||
| 1714 | Ga0081455_10496219 | |||
| 1715 | Ga0081538_10016160 | |||
| 1716 | Ga0081540_1001538 | |||
| 1717 | Ga0081540_1002078 | |||
| 1718 | Ga0081540_1003660 | |||
| 1719 | Ga0081540_1008178 | |||
| 1720 | Ga0081540_1008898 | |||
| 1721 | Ga0081540_1014574 | |||
| 1722 | Ga0081540_1032957 | |||
| 1723 | Ga0081540_1086701 | |||
| 1724 | Ga0081540_1134711 | |||
| 1725 | Ga0081540_1305108 | |||
| 1726 | Ga0081539_10000080 | |||
| 1727 | Ga0081539_10000498 | |||
| 1728 | Ga0081539_10011910 | |||
| 1729 | Ga0081539_10028294 | |||
| 1730 | Ga0081539_10071100 | |||
| 1731 | Ga0081539_10194479 | |||
| 1732 | Ga0070717_10010508 | |||
| 1733 | Ga0070717_10018723 | |||
| 1734 | Ga0070717_10046983 | |||
| 1735 | Ga0070717_10053340 | |||
| 1736 | Ga0070717_10333654 | |||
| 1737 | Ga0070717_10445232 | |||
| 1738 | Ga0070717_11002044 | |||
| 1739 | Ga0075365_10021569 | |||
| 1740 | Ga0075365_10176696 | |||
| 1741 | Ga0075365_10379106 | |||
| 1742 | Ga0075368_10247084 | |||
| 1743 | Ga0075363_100357461 | |||
| 1744 | Ga0075363_100497625 | |||
| 1745 | Ga0070716_100001641 | |||
| 1746 | Ga0070716_100002831 | |||
| 1747 | Ga0070716_100665850 | |||
| 1748 | Ga0070716_100844507 | |||
| 1749 | Ga0070716_101609299 | |||
| 1750 | Ga0070712_100026574 | |||
| 1751 | Ga0070712_100153424 | |||
| 1752 | Ga0070712_101414810 | |||
| 1753 | Ga0075362_10187526 | |||
| 1754 | Ga0075362_10195509 | |||
| 1755 | Ga0075367_10023235 | |||
| 1756 | Ga0075367_10373781 | |||
| 1757 | Ga0075367_10437006 | |||
| 1758 | Ga0075367_10440525 | |||
| 1759 | Ga0075366_10165600 | |||
| 1760 | Ga0075366_10243110 | |||
| 1761 | Ga0075366_10837026 | |||
| 1762 | Ga0075366_10977563 | |||
| 1763 | Ga0097621_100061477 | |||
| 1764 | Ga0097621_100196156 | |||
| 1765 | Ga0097621_100205780 | |||
| 1766 | Ga0097621_101842056 | |||
| 1767 | Ga0097621_101889315 | |||
| 1768 | Ga0075370_10362605 | |||
| 1769 | Ga0068871_100305229 | |||
| 1770 | Ga0068871_100704021 | |||
| 1771 | Ga0068871_100857972 | |||
| 1772 | Ga0068871_100949221 | |||
| 1773 | Ga0075434_100452156 | |||
| 1774 | Ga0075429_100897583 | |||
| 1775 | Ga0068865_100050924 | |||
| 1776 | Ga0068865_100180232 | |||
| 1777 | Ga0097620_100420422 | |||
| 1778 | Ga0097620_100737365 | |||
| 1779 | Ga0099825_1039359 | |||
| 1780 | Ga0099824_1006683 | |||
| 1781 | Ga0099822_1000418 | |||
| 1782 | Ga0075435_100724066 | |||
| 1783 | Ga0099794_10029452 | |||
| 1784 | Ga0099794_10111805 | |||
| 1785 | Ga0099794_10128782 | |||
| 1786 | Ga0099794_10458609 | |||
| 1787 | Ga0099794_10474923 | |||
| 1788 | Ga0099795_10080174 | |||
| 1789 | Ga0099795_10096198 | |||
| 1790 | Ga0099795_10128064 | |||
| 1791 | Ga0099795_10308116 | |||
| 1792 | Ga0099795_10335215 | |||
| 1793 | Ga0099795_10385831 | |||
| 1794 | Ga0105251_10560716 | |||
| 1795 | Ga0105244_10421508 | |||
| 1796 | Ga0105250_10018383 | |||
| 1797 | Ga0105240_10010878 | |||
| 1798 | Ga0105240_10026626 | |||
| 1799 | Ga0105240_10097500 | |||
| 1800 | Ga0105240_10155163 | |||
| 1801 | Ga0105240_10236739 | |||
| 1802 | Ga0105240_10427922 | |||
| 1803 | Ga0105240_10608267 | |||
| 1804 | Ga0111539_10174814 | |||
| 1805 | Ga0111539_10439612 | |||
| 1806 | Ga0105245_10026065 | |||
| 1807 | Ga0105245_11121040 | |||
| 1808 | Ga0105247_10044664 | |||
| 1809 | Ga0105247_10144089 | |||
| 1810 | Ga0105247_10203570 | |||
| 1811 | Ga0105247_10867839 | |||
| 1812 | Ga0105247_11646848 | |||
| 1813 | Ga0105243_10059410 | |||
| 1814 | Ga0105243_10659051 | |||
| 1815 | Ga0105241_10000375 | |||
| 1816 | Ga0105241_10237331 | |||
| 1817 | Ga0105241_10565195 | |||
| 1818 | Ga0105241_11255179 | |||
| 1819 | Ga0105242_10093388 | |||
| 1820 | Ga0105242_10248578 | |||
| 1821 | Ga0105242_10381833 | |||
| 1822 | Ga0105242_10477824 | |||
| 1823 | Ga0105242_10791971 | |||
| 1824 | Ga0105248_10049495 | |||
| 1825 | Ga0105237_10006382 | |||
| 1826 | Ga0105237_10008299 | |||
| 1827 | Ga0105237_10024116 | |||
| 1828 | Ga0105237_10080055 | |||
| 1829 | Ga0105237_10101460 | |||
| 1830 | Ga0105237_10148579 | |||
| 1831 | Ga0105237_10211233 | |||
| 1832 | Ga0105237_10219117 | |||
| 1833 | Ga0105237_10251855 | |||
| 1834 | Ga0105237_10644966 | |||
| 1835 | Ga0105237_11559825 | |||
| 1836 | Ga0105237_11821153 | |||
| 1837 | Ga0105238_10000885 | |||
| 1838 | Ga0105238_10005609 | |||
| 1839 | Ga0105238_10006417 | |||
| 1840 | Ga0105238_10091024 | |||
| 1841 | Ga0105238_10620117 | |||
| 1842 | Ga0105238_10982261 | |||
| 1843 | Ga0105238_11066667 | |||
| 1844 | Ga0105238_11231957 | |||
| 1845 | Ga0105238_11351498 | |||
| 1846 | Ga0105249_10079454 | |||
| 1847 | Ga0105249_10682842 | |||
| 1848 | Ga0105249_11678457 | |||
| 1849 | Ga0105249_12466770 | |||
| 1850 | Ga0099796_10008097 | |||
| 1851 | Ga0099796_10127663 | |||
| 1852 | Ga0105239_10011070 | |||
| 1853 | Ga0105239_10020488 | |||
| 1854 | Ga0105239_10024299 | |||
| 1855 | Ga0105239_10132834 | |||
| 1856 | Ga0105239_10407574 | |||
| 1857 | Ga0105239_10537658 | |||
| 1858 | Ga0105239_10547699 | |||
| 1859 | Ga0105239_10573942 | |||
| 1860 | Ga0105239_10628018 | |||
| 1861 | Ga0105239_10686103 | |||
| 1862 | Ga0105246_10118216 | |||
| 1863 | Ga0105246_10512111 | |||
| 1864 | Ga0105246_10953329 | |||
| 1865 | Ga0105246_11725248 | |||
| 1866 | Ga0157337_1021823 | |||
| 1867 | Ga0157338_1069532 | |||
| 1868 | Ga0157373_10438767 | |||
| 1869 | Ga0157371_10080655 | |||
| 1870 | Ga0157370_10163226 | |||
| 1871 | Ga0157370_10231909 | |||
| 1872 | Ga0157370_10270046 | |||
| 1873 | Ga0157370_10441653 | |||
| 1874 | Ga0157370_11983552 | |||
| 1875 | Ga0157369_10003699 | |||
| 1876 | Ga0157369_10011122 | |||
| 1877 | Ga0157369_10016823 | |||
| 1878 | Ga0157369_10685838 | |||
| 1879 | Ga0157369_10715551 | |||
| 1880 | Ga0157374_10071289 | |||
| 1881 | Ga0157374_10290805 | |||
| 1882 | Ga0157374_10581877 | |||
| 1883 | Ga0157378_10529471 | |||
| 1884 | Ga0157378_10808792 | |||
| 1885 | Ga0157378_11035404 | |||
| 1886 | Ga0157378_13056578 | |||
| 1887 | Ga0163162_10104898 | |||
| 1888 | Ga0163162_10132431 | |||
| 1889 | Ga0163162_10195168 | |||
| 1890 | Ga0163162_10355076 | |||
| 1891 | Ga0163162_13197226 | |||
| 1892 | Ga0157372_10371500 | |||
| 1893 | Ga0157372_10616929 | |||
| 1894 | Ga0157372_10662518 | |||
| 1895 | Ga0157372_10821001 | |||
| 1896 | Ga0157372_11039526 | |||
| 1897 | Ga0157372_11828009 | |||
| 1898 | Ga0157375_10078938 | |||
| 1899 | Ga0157375_10097357 | |||
| 1900 | Ga0157375_10123103 | |||
| 1901 | Ga0157375_12341988 | |||
| 1902 | Ga0157375_13145741 | |||
| 1903 | Ga0163163_10019375 | |||
| 1904 | Ga0163163_10140744 | |||
| 1905 | Ga0163163_10294331 | |||
| 1906 | Ga0163163_10522793 | |||
| 1907 | Ga0157380_10967694 | |||
| 1908 | Ga0157380_11005044 | |||
| 1909 | Ga0157380_12459464 | |||
| 1910 | Ga0182008_10151999 | |||
| 1911 | Ga0182008_10447148 | |||
| 1912 | Ga0157379_10072179 | |||
| 1913 | Ga0157379_10128607 | |||
| 1914 | Ga0157379_10309838 | |||
| 1915 | Ga0157379_10865094 | |||
| 1916 | Ga0157376_10264396 | |||
| 1917 | Ga0157376_11237193 | |||
| 1918 | Ga0206356_10824015 | |||
| 1919 | Ga0206355_1375172 | |||
| 1920 | Ga0206350_10271927 | |||
| 1921 | Ga0206354_10310108 | |||
| 1922 | Ga0213873_10086560 | |||
| 1923 | Ga0213873_10107998 | |||
| 1924 | Ga0213874_10110235 | |||
| 1925 | Ga0213874_10138265 | |||
| 1926 | Ga0213876_10018891 | |||
| 1927 | Ga0213876_10108795 | |||
| 1928 | Ga0213876_10118908 | |||
| 1929 | Ga0213876_10203730 | |||
| 1930 | Ga0213876_10701295 | |||
| 1931 | Ga0213875_10069234 | |||
| 1932 | Ga0213871_10008840 | |||
| 1933 | Ga0213871_10110776 | |||
| 1934 | Ga0224712_10110279 | |||
| 1935 | Ga0209148_1010916 | |||
| 1936 | Ga0209233_1006072 | |||
| 1937 | Ga0209455_1007118 | |||
| 1938 | Ga0209455_1014353 | |||
| 1939 | Ga0209758_1002215 | |||
| 1940 | Ga0209758_1032638 | |||
| 1941 | Ga0209758_1071592 | |||
| 1942 | Ga0207697_10027916 | |||
| 1943 | Ga0207656_10056016 | |||
| 1944 | Ga0207656_10072434 | |||
| 1945 | Ga0207656_10076710 | |||
| 1946 | Ga0207696_1032698 | |||
| 1947 | Ga0207653_10017200 | |||
| 1948 | Ga0207692_10000386 | |||
| 1949 | Ga0207692_10176207 | |||
| 1950 | Ga0207692_10370189 | |||
| 1951 | Ga0207692_10769614 | |||
| 1952 | Ga0207642_10090211 | |||
| 1953 | Ga0207642_10234165 | |||
| 1954 | Ga0207710_10043541 | |||
| 1955 | Ga0207710_10060054 | |||
| 1956 | Ga0207710_10199320 | |||
| 1957 | Ga0207710_10491124 | |||
| 1958 | Ga0207688_10013695 | |||
| 1959 | Ga0207688_10102252 | |||
| 1960 | Ga0207688_10364613 | |||
| 1961 | Ga0207647_10015721 | |||
| 1962 | Ga0207647_10251620 | |||
| 1963 | Ga0207685_10002099 | |||
| 1964 | Ga0207699_10000411 | |||
| 1965 | Ga0207699_10003008 | |||
| 1966 | Ga0207699_10072963 | |||
| 1967 | Ga0207699_10243468 | |||
| 1968 | Ga0207699_10482407 | |||
| 1969 | Ga0207699_10615968 | |||
| 1970 | Ga0207699_10861262 | |||
| 1971 | Ga0207645_10600053 | |||
| 1972 | Ga0207705_10049208 | |||
| 1973 | Ga0207705_11462528 | |||
| 1974 | Ga0207684_10420975 | |||
| 1975 | Ga0207684_10689409 | |||
| 1976 | Ga0207684_10879702 | |||
| 1977 | Ga0207654_10000629 | |||
| 1978 | Ga0207654_10061939 | |||
| 1979 | Ga0207654_10787675 | |||
| 1980 | Ga0207654_10853485 | |||
| 1981 | Ga0207707_10001473 | |||
| 1982 | Ga0207707_10013690 | |||
| 1983 | Ga0207707_10015990 | |||
| 1984 | Ga0207707_10097004 | |||
| 1985 | Ga0207707_10118392 | |||
| 1986 | Ga0207707_10132231 | |||
| 1987 | Ga0207707_10154042 | |||
| 1988 | Ga0207707_10262126 | |||
| 1989 | Ga0207695_10001265 | |||
| 1990 | Ga0207695_10039200 | |||
| 1991 | Ga0207695_10039689 | |||
| 1992 | Ga0207695_10149556 | |||
| 1993 | Ga0207695_10177166 | |||
| 1994 | Ga0207695_10226999 | |||
| 1995 | Ga0207671_10005731 | |||
| 1996 | Ga0207671_10015794 | |||
| 1997 | Ga0207671_10094235 | |||
| 1998 | Ga0207671_10101843 | |||
| 1999 | Ga0207671_10153115 | |||
| 2000 | Ga0207671_10194177 | |||
| 2001 | Ga0207671_10360592 | |||
| 2002 | Ga0207671_10418282 | |||
| 2003 | Ga0207671_10438451 | |||
| 2004 | Ga0207671_10656257 | |||
| 2005 | Ga0207671_11154680 | |||
| 2006 | Ga0207671_11180234 | |||
| 2007 | Ga0207693_10003644 | |||
| 2008 | Ga0207693_10039807 | |||
| 2009 | Ga0207693_10092044 | |||
| 2010 | Ga0207663_10000897 | |||
| 2011 | Ga0207663_10010802 | |||
| 2012 | Ga0207663_10053778 | |||
| 2013 | Ga0207663_10154973 | |||
| 2014 | Ga0207663_10171764 | |||
| 2015 | Ga0207663_10694508 | |||
| 2016 | Ga0207660_10003205 | |||
| 2017 | Ga0207660_10022034 | |||
| 2018 | Ga0207660_10158340 | |||
| 2019 | Ga0207660_10633529 | |||
| 2020 | Ga0207657_10011790 | |||
| 2021 | Ga0207657_10318372 | |||
| 2022 | Ga0207657_11231774 | |||
| 2023 | Ga0207649_10595718 | |||
| 2024 | Ga0207652_10006959 | |||
| 2025 | Ga0207652_10012754 | |||
| 2026 | Ga0207652_10038366 | |||
| 2027 | Ga0207652_10129055 | |||
| 2028 | Ga0207652_10325541 | |||
| 2029 | Ga0207652_11025320 | |||
| 2030 | Ga0207646_10077709 | |||
| 2031 | Ga0207646_11560447 | |||
| 2032 | Ga0207681_10050253 | |||
| 2033 | Ga0207694_10000082 | |||
| 2034 | Ga0207694_10025115 | |||
| 2035 | Ga0207694_10031933 | |||
| 2036 | Ga0207694_10032555 | |||
| 2037 | Ga0207694_10161959 | |||
| 2038 | Ga0207694_10706418 | |||
| 2039 | Ga0207694_11325223 | |||
| 2040 | Ga0207694_11390093 | |||
| 2041 | Ga0207650_10247985 | |||
| 2042 | Ga0207687_10029908 | |||
| 2043 | Ga0207687_10105185 | |||
| 2044 | Ga0207687_10918961 | |||
| 2045 | Ga0207700_10003087 | |||
| 2046 | Ga0207700_10006990 | |||
| 2047 | Ga0207700_10010852 | |||
| 2048 | Ga0207700_10011089 | |||
| 2049 | Ga0207700_10021835 | |||
| 2050 | Ga0207700_10029340 | |||
| 2051 | Ga0207700_10102684 | |||
| 2052 | Ga0207700_10613897 | |||
| 2053 | Ga0207700_10862135 | |||
| 2054 | Ga0207664_10004435 | |||
| 2055 | Ga0207664_10070887 | |||
| 2056 | Ga0207664_10140973 | |||
| 2057 | Ga0207664_10271666 | |||
| 2058 | Ga0207664_10553805 | |||
| 2059 | Ga0207664_10705276 | |||
| 2060 | Ga0207664_11206854 | |||
| 2061 | Ga0207690_10945993 | |||
| 2062 | Ga0207706_10080562 | |||
| 2063 | Ga0207706_10098139 | |||
| 2064 | Ga0207706_10171143 | |||
| 2065 | Ga0207706_10460652 | |||
| 2066 | Ga0207686_10065126 | |||
| 2067 | Ga0207686_10675169 | |||
| 2068 | Ga0207709_10065212 | |||
| 2069 | Ga0207709_10471578 | |||
| 2070 | Ga0207670_10187476 | |||
| 2071 | Ga0207670_10771539 | |||
| 2072 | Ga0207669_10032231 | |||
| 2073 | Ga0207669_10579773 | |||
| 2074 | Ga0207669_10719273 | |||
| 2075 | Ga0207704_10330524 | |||
| 2076 | Ga0207665_10001244 | |||
| 2077 | Ga0207665_10003077 | |||
| 2078 | Ga0207665_10129259 | |||
| 2079 | Ga0207665_10287312 | |||
| 2080 | Ga0207665_10689963 | |||
| 2081 | Ga0207691_10273607 | |||
| 2082 | Ga0207691_10610493 | |||
| 2083 | Ga0207711_10468581 | |||
| 2084 | Ga0207711_10501381 | |||
| 2085 | Ga0207661_10003495 | |||
| 2086 | Ga0207661_10010884 | |||
| 2087 | Ga0207661_10100708 | |||
| 2088 | Ga0207661_10956302 | |||
| 2089 | Ga0207679_10461889 | |||
| 2090 | Ga0207667_10006677 | |||
| 2091 | Ga0207667_10008474 | |||
| 2092 | Ga0207667_10009542 | |||
| 2093 | Ga0207667_10109324 | |||
| 2094 | Ga0207667_10120372 | |||
| 2095 | Ga0207667_10261496 | |||
| 2096 | Ga0207667_10324817 | |||
| 2097 | Ga0207667_10513264 | |||
| 2098 | Ga0207667_10557116 | |||
| 2099 | Ga0207667_10559959 | |||
| 2100 | Ga0207667_11554073 | |||
| 2101 | Ga0207651_10284249 | |||
| 2102 | Ga0207651_10297316 | |||
| 2103 | Ga0207712_10534468 | |||
| 2104 | Ga0207712_10654023 | |||
| 2105 | Ga0207712_11556679 | |||
| 2106 | Ga0207668_10062419 | |||
| 2107 | Ga0207668_10377764 | |||
| 2108 | Ga0207668_10405016 | |||
| 2109 | Ga0207640_10023703 | |||
| 2110 | Ga0207640_10956990 | |||
| 2111 | Ga0207640_11103959 | |||
| 2112 | Ga0207658_10453227 | |||
| 2113 | Ga0207658_10643294 | |||
| 2114 | Ga0207658_11865055 | |||
| 2115 | Ga0207677_10196330 | |||
| 2116 | Ga0207677_10323936 | |||
| 2117 | Ga0207703_10155612 | |||
| 2118 | Ga0207703_10201766 | |||
| 2119 | Ga0207703_10306009 | |||
| 2120 | Ga0207703_10401115 | |||
| 2121 | Ga0207703_11665711 | |||
| 2122 | Ga0207703_12296747 | |||
| 2123 | Ga0207639_10003792 | |||
| 2124 | Ga0207639_10171290 | |||
| 2125 | Ga0207639_10183444 | |||
| 2126 | Ga0207639_10443502 | |||
| 2127 | Ga0207639_10465134 | |||
| 2128 | Ga0207639_10651857 | |||
| 2129 | Ga0207639_11205679 | |||
| 2130 | Ga0207639_11437911 | |||
| 2131 | Ga0207678_10113995 | |||
| 2132 | Ga0207678_10200272 | |||
| 2133 | Ga0207678_10219791 | |||
| 2134 | Ga0207678_10322042 | |||
| 2135 | Ga0207708_10104541 | |||
| 2136 | Ga0207708_10175317 | |||
| 2137 | Ga0207702_10000002 | |||
| 2138 | Ga0207702_10000478 | |||
| 2139 | Ga0207702_10061546 | |||
| 2140 | Ga0207702_10195697 | |||
| 2141 | Ga0207702_10391416 | |||
| 2142 | Ga0207702_10990687 | |||
| 2143 | Ga0207702_11263645 | |||
| 2144 | Ga0207641_10896810 | |||
| 2145 | Ga0207641_11050143 | |||
| 2146 | Ga0207648_10021511 | |||
| 2147 | Ga0207648_10995497 | |||
| 2148 | Ga0207676_10089392 | |||
| 2149 | Ga0207676_10116170 | |||
| 2150 | Ga0207676_10849018 | |||
| 2151 | Ga0207676_12492721 | |||
| 2152 | Ga0207674_10007536 | |||
| 2153 | Ga0207674_10011165 | |||
| 2154 | Ga0207674_10028212 | |||
| 2155 | Ga0207674_10034482 | |||
| 2156 | Ga0207674_10103770 | |||
| 2157 | Ga0207674_10648307 | |||
| 2158 | Ga0207675_100404646 | |||
| 2159 | Ga0207675_101322776 | |||
| 2160 | Ga0207683_10104603 | |||
| 2161 | Ga0207683_10198179 | |||
| 2162 | Ga0207683_10365184 | |||
| 2163 | Ga0207683_10783150 | |||
| 2164 | Ga0207683_10960871 | |||
| 2165 | Ga0207698_10122325 | |||
| 2166 | Ga0207698_10225106 | |||
| 2167 | Ga0207698_10417946 | |||
| 2168 | Ga0207698_10505617 | |||
| 2169 | Ga0207698_10535508 | |||
| 2170 | Ga0207698_10777761 | |||
| 2171 | Ga0207698_10909777 | |||
| 2172 | Ga0209589_1000003 | |||
| 2173 | Ga0209489_100003 | |||
| 2174 | Ga0209700_100003 | |||
| 2175 | Ga0209179_1033288 | |||
| 2176 | Ga0209179_1067049 | |||
| 2177 | Ga0209179_1089564 | |||
| 2178 | Ga0209179_1133571 | |||
| 2179 | Ga0209588_1023809 | |||
| 2180 | Ga0209813_10177077 | |||
| 2181 | Ga0268266_10162678 | |||
| 2182 | Ga0268266_10215025 | |||
| 2183 | Ga0268266_10264045 | |||
| 2184 | Ga0268266_10726009 | |||
| 2185 | Ga0268266_10744311 | |||
| 2186 | Ga0268266_11606005 | |||
| 2187 | Ga0268266_11809873 | |||
| 2188 | Ga0268265_10517250 | |||
| 2189 | Ga0268265_10587354 | |||
| 2190 | Ga0268265_10701635 | |||
| 2191 | Ga0268264_10000043 | |||
| 2192 | Ga0268264_10497575 | |||
| 2193 | Ga0265337_1018947 | |||
| 2194 | Ga0265319_1012285 | |||
| 2195 | Ga0265334_10023180 | |||
| 2196 | Ga0265334_10086784 | |||
| 2197 | Ga0265318_10003124 | |||
| 2198 | Ga0265323_10001316 | |||
| 2199 | Ga0265322_10003976 | |||
| 2200 | Ga0265336_10000579 | |||
| 2201 | Ga0307517_10215992 | |||
| 2202 | Ga0307515_10055010 | |||
| 2203 | Ga0265338_10001398 | |||
| 2204 | Ga0265324_10010613 | |||
| 2205 | Ga0307511_10101511 | |||
| 2206 | Ga0307511_10119276 | |||
| 2207 | Ga0265762_1068277 | |||
| 2208 | Ga0265763_1017816 | |||
| 2209 | Ga0265770_1083041 | |||
| 2210 | Ga0265330_10021534 | |||
| 2211 | Ga0265330_10029380 | |||
| 2212 | Ga0265332_10043626 | |||
| 2213 | Ga0265332_10087499 | |||
| 2214 | Ga0265325_10029462 | |||
| 2215 | Ga0265340_10002366 | |||
| 2216 | Ga0265339_10009369 | |||
| 2217 | Ga0265339_10019907 | |||
| 2218 | Ga0265339_10119706 | |||
| 2219 | Ga0265339_10325624 | |||
| 2220 | Ga0265339_10539454 | |||
| 2221 | Ga0265331_10038825 | |||
| 2222 | Ga0265331_10112707 | |||
| 2223 | Ga0265316_10090463 | |||
| 2224 | Ga0265316_10182294 | |||
| 2225 | Ga0307513_10462563 | |||
| 2226 | Ga0307513_10547481 | |||
| 2227 | Ga0307513_11044200 | |||
| 2228 | Ga0307509_10224089 | |||
| 2229 | Ga0307509_10233876 | |||
| 2230 | Ga0307509_10264488 | |||
| 2231 | Ga0307509_10510776 | |||
| 2232 | Ga0307509_10744184 | |||
| 2233 | Ga0307408_100878894 | |||
| 2234 | Ga0265313_10126662 | |||
| 2235 | Ga0265313_10284172 | |||
| 2236 | Ga0307508_10001059 | |||
| 2237 | Ga0307508_10007228 | |||
| 2238 | Ga0307508_10060565 | |||
| 2239 | Ga0307508_10351820 | |||
| 2240 | Ga0265314_10008943 | |||
| 2241 | Ga0265342_10002731 | |||
| 2242 | Ga0265342_10031442 | |||
| 2243 | Ga0265342_10216379 | |||
| 2244 | Ga0307516_10015493 | |||
| 2245 | Ga0307516_10063699 | |||
| 2246 | Ga0307516_10096643 | |||
| 2247 | Ga0307516_10135644 | |||
| 2248 | Ga0307516_10145136 | |||
| 2249 | Ga0307516_10152987 | |||
| 2250 | Ga0307516_10176035 | |||
| 2251 | Ga0307516_10252540 | |||
| 2252 | Ga0307516_10547677 | |||
| 2253 | Ga0307405_10745487 | |||
| 2254 | Ga0307406_10829845 | |||
| 2255 | Ga0307412_10235492 | |||
| 2256 | Ga0307409_100308665 | |||
| 2257 | Ga0307409_101601930 | |||
| 2258 | Ga0307416_100901219 | |||
| 2259 | Ga0307416_100987456 | |||
| 2260 | Ga0307414_10389249 | |||
| 2261 | Ga0307411_11280264 | |||
| 2262 | Ga0307415_100980503 | |||
| 2263 | Ga0307507_10088859 | |||
| 2264 | Ga0307510_10010241 | |||
| 2265 | Ga0307510_10019329 | |||
| 2266 | Ga0307510_10109337 | |||
| 2267 | Ga0307510_10230706 | |||
| 2268 | Ga0307510_10340909 | |||
| 2269 | Ga0315911_1000001 | |||
| 2270 | Ga0316215_1000526 | |||
| 2271 | Ga0373926_0003514 | |||
| 2272 | Ga0373928_0002944 | |||
| 2273 | Ga0373929_0198895 | |||
| 2274 | Ga0373934_0012801 | |||
| 2275 | Ga0373934_0018581 | |||
| 2276 | Ga0373934_0278486 | |||
| 2277 | Ga0373940_0114722 | |||
| 2278 | Ga0373944_0200611 | |||
| 2279 | Ga0373949_0310641 | |||
| 2280 | Ga0373952_0180603 | |||
| 2281 | Ga0373923_0001405 | |||
| 2282 | Ga0373923_0033984 | |||
| 2283 | Ga0373932_0113753 | |||
| 2284 | Ga0373936_0011153 | |||
| 2285 | Ga0373936_0014114 | |||
| 2286 | Ga0373936_0021286 | |||
| 2287 | Ga0373936_0255164 | |||
| 2288 | Ga0373941_0177706 | |||
| 2289 | Ga0373953_0001516 | |||
| 2290 | Ga0373953_0042708 | |||
| 2291 | Ga0373953_0046928 | |||
| 2292 | Ga0373953_0135714 | |||
| 2293 | Ga0373953_0178273 | |||
| 2294 | Ga0373953_0267192 | |||
| 2295 | Ga0373954_0000132 | |||
| 2296 | Ga0373954_0012512 | |||
| 2297 | Ga0373954_0120546 | |||
| 2298 | Ga0373954_0165687 | |||
| 2299 | Ga0373956_0041475 | |||
| 2300 | Ga0373956_0417455 | |||
| 2301 | Ga0373957_0000168 | |||
| 2302 | Ga0373957_0024164 | |||
| 2303 | Ga0373957_0115560 | |||
| 2304 | Ga0373960_0116131 | |||
| 2305 | Ga0373960_0347968 | |||
| 2306 | Ga0373943_0033585 | |||
| 2307 | Ga0373943_0053207 | |||
| 2308 | Ga0373943_0121474 | |||
| 2309 | Ga0373943_0407583 | |||
| 2310 | Ga0373946_0003228 | |||
| 2311 | Ga0373946_0074634 | |||
| 2312 | Ga0373946_0078850 | |||
| 2313 | Ga0373955_0001612 | |||
| 2314 | Ga0373955_0007649 | |||
| 2315 | Ga0373955_0055600 | |||
| 2316 | Ga0373955_0304498 | |||
| 2317 | Ga0373942_0008063 | |||
| 2318 | Ga0373962_0303142 | |||
| 2319 | Ga0373924_0006263 | |||
| 2320 | Ga0373924_0017596 | |||
| 2321 | Ga0373924_0047743 | |||
| 2322 | Ga0373924_0203407 | |||
| 2323 | Ga0373931_0004299 | |||
| 2324 | Ga0373931_0063897 | |||
| 2325 | Ga0373935_0000435 | |||
| 2326 | Ga0373935_0019538 | |||
| 2327 | Ga0373935_0391622 | |||
| 2328 | Ga0373935_0585129 | |||
| 2329 | Ga0373935_0770135 | |||
| 2330 | Ga0373927_0002587 | |||
| 2331 | Ga0373927_0008673 | |||
| 2332 | Ga0373927_0010027 | |||
| 2333 | Ga0373927_0027124 | |||
| 2334 | Ga0373927_0106796 | |||
| 2335 | Ga0373927_0462735 | |||
| 2336 | Ga0373927_0493178 | |||
| 2337 | Ga0373927_0575714 | |||
| 2338 | Ga0373927_0661197 | |||
| 2339 | Ga0373927_0832459 | |||
| 2340 | Ga0373933_0000243 | |||
| 2341 | Ga0373933_0069361 | |||
| 2342 | Ga0373933_0218792 | |||
| 2343 | Ga0373947_0007586 | |||
| 2344 | Ga0373947_0012060 | |||
| 2345 | Ga0373947_0024670 | |||
| 2346 | Ga0373947_0038731 | |||
| 2347 | Ga0373947_0186019 | |||
| 2348 | Ga0373947_0355932 | |||
| 2349 | Ga0373947_0436874 | |||
| 2350 | Ga0373947_0608518 | |||
| 2351 | Ga0373947_1198408 | |||
| 2352 | Ga0373937_0039688 | |||
| 2353 | Ga0373937_0196956 | |||
| 2354 | Ga0373937_0244436 | |||
| 2355 | Ga0373937_0667895 | |||
| 2356 | Ga0373937_0728048 | |||
| 2357 | Ga0310109_054355 | |||
| 2358 | Ga0373925_0001774 | |||
| 2359 | Ga0373925_0045958 | |||
| 2360 | Ga0373925_0054102 | |||
| 2361 | Ga0373925_0067551 | |||
| 2362 | Ga0373925_0483407 | |||
| 2363 | Ga0373925_0593208 | |||
| 2364 | Ga0373925_0807177 | |||
| 2365 | Ga0373925_0943314 | |||
| 2366 | Ga0395900_0072533 | |||
| 2367 | Ga0395900_0809546 | |||
| 2368 | Ga0395898_1678239 | |||
| 2369 | Ga0395905_0022828 | |||
| 2370 | Ga0395905_1235047 | |||
| 2371 | Ga0436364_0235897 | |||
| 2372 | Ga0436364_0740920 | |||
| 2373 | Ga0436364_1140579 | |||
| 2374 | Ga0395901_0797843 | |||
| 2375 | Ga0395901_0997229 | |||
| 2376 | Ga0436365_0090210 | |||
| 2377 | Ga0436365_0136317 | |||
| 2378 | Ga0436365_0186711 | |||
| 2379 | Ga0436365_0482256 | |||
| 2380 | Ga0436365_0948552 | |||
| 2381 | Ga0436365_0996952 | |||
| 2382 | Ga0436365_1250872 | |||
| 2383 | Ga0436365_1444108 | |||
| 2384 | Ga0436365_1455192 | |||
| 2385 | Ga0436365_1458230 | |||
| 2386 | Ga0436360_0485622 | |||
| 2387 | Ga0436360_0577390 | |||
| 2388 | Ga0436360_0979855 | |||
| 2389 | Ga0436360_1055908 | |||
| 2390 | Ga0436360_1355672 | |||
| 2391 | Ga0436361_0350312 | |||
| 2392 | Ga0436361_0886899 | |||
| 2393 | Ga0436361_0915746 | |||
| 2394 | Ga0436361_0924062 | |||
| 2395 | Ga0436361_1001085 | |||
| 2396 | Ga0436361_1175390 | |||
| 2397 | Ga0436363_1278748 | |||
| 2398 | Ga0436363_1347498 | |||
| 2399 | Ga0436362_0377775 | |||
| 2400 | Ga0436362_0382758 | |||
| 2401 | Ga0436362_0610597 | |||
| 2402 | Ga0436362_1238292 | |||
| 2403 | Ga0439465_0103614 | |||
| 2404 | Ga0451791_1702097 | |||
| 2405 | Ga0451793_0207987 | |||
| 2406 | Ga0451797_1118947 | |||
| 2407 | Ga0451795_0620610 | |||
| 2408 | Ga0451798_0117060 | |||
| 2409 | Ga0451800_1531708 | |||
| 2410 | Ga0451802_1867047 | |||
| 2411 | Ga0451807_0039385 | |||
| 2412 | Ga0451807_1920733 | |||
| 2413 | Ga0451841_1263376 | |||
| 2414 | Ga0451851_0996538 | |||
| 2415 | Ga0451855_0429867 | |||
| 2416 | Ga0451853_3357421 | |||
| 2417 | Ga0451853_3867451 | |||
| 2418 | Ga0466966_0094483 | |||
| 2419 | Ga0466966_0099429 | |||
| 2420 | Ga0466961_0898865 | |||
| 2421 | Ga0466963_0306964 | |||
| 2422 | Ga0466963_0362647 | |||
| 2423 | Ga0466963_0915584 | |||
| 2424 | Ga0466964_0096969 | |||
| 2425 | Ga0466971_0147944 | |||
| 2426 | Ga0466968_0284005 | |||
| 2427 | Ga0466970_0086575 | |||
| 2428 | Ga0466957_0297805 | |||
| 2429 | Ga0466957_0407907 | |||
| 2430 | Ga0466957_1375010 | |||
| 2431 | Ga0466959_0011001 | |||
| 2432 | Ga0466967_0093443 | |||
| 2433 | Ga0466967_0139617 | |||
| 2434 | Ga0466967_0154900 | |||
| 2435 | Ga0466967_0272497 | |||
| 2436 | Ga0466967_1731067 | |||
| 2437 | Ga0466967_2361388 | |||
| 2438 | Ga0495617_175702 | |||
| 2439 | Ga0495627_162677 | |||
| 2440 | Ga0495592_0000316 | |||
| 2441 | Ga0495592_0047468 | |||
| 2442 | Ga0495592_0049440 | |||
| 2443 | Ga0495592_0181288 | |||
| 2444 | Ga0495603_0001446 | |||
| 2445 | Ga0495603_0022841 | |||
| 2446 | Ga0495603_0048318 | |||
| 2447 | Ga0495603_0145569 | |||
| 2448 | Ga0495603_0195978 | |||
| 2449 | Ga0495603_0501199 | |||
| 2450 | Ga0495629_0000176 | |||
| 2451 | Ga0495629_0008069 | |||
| 2452 | Ga0495629_0115694 | |||
| 2453 | Ga0495638_0161606 | |||
| 2454 | Ga0495638_0167148 | |||
| 2455 | Ga0495641_0007242 | |||
| 2456 | Ga0495641_0246112 | |||
| 2457 | Ga0495651_0002336 | |||
| 2458 | Ga0495651_0034663 | |||
| 2459 | Ga0495651_0036289 | |||
| 2460 | Ga0495651_0133363 | |||
| 2461 | Ga0495653_0002333 | |||
| 2462 | Ga0495653_0048677 | |||
| 2463 | Ga0495653_0677016 | |||
| 2464 | Ga0495650_0114507 | |||
| 2465 | Ga0495580_0001310 | |||
| 2466 | Ga0495580_0026506 | |||
| 2467 | Ga0495580_0241022 | |||
| 2468 | Ga0495580_0433341 | |||
| 2469 | Ga0495582_0000545 | |||
| 2470 | Ga0495582_0019184 | |||
| 2471 | Ga0495582_0325338 | |||
| 2472 | Ga0495605_0328411 | |||
| 2473 | Ga0495639_0010592 | |||
| 2474 | Ga0495639_0089834 | |||
| 2475 | Ga0495639_0103776 | |||
| 2476 | Ga0495639_0272352 | |||
| 2477 | Ga0495662_0003999 | |||
| 2478 | Ga0495662_0171896 | |||
| 2479 | Ga0495664_0016518 | |||
| 2480 | Ga0495664_0022116 | |||
| 2481 | Ga0495664_0112353 | |||
| 2482 | Ga0495664_0123109 | |||
| 2483 | Ga0495664_0140249 | |||
| 2484 | Ga0495664_0267503 | |||
| 2485 | Ga0495664_0761221 | |||
| 2486 | Ga0495584_0493114 | |||
| 2487 | Ga0495585_0035267 | |||
| 2488 | Ga0495585_0180295 | |||
| 2489 | Ga0495585_0279772 | |||
| 2490 | Ga0495594_0000020 | |||
| 2491 | Ga0495594_0087977 | |||
| 2492 | Ga0495594_0249012 | |||
| 2493 | Ga0495594_0313122 | |||
| 2494 | Ga0495594_0511637 | |||
| 2495 | Ga0495594_0536512 | |||
| 2496 | Ga0495583_0212960 | |||
| 2497 | Ga0495606_0003820 | |||
| 2498 | Ga0495606_0320351 | |||
| 2499 | Ga0495606_0328870 | |||
| 2500 | Ga0495606_0402991 | |||
| 2501 | Ga0495608_0005003 | |||
| 2502 | Ga0495608_0076801 | |||
| 2503 | Ga0495610_0070605 | |||
| 2504 | Ga0495610_0181975 | |||
| 2505 | Ga0495616_0060187 | |||
| 2506 | Ga0495618_0078963 | |||
| 2507 | Ga0495618_0125439 | |||
| 2508 | Ga0495618_0174603 | |||
| 2509 | Ga0495618_0324373 | |||
| 2510 | Ga0495620_0251452 | |||
| 2511 | Ga0495620_0256667 | |||
| 2512 | Ga0495628_0010144 | |||
| 2513 | Ga0495628_0058137 | |||
| 2514 | Ga0495628_0075750 | |||
| 2515 | Ga0495628_1190507 | |||
| 2516 | Ga0495630_0044087 | |||
| 2517 | Ga0495630_0274763 | |||
| 2518 | Ga0495630_0904493 | |||
| 2519 | Ga0495630_1100710 | |||
| 2520 | Ga0495631_0025372 | |||
| 2521 | Ga0495631_0162612 | |||
| 2522 | Ga0495631_0363391 | |||
| 2523 | Ga0495632_0138676 | |||
| 2524 | Ga0495632_0150187 | |||
| 2525 | Ga0495632_0296297 | |||
| 2526 | Ga0495637_0336925 | |||
| 2527 | Ga0495644_0078643 | |||
| 2528 | Ga0495644_0318893 | |||
| 2529 | Ga0495644_0430845 | |||
| 2530 | Ga0495648_0028869 | |||
| 2531 | Ga0495648_0093578 | |||
| 2532 | Ga0495666_0010941 | |||
| 2533 | Ga0495652_0004857 | |||
| 2534 | Ga0495652_0047989 | |||
| 2535 | Ga0495652_0355006 | |||
| 2536 | Ga0495652_0979629 | |||
| 2537 | Ga0495654_0090172 | |||
| 2538 | Ga0495665_0000170 | |||
| 2539 | Ga0495665_0137466 | |||
| 2540 | Ga0495640_0002547 | |||
| 2541 | Ga0495640_0010374 | |||
| 2542 | Ga0495640_0094459 | |||
| 2543 | Ga0495640_0593690 | |||
| 2544 | Ga0495640_0856612 | |||
| 2545 | Ga0495587_0001071 | |||
| 2546 | Ga0495587_0031364 | |||
| 2547 | Ga0495587_0602018 | |||
| 2548 | Ga0495598_0013908 | |||
| 2549 | Ga0495609_0309606 | |||
| 2550 | Ga0495609_0427873 | |||
| 2551 | Ga0495621_0043795 | |||
| 2552 | Ga0495645_0003790 | |||
| 2553 | Ga0495645_0011662 | |||
| 2554 | Ga0495622_0002079 | |||
| 2555 | Ga0495622_0028006 | |||
| 2556 | Ga0495622_0229126 | |||
| 2557 | Ga0495667_0007097 | |||
| 2558 | Ga0495667_0046148 | |||
| 2559 | Ga0495667_0558964 | |||
| 2560 | Ga0495656_0050030 | |||
| 2561 | Ga0495656_0114997 | |||
| 2562 | Ga0495668_0041329 | |||
| 2563 | Ga0495668_0250745 | |||
| 2564 | Ga0495668_0304781 | |||
| 2565 | Ga0495668_0439123 | |||
| 2566 | Ga0495634_0000998 | |||
| 2567 | Ga0495634_0019197 | |||
| 2568 | Ga0495634_0111197 | |||
| 2569 | Ga0495634_0402870 | |||
| 2570 | Ga0495611_0040906 | |||
| 2571 | Ga0495611_0379933 | |||
| 2572 | Ga0495625_0260674 | |||
| 2573 | Ga0495625_0400839 | |||
| 2574 | Ga0495635_0000040 | |||
| 2575 | Ga0495635_0030879 | |||
| 2576 | Ga0495635_0084818 | |||
| 2577 | Ga0495635_0177498 | |||
| 2578 | Ga0495659_0031086 | |||
| 2579 | Ga0495659_0049398 | |||
| 2580 | Ga0495661_0108816 | |||
| 2581 | Ga0495588_0010035 | |||
| 2582 | Ga0495588_0063546 | |||
| 2583 | Ga0495588_0257880 | |||
| 2584 | Ga0495657_0000218 | |||
| 2585 | Ga0495657_0204325 | |||
| 2586 | Ga0495657_0460422 | |||
| 2587 | Ga0495657_0640031 | |||
| 2588 | Ga0495599_0000256 | |||
| 2589 | Ga0495599_0044271 | |||
| 2590 | Ga0495599_0049469 | |||
| 2591 | Ga0495599_0097164 | |||
| 2592 | Ga0495623_0013540 | |||
| 2593 | Ga0495623_0085754 | |||
| 2594 | Ga0495623_0422695 | |||
| 2595 | Ga0495623_0597224 | |||
| 2596 | Ga0495646_0003573 | |||
| 2597 | Ga0495646_0083110 | |||
| 2598 | Ga0495646_0534592 | |||
| 2599 | Ga0495647_0001303 | |||
| 2600 | Ga0495647_0065497 | |||
| 2601 | Ga0495647_0128312 | |||
| 2602 | Ga0495647_0218145 | |||
| 2603 | Ga0495658_0002344 | |||
| 2604 | Ga0495669_0004164 | |||
| 2605 | Ga0495669_0052804 | |||
| 2606 | Ga0495669_0101358 | |||
| 2607 | Ga0495669_0210326 | |||
| 2608 | Ga0495669_0274305 | |||
| 2609 | Ga0495669_0393434 | |||
| 2610 | Ga0495613_0017244 | |||
| 2611 | Ga0495613_0148878 | |||
| 2612 | Ga0495613_0276398 | |||
| 2613 | Ga0495613_0759863 | |||
| 2614 | Ga0495624_0009089 | |||
| 2615 | Ga0495624_0037826 | |||
| 2616 | Ga0495624_0295698 | |||
| 2617 | Ga0495624_0523356 | |||
| 2618 | Ga0495670_0082771 | |||
| 2619 | Ga0495670_0170470 | |||
| 2620 | Ga0495671_0074187 | |||
| 2621 | Ga0495671_0153623 | |||
| 2622 | Ga0495649_0276088 | |||
| 2623 | Ga0495589_0243042 | |||
| 2624 | Ga0495589_0381400 | |||
| 2625 | Ga0495600_0000541 | |||
| 2626 | Ga0495600_0067787 | |||
| 2627 | Ga0495600_0086718 | |||
| 2628 | Ga0495581_0003140 | |||
| 2629 | Ga0495581_0023393 | |||
| 2630 | Ga0495581_0061621 | |||
| 2631 | Ga0495581_0066144 | |||
| 2632 | Ga0495581_0623858 | |||
| 2633 | Ga0495604_0001811 | |||
| 2634 | Ga0495604_0343396 | |||
| 2635 | Ga0495604_0402588 | |||
| 2636 | Ga0495604_0521387 | |||
| 2637 | Ga0495604_0594829 | |||
| 2638 | Ga0495636_0464653 | |||
| 2639 | Ga0495674_0000600 | |||
| 2640 | Ga0495674_0077886 | |||
| 2641 | Ga0495674_0634500 | |||
| 2642 | Ga0495674_0750856 | |||
| 2643 | Ga0495672_0007934 | |||
| 2644 | Ga0495672_0200728 | |||
| 2645 | Ga0495672_0260818 | |||
| 2646 | Ga0495676_0037688 | |||
| 2647 | Ga0495676_0046483 | |||
| 2648 | Ga0495676_0049266 | |||
| 2649 | Ga0495676_0320194 | |||
| 2650 | Ga0495680_0011919 | |||
| 2651 | Ga0495680_0059137 | |||
| 2652 | Ga0495680_0080401 | |||
| 2653 | Ga0495680_0396202 | |||
| 2654 | Ga0495680_0433135 | |||
| 2655 | Ga0495680_0501396 | |||
| 2656 | Ga0495683_0058376 | |||
| 2657 | Ga0495683_0088393 | |||
| 2658 | Ga0495683_0158602 | |||
| 2659 | Ga0495675_0055004 | |||
| 2660 | Ga0495677_0123238 | |||
| 2661 | Ga0495677_0362708 | |||
| 2662 | Ga0495679_050073 | |||
| 2663 | Ga0495685_282846 | |||
| 2664 | Ga0495673_0064876 | |||
| 2665 | Ga0495673_0091021 | |||
| 2666 | Ga0495673_0260515 | |||
| 2667 | Ga0495684_0000023 | |||
| 2668 | Ga0495684_0035362 | |||
| 2669 | Ga0495684_0041506 | |||
| 2670 | Ga0495593_0003332 | |||
| 2671 | Ga0495593_0005773 | |||
| 2672 | Ga0495593_0086730 | |||
| 2673 | Ga0495602_0008270 | |||
| 2674 | Ga0495602_0079174 | |||
| 2675 | Ga0495602_0222208 | |||
| 2676 | Ga0495602_0480250 | |||
| 2677 | Ga0495614_0513275 | |||
| 2678 | Ga0496100_0005982 | |||
| 2679 | Ga0496100_0162736 | |||
| 2680 | Ga0496100_0386942 | |||
| 2681 | Ga0496101_0025777 | |||
| 2682 | Ga0496101_0038511 | |||
| 2683 | Ga0496101_0224261 | |||
| 2684 | Ga0496101_0637589 | |||
| 2685 | Ga0496102_0008125 | |||
| 2686 | Ga0496102_0156905 | |||
| 2687 | Ga0496102_0275430 | |||
| 2688 | Ga0496102_0311979 | |||
| 2689 | Ga0496102_0558399 | |||
| 2690 | Ga0496103_0042708 | |||
| 2691 | Ga0496103_0126537 | |||
| 2692 | Ga0496104_0020842 | |||
| 2693 | Ga0496104_0029258 | |||
| 2694 | Ga0496104_0075547 | |||
| 2695 | Ga0496104_0370557 | |||
| 2696 | Ga0496104_0393197 | |||
| 2697 | Ga0496105_0008473 | |||
| 2698 | Ga0496105_0054973 | |||
| 2699 | Ga0496105_0255995 | |||
| 2700 | Ga0496105_0275710 | |||
| 2701 | Ga0496105_0320305 | |||
| 2702 | Ga0496105_0805733 | |||
| 2703 | Ga0496106_0008202 | |||
| 2704 | Ga0496106_0041693 | |||
| 2705 | Ga0496106_0046901 | |||
| 2706 | Ga0496106_0050608 | |||
| 2707 | Ga0496106_0061464 | |||
| 2708 | Ga0496106_0075215 | |||
| 2709 | Ga0496106_1198276 | |||
| 2710 | Ga0496107_0022899 | |||
| 2711 | Ga0496107_0035705 | |||
| 2712 | Ga0496107_0065602 | |||
| 2713 | Ga0496107_0168783 | |||
| 2714 | Ga0496107_0176583 | |||
| 2715 | Ga0496107_0216401 | |||
| 2716 | Ga0496107_0612891 | |||
| 2717 | Ga0496107_0636235 | |||
| 2718 | Ga0496108_0003213 | |||
| 2719 | Ga0496108_0010940 | |||
| 2720 | Ga0496108_0012155 | |||
| 2721 | Ga0496108_0039596 | |||
| 2722 | Ga0496108_0053217 | |||
| 2723 | Ga0496108_1352100 | |||
| 2724 | Ga0496109_0002585 | |||
| 2725 | Ga0496109_0016135 | |||
| 2726 | Ga0496109_0025566 | |||
| 2727 | Ga0496109_0260761 | |||
| 2728 | Ga0496109_0507382 | |||
| 2729 | Ga0496109_1310615 | |||
| 2730 | Ga0496110_0005094 | |||
| 2731 | Ga0496110_0009693 | |||
| 2732 | Ga0496110_0011502 | |||
| 2733 | Ga0496110_0090813 | |||
| 2734 | Ga0496110_0109266 | |||
| 2735 | Ga0496110_0215738 | |||
| 2736 | Ga0496110_0298264 | |||
| 2737 | Ga0496110_1152860 | |||
| 2738 | Ga0496111_0041081 | |||
| 2739 | Ga0496111_0152865 | |||
| 2740 | Ga0496111_0164446 | |||
| 2741 | Ga0496111_0165666 | |||
| 2742 | Ga0496111_0204773 | |||
| 2743 | Ga0496111_0266366 | |||
| 2744 | Ga0496112_0000031 | |||
| 2745 | Ga0496112_0002881 | |||
| 2746 | Ga0496112_0055524 | |||
| 2747 | Ga0496112_0118015 | |||
| 2748 | Ga0496112_0189893 | |||
| 2749 | Ga0496112_0366845 | |||
| 2750 | Ga0496113_0006041 | |||
| 2751 | Ga0496113_0014440 | |||
| 2752 | Ga0496113_0039454 | |||
| 2753 | Ga0496113_1074691 | |||
| 2754 | Ga0496114_0028470 | |||
| 2755 | Ga0496114_0090800 | |||
| 2756 | Ga0496114_0271973 | |||
| 2757 | Ga0496114_0631052 | |||
| 2758 | Ga0496114_1571325 | |||
| 2759 | Ga0496115_0010614 | |||
| 2760 | Ga0496115_0038527 | |||
| 2761 | Ga0496115_0068732 | |||
| 2762 | Ga0496115_0138134 | |||
| 2763 | Ga0496115_0158378 | |||
| 2764 | Ga0496115_0172524 | |||
| 2765 | Ga0496115_0234195 | |||
| 2766 | Ga0496115_0616443 | |||
| 2767 | Ga0496118_0001670 | |||
| 2768 | Ga0496118_0043015 | |||
| 2769 | Ga0496119_0064309 | |||
| 2770 | Ga0496119_0405635 | |||
| 2771 | Ga0496120_0093413 | |||
| 2772 | Ga0496120_0129130 | |||
| 2773 | Ga0496121_0000183 | |||
| 2774 | Ga0496121_0001473 | |||
| 2775 | Ga0496121_0002518 | |||
| 2776 | Ga0496121_0157177 | |||
| 2777 | Ga0496121_0219605 | |||
| 2778 | Ga0496121_0381970 | |||
| 2779 | Ga0496124_0001382 | |||
| 2780 | Ga0496124_0016454 | |||
| 2781 | Ga0496124_0299139 | |||
| 2782 | Ga0496125_0048308 | |||
| 2783 | Ga0496125_0060785 | |||
| 2784 | Ga0496126_0004491 | |||
| 2785 | Ga0496126_0013413 | |||
| 2786 | Ga0496126_0063841 | |||
| 2787 | Ga0496126_0115146 | |||
| 2788 | Ga0496126_0129927 | |||
| 2789 | Ga0496126_0223766 | |||
| 2790 | Ga0496126_0242172 | |||
| 2791 | Ga0496126_0394707 | |||
| 2792 | Ga0496126_0498782 | |||
| 2793 | Ga0496126_0534124 | |||
| 2794 | Ga0496126_0643537 | |||
| 2795 | Ga0495678_065656 | |||
| 2796 | Ga0495682_0171067 | |||
| 2797 | Ga0501031_0000442 | |||
| 2798 | Ga0501032_0000773 | |||
| 2799 | Ga0501033_0000025 | |||
| 2800 | Ga0501033_0336470 | |||
| 2801 | Ga0501034_0000021 | |||
| 2802 | Ga0501036_0000069 | |||
| 2803 | Ga0501037_0000034 | |||
| 2804 | Ga0501038_0000537 | |||
| 2805 | Ga0501039_0000198 | |||
| 2806 | Ga0501042_0670899 | |||
| 2807 | Ga0501043_0001044 | |||
| 2808 | Ga0501046_0011176 | |||
| 2809 | Ga0501047_0000587 | |||
| 2810 | Ga0501047_0047916 | |||
| 2811 | Ga0501047_0748050 | |||
| 2812 | Ga0501048_0008991 | |||
| 2813 | Ga0501067_0000331 | |||
| 2814 | Ga0501067_0056192 | |||
| 2815 | Ga0501068_0000039 | |||
| 2816 | Ga0501069_0000910 | |||
| 2817 | Ga0501069_0029131 | |||
| 2818 | Ga0501069_0410822 | |||
| 2819 | Ga0501070_0033515 | |||
| 2820 | Ga0501070_0140507 | |||
| 2821 | Ga0501070_0282353 | |||
| 2822 | Ga0501070_0306690 | |||
| 2823 | Ga0501072_0007314 | |||
| 2824 | Ga0501072_0250013 | |||
| 2825 | Ga0501073_0000236 | |||
| 2826 | Ga0501073_0069491 | |||
| 2827 | Ga0501074_0000048 | |||
| 2828 | Ga0501074_0030647 | |||
| 2829 | Ga0501257_204124 | |||
| 2830 | Ga0501225_0182944 | |||
| 2831 | Ga0501079_0011390 | |||
| 2832 | Ga0501079_0828095 | |||
| 2833 | Ga0501080_0034680 | |||
| 2834 | Ga0501080_0278675 | |||
| 2835 | Ga0501080_0472463 | |||
| 2836 | Ga0501081_1022083 | |||
| 2837 | Ga0501083_0030815 | |||
| 2838 | Ga0501035_0000865 | |||
| 2839 | Ga0501044_0000028 | |||
| 2840 | Ga0501044_0070718 | |||
| 2841 | Ga0501044_0180205 | |||
| 2842 | Ga0501044_0777983 | |||
| 2843 | Ga0501045_0191681 | |||
| 2844 | nmdc:mga03683_245279_c1 | |||
| 2845 | nmdc:mga03683_555581_c1 | |||
| 2846 | nmdc:mga0yw44_172489_c1 | |||
| 2847 | nmdc:mga0yw44_343361_c1 | |||
| 2848 | nmdc:mga0k408_184235_c2 | |||
| 2849 | nmdc:mga0k408_29543_c1 | |||
| 2850 | nmdc:mga0k408_611302_c1 | |||
| 2851 | nmdc:mga0k408_695351_c1 | |||
| 2852 | nmdc:mga06z11_191886_c1 | |||
| 2853 | nmdc:mga06z11_298778_c1 | |||
| 2854 | nmdc:mga04h51_171599_c1 | |||
| 2855 | nmdc:mga07m45_103042_c1 | |||
| 2856 | nmdc:mga07m45_479438_c1 | |||
| 2857 | nmdc:mga07m45_907950_c1 | |||
| 2858 | nmdc:mga06r32_564965_c1 | |||
| 2859 | nmdc:mga08y16_314653_c1 | |||
| 2860 | nmdc:mga0n895_158416_c1 | |||
| 2861 | nmdc:mga0n895_354924_c1 | |||
| 2862 | nmdc:mga0rr50_700405_c1 | |||
| 2863 | nmdc:mga08x19_104020_c1 | |||
| 2864 | nmdc:mga0a205_1029238_c1 | |||
| 2865 | nmdc:mga0sz30_202315_c1 | |||
| 2866 | nmdc:mga0sz30_345707_c1 | |||
| 2867 | Ga0495601_0032809 | |||
| 2868 | Ga0495601_0047559 | |||
| 2869 | Ga0495601_0050146 | |||
| 2870 | Ga0495601_0221914 | |||
| 2871 | Ga0495612_0086620 | |||
| 2872 | Ga0495612_0163605 | |||
| 2873 | Ga0500635_0003272 | |||
| 2874 | Ga0500635_0024104 | |||
| 2875 | Ga0500635_0033210 | |||
| 2876 | Ga0495655_0134726 | |||
| 2877 | Ga0495595_0000634 | |||
| 2878 | Ga0495595_0096720 | |||
| 2879 | Ga0495595_0245576 | |||
| 2880 | Ga0495595_0574087 | |||
| 2881 | Ga0495619_0000697 | |||
| 2882 | Ga0495619_0013615 | |||
| 2883 | Ga0495619_0072468 | |||
| 2884 | Ga0495619_0531461 | |||
| 2885 | Ga0495619_0639362 | |||
| 2886 | Ga0500578_0261630 | |||
| 2887 | Ga0500578_0319122 | |||
| 2888 | Ga0500647_0055764 | |||
| 2889 | Ga0500647_0291114 | |||
| 2890 | Ga0500583_0073951 | |||
| 2891 | Ga0500583_0417295 | |||
| 2892 | Ga0500651_0030288 | |||
| 2893 | Ga0500651_0030472 | |||
| 2894 | Ga0500651_0156988 | |||
| 2895 | Ga0500566_0000010 | |||
| 2896 | Ga0500566_0051918 | |||
| 2897 | Ga0500566_0490302 | |||
| 2898 | Ga0500640_000055 | |||
| 2899 | Ga0500641_0093867 | |||
| 2900 | Ga0500654_142441 | |||
| 2901 | Ga0500554_000560 | |||
| 2902 | Ga0500554_027963 | |||
| 2903 | Ga0500556_0073406 | |||
| 2904 | Ga0500556_0151239 | |||
| 2905 | Ga0500569_006916 | |||
| 2906 | Ga0500572_000088 | |||
| 2907 | Ga0500572_001292 | |||
| 2908 | Ga0500591_200314 | |||
| 2909 | Ga0500595_000967 | |||
| 2910 | Ga0500595_002830 | |||
| 2911 | Ga0500595_006501 | |||
| 2912 | Ga0500595_008515 | |||
| 2913 | Ga0500608_061747 | |||
| 2914 | Ga0500608_112922 | |||
| 2915 | Ga0500614_000734 | |||
| 2916 | Ga0500655_065207 | |||
| 2917 | Ga0500658_0069848 | |||
| 2918 | Ga0500658_0221356 | |||
| 2919 | Ga0500559_0001744 | |||
| 2920 | Ga0500559_0024871 | |||
| 2921 | Ga0500559_0088109 | |||
| 2922 | Ga0500568_0023381 | |||
| 2923 | Ga0500568_0093224 | |||
| 2924 | Ga0500568_0119209 | |||
| 2925 | Ga0500573_0147868 | |||
| 2926 | Ga0500577_0118571 | |||
| 2927 | Ga0500588_0017368 | |||
| 2928 | Ga0500589_046444 | |||
| 2929 | Ga0500590_105444 | |||
| 2930 | Ga0500590_176307 | |||
| 2931 | Ga0500590_189746 | |||
| 2932 | Ga0500603_000342 | |||
| 2933 | Ga0500603_004423 | |||
| 2934 | Ga0500603_013232 | |||
| 2935 | Ga0500603_133042 | |||
| 2936 | Ga0500603_148305 | |||
| 2937 | Ga0500604_0009862 | |||
| 2938 | Ga0500619_188296 | |||
| 2939 | Ga0500622_0074138 | |||
| 2940 | Ga0500627_0092869 | |||
| 2941 | Ga0500627_0415377 | |||
| 2942 | Ga0500630_003317 | |||
| 2943 | Ga0500634_0171056 | |||
| 2944 | Ga0500638_000712 | |||
| 2945 | Ga0500638_093941 | |||
| 2946 | Ga0500638_159196 | |||
| 2947 | Ga0500638_162057 | |||
| 2948 | Ga0500638_353576 | |||
| 2949 | Ga0500639_000001 | |||
| 2950 | Ga0500639_056128 | |||
| 2951 | Ga0500639_057167 | |||
| 2952 | Ga0500636_0078193 | |||
| 2953 | Ga0500636_0091378 | |||
| 2954 | Ga0500636_0194916 | |||
| 2955 | Ga0500636_0303041 | |||
| 2956 | Ga0500636_0398726 | |||
| 2957 | Ga0500637_0002851 | |||
| 2958 | Ga0500637_0005100 | |||
| 2959 | Ga0500637_0035858 | |||
| 2960 | Ga0500637_0364416 | |||
| 2961 | Ga0500576_254031 | |||
| 2962 | Ga0500609_008206 | |||
| 2963 | Ga0500552_006330 | |||
| 2964 | Ga0500596_006761 | |||
| 2965 | Ga0500596_007614 | |||
| 2966 | Ga0500601_006758 | |||
| 2967 | Ga0500587_017740 | |||
| 2968 | Ga0501084_0001432 | |||
| 2969 | Ga0500661_000387 | |||
| 2970 | Ga0587115_088134 | |||
| 2971 | Ga0501082_0011376 | |||
| 2972 | Ga0501082_0485625 | |||
| 2973 | Ga0501082_1589670 | |||
| 2974 | Ga0466962_0140275 | |||
| 2975 | 2509150379 | |||
| 2976 | 2513692387 | |||
| 2977 | 2513893561 | |||
| 2978 | 2876809028 | |||
| 2979 | 2879115405 | |||
| 2980 | 2922390852 | |||
| 2981 | 8006965605 | |||
| 2982 | 8056673996 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hkk-assembly1.cif.gz_A | structure of human leukotriene c4 synthase in complex with glutathione sulfonate | 0.8043 | 3 | 128 |
| 4bpm-assembly1.cif.gz_A | crystal structure of a human integral membrane enzyme | 0.8036 | 3 | 130 |
| 4ntb-assembly1.cif.gz_A | mus musculus ltc4 synthase in gsh complex form | 0.7995 | 3 | 128 |
| 4jc7-assembly1.cif.gz_A | human ltc4 synthase in complex with product analogs - implications for enzyme catalysis | 0.7947 | 3 | 128 |
| 4j7t-assembly1.cif.gz_A | human ltc4 synthase in complex with product analogs - implications for enzyme catalysis | 0.7935 | 3 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P64515_1_129_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8313 | 2 | 130 | 1.20.120.550 |
| af_B0R1E9_1_152_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8179 | 3 | 130 | 1.20.120.550 |
| af_P10620_2_155_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8065 | 3 | 130 | 1.20.120.550 |
| af_Q9JHF3_7_153_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8013 | 3 | 130 | 1.20.120.550 |
| 4jc7A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.7947 | 3 | 128 | 1.20.120.550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A533JAF3-F1-model_v4 | deleted | 0.9991 | 45 | 132 |
|
| AF-A0A7S7Z5G2-F1-model_v4 | MAPEG family protein | 0.991 | 1 | 132 |
GO:0016020
|
| AF-A0A2M8R4K8-F1-model_v4 | MAPEG family protein | 0.9897 | 1 | 132 |
GO:0016020
|
| AF-A0A5S4X384-F1-model_v4 | MAPEG family protein | 0.9881 | 1 | 132 |
GO:0016020
|
| AF-A0A533JAF3-F1-model_v4 | deleted | 0.9879 | 45 | 132 |
|