F494372
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1497 | 517 | 2836 | 415 |
Family's Representative Sequence
| Representative Sequence | 3300002704|JGI25155J39150_1000002|JGI25155J39150_100000234 |
| Length | 442 |
| Sequence | MTTQTRFFARHAGVALAVTAMFYSSMTLAQAPAAKAAAPTKATVATPAAGGAVNLNQTVKIAWLDPLSGLMAAVGTNQLKGFQFLAEQFSKKNKAGVKFEIIGIDNKLSPQETTNALKSAIDQGARYVVQGNGSGPALAIMDALSKYNERNPGKEVVYLNYAAVDPDLTNSKCEYWHFRLDADTSMKMEALTAFMKEQPDIKKVYLINQNYSHGQQVAKFAKANLASKRPDIQIVGEDLHPLAQVRDFAPYIAKIKQSGADTVITGNWGSDLSLLVKAANEAGLNNVKFYTYYAGVTGTPTALGAGSAGRVYMVAYNHLNMGGEIQQIQAEYKKKFNDDFYTGAIFHAFTILTEAMAQTKSTEPAVVAKAMEGLRFKSFNGDVEMRKTDHQLQQGLYIDKWEKAGGKYPYDAENTGYTFVPVKYYEPYVASTPTSCQMKRPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 35 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 87 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 106 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 107 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 108 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 230 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 242 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 243 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 245 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 246 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 247 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 248 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 249 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 250 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 251 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 253 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 254 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 255 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 256 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 257 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 258 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 259 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 260 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 261 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 262 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 263 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 264 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 265 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 266 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 267 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 268 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 269 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 270 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 271 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 272 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 273 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 274 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 277 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 278 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 279 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 282 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 283 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 284 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 285 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 286 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 287 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 288 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 289 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 290 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 291 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 292 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 293 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 294 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 295 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 297 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 298 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 299 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 300 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 301 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 302 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 303 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 304 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 305 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 306 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 307 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 308 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 309 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 310 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 311 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 312 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 313 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 314 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 315 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 316 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 317 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 318 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 319 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 320 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 321 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 322 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 323 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 324 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 325 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 326 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 327 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 328 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 329 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 330 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 365 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 366 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 367 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 368 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 369 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 372 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 373 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 374 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 375 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 376 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 377 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 378 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 379 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 380 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 381 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 382 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 383 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 384 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 385 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 386 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 387 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 395 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 396 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 397 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 398 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 399 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 400 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 401 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 402 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 403 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 404 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 406 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 407 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 408 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 410 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 411 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 412 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 413 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 414 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 418 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 420 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 421 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 422 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 423 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 424 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 425 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 427 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 428 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 429 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 430 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 431 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 432 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 433 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 434 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 435 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 436 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 437 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 438 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 439 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 440 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 442 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 443 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 444 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 445 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 446 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 447 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 448 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 449 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 450 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 451 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 452 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 453 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 454 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 455 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 456 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 457 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 458 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 459 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 460 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 461 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 462 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 463 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 464 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 465 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 466 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 467 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 468 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 469 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 470 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 471 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 472 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 473 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 474 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 475 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 476 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 477 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 478 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 479 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 480 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 481 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 482 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 483 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 484 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 485 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 486 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 487 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 488 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 489 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 490 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 491 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 492 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 493 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 494 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 495 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 496 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 497 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 498 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 499 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 500 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 501 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 502 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 503 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 504 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 505 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 506 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 507 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 508 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 509 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 510 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 511 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 512 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 513 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 514 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 515 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 516 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 517 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.38 |
| Metatranscriptomes | 0.2 |
| Isolates | 8.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.45 |
| Nodule | 1.14 |
| Rhizoplane | 1.94 |
| Rhizosphere | 60.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000002 | 3300002704 | Bacteria | 292156 |
| 2 | JGI24740J21852_10020775 | 3300001979 | Bacteria | 2284 |
| 3 | JGI25156J39149_1000003 | 3300002705 | Bacteria | 305434 |
| 4 | JGI25156J39149_1000837 | 3300002705 | Bacteria | 15529 |
| 5 | JGI25156J39149_1008895 | 3300002705 | Bacteria | 2486 |
| 6 | JGI25156J39149_1012858 | 3300002705 | Bacteria | 1813 |
| 7 | JGI25154J39366_1000009 | 3300002738 | Bacteria | 305408 |
| 8 | JGI25154J39366_1002448 | 3300002738 | Bacteria | 4797 |
| 9 | JGI25158J39367_1001490 | 3300002739 | Bacteria | 4085 |
| 10 | JGI25157J39369_1000002 | 3300002741 | Bacteria | 305434 |
| 11 | JGI25157J39369_1000251 | 3300002741 | Bacteria | 40025 |
| 12 | JGI25152J39213_1000738 | 3300002773 | Bacteria | 16742 |
| 13 | JGI25152J39213_1006919 | 3300002773 | Bacteria | 2999 |
| 14 | JGI25150J39212_1000868 | 3300002774 | Bacteria | 10033 |
| 15 | JGI25150J39212_1004489 | 3300002774 | Bacteria | 3101 |
| 16 | JGI25159J45721_1000417 | 3300002987 | Bacteria | 19666 |
| 17 | JGI25159J45721_1001150 | 3300002987 | Bacteria | 11299 |
| 18 | JGI25159J45721_1001933 | 3300002987 | Bacteria | 8263 |
| 19 | JGI25159J45721_1008673 | 3300002987 | Bacteria | 2770 |
| 20 | JGI25151J46595_10006428 | 3300003187 | Bacteria | 5909 |
| 21 | JGI25151J46595_10007156 | 3300003187 | Bacteria | 5500 |
| 22 | JGI25151J46595_10016665 | 3300003187 | Bacteria | 3206 |
| 23 | rootH1_10009119 | 3300003316 | Bacteria | 6425 |
| 24 | rootH2_10036890 | 3300003320 | Bacteria | 1933 |
| 25 | rootL2_10023281 | 3300003322 | Bacteria | 3269 |
| 26 | rootL2_10040743 | 3300003322 | Bacteria | 1927 |
| 27 | JGI25160J50197_1000472 | 3300003354 | Bacteria | 24628 |
| 28 | JGI25161J50226_1000032 | 3300003374 | Bacteria | 138440 |
| 29 | JGI25161J50226_1000064 | 3300003374 | Bacteria | 99448 |
| 30 | Ga0055533_1000028 | 3300003756 | Bacteria | 311012 |
| 31 | Ga0055533_1000057 | 3300003756 | Bacteria | 194035 |
| 32 | Ga0055525_1000522 | 3300003759 | Bacteria | 18499 |
| 33 | Ga0055535_1000856 | 3300003761 | Bacteria | 21517 |
| 34 | Ga0055535_1001176 | 3300003761 | Bacteria | 15121 |
| 35 | Ga0055542_1000021 | 3300003762 | Bacteria | 331499 |
| 36 | Ga0055529_1000331 | 3300003763 | Bacteria | 53202 |
| 37 | Ga0055526_1001029 | 3300003771 | Bacteria | 20391 |
| 38 | Ga0055526_1024152 | 3300003771 | Bacteria | 2001 |
| 39 | Ga0055537_1000036 | 3300003773 | Bacteria | 96045 |
| 40 | Ga0055537_1000221 | 3300003773 | Bacteria | 41984 |
| 41 | Ga0055537_1000565 | 3300003773 | Bacteria | 20867 |
| 42 | Ga0055537_1002864 | 3300003773 | Bacteria | 5526 |
| 43 | Ga0055537_1010531 | 3300003773 | Bacteria | 1944 |
| 44 | Ga0055524_1000012 | 3300003775 | Bacteria | 260384 |
| 45 | Ga0055524_1000287 | 3300003775 | Bacteria | 48964 |
| 46 | Ga0055524_1000554 | 3300003775 | Bacteria | 28221 |
| 47 | Ga0055524_1013988 | 3300003775 | Bacteria | 2997 |
| 48 | Ga0055536_1003447 | 3300003781 | Bacteria | 8482 |
| 49 | Ga0055536_1003631 | 3300003781 | Bacteria | 8227 |
| 50 | Ga0055536_1004360 | 3300003781 | Bacteria | 7268 |
| 51 | Ga0055536_1010599 | 3300003781 | Bacteria | 3635 |
| 52 | Ga0055536_1012824 | 3300003781 | Bacteria | 3076 |
| 53 | Ga0055534_1000018 | 3300003784 | Bacteria | 138136 |
| 54 | Ga0055534_1000220 | 3300003784 | Bacteria | 41988 |
| 55 | Ga0055534_1001383 | 3300003784 | Bacteria | 9696 |
| 56 | Ga0055534_1004361 | 3300003784 | Bacteria | 4125 |
| 57 | Ga0055528_1000509 | 3300003790 | Bacteria | 30550 |
| 58 | Ga0055528_1003825 | 3300003790 | Bacteria | 7407 |
| 59 | Ga0055528_1007055 | 3300003790 | Bacteria | 5021 |
| 60 | Ga0055530_10000218 | 3300003791 | Bacteria | 51314 |
| 61 | Ga0055530_10000430 | 3300003791 | Bacteria | 37250 |
| 62 | Ga0055530_10002887 | 3300003791 | Bacteria | 10467 |
| 63 | Ga0055530_10003706 | 3300003791 | Bacteria | 8509 |
| 64 | Ga0055530_10008617 | 3300003791 | Bacteria | 4048 |
| 65 | Ga0055540_1000012 | 3300003792 | Bacteria | 262667 |
| 66 | Ga0055540_1000016 | 3300003792 | Bacteria | 232942 |
| 67 | Ga0055540_1000039 | 3300003792 | Bacteria | 161844 |
| 68 | Ga0055540_1000062 | 3300003792 | Bacteria | 128474 |
| 69 | Ga0055540_1000420 | 3300003792 | Bacteria | 33992 |
| 70 | Ga0055540_1000492 | 3300003792 | Bacteria | 30076 |
| 71 | Ga0055540_1002048 | 3300003792 | Bacteria | 11151 |
| 72 | Ga0055540_1006044 | 3300003792 | Bacteria | 4903 |
| 73 | Ga0055540_1008499 | 3300003792 | Bacteria | 3689 |
| 74 | Ga0055531_10000309 | 3300003794 | Bacteria | 48285 |
| 75 | Ga0055531_10000313 | 3300003794 | Bacteria | 47791 |
| 76 | Ga0055531_10000542 | 3300003794 | Bacteria | 33438 |
| 77 | Ga0055531_10002364 | 3300003794 | Bacteria | 12685 |
| 78 | Ga0055531_10003057 | 3300003794 | Bacteria | 10840 |
| 79 | Ga0055531_10009223 | 3300003794 | Bacteria | 5075 |
| 80 | Ga0055531_10012926 | 3300003794 | Bacteria | 3888 |
| 81 | Ga0055531_10014062 | 3300003794 | Bacteria | 3635 |
| 82 | Ga0055531_10020585 | 3300003794 | Bacteria | 2602 |
| 83 | Ga0055543_1003006 | 3300004625 | Bacteria | 5217 |
| 84 | Ga0055543_1005865 | 3300004625 | Bacteria | 3067 |
| 85 | Ga0055543_1005952 | 3300004625 | Bacteria | 3029 |
| 86 | Ga0055543_1006341 | 3300004625 | Bacteria | 2870 |
| 87 | Ga0055543_1008256 | 3300004625 | Bacteria | 2318 |
| 88 | Ga0065165_1000354 | 3300005262 | Bacteria | 75337 |
| 89 | Ga0065165_1000935 | 3300005262 | Bacteria | 37344 |
| 90 | Ga0065165_1001664 | 3300005262 | Bacteria | 22493 |
| 91 | Ga0065165_1014104 | 3300005262 | Bacteria | 3120 |
| 92 | Ga0065165_1015749 | 3300005262 | Bacteria | 2870 |
| 93 | Ga0065165_1027589 | 3300005262 | Bacteria | 1847 |
| 94 | Ga0065165_1031101 | 3300005262 | Bacteria | 1691 |
| 95 | Ga0065714_10074978 | 3300005288 | Bacteria | 2964 |
| 96 | Ga0065704_10105517 | 3300005289 | Bacteria | 2109 |
| 97 | Ga0065704_10108668 | 3300005289 | Bacteria | 2022 |
| 98 | Ga0065704_10126163 | 3300005289 | Bacteria | 1693 |
| 99 | Ga0065712_10077432 | 3300005290 | Bacteria | 3482 |
| 100 | Ga0065715_10025844 | 3300005293 | Bacteria | 1564 |
| 101 | Ga0065715_10122914 | 3300005293 | Bacteria | 2192 |
| 102 | Ga0065715_10207777 | 3300005293 | Bacteria | 1329 |
| 103 | Ga0065707_10086952 | 3300005295 | Bacteria | 5233 |
| 104 | Ga0070658_10088236 | 3300005327 | Bacteria | 2554 |
| 105 | Ga0070658_10169512 | 3300005327 | Bacteria | 1834 |
| 106 | Ga0070676_10000305 | 3300005328 | Bacteria | 22094 |
| 107 | Ga0070676_10001353 | 3300005328 | Bacteria | 12331 |
| 108 | Ga0070676_10001456 | 3300005328 | Bacteria | 11960 |
| 109 | Ga0070676_10012035 | 3300005328 | Bacteria | 4715 |
| 110 | Ga0070676_10021974 | 3300005328 | Bacteria | 3575 |
| 111 | Ga0070683_100007952 | 3300005329 | Bacteria | 8995 |
| 112 | Ga0070683_100297331 | 3300005329 | Bacteria | 1536 |
| 113 | Ga0070690_100005973 | 3300005330 | Bacteria | 6875 |
| 114 | Ga0070690_100010484 | 3300005330 | Bacteria | 5396 |
| 115 | Ga0070690_100037982 | 3300005330 | Bacteria | 3036 |
| 116 | Ga0070670_100012432 | 3300005331 | Bacteria | 7286 |
| 117 | Ga0070670_100017269 | 3300005331 | Bacteria | 6189 |
| 118 | Ga0070670_100025196 | 3300005331 | Bacteria | 5119 |
| 119 | Ga0070670_100040203 | 3300005331 | Bacteria | 4022 |
| 120 | Ga0070670_100075565 | 3300005331 | Bacteria | 2894 |
| 121 | Ga0070670_100222624 | 3300005331 | Bacteria | 1642 |
| 122 | Ga0070677_10004130 | 3300005333 | Bacteria | 4715 |
| 123 | Ga0068869_100041163 | 3300005334 | Bacteria | 3307 |
| 124 | Ga0068869_100045673 | 3300005334 | Bacteria | 3155 |
| 125 | Ga0068869_100126844 | 3300005334 | Bacteria | 1958 |
| 126 | Ga0070666_10007102 | 3300005335 | Bacteria | 6905 |
| 127 | Ga0070666_10042863 | 3300005335 | Bacteria | 3028 |
| 128 | Ga0070666_10145344 | 3300005335 | Bacteria | 1653 |
| 129 | Ga0070680_100002531 | 3300005336 | Bacteria | 13546 |
| 130 | Ga0070682_100098288 | 3300005337 | Bacteria | 1928 |
| 131 | Ga0070682_100145677 | 3300005337 | Bacteria | 1619 |
| 132 | Ga0068868_100003758 | 3300005338 | Bacteria | 10601 |
| 133 | Ga0068868_100007012 | 3300005338 | Bacteria | 8009 |
| 134 | Ga0068868_100010416 | 3300005338 | Bacteria | 6731 |
| 135 | Ga0068868_100024715 | 3300005338 | Bacteria | 4561 |
| 136 | Ga0068868_100026439 | 3300005338 | Bacteria | 4423 |
| 137 | Ga0068868_100079207 | 3300005338 | Bacteria | 2632 |
| 138 | Ga0068868_100089432 | 3300005338 | Bacteria | 2479 |
| 139 | Ga0068868_100135869 | 3300005338 | Bacteria | 2015 |
| 140 | Ga0068868_100226829 | 3300005338 | Bacteria | 1566 |
| 141 | Ga0070660_100017780 | 3300005339 | Bacteria | 5186 |
| 142 | Ga0070660_100104942 | 3300005339 | Bacteria | 2242 |
| 143 | Ga0070660_100249041 | 3300005339 | Bacteria | 1448 |
| 144 | Ga0070689_100005827 | 3300005340 | Bacteria | 8458 |
| 145 | Ga0070687_100027806 | 3300005343 | Bacteria | 2736 |
| 146 | Ga0070687_100051223 | 3300005343 | Bacteria | 2136 |
| 147 | Ga0070661_100002137 | 3300005344 | Bacteria | 13617 |
| 148 | Ga0070661_100004541 | 3300005344 | Bacteria | 9553 |
| 149 | Ga0070661_100027419 | 3300005344 | Bacteria | 4101 |
| 150 | Ga0070661_100225554 | 3300005344 | Bacteria | 1438 |
| 151 | Ga0070668_100000930 | 3300005347 | Bacteria | 20445 |
| 152 | Ga0070668_100002014 | 3300005347 | Bacteria | 14861 |
| 153 | Ga0070668_100014358 | 3300005347 | Bacteria | 5918 |
| 154 | Ga0070668_100129226 | 3300005347 | Bacteria | 2026 |
| 155 | Ga0070669_100003934 | 3300005353 | Bacteria | 10748 |
| 156 | Ga0070669_100008074 | 3300005353 | Bacteria | 7520 |
| 157 | Ga0070669_100059655 | 3300005353 | Bacteria | 2802 |
| 158 | Ga0070669_100197831 | 3300005353 | Bacteria | 1580 |
| 159 | Ga0070675_100000703 | 3300005354 | Bacteria | 23209 |
| 160 | Ga0070675_100002563 | 3300005354 | Bacteria | 13606 |
| 161 | Ga0070675_100005844 | 3300005354 | Bacteria | 9423 |
| 162 | Ga0070675_100008566 | 3300005354 | Bacteria | 7941 |
| 163 | Ga0070675_100012697 | 3300005354 | Bacteria | 6607 |
| 164 | Ga0070675_100018066 | 3300005354 | Bacteria | 5612 |
| 165 | Ga0070675_100136272 | 3300005354 | Bacteria | 2095 |
| 166 | Ga0070675_100155626 | 3300005354 | Bacteria | 1962 |
| 167 | Ga0070671_100005574 | 3300005355 | Bacteria | 10029 |
| 168 | Ga0070671_100018775 | 3300005355 | Bacteria | 5620 |
| 169 | Ga0070671_100034852 | 3300005355 | Bacteria | 4168 |
| 170 | Ga0070671_100047811 | 3300005355 | Bacteria | 3556 |
| 171 | Ga0070671_100074851 | 3300005355 | Bacteria | 2829 |
| 172 | Ga0070674_100000518 | 3300005356 | Bacteria | 19349 |
| 173 | Ga0070674_100002778 | 3300005356 | Bacteria | 9676 |
| 174 | Ga0070674_100002952 | 3300005356 | Bacteria | 9433 |
| 175 | Ga0070674_100003318 | 3300005356 | Bacteria | 9011 |
| 176 | Ga0070674_100004623 | 3300005356 | Bacteria | 7864 |
| 177 | Ga0070674_100025030 | 3300005356 | Bacteria | 3879 |
| 178 | Ga0070674_100039485 | 3300005356 | Bacteria | 3188 |
| 179 | Ga0070674_100058684 | 3300005356 | Bacteria | 2676 |
| 180 | Ga0070674_100069552 | 3300005356 | Bacteria | 2484 |
| 181 | Ga0070673_100002198 | 3300005364 | Bacteria | 11789 |
| 182 | Ga0070673_100002713 | 3300005364 | Bacteria | 10854 |
| 183 | Ga0070673_100006984 | 3300005364 | Bacteria | 7395 |
| 184 | Ga0070673_100014798 | 3300005364 | Bacteria | 5454 |
| 185 | Ga0070673_100017830 | 3300005364 | Bacteria | 5058 |
| 186 | Ga0070673_100141075 | 3300005364 | Bacteria | 2032 |
| 187 | Ga0070673_100163511 | 3300005364 | Bacteria | 1895 |
| 188 | Ga0070673_100211707 | 3300005364 | Bacteria | 1674 |
| 189 | Ga0070673_100216577 | 3300005364 | Bacteria | 1655 |
| 190 | Ga0070688_100077724 | 3300005365 | Bacteria | 2139 |
| 191 | Ga0070659_100000178 | 3300005366 | Bacteria | 48934 |
| 192 | Ga0070659_100013767 | 3300005366 | Bacteria | 6031 |
| 193 | Ga0070659_100036994 | 3300005366 | Bacteria | 3804 |
| 194 | Ga0070659_100090482 | 3300005366 | Bacteria | 2452 |
| 195 | Ga0070667_100000887 | 3300005367 | Bacteria | 27641 |
| 196 | Ga0070667_100001423 | 3300005367 | Bacteria | 21447 |
| 197 | Ga0070667_100022085 | 3300005367 | Bacteria | 5278 |
| 198 | Ga0070667_100166632 | 3300005367 | Bacteria | 1943 |
| 199 | Ga0070667_100255817 | 3300005367 | Bacteria | 1567 |
| 200 | Ga0070700_100011768 | 3300005441 | Bacteria | 4856 |
| 201 | Ga0070700_100060568 | 3300005441 | Bacteria | 2386 |
| 202 | Ga0070663_100067903 | 3300005455 | Bacteria | 2587 |
| 203 | Ga0070663_100123499 | 3300005455 | Bacteria | 1958 |
| 204 | Ga0070678_100000683 | 3300005456 | Bacteria | 16725 |
| 205 | Ga0070678_100027992 | 3300005456 | Bacteria | 3836 |
| 206 | Ga0070678_100093366 | 3300005456 | Bacteria | 2314 |
| 207 | Ga0070678_100140093 | 3300005456 | Bacteria | 1934 |
| 208 | Ga0070678_100160270 | 3300005456 | Bacteria | 1822 |
| 209 | Ga0070678_100160965 | 3300005456 | Bacteria | 1818 |
| 210 | Ga0070678_100183807 | 3300005456 | Bacteria | 1713 |
| 211 | Ga0070678_100227746 | 3300005456 | Bacteria | 1552 |
| 212 | Ga0070662_100000646 | 3300005457 | Bacteria | 21061 |
| 213 | Ga0070662_100010127 | 3300005457 | Bacteria | 6177 |
| 214 | Ga0070662_100019033 | 3300005457 | Bacteria | 4655 |
| 215 | Ga0070662_100090650 | 3300005457 | Bacteria | 2295 |
| 216 | Ga0070681_10303528 | 3300005458 | Bacteria | 1506 |
| 217 | Ga0068867_100000234 | 3300005459 | Bacteria | 36383 |
| 218 | Ga0068867_100001306 | 3300005459 | Bacteria | 17230 |
| 219 | Ga0068867_100004484 | 3300005459 | Bacteria | 9810 |
| 220 | Ga0068867_100006316 | 3300005459 | Bacteria | 8384 |
| 221 | Ga0068867_100006419 | 3300005459 | Bacteria | 8306 |
| 222 | Ga0068867_100006718 | 3300005459 | Bacteria | 8133 |
| 223 | Ga0068867_100006852 | 3300005459 | Bacteria | 8058 |
| 224 | Ga0068867_100010351 | 3300005459 | Bacteria | 6580 |
| 225 | Ga0068867_100014751 | 3300005459 | Bacteria | 5538 |
| 226 | Ga0068867_100079902 | 3300005459 | Bacteria | 2462 |
| 227 | Ga0070685_10116931 | 3300005466 | Bacteria | 1651 |
| 228 | Ga0070706_100006474 | 3300005467 | Bacteria | 11054 |
| 229 | Ga0070707_100266424 | 3300005468 | Bacteria | 1666 |
| 230 | Ga0070699_100104211 | 3300005518 | Bacteria | 2488 |
| 231 | Ga0070679_100060332 | 3300005530 | Bacteria | 3780 |
| 232 | Ga0070679_100076637 | 3300005530 | Bacteria | 3333 |
| 233 | Ga0070679_100152598 | 3300005530 | Bacteria | 2286 |
| 234 | Ga0070684_100002660 | 3300005535 | Bacteria | 13192 |
| 235 | Ga0070684_100134427 | 3300005535 | Bacteria | 2233 |
| 236 | Ga0068853_100035486 | 3300005539 | Bacteria | 4236 |
| 237 | Ga0068853_100046733 | 3300005539 | Bacteria | 3713 |
| 238 | Ga0068853_100087126 | 3300005539 | Bacteria | 2739 |
| 239 | Ga0068853_100259887 | 3300005539 | Bacteria | 1596 |
| 240 | Ga0070672_100000150 | 3300005543 | Bacteria | 38126 |
| 241 | Ga0070672_100000188 | 3300005543 | Bacteria | 34174 |
| 242 | Ga0070672_100003178 | 3300005543 | Bacteria | 10627 |
| 243 | Ga0070672_100029365 | 3300005543 | Bacteria | 4122 |
| 244 | Ga0070672_100061568 | 3300005543 | Bacteria | 2959 |
| 245 | Ga0070672_100090311 | 3300005543 | Bacteria | 2470 |
| 246 | Ga0070672_100098835 | 3300005543 | Bacteria | 2364 |
| 247 | Ga0070672_100204136 | 3300005543 | Bacteria | 1653 |
| 248 | Ga0070665_100235466 | 3300005548 | Bacteria | 1831 |
| 249 | Ga0068855_100008323 | 3300005563 | Bacteria | 12537 |
| 250 | Ga0068855_100017415 | 3300005563 | Bacteria | 8643 |
| 251 | Ga0068855_100231884 | 3300005563 | Bacteria | 2067 |
| 252 | Ga0068855_100276875 | 3300005563 | Bacteria | 1865 |
| 253 | Ga0068855_100277889 | 3300005563 | Bacteria | 1860 |
| 254 | Ga0070664_100034043 | 3300005564 | Bacteria | 4272 |
| 255 | Ga0070664_100064440 | 3300005564 | Bacteria | 3125 |
| 256 | Ga0068857_100000422 | 3300005577 | Bacteria | 29970 |
| 257 | Ga0068857_100025951 | 3300005577 | Bacteria | 5161 |
| 258 | Ga0068857_100033075 | 3300005577 | Bacteria | 4572 |
| 259 | Ga0068857_100137230 | 3300005577 | Bacteria | 2209 |
| 260 | Ga0068854_100001586 | 3300005578 | Bacteria | 13835 |
| 261 | Ga0068854_100072293 | 3300005578 | Bacteria | 2525 |
| 262 | Ga0068854_100137384 | 3300005578 | Bacteria | 1872 |
| 263 | Ga0068856_100004817 | 3300005614 | Bacteria | 13375 |
| 264 | Ga0068856_100050218 | 3300005614 | Bacteria | 4112 |
| 265 | Ga0068856_100105028 | 3300005614 | Bacteria | 2819 |
| 266 | Ga0068852_100003415 | 3300005616 | Bacteria | 11092 |
| 267 | Ga0068852_100040628 | 3300005616 | Bacteria | 3926 |
| 268 | Ga0068852_100041540 | 3300005616 | Bacteria | 3887 |
| 269 | Ga0068852_100111142 | 3300005616 | Bacteria | 2491 |
| 270 | Ga0068852_100180723 | 3300005616 | Bacteria | 1983 |
| 271 | Ga0068852_100185549 | 3300005616 | Bacteria | 1959 |
| 272 | Ga0068859_100003146 | 3300005617 | Bacteria | 16781 |
| 273 | Ga0068859_100030836 | 3300005617 | Bacteria | 5381 |
| 274 | Ga0068859_100090165 | 3300005617 | Bacteria | 3117 |
| 275 | Ga0068859_100148499 | 3300005617 | Bacteria | 2419 |
| 276 | Ga0068859_100154049 | 3300005617 | Bacteria | 2375 |
| 277 | Ga0068864_100001395 | 3300005618 | Bacteria | 20021 |
| 278 | Ga0068864_100006994 | 3300005618 | Bacteria | 9256 |
| 279 | Ga0068864_100012986 | 3300005618 | Bacteria | 6893 |
| 280 | Ga0068864_100031021 | 3300005618 | Bacteria | 4533 |
| 281 | Ga0068864_100094537 | 3300005618 | Bacteria | 2642 |
| 282 | Ga0068866_10027755 | 3300005718 | Bacteria | 2690 |
| 283 | Ga0068861_100000357 | 3300005719 | Bacteria | 26082 |
| 284 | Ga0068861_100005099 | 3300005719 | Bacteria | 8855 |
| 285 | Ga0068861_100024110 | 3300005719 | Bacteria | 4396 |
| 286 | Ga0068861_100026409 | 3300005719 | Bacteria | 4221 |
| 287 | Ga0068861_100148574 | 3300005719 | Bacteria | 1920 |
| 288 | Ga0068851_10061466 | 3300005834 | Bacteria | 1925 |
| 289 | Ga0068851_10066642 | 3300005834 | Bacteria | 1856 |
| 290 | Ga0068851_10090274 | 3300005834 | Bacteria | 1612 |
| 291 | Ga0068851_10103958 | 3300005834 | Bacteria | 1509 |
| 292 | Ga0068870_10025973 | 3300005840 | Bacteria | 2913 |
| 293 | Ga0068863_100004937 | 3300005841 | Bacteria | 13152 |
| 294 | Ga0068863_100006024 | 3300005841 | Bacteria | 11893 |
| 295 | Ga0068863_100045223 | 3300005841 | Bacteria | 4178 |
| 296 | Ga0068863_100077904 | 3300005841 | Bacteria | 3137 |
| 297 | Ga0068863_100163097 | 3300005841 | Bacteria | 2136 |
| 298 | Ga0068863_100171074 | 3300005841 | Bacteria | 2084 |
| 299 | Ga0068863_100192095 | 3300005841 | Bacteria | 1962 |
| 300 | Ga0068858_100001070 | 3300005842 | Bacteria | 28311 |
| 301 | Ga0068858_100005932 | 3300005842 | Bacteria | 11927 |
| 302 | Ga0068858_100006988 | 3300005842 | Bacteria | 10963 |
| 303 | Ga0068860_100001404 | 3300005843 | Bacteria | 26110 |
| 304 | Ga0068860_100001441 | 3300005843 | Bacteria | 25753 |
| 305 | Ga0068860_100003633 | 3300005843 | Bacteria | 15860 |
| 306 | Ga0068860_100018213 | 3300005843 | Bacteria | 6835 |
| 307 | Ga0068860_100056492 | 3300005843 | Bacteria | 3731 |
| 308 | Ga0068860_100069015 | 3300005843 | Bacteria | 3359 |
| 309 | Ga0068862_100008643 | 3300005844 | Bacteria | 8424 |
| 310 | Ga0068862_100012198 | 3300005844 | Bacteria | 7103 |
| 311 | Ga0068862_100014297 | 3300005844 | Bacteria | 6585 |
| 312 | Ga0068862_100089917 | 3300005844 | Bacteria | 2673 |
| 313 | Ga0075365_10000234 | 3300006038 | Bacteria | 18998 |
| 314 | Ga0075365_10013483 | 3300006038 | Bacteria | 4892 |
| 315 | Ga0075365_10017690 | 3300006038 | Bacteria | 4368 |
| 316 | Ga0075365_10040013 | 3300006038 | Bacteria | 3055 |
| 317 | Ga0075364_10081580 | 3300006051 | Bacteria | 2139 |
| 318 | Ga0075432_10015726 | 3300006058 | Bacteria | 2582 |
| 319 | Ga0075362_10013909 | 3300006177 | Bacteria | 3234 |
| 320 | Ga0075362_10019047 | 3300006177 | Bacteria | 2849 |
| 321 | Ga0075362_10025386 | 3300006177 | Bacteria | 2522 |
| 322 | Ga0075362_10025904 | 3300006177 | Bacteria | 2501 |
| 323 | Ga0075362_10051494 | 3300006177 | Bacteria | 1843 |
| 324 | Ga0075367_10023649 | 3300006178 | Bacteria | 3459 |
| 325 | Ga0075367_10046511 | 3300006178 | Bacteria | 2550 |
| 326 | Ga0075367_10062297 | 3300006178 | Bacteria | 2227 |
| 327 | Ga0075367_10138911 | 3300006178 | Bacteria | 1505 |
| 328 | Ga0075369_10001213 | 3300006186 | Bacteria | 8746 |
| 329 | Ga0075369_10048776 | 3300006186 | Bacteria | 1828 |
| 330 | Ga0075369_10052095 | 3300006186 | Bacteria | 1774 |
| 331 | Ga0075366_10003302 | 3300006195 | Bacteria | 8485 |
| 332 | Ga0075366_10005390 | 3300006195 | Bacteria | 6930 |
| 333 | Ga0075366_10011482 | 3300006195 | Bacteria | 5003 |
| 334 | Ga0075366_10044896 | 3300006195 | Bacteria | 2619 |
| 335 | Ga0075366_10050413 | 3300006195 | Bacteria | 2471 |
| 336 | Ga0075366_10058716 | 3300006195 | Bacteria | 2285 |
| 337 | Ga0075366_10088581 | 3300006195 | Bacteria | 1853 |
| 338 | Ga0075366_10097862 | 3300006195 | Bacteria | 1760 |
| 339 | Ga0097621_100040696 | 3300006237 | Bacteria | 3738 |
| 340 | Ga0097621_100048451 | 3300006237 | Bacteria | 3447 |
| 341 | Ga0097621_100060446 | 3300006237 | Bacteria | 3106 |
| 342 | Ga0097621_100061415 | 3300006237 | Bacteria | 3082 |
| 343 | Ga0097621_100151552 | 3300006237 | Bacteria | 1988 |
| 344 | Ga0075370_10000246 | 3300006353 | Bacteria | 19428 |
| 345 | Ga0075370_10001169 | 3300006353 | Bacteria | 11034 |
| 346 | Ga0075370_10003627 | 3300006353 | Bacteria | 7385 |
| 347 | Ga0075370_10003633 | 3300006353 | Bacteria | 7381 |
| 348 | Ga0075370_10006991 | 3300006353 | Bacteria | 5720 |
| 349 | Ga0075370_10008378 | 3300006353 | Bacteria | 5319 |
| 350 | Ga0075370_10017146 | 3300006353 | Bacteria | 3909 |
| 351 | Ga0075370_10028091 | 3300006353 | Bacteria | 3125 |
| 352 | Ga0075370_10028308 | 3300006353 | Bacteria | 3114 |
| 353 | Ga0075370_10031633 | 3300006353 | Bacteria | 2954 |
| 354 | Ga0075370_10037655 | 3300006353 | Bacteria | 2720 |
| 355 | Ga0075370_10043263 | 3300006353 | Bacteria | 2545 |
| 356 | Ga0075370_10052826 | 3300006353 | Bacteria | 2306 |
| 357 | Ga0075370_10059175 | 3300006353 | Bacteria | 2180 |
| 358 | Ga0068871_100014788 | 3300006358 | Bacteria | 5827 |
| 359 | Ga0068871_100026057 | 3300006358 | Bacteria | 4558 |
| 360 | Ga0068871_100051277 | 3300006358 | Bacteria | 3341 |
| 361 | Ga0068871_100073545 | 3300006358 | Bacteria | 2818 |
| 362 | Ga0068871_100129646 | 3300006358 | Bacteria | 2137 |
| 363 | Ga0075429_100095617 | 3300006880 | Bacteria | 2591 |
| 364 | Ga0068865_100002164 | 3300006881 | Bacteria | 11577 |
| 365 | Ga0068865_100004824 | 3300006881 | Bacteria | 8148 |
| 366 | Ga0068865_100005297 | 3300006881 | Bacteria | 7806 |
| 367 | Ga0068865_100025563 | 3300006881 | Bacteria | 3885 |
| 368 | Ga0068865_100195010 | 3300006881 | Bacteria | 1569 |
| 369 | Ga0097620_100003146 | 3300006931 | Bacteria | 16781 |
| 370 | Ga0097620_100030836 | 3300006931 | Bacteria | 5381 |
| 371 | Ga0097620_100090164 | 3300006931 | Bacteria | 3117 |
| 372 | Ga0097620_100148494 | 3300006931 | Bacteria | 2419 |
| 373 | Ga0097620_100154058 | 3300006931 | Bacteria | 2375 |
| 374 | Ga0099823_1007351 | 3300006944 | Bacteria | 11174 |
| 375 | Ga0079104_1000011 | 3300006946 | Bacteria | 359962 |
| 376 | Ga0079104_1000019 | 3300006946 | Bacteria | 269313 |
| 377 | Ga0099826_10000096 | 3300006948 | Bacteria | 41938 |
| 378 | Ga0099826_10007062 | 3300006948 | Bacteria | 8243 |
| 379 | Ga0105244_10003175 | 3300009036 | Bacteria | 11930 |
| 380 | Ga0105244_10101048 | 3300009036 | Bacteria | 1410 |
| 381 | Ga0105250_10017928 | 3300009092 | Bacteria | 2873 |
| 382 | Ga0105240_10000951 | 3300009093 | Bacteria | 51613 |
| 383 | Ga0105240_10001089 | 3300009093 | Bacteria | 47935 |
| 384 | Ga0105245_10009930 | 3300009098 | Bacteria | 8293 |
| 385 | Ga0105245_10071820 | 3300009098 | Bacteria | 3144 |
| 386 | Ga0105245_10105118 | 3300009098 | Bacteria | 2618 |
| 387 | Ga0114129_10134779 | 3300009147 | Bacteria | 3389 |
| 388 | Ga0105243_10000400 | 3300009148 | Bacteria | 45768 |
| 389 | Ga0105243_10001880 | 3300009148 | Bacteria | 17890 |
| 390 | Ga0105243_10003082 | 3300009148 | Bacteria | 13722 |
| 391 | Ga0105243_10015844 | 3300009148 | Bacteria | 5703 |
| 392 | Ga0105243_10020381 | 3300009148 | Bacteria | 5028 |
| 393 | Ga0105243_10247510 | 3300009148 | Bacteria | 1590 |
| 394 | Ga0105243_10267990 | 3300009148 | Bacteria | 1532 |
| 395 | Ga0105241_10043500 | 3300009174 | Bacteria | 3402 |
| 396 | Ga0105242_10006688 | 3300009176 | Bacteria | 8899 |
| 397 | Ga0105242_10028293 | 3300009176 | Bacteria | 4461 |
| 398 | Ga0105242_10034606 | 3300009176 | Bacteria | 4050 |
| 399 | Ga0105242_10035127 | 3300009176 | Bacteria | 4020 |
| 400 | Ga0105242_10173431 | 3300009176 | Bacteria | 1897 |
| 401 | Ga0105248_10014279 | 3300009177 | Bacteria | 8743 |
| 402 | Ga0105248_10021294 | 3300009177 | Bacteria | 7185 |
| 403 | Ga0105248_10107959 | 3300009177 | Bacteria | 3139 |
| 404 | Ga0105248_10135771 | 3300009177 | Bacteria | 2775 |
| 405 | Ga0105248_10173519 | 3300009177 | Bacteria | 2430 |
| 406 | Ga0105248_10173966 | 3300009177 | Bacteria | 2427 |
| 407 | Ga0105237_10003603 | 3300009545 | Bacteria | 18306 |
| 408 | Ga0105237_10030715 | 3300009545 | Bacteria | 5454 |
| 409 | Ga0105237_10057916 | 3300009545 | Bacteria | 3877 |
| 410 | Ga0105238_10007548 | 3300009551 | Bacteria | 10891 |
| 411 | Ga0105238_10007948 | 3300009551 | Bacteria | 10612 |
| 412 | Ga0105238_10020812 | 3300009551 | Bacteria | 6681 |
| 413 | Ga0105238_10112379 | 3300009551 | Bacteria | 2703 |
| 414 | Ga0105249_10001498 | 3300009553 | Bacteria | 20478 |
| 415 | Ga0105249_10004113 | 3300009553 | Bacteria | 12563 |
| 416 | Ga0105249_10152584 | 3300009553 | Bacteria | 2225 |
| 417 | Ga0105239_10005179 | 3300010375 | Bacteria | 15367 |
| 418 | Ga0105239_10100070 | 3300010375 | Bacteria | 3206 |
| 419 | Ga0105246_10024888 | 3300011119 | Bacteria | 3896 |
| 420 | Ga0105246_10116819 | 3300011119 | Bacteria | 1970 |
| 421 | Ga0157319_1000009 | 3300012497 | Bacteria | 227971 |
| 422 | Ga0157373_10008552 | 3300013100 | Bacteria | 7603 |
| 423 | Ga0157373_10012879 | 3300013100 | Bacteria | 6140 |
| 424 | Ga0157373_10133603 | 3300013100 | Bacteria | 1744 |
| 425 | Ga0157370_10000583 | 3300013104 | Bacteria | 45511 |
| 426 | Ga0157370_10019170 | 3300013104 | Bacteria | 6874 |
| 427 | Ga0157370_10129097 | 3300013104 | Bacteria | 2358 |
| 428 | Ga0157369_10009941 | 3300013105 | Bacteria | 10868 |
| 429 | Ga0157369_10021442 | 3300013105 | Bacteria | 7227 |
| 430 | Ga0157369_10035074 | 3300013105 | Bacteria | 5502 |
| 431 | Ga0157374_10016391 | 3300013296 | Bacteria | 6511 |
| 432 | Ga0157374_10037469 | 3300013296 | Bacteria | 4451 |
| 433 | Ga0157374_10102555 | 3300013296 | Bacteria | 2744 |
| 434 | Ga0157374_10183801 | 3300013296 | Bacteria | 2043 |
| 435 | Ga0157374_10204401 | 3300013296 | Bacteria | 1935 |
| 436 | Ga0157378_10034311 | 3300013297 | Bacteria | 4487 |
| 437 | Ga0163162_10011301 | 3300013306 | Bacteria | 8707 |
| 438 | Ga0163162_10022647 | 3300013306 | Bacteria | 6193 |
| 439 | Ga0163162_10029102 | 3300013306 | Bacteria | 5466 |
| 440 | Ga0163162_10074236 | 3300013306 | Bacteria | 3459 |
| 441 | Ga0163162_10075996 | 3300013306 | Bacteria | 3420 |
| 442 | Ga0163162_10122944 | 3300013306 | Bacteria | 2700 |
| 443 | Ga0163162_10308257 | 3300013306 | Bacteria | 1715 |
| 444 | Ga0157372_10002878 | 3300013307 | Bacteria | 18606 |
| 445 | Ga0157372_10026418 | 3300013307 | Bacteria | 6318 |
| 446 | Ga0157372_10039703 | 3300013307 | Bacteria | 5196 |
| 447 | Ga0157375_10003456 | 3300013308 | Bacteria | 13690 |
| 448 | Ga0157375_10017862 | 3300013308 | Bacteria | 6416 |
| 449 | Ga0157375_10036590 | 3300013308 | Bacteria | 4698 |
| 450 | Ga0157375_10038720 | 3300013308 | Bacteria | 4580 |
| 451 | Ga0157375_10042838 | 3300013308 | Bacteria | 4385 |
| 452 | Ga0157375_10063319 | 3300013308 | Bacteria | 3679 |
| 453 | Ga0157375_10335149 | 3300013308 | Bacteria | 1678 |
| 454 | Ga0157375_10445857 | 3300013308 | Bacteria | 1460 |
| 455 | Ga0163163_10005453 | 3300014325 | Bacteria | 10993 |
| 456 | Ga0163163_10294718 | 3300014325 | Bacteria | 1674 |
| 457 | Ga0157380_10002934 | 3300014326 | Bacteria | 11595 |
| 458 | Ga0157380_10003080 | 3300014326 | Bacteria | 11367 |
| 459 | Ga0157380_10023913 | 3300014326 | Bacteria | 4616 |
| 460 | Ga0157380_10105348 | 3300014326 | Bacteria | 2357 |
| 461 | Ga0182008_10000398 | 3300014497 | Bacteria | 33725 |
| 462 | Ga0182008_10001698 | 3300014497 | Bacteria | 14453 |
| 463 | Ga0182008_10007000 | 3300014497 | Bacteria | 6254 |
| 464 | Ga0182008_10013166 | 3300014497 | Bacteria | 4350 |
| 465 | Ga0182008_10015404 | 3300014497 | Bacteria | 3989 |
| 466 | Ga0182008_10034149 | 3300014497 | Bacteria | 2550 |
| 467 | Ga0182008_10042429 | 3300014497 | Bacteria | 2266 |
| 468 | Ga0157377_10000014 | 3300014745 | Bacteria | 213961 |
| 469 | Ga0157379_10007780 | 3300014968 | Bacteria | 9280 |
| 470 | Ga0157379_10012988 | 3300014968 | Bacteria | 7288 |
| 471 | Ga0157379_10017193 | 3300014968 | Bacteria | 6370 |
| 472 | Ga0157379_10027948 | 3300014968 | Bacteria | 5019 |
| 473 | Ga0157379_10030440 | 3300014968 | Bacteria | 4805 |
| 474 | Ga0157379_10095832 | 3300014968 | Bacteria | 2663 |
| 475 | Ga0157379_10275757 | 3300014968 | Bacteria | 1530 |
| 476 | Ga0157376_10002109 | 3300014969 | Bacteria | 13382 |
| 477 | Ga0157376_10018872 | 3300014969 | Bacteria | 5301 |
| 478 | Ga0157376_10035383 | 3300014969 | Bacteria | 4040 |
| 479 | Ga0157376_10097017 | 3300014969 | Bacteria | 2567 |
| 480 | Ga0157376_10130519 | 3300014969 | Bacteria | 2241 |
| 481 | Ga0157376_10279849 | 3300014969 | Bacteria | 1571 |
| 482 | Ga0182006_1001743 | 3300015261 | Bacteria | 12616 |
| 483 | Ga0182006_1014199 | 3300015261 | Bacteria | 3437 |
| 484 | Ga0182006_1035107 | 3300015261 | Bacteria | 2001 |
| 485 | Ga0182006_1039934 | 3300015261 | Bacteria | 1849 |
| 486 | Ga0182007_10003330 | 3300015262 | Bacteria | 7604 |
| 487 | Ga0182007_10029258 | 3300015262 | Bacteria | 1887 |
| 488 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 489 | Ga0163161_10000149 | 3300017792 | Bacteria | 64127 |
| 490 | Ga0163161_10004629 | 3300017792 | Bacteria | 9576 |
| 491 | Ga0163161_10007626 | 3300017792 | Bacteria | 7485 |
| 492 | Ga0163161_10010900 | 3300017792 | Bacteria | 6303 |
| 493 | Ga0163161_10013402 | 3300017792 | Bacteria | 5704 |
| 494 | Ga0163161_10018680 | 3300017792 | Bacteria | 4860 |
| 495 | Ga0163161_10028738 | 3300017792 | Bacteria | 3950 |
| 496 | Ga0163161_10046965 | 3300017792 | Bacteria | 3117 |
| 497 | Ga0163161_10064859 | 3300017792 | Bacteria | 2665 |
| 498 | Ga0163161_10087430 | 3300017792 | Bacteria | 2302 |
| 499 | Ga0213872_10001558 | 3300021361 | Bacteria | 14675 |
| 500 | Ga0213872_10024989 | 3300021361 | Bacteria | 2747 |
| 501 | Ga0213872_10041667 | 3300021361 | Bacteria | 2095 |
| 502 | Ga0213876_10028678 | 3300021384 | Bacteria | 2935 |
| 503 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 504 | Ga0209436_108179 | 3300025208 | Bacteria | 2107 |
| 505 | Ga0209674_100007 | 3300025226 | Bacteria | 1077082 |
| 506 | Ga0209672_100751 | 3300025228 | Bacteria | 15798 |
| 507 | Ga0209672_103873 | 3300025228 | Bacteria | 2944 |
| 508 | Ga0209147_102627 | 3300025229 | Bacteria | 4230 |
| 509 | Ga0209563_100033 | 3300025230 | Bacteria | 457883 |
| 510 | Ga0209563_103671 | 3300025230 | Bacteria | 3118 |
| 511 | Ga0207427_101232 | 3300025231 | Bacteria | 9812 |
| 512 | Ga0209258_100058 | 3300025242 | Bacteria | 331567 |
| 513 | Ga0209258_100353 | 3300025242 | Bacteria | 63996 |
| 514 | Ga0207425_1000218 | 3300025245 | Bacteria | 45206 |
| 515 | Ga0207425_1001283 | 3300025245 | Bacteria | 10899 |
| 516 | Ga0207425_1002538 | 3300025245 | Bacteria | 6365 |
| 517 | Ga0207425_1006474 | 3300025245 | Bacteria | 3201 |
| 518 | Ga0207425_1012416 | 3300025245 | Bacteria | 1999 |
| 519 | Ga0207425_1015207 | 3300025245 | Bacteria | 1732 |
| 520 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 521 | Ga0209646_1000053 | 3300025246 | Bacteria | 284737 |
| 522 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 523 | Ga0209026_1000020 | 3300025250 | Bacteria | 376211 |
| 524 | Ga0209026_1002653 | 3300025250 | Bacteria | 6505 |
| 525 | Ga0209677_100132 | 3300025253 | Bacteria | 72060 |
| 526 | Ga0209677_100161 | 3300025253 | Bacteria | 59768 |
| 527 | Ga0209677_103481 | 3300025253 | Bacteria | 5069 |
| 528 | Ga0209148_1000071 | 3300025254 | Bacteria | 331551 |
| 529 | Ga0209148_1003552 | 3300025254 | Bacteria | 4233 |
| 530 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 531 | Ga0209759_1000017 | 3300025256 | Bacteria | 376232 |
| 532 | Ga0209759_1000913 | 3300025256 | Bacteria | 21908 |
| 533 | Ga0209759_1001199 | 3300025256 | Bacteria | 16128 |
| 534 | Ga0209759_1002284 | 3300025256 | Bacteria | 8656 |
| 535 | Ga0209129_1000023 | 3300025258 | Bacteria | 420646 |
| 536 | Ga0209129_1000041 | 3300025258 | Bacteria | 307590 |
| 537 | Ga0209129_1001863 | 3300025258 | Bacteria | 11142 |
| 538 | Ga0209129_1007583 | 3300025258 | Bacteria | 3196 |
| 539 | Ga0209129_1008749 | 3300025258 | Bacteria | 2767 |
| 540 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 541 | Ga0209565_1000075 | 3300025263 | Bacteria | 162259 |
| 542 | Ga0209565_1000327 | 3300025263 | Bacteria | 42380 |
| 543 | Ga0209565_1000609 | 3300025263 | Bacteria | 23714 |
| 544 | Ga0209565_1000693 | 3300025263 | Bacteria | 20872 |
| 545 | Ga0209565_1003001 | 3300025263 | Bacteria | 5719 |
| 546 | Ga0209455_1000136 | 3300025272 | Bacteria | 146375 |
| 547 | Ga0209673_1000066 | 3300025273 | Bacteria | 250037 |
| 548 | Ga0209673_1000289 | 3300025273 | Bacteria | 93941 |
| 549 | Ga0209673_1000357 | 3300025273 | Bacteria | 82249 |
| 550 | Ga0209673_1000362 | 3300025273 | Bacteria | 81651 |
| 551 | Ga0209673_1000798 | 3300025273 | Bacteria | 41767 |
| 552 | Ga0209673_1006734 | 3300025273 | Bacteria | 5472 |
| 553 | Ga0209673_1009202 | 3300025273 | Bacteria | 4307 |
| 554 | Ga0209673_1009683 | 3300025273 | Bacteria | 4141 |
| 555 | Ga0209673_1017231 | 3300025273 | Bacteria | 2668 |
| 556 | Ga0209673_1019046 | 3300025273 | Bacteria | 2476 |
| 557 | Ga0209130_1000069 | 3300025284 | Bacteria | 179177 |
| 558 | Ga0209130_1000082 | 3300025284 | Bacteria | 164441 |
| 559 | Ga0209130_1000094 | 3300025284 | Bacteria | 145569 |
| 560 | Ga0209130_1002257 | 3300025284 | Bacteria | 9954 |
| 561 | Ga0209130_1003786 | 3300025284 | Bacteria | 6155 |
| 562 | Ga0209675_1000061 | 3300025291 | Bacteria | 181096 |
| 563 | Ga0209675_1000074 | 3300025291 | Bacteria | 162260 |
| 564 | Ga0209675_1000177 | 3300025291 | Bacteria | 73574 |
| 565 | Ga0209675_1000325 | 3300025291 | Bacteria | 42380 |
| 566 | Ga0209675_1001059 | 3300025291 | Bacteria | 17058 |
| 567 | Ga0209675_1001796 | 3300025291 | Bacteria | 11724 |
| 568 | Ga0209675_1004674 | 3300025291 | Bacteria | 6008 |
| 569 | Ga0209675_1005211 | 3300025291 | Bacteria | 5510 |
| 570 | Ga0209675_1012304 | 3300025291 | Bacteria | 2769 |
| 571 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 572 | Ga0209676_1000029 | 3300025292 | Bacteria | 520536 |
| 573 | Ga0209676_1000105 | 3300025292 | Bacteria | 224151 |
| 574 | Ga0209676_1000142 | 3300025292 | Bacteria | 175752 |
| 575 | Ga0209676_1000186 | 3300025292 | Bacteria | 142440 |
| 576 | Ga0209676_1003917 | 3300025292 | Bacteria | 8635 |
| 577 | Ga0209676_1017519 | 3300025292 | Bacteria | 2532 |
| 578 | Ga0209025_1000351 | 3300025294 | Bacteria | 99585 |
| 579 | Ga0209025_1000579 | 3300025294 | Bacteria | 66370 |
| 580 | Ga0209025_1000644 | 3300025294 | Bacteria | 61330 |
| 581 | Ga0209025_1005852 | 3300025294 | Bacteria | 9833 |
| 582 | Ga0209025_1010713 | 3300025294 | Bacteria | 6167 |
| 583 | Ga0209025_1022914 | 3300025294 | Bacteria | 3290 |
| 584 | Ga0209025_1027340 | 3300025294 | Bacteria | 2831 |
| 585 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 586 | Ga0209564_1000029 | 3300025295 | Bacteria | 505995 |
| 587 | Ga0209564_1000090 | 3300025295 | Bacteria | 249298 |
| 588 | Ga0209564_1000527 | 3300025295 | Bacteria | 62263 |
| 589 | Ga0209564_1005458 | 3300025295 | Bacteria | 7254 |
| 590 | Ga0209564_1005474 | 3300025295 | Bacteria | 7234 |
| 591 | Ga0209564_1009963 | 3300025295 | Bacteria | 4441 |
| 592 | Ga0209564_1022209 | 3300025295 | Bacteria | 2251 |
| 593 | Ga0209758_1000043 | 3300025297 | Bacteria | 402310 |
| 594 | Ga0209758_1000044 | 3300025297 | Bacteria | 398448 |
| 595 | Ga0209758_1000057 | 3300025297 | Bacteria | 333111 |
| 596 | Ga0209758_1020115 | 3300025297 | Bacteria | 3177 |
| 597 | Ga0209758_1041408 | 3300025297 | Bacteria | 1722 |
| 598 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 599 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 600 | Ga0209050_1000082 | 3300025298 | Bacteria | 266864 |
| 601 | Ga0209050_1000149 | 3300025298 | Bacteria | 163252 |
| 602 | Ga0209050_1000569 | 3300025298 | Bacteria | 59887 |
| 603 | Ga0209050_1001141 | 3300025298 | Bacteria | 31960 |
| 604 | Ga0209050_1001330 | 3300025298 | Bacteria | 27524 |
| 605 | Ga0209050_1004588 | 3300025298 | Bacteria | 9259 |
| 606 | Ga0209050_1005248 | 3300025298 | Bacteria | 8259 |
| 607 | Ga0209050_1006884 | 3300025298 | Bacteria | 6593 |
| 608 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 609 | Ga0209256_1000020 | 3300025299 | Bacteria | 542402 |
| 610 | Ga0209256_1000022 | 3300025299 | Bacteria | 481843 |
| 611 | Ga0209256_1000024 | 3300025299 | Bacteria | 448909 |
| 612 | Ga0209256_1002170 | 3300025299 | Bacteria | 16860 |
| 613 | Ga0209256_1002204 | 3300025299 | Bacteria | 16682 |
| 614 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 615 | Ga0207426_1000025 | 3300025302 | Bacteria | 532921 |
| 616 | Ga0207426_1000031 | 3300025302 | Bacteria | 460699 |
| 617 | Ga0207426_1001168 | 3300025302 | Bacteria | 23518 |
| 618 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 619 | Ga0209051_1000029 | 3300025303 | Bacteria | 403675 |
| 620 | Ga0209051_1000036 | 3300025303 | Bacteria | 339863 |
| 621 | Ga0209051_1000063 | 3300025303 | Bacteria | 249739 |
| 622 | Ga0209051_1000064 | 3300025303 | Bacteria | 231735 |
| 623 | Ga0209051_1000078 | 3300025303 | Bacteria | 201965 |
| 624 | Ga0209051_1000213 | 3300025303 | Bacteria | 98755 |
| 625 | Ga0209051_1000243 | 3300025303 | Bacteria | 91605 |
| 626 | Ga0209051_1000455 | 3300025303 | Bacteria | 54195 |
| 627 | Ga0209051_1001500 | 3300025303 | Bacteria | 19504 |
| 628 | Ga0209051_1004021 | 3300025303 | Bacteria | 9305 |
| 629 | Ga0209051_1006392 | 3300025303 | Bacteria | 6651 |
| 630 | Ga0209051_1006879 | 3300025303 | Bacteria | 6318 |
| 631 | Ga0209051_1008919 | 3300025303 | Bacteria | 5238 |
| 632 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 633 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 634 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 635 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 636 | Ga0209257_1000030 | 3300025304 | Bacteria | 689812 |
| 637 | Ga0209257_1000109 | 3300025304 | Bacteria | 239439 |
| 638 | Ga0209257_1000118 | 3300025304 | Bacteria | 225963 |
| 639 | Ga0209257_1000226 | 3300025304 | Bacteria | 133836 |
| 640 | Ga0209257_1000980 | 3300025304 | Bacteria | 38745 |
| 641 | Ga0209257_1002930 | 3300025304 | Bacteria | 15721 |
| 642 | Ga0209257_1003485 | 3300025304 | Bacteria | 13420 |
| 643 | Ga0209257_1018343 | 3300025304 | Bacteria | 2698 |
| 644 | Ga0209257_1019700 | 3300025304 | Bacteria | 2527 |
| 645 | Ga0207697_10006077 | 3300025315 | Bacteria | 5519 |
| 646 | Ga0207697_10020917 | 3300025315 | Bacteria | 2679 |
| 647 | Ga0207697_10023400 | 3300025315 | Bacteria | 2529 |
| 648 | Ga0207697_10055501 | 3300025315 | Bacteria | 1642 |
| 649 | Ga0207656_10003985 | 3300025321 | Bacteria | 5119 |
| 650 | Ga0207656_10012705 | 3300025321 | Bacteria | 3206 |
| 651 | Ga0207656_10013411 | 3300025321 | Bacteria | 3132 |
| 652 | Ga0207656_10020257 | 3300025321 | Bacteria | 2642 |
| 653 | Ga0207656_10025458 | 3300025321 | Bacteria | 2402 |
| 654 | Ga0207696_1015363 | 3300025711 | Bacteria | 2598 |
| 655 | Ga0207655_1026542 | 3300025728 | Bacteria | 2780 |
| 656 | Ga0207682_10000759 | 3300025893 | Bacteria | 14883 |
| 657 | Ga0207682_10013091 | 3300025893 | Bacteria | 3233 |
| 658 | Ga0207642_10029763 | 3300025899 | Bacteria | 2265 |
| 659 | Ga0207680_10001601 | 3300025903 | Bacteria | 10703 |
| 660 | Ga0207645_10003471 | 3300025907 | Bacteria | 11944 |
| 661 | Ga0207645_10004926 | 3300025907 | Bacteria | 9791 |
| 662 | Ga0207645_10011577 | 3300025907 | Bacteria | 6015 |
| 663 | Ga0207645_10012714 | 3300025907 | Bacteria | 5707 |
| 664 | Ga0207645_10018093 | 3300025907 | Bacteria | 4644 |
| 665 | Ga0207645_10028617 | 3300025907 | Bacteria | 3597 |
| 666 | Ga0207643_10012919 | 3300025908 | Bacteria | 4516 |
| 667 | Ga0207705_10123016 | 3300025909 | Bacteria | 1927 |
| 668 | Ga0207684_10011095 | 3300025910 | Bacteria | 7887 |
| 669 | Ga0207654_10034398 | 3300025911 | Bacteria | 2815 |
| 670 | Ga0207695_10002904 | 3300025913 | Bacteria | 24801 |
| 671 | Ga0207695_10018222 | 3300025913 | Bacteria | 8125 |
| 672 | Ga0207695_10155131 | 3300025913 | Bacteria | 2225 |
| 673 | Ga0207671_10005965 | 3300025914 | Bacteria | 11041 |
| 674 | Ga0207671_10103190 | 3300025914 | Bacteria | 2162 |
| 675 | Ga0207662_10029873 | 3300025918 | Bacteria | 3160 |
| 676 | Ga0207657_10035067 | 3300025919 | Bacteria | 4504 |
| 677 | Ga0207657_10050686 | 3300025919 | Bacteria | 3611 |
| 678 | Ga0207657_10056390 | 3300025919 | Bacteria | 3390 |
| 679 | Ga0207657_10129827 | 3300025919 | Bacteria | 2066 |
| 680 | Ga0207649_10009799 | 3300025920 | Bacteria | 5249 |
| 681 | Ga0207649_10097267 | 3300025920 | Bacteria | 1941 |
| 682 | Ga0207652_10015168 | 3300025921 | Bacteria | 6252 |
| 683 | Ga0207652_10139706 | 3300025921 | Bacteria | 2165 |
| 684 | Ga0207646_10157201 | 3300025922 | Bacteria | 2051 |
| 685 | Ga0207681_10000899 | 3300025923 | Bacteria | 19447 |
| 686 | Ga0207681_10010511 | 3300025923 | Bacteria | 5669 |
| 687 | Ga0207694_10016398 | 3300025924 | Bacteria | 5594 |
| 688 | Ga0207694_10034080 | 3300025924 | Bacteria | 3903 |
| 689 | Ga0207694_10043051 | 3300025924 | Bacteria | 3484 |
| 690 | Ga0207694_10149216 | 3300025924 | Bacteria | 1883 |
| 691 | Ga0207650_10000878 | 3300025925 | Bacteria | 22741 |
| 692 | Ga0207650_10002442 | 3300025925 | Bacteria | 12942 |
| 693 | Ga0207650_10014659 | 3300025925 | Bacteria | 5445 |
| 694 | Ga0207650_10140005 | 3300025925 | Bacteria | 1901 |
| 695 | Ga0207659_10000135 | 3300025926 | Bacteria | 43365 |
| 696 | Ga0207659_10000207 | 3300025926 | Bacteria | 35338 |
| 697 | Ga0207659_10001596 | 3300025926 | Bacteria | 13455 |
| 698 | Ga0207659_10006224 | 3300025926 | Bacteria | 7300 |
| 699 | Ga0207659_10032239 | 3300025926 | Bacteria | 3594 |
| 700 | Ga0207659_10141460 | 3300025926 | Bacteria | 1868 |
| 701 | Ga0207659_10259042 | 3300025926 | Bacteria | 1414 |
| 702 | Ga0207687_10015611 | 3300025927 | Bacteria | 4982 |
| 703 | Ga0207687_10098169 | 3300025927 | Bacteria | 2150 |
| 704 | Ga0207644_10001220 | 3300025931 | Bacteria | 16541 |
| 705 | Ga0207644_10001228 | 3300025931 | Bacteria | 16510 |
| 706 | Ga0207644_10021457 | 3300025931 | Bacteria | 4400 |
| 707 | Ga0207644_10041528 | 3300025931 | Bacteria | 3254 |
| 708 | Ga0207644_10046621 | 3300025931 | Bacteria | 3089 |
| 709 | Ga0207644_10244143 | 3300025931 | Bacteria | 1431 |
| 710 | Ga0207690_10000359 | 3300025932 | Bacteria | 30319 |
| 711 | Ga0207690_10039046 | 3300025932 | Bacteria | 3095 |
| 712 | Ga0207690_10102670 | 3300025932 | Bacteria | 2045 |
| 713 | Ga0207690_10224641 | 3300025932 | Bacteria | 1438 |
| 714 | Ga0207706_10000654 | 3300025933 | Bacteria | 36592 |
| 715 | Ga0207706_10002883 | 3300025933 | Bacteria | 16654 |
| 716 | Ga0207706_10002944 | 3300025933 | Bacteria | 16449 |
| 717 | Ga0207706_10017782 | 3300025933 | Bacteria | 6403 |
| 718 | Ga0207706_10073320 | 3300025933 | Bacteria | 3010 |
| 719 | Ga0207706_10078450 | 3300025933 | Bacteria | 2904 |
| 720 | Ga0207706_10200717 | 3300025933 | Bacteria | 1749 |
| 721 | Ga0207686_10013697 | 3300025934 | Bacteria | 4493 |
| 722 | Ga0207686_10025763 | 3300025934 | Bacteria | 3426 |
| 723 | Ga0207686_10073882 | 3300025934 | Bacteria | 2201 |
| 724 | Ga0207709_10000038 | 3300025935 | Bacteria | 266638 |
| 725 | Ga0207709_10000147 | 3300025935 | Bacteria | 97401 |
| 726 | Ga0207709_10000214 | 3300025935 | Bacteria | 74364 |
| 727 | Ga0207709_10004723 | 3300025935 | Bacteria | 7828 |
| 728 | Ga0207709_10009501 | 3300025935 | Bacteria | 5351 |
| 729 | Ga0207709_10020370 | 3300025935 | Bacteria | 3741 |
| 730 | Ga0207709_10032522 | 3300025935 | Bacteria | 3055 |
| 731 | Ga0207670_10039836 | 3300025936 | Bacteria | 3080 |
| 732 | Ga0207669_10001219 | 3300025937 | Bacteria | 10928 |
| 733 | Ga0207669_10001590 | 3300025937 | Bacteria | 9667 |
| 734 | Ga0207669_10004703 | 3300025937 | Bacteria | 6041 |
| 735 | Ga0207669_10006838 | 3300025937 | Bacteria | 5244 |
| 736 | Ga0207669_10009417 | 3300025937 | Bacteria | 4650 |
| 737 | Ga0207669_10013232 | 3300025937 | Bacteria | 4090 |
| 738 | Ga0207669_10021720 | 3300025937 | Bacteria | 3394 |
| 739 | Ga0207669_10052263 | 3300025937 | Bacteria | 2453 |
| 740 | Ga0207704_10002775 | 3300025938 | Bacteria | 7905 |
| 741 | Ga0207704_10005625 | 3300025938 | Bacteria | 5785 |
| 742 | Ga0207704_10029924 | 3300025938 | Bacteria | 3046 |
| 743 | Ga0207691_10001187 | 3300025940 | Bacteria | 25907 |
| 744 | Ga0207691_10001712 | 3300025940 | Bacteria | 21616 |
| 745 | Ga0207691_10039447 | 3300025940 | Bacteria | 4369 |
| 746 | Ga0207691_10133271 | 3300025940 | Bacteria | 2193 |
| 747 | Ga0207691_10150673 | 3300025940 | Bacteria | 2045 |
| 748 | Ga0207711_10004508 | 3300025941 | Bacteria | 11863 |
| 749 | Ga0207711_10045951 | 3300025941 | Bacteria | 3731 |
| 750 | Ga0207711_10048324 | 3300025941 | Bacteria | 3640 |
| 751 | Ga0207711_10120738 | 3300025941 | Bacteria | 2339 |
| 752 | Ga0207711_10144084 | 3300025941 | Bacteria | 2145 |
| 753 | Ga0207689_10005835 | 3300025942 | Bacteria | 10916 |
| 754 | Ga0207689_10006945 | 3300025942 | Bacteria | 9952 |
| 755 | Ga0207689_10023078 | 3300025942 | Bacteria | 5225 |
| 756 | Ga0207689_10101824 | 3300025942 | Bacteria | 2359 |
| 757 | Ga0207689_10153379 | 3300025942 | Bacteria | 1899 |
| 758 | Ga0207661_10012975 | 3300025944 | Bacteria | 6080 |
| 759 | Ga0207679_10000220 | 3300025945 | Bacteria | 45059 |
| 760 | Ga0207679_10003707 | 3300025945 | Bacteria | 9470 |
| 761 | Ga0207679_10017872 | 3300025945 | Bacteria | 4741 |
| 762 | Ga0207679_10072079 | 3300025945 | Bacteria | 2608 |
| 763 | Ga0207667_10025000 | 3300025949 | Bacteria | 6547 |
| 764 | Ga0207667_10054838 | 3300025949 | Bacteria | 4192 |
| 765 | Ga0207667_10103527 | 3300025949 | Bacteria | 2936 |
| 766 | Ga0207651_10000798 | 3300025960 | Bacteria | 13560 |
| 767 | Ga0207651_10002450 | 3300025960 | Bacteria | 8878 |
| 768 | Ga0207651_10013478 | 3300025960 | Bacteria | 4680 |
| 769 | Ga0207651_10018259 | 3300025960 | Bacteria | 4168 |
| 770 | Ga0207651_10047090 | 3300025960 | Bacteria | 2904 |
| 771 | Ga0207651_10047832 | 3300025960 | Bacteria | 2887 |
| 772 | Ga0207651_10055284 | 3300025960 | Bacteria | 2725 |
| 773 | Ga0207651_10110123 | 3300025960 | Bacteria | 2065 |
| 774 | Ga0207712_10000828 | 3300025961 | Bacteria | 22710 |
| 775 | Ga0207668_10001541 | 3300025972 | Bacteria | 13480 |
| 776 | Ga0207668_10014399 | 3300025972 | Bacteria | 4894 |
| 777 | Ga0207668_10025183 | 3300025972 | Bacteria | 3848 |
| 778 | Ga0207668_10117088 | 3300025972 | Bacteria | 2010 |
| 779 | Ga0207668_10183343 | 3300025972 | Bacteria | 1653 |
| 780 | Ga0207640_10006017 | 3300025981 | Bacteria | 6631 |
| 781 | Ga0207640_10095449 | 3300025981 | Bacteria | 2071 |
| 782 | Ga0207658_10000860 | 3300025986 | Bacteria | 25382 |
| 783 | Ga0207658_10003454 | 3300025986 | Bacteria | 11183 |
| 784 | Ga0207658_10005178 | 3300025986 | Bacteria | 8976 |
| 785 | Ga0207658_10056497 | 3300025986 | Bacteria | 2913 |
| 786 | Ga0207677_10005607 | 3300026023 | Bacteria | 6819 |
| 787 | Ga0207677_10012083 | 3300026023 | Bacteria | 4948 |
| 788 | Ga0207677_10014359 | 3300026023 | Bacteria | 4623 |
| 789 | Ga0207677_10015442 | 3300026023 | Bacteria | 4492 |
| 790 | Ga0207677_10026317 | 3300026023 | Bacteria | 3646 |
| 791 | Ga0207677_10079217 | 3300026023 | Bacteria | 2349 |
| 792 | Ga0207677_10153967 | 3300026023 | Bacteria | 1778 |
| 793 | Ga0207703_10001624 | 3300026035 | Bacteria | 20249 |
| 794 | Ga0207703_10002139 | 3300026035 | Bacteria | 17362 |
| 795 | Ga0207703_10009455 | 3300026035 | Bacteria | 7654 |
| 796 | Ga0207639_10039741 | 3300026041 | Bacteria | 3507 |
| 797 | Ga0207678_10160314 | 3300026067 | Bacteria | 1921 |
| 798 | Ga0207678_10199620 | 3300026067 | Bacteria | 1710 |
| 799 | Ga0207708_10073767 | 3300026075 | Bacteria | 2616 |
| 800 | Ga0207708_10075749 | 3300026075 | Bacteria | 2580 |
| 801 | Ga0207702_10002918 | 3300026078 | Bacteria | 16003 |
| 802 | Ga0207702_10011208 | 3300026078 | Bacteria | 7478 |
| 803 | Ga0207702_10099543 | 3300026078 | Bacteria | 2563 |
| 804 | Ga0207702_10240766 | 3300026078 | Bacteria | 1695 |
| 805 | Ga0207641_10001135 | 3300026088 | Bacteria | 26751 |
| 806 | Ga0207641_10005572 | 3300026088 | Bacteria | 10729 |
| 807 | Ga0207641_10019756 | 3300026088 | Bacteria | 5530 |
| 808 | Ga0207641_10020064 | 3300026088 | Bacteria | 5488 |
| 809 | Ga0207641_10036047 | 3300026088 | Bacteria | 4127 |
| 810 | Ga0207641_10052146 | 3300026088 | Bacteria | 3464 |
| 811 | Ga0207641_10070520 | 3300026088 | Bacteria | 3003 |
| 812 | Ga0207641_10218443 | 3300026088 | Bacteria | 1766 |
| 813 | Ga0207641_10314327 | 3300026088 | Bacteria | 1483 |
| 814 | Ga0207648_10000062 | 3300026089 | Bacteria | 99889 |
| 815 | Ga0207648_10002388 | 3300026089 | Bacteria | 20214 |
| 816 | Ga0207648_10004104 | 3300026089 | Bacteria | 15074 |
| 817 | Ga0207648_10006529 | 3300026089 | Bacteria | 11575 |
| 818 | Ga0207648_10007879 | 3300026089 | Bacteria | 10392 |
| 819 | Ga0207648_10022340 | 3300026089 | Bacteria | 5684 |
| 820 | Ga0207648_10076245 | 3300026089 | Bacteria | 2923 |
| 821 | Ga0207648_10144260 | 3300026089 | Bacteria | 2100 |
| 822 | Ga0207648_10148564 | 3300026089 | Bacteria | 2068 |
| 823 | Ga0207648_10159701 | 3300026089 | Bacteria | 1991 |
| 824 | Ga0207676_10001093 | 3300026095 | Bacteria | 20538 |
| 825 | Ga0207676_10007428 | 3300026095 | Bacteria | 7772 |
| 826 | Ga0207676_10026622 | 3300026095 | Bacteria | 4301 |
| 827 | Ga0207676_10037688 | 3300026095 | Bacteria | 3686 |
| 828 | Ga0207676_10108534 | 3300026095 | Bacteria | 2317 |
| 829 | Ga0207674_10001725 | 3300026116 | Bacteria | 27953 |
| 830 | Ga0207674_10015020 | 3300026116 | Bacteria | 8530 |
| 831 | Ga0207674_10041759 | 3300026116 | Bacteria | 4741 |
| 832 | Ga0207674_10052794 | 3300026116 | Bacteria | 4145 |
| 833 | Ga0207674_10112297 | 3300026116 | Bacteria | 2699 |
| 834 | Ga0207675_100000868 | 3300026118 | Bacteria | 30104 |
| 835 | Ga0207675_100002203 | 3300026118 | Bacteria | 19364 |
| 836 | Ga0207675_100004188 | 3300026118 | Bacteria | 13958 |
| 837 | Ga0207675_100005109 | 3300026118 | Bacteria | 12629 |
| 838 | Ga0207683_10001181 | 3300026121 | Bacteria | 23629 |
| 839 | Ga0207683_10023663 | 3300026121 | Bacteria | 5284 |
| 840 | Ga0207683_10044028 | 3300026121 | Bacteria | 3901 |
| 841 | Ga0207683_10044881 | 3300026121 | Bacteria | 3864 |
| 842 | Ga0207683_10046127 | 3300026121 | Bacteria | 3812 |
| 843 | Ga0207683_10108741 | 3300026121 | Bacteria | 2481 |
| 844 | Ga0207683_10164978 | 3300026121 | Bacteria | 2004 |
| 845 | Ga0207683_10177045 | 3300026121 | Bacteria | 1933 |
| 846 | Ga0207683_10181255 | 3300026121 | Bacteria | 1910 |
| 847 | Ga0207698_10004390 | 3300026142 | Bacteria | 8592 |
| 848 | Ga0207698_10012848 | 3300026142 | Bacteria | 5500 |
| 849 | Ga0207698_10024454 | 3300026142 | Bacteria | 4239 |
| 850 | Ga0207698_10051797 | 3300026142 | Bacteria | 3140 |
| 851 | Ga0207698_10099612 | 3300026142 | Bacteria | 2404 |
| 852 | Ga0207698_10134379 | 3300026142 | Bacteria | 2120 |
| 853 | Ga0207698_10200427 | 3300026142 | Bacteria | 1787 |
| 854 | Ga0207698_10273412 | 3300026142 | Bacteria | 1559 |
| 855 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 856 | Ga0209281_1000149 | 3300027111 | Bacteria | 167880 |
| 857 | Ga0209389_1010627 | 3300027296 | Bacteria | 8307 |
| 858 | Ga0209984_1002311 | 3300027424 | Bacteria | 2126 |
| 859 | Ga0209968_1000125 | 3300027526 | Bacteria | 13613 |
| 860 | Ga0209970_1000690 | 3300027614 | Bacteria | 5862 |
| 861 | Ga0209282_1000228 | 3300027666 | Bacteria | 29111 |
| 862 | Ga0209282_1000864 | 3300027666 | Bacteria | 15661 |
| 863 | Ga0209971_1007153 | 3300027682 | Bacteria | 2646 |
| 864 | Ga0209966_1000014 | 3300027695 | Bacteria | 81913 |
| 865 | Ga0209974_10001071 | 3300027876 | Bacteria | 9696 |
| 866 | Ga0209974_10014591 | 3300027876 | Bacteria | 2612 |
| 867 | Ga0268266_10072143 | 3300028379 | Bacteria | 2993 |
| 868 | Ga0268265_10030110 | 3300028380 | Bacteria | 3905 |
| 869 | Ga0268265_10042246 | 3300028380 | Bacteria | 3381 |
| 870 | Ga0268265_10083622 | 3300028380 | Bacteria | 2528 |
| 871 | Ga0268264_10001193 | 3300028381 | Bacteria | 25104 |
| 872 | Ga0268264_10001745 | 3300028381 | Bacteria | 19956 |
| 873 | Ga0268264_10023892 | 3300028381 | Bacteria | 4986 |
| 874 | Ga0268264_10093386 | 3300028381 | Bacteria | 2599 |
| 875 | Ga0268264_10116829 | 3300028381 | Bacteria | 2345 |
| 876 | Ga0268264_10126132 | 3300028381 | Bacteria | 2262 |
| 877 | Ga0265336_10000012 | 3300028666 | Bacteria | 261478 |
| 878 | Ga0307517_10001025 | 3300028786 | Bacteria | 47474 |
| 879 | Ga0307515_10000064 | 3300028794 | Bacteria | 245452 |
| 880 | Ga0307515_10000137 | 3300028794 | Bacteria | 173516 |
| 881 | Ga0307515_10000139 | 3300028794 | Bacteria | 173074 |
| 882 | Ga0307515_10000187 | 3300028794 | Bacteria | 151904 |
| 883 | Ga0307515_10000727 | 3300028794 | Bacteria | 75922 |
| 884 | Ga0307515_10000998 | 3300028794 | Bacteria | 64720 |
| 885 | Ga0307515_10001587 | 3300028794 | Bacteria | 50732 |
| 886 | Ga0307515_10002977 | 3300028794 | Bacteria | 35954 |
| 887 | Ga0307515_10007083 | 3300028794 | Bacteria | 22277 |
| 888 | Ga0307515_10014464 | 3300028794 | Bacteria | 14626 |
| 889 | Ga0307515_10021785 | 3300028794 | Bacteria | 11339 |
| 890 | Ga0307515_10068465 | 3300028794 | Bacteria | 4876 |
| 891 | Ga0307515_10110315 | 3300028794 | Bacteria | 3221 |
| 892 | Ga0265324_10003636 | 3300029957 | Bacteria | 7236 |
| 893 | Ga0307512_10049207 | 3300030522 | Bacteria | 3402 |
| 894 | Ga0314311_1018086 | 3300030733 | Bacteria | 2224 |
| 895 | Ga0316178_1128022 | 3300030735 | Bacteria | 6105 |
| 896 | Ga0316180_1003872 | 3300030736 | Bacteria | 2649 |
| 897 | Ga0316183_1046777 | 3300030742 | Bacteria | 3782 |
| 898 | Ga0316181_1014423 | 3300030744 | Bacteria | 6558 |
| 899 | Ga0265330_10000117 | 3300031235 | Bacteria | 63961 |
| 900 | Ga0265332_10000002 | 3300031238 | Bacteria | 709510 |
| 901 | Ga0265332_10000033 | 3300031238 | Bacteria | 153334 |
| 902 | Ga0265332_10000125 | 3300031238 | Bacteria | 63932 |
| 903 | Ga0265331_10001854 | 3300031250 | Bacteria | 14925 |
| 904 | Ga0265327_10000309 | 3300031251 | Bacteria | 94387 |
| 905 | Ga0265327_10000779 | 3300031251 | Bacteria | 49235 |
| 906 | Ga0265327_10001589 | 3300031251 | Bacteria | 27701 |
| 907 | Ga0265327_10011830 | 3300031251 | Bacteria | 5962 |
| 908 | Ga0265316_10000833 | 3300031344 | Bacteria | 34174 |
| 909 | Ga0307513_10000019 | 3300031456 | Bacteria | 231194 |
| 910 | Ga0307513_10000051 | 3300031456 | Bacteria | 149733 |
| 911 | Ga0307513_10002833 | 3300031456 | Bacteria | 23769 |
| 912 | Ga0307513_10007462 | 3300031456 | Bacteria | 14170 |
| 913 | Ga0307513_10008369 | 3300031456 | Bacteria | 13245 |
| 914 | Ga0307513_10058693 | 3300031456 | Bacteria | 4087 |
| 915 | Ga0307513_10310883 | 3300031456 | Bacteria | 1338 |
| 916 | Ga0307509_10000092 | 3300031507 | Bacteria | 124019 |
| 917 | Ga0307509_10003532 | 3300031507 | Bacteria | 23562 |
| 918 | Ga0307509_10037154 | 3300031507 | Bacteria | 5325 |
| 919 | Ga0307509_10038946 | 3300031507 | Bacteria | 5181 |
| 920 | Ga0307509_10056231 | 3300031507 | Bacteria | 4177 |
| 921 | Ga0307509_10095060 | 3300031507 | Bacteria | 3037 |
| 922 | Ga0307509_10103755 | 3300031507 | Bacteria | 2870 |
| 923 | Ga0307509_10146780 | 3300031507 | Bacteria | 2283 |
| 924 | Ga0307408_100000008 | 3300031548 | Bacteria | 456355 |
| 925 | Ga0307408_100000407 | 3300031548 | Bacteria | 38725 |
| 926 | Ga0307408_100006921 | 3300031548 | Bacteria | 7505 |
| 927 | Ga0307408_100025292 | 3300031548 | Bacteria | 4066 |
| 928 | Ga0307408_100051504 | 3300031548 | Bacteria | 2965 |
| 929 | Ga0307408_100071443 | 3300031548 | Bacteria | 2566 |
| 930 | Ga0307408_100075069 | 3300031548 | Bacteria | 2511 |
| 931 | Ga0307408_100119969 | 3300031548 | Bacteria | 2035 |
| 932 | Ga0307408_100124722 | 3300031548 | Bacteria | 2000 |
| 933 | Ga0307508_10000004 | 3300031616 | Bacteria | 287547 |
| 934 | Ga0307508_10001570 | 3300031616 | Bacteria | 25499 |
| 935 | Ga0307514_10003976 | 3300031649 | Bacteria | 13806 |
| 936 | Ga0307514_10040375 | 3300031649 | Bacteria | 3679 |
| 937 | Ga0307514_10040483 | 3300031649 | Bacteria | 3673 |
| 938 | Ga0265314_10000012 | 3300031711 | Bacteria | 415184 |
| 939 | Ga0265314_10147752 | 3300031711 | Bacteria | 1445 |
| 940 | Ga0307516_10000109 | 3300031730 | Bacteria | 94762 |
| 941 | Ga0307516_10003586 | 3300031730 | Bacteria | 19792 |
| 942 | Ga0307516_10005086 | 3300031730 | Bacteria | 15898 |
| 943 | Ga0307516_10007069 | 3300031730 | Bacteria | 12982 |
| 944 | Ga0307516_10019753 | 3300031730 | Bacteria | 6971 |
| 945 | Ga0307516_10050860 | 3300031730 | Bacteria | 4063 |
| 946 | Ga0307516_10172547 | 3300031730 | Bacteria | 1902 |
| 947 | Ga0307516_10210361 | 3300031730 | Bacteria | 1660 |
| 948 | Ga0307405_10062736 | 3300031731 | Bacteria | 2354 |
| 949 | Ga0307405_10123767 | 3300031731 | Bacteria | 1774 |
| 950 | Ga0307405_10154149 | 3300031731 | Bacteria | 1619 |
| 951 | Ga0307405_10185738 | 3300031731 | Bacteria | 1496 |
| 952 | Ga0307413_10145654 | 3300031824 | Bacteria | 1643 |
| 953 | Ga0307410_10005512 | 3300031852 | Bacteria | 6707 |
| 954 | Ga0307406_10000050 | 3300031901 | Bacteria | 66438 |
| 955 | Ga0307406_10000440 | 3300031901 | Bacteria | 24253 |
| 956 | Ga0307406_10003882 | 3300031901 | Bacteria | 8142 |
| 957 | Ga0307406_10004637 | 3300031901 | Bacteria | 7485 |
| 958 | Ga0307406_10071343 | 3300031901 | Bacteria | 2276 |
| 959 | Ga0307412_10013847 | 3300031911 | Bacteria | 4741 |
| 960 | Ga0307412_10029763 | 3300031911 | Bacteria | 3430 |
| 961 | Ga0307412_10088191 | 3300031911 | Bacteria | 2163 |
| 962 | Ga0307409_100004771 | 3300031995 | Bacteria | 7684 |
| 963 | Ga0307409_100048315 | 3300031995 | Bacteria | 3237 |
| 964 | Ga0307416_100003421 | 3300032002 | Bacteria | 9318 |
| 965 | Ga0307416_100013163 | 3300032002 | Bacteria | 5613 |
| 966 | Ga0307416_100073184 | 3300032002 | Bacteria | 2856 |
| 967 | Ga0307414_10007644 | 3300032004 | Bacteria | 6084 |
| 968 | Ga0307414_10023583 | 3300032004 | Bacteria | 3906 |
| 969 | Ga0307414_10030258 | 3300032004 | Bacteria | 3534 |
| 970 | Ga0307414_10092110 | 3300032004 | Bacteria | 2255 |
| 971 | Ga0307414_10117542 | 3300032004 | Bacteria | 2037 |
| 972 | Ga0307414_10129557 | 3300032004 | Bacteria | 1956 |
| 973 | Ga0307411_10005288 | 3300032005 | Bacteria | 6322 |
| 974 | Ga0307411_10014448 | 3300032005 | Bacteria | 4393 |
| 975 | Ga0307411_10110231 | 3300032005 | Bacteria | 1967 |
| 976 | Ga0307411_10113643 | 3300032005 | Bacteria | 1943 |
| 977 | Ga0307411_10155332 | 3300032005 | Bacteria | 1706 |
| 978 | Ga0307415_100007187 | 3300032126 | Bacteria | 6073 |
| 979 | Ga0307507_10012966 | 3300033179 | Bacteria | 10205 |
| 980 | Ga0307507_10048731 | 3300033179 | Bacteria | 4116 |
| 981 | Ga0307510_10002759 | 3300033180 | Bacteria | 20117 |
| 982 | Ga0373934_0006495 | 3300035086 | Bacteria | 4339 |
| 983 | Ga0373932_0012678 | 3300035112 | Bacteria | 2080 |
| 984 | Ga0373939_0000008 | 3300035114 | Bacteria | 77597 |
| 985 | Ga0373957_0091396 | 3300035120 | Bacteria | 1210 |
| 986 | Ga0373931_0000533 | 3300035691 | Bacteria | 15615 |
| 987 | Ga0373931_0025052 | 3300035691 | Bacteria | 3029 |
| 988 | Ga0373937_0025203 | 3300036401 | Bacteria | 5370 |
| 989 | Ga0373925_0003362 | 3300037068 | Bacteria | 12410 |
| 990 | Ga0373925_0147863 | 3300037068 | Bacteria | 1843 |
| 991 | Ga0395899_0000992 | 3300037312 | Bacteria | 26097 |
| 992 | Ga0395899_0013417 | 3300037312 | Bacteria | 6269 |
| 993 | Ga0395899_0025496 | 3300037312 | Bacteria | 4463 |
| 994 | Ga0395899_0027819 | 3300037312 | Bacteria | 4260 |
| 995 | Ga0395900_0004787 | 3300037418 | Bacteria | 14263 |
| 996 | Ga0395900_0020937 | 3300037418 | Bacteria | 6683 |
| 997 | Ga0395900_0026497 | 3300037418 | Bacteria | 5936 |
| 998 | Ga0395900_0029664 | 3300037418 | Bacteria | 5612 |
| 999 | Ga0395900_0079616 | 3300037418 | Bacteria | 3367 |
| 1000 | Ga0395898_0006328 | 3300037466 | Bacteria | 12651 |
| 1001 | Ga0395898_0036706 | 3300037466 | Bacteria | 4865 |
| 1002 | Ga0395898_0054593 | 3300037466 | Bacteria | 3898 |
| 1003 | Ga0395905_0000148 | 3300037471 | Bacteria | 116301 |
| 1004 | Ga0395905_0000382 | 3300037471 | Bacteria | 63066 |
| 1005 | Ga0395905_0002029 | 3300037471 | Bacteria | 23136 |
| 1006 | Ga0395905_0003923 | 3300037471 | Bacteria | 15650 |
| 1007 | Ga0395905_0005758 | 3300037471 | Bacteria | 12595 |
| 1008 | Ga0395905_0006766 | 3300037471 | Bacteria | 11482 |
| 1009 | Ga0395905_0015358 | 3300037471 | Bacteria | 7278 |
| 1010 | Ga0395905_0017190 | 3300037471 | Bacteria | 6870 |
| 1011 | Ga0395905_0021027 | 3300037471 | Bacteria | 6179 |
| 1012 | Ga0395905_0029796 | 3300037471 | Bacteria | 5143 |
| 1013 | Ga0395905_0032872 | 3300037471 | Bacteria | 4876 |
| 1014 | Ga0395905_0050244 | 3300037471 | Bacteria | 3907 |
| 1015 | Ga0395905_0054783 | 3300037471 | Bacteria | 3732 |
| 1016 | Ga0395905_0084413 | 3300037471 | Bacteria | 2975 |
| 1017 | Ga0395905_0095056 | 3300037471 | Bacteria | 2796 |
| 1018 | Ga0395901_0010348 | 3300038443 | Bacteria | 9448 |
| 1019 | Ga0395901_0034728 | 3300038443 | Bacteria | 5208 |
| 1020 | Ga0395901_0049039 | 3300038443 | Bacteria | 4386 |
| 1021 | Ga0395901_0106293 | 3300038443 | Bacteria | 2946 |
| 1022 | Ga0395901_0150472 | 3300038443 | Bacteria | 2446 |
| 1023 | Ga0395901_0327295 | 3300038443 | Bacteria | 1585 |
| 1024 | Ga0436365_0538258 | 3300039437 | Bacteria | 1412 |
| 1025 | Ga0436361_0026531 | 3300039447 | Bacteria | 11861 |
| 1026 | Ga0436361_0258710 | 3300039447 | Bacteria | 1489 |
| 1027 | Ga0436361_0572364 | 3300039447 | Bacteria | 7145 |
| 1028 | Ga0436361_0848510 | 3300039447 | Bacteria | 27411 |
| 1029 | Ga0436363_0660497 | 3300039450 | Bacteria | 10660 |
| 1030 | Ga0439436_0016367 | 3300041404 | Bacteria | 2225 |
| 1031 | Ga0439439_0011910 | 3300041406 | Bacteria | 2097 |
| 1032 | Ga0439447_025116 | 3300041407 | Bacteria | 1537 |
| 1033 | Ga0439466_0015578 | 3300041411 | Bacteria | 2761 |
| 1034 | Ga0451789_0102886 | 3300041443 | Bacteria | 3368 |
| 1035 | Ga0451789_0982253 | 3300041443 | Bacteria | 2279 |
| 1036 | Ga0451798_0381267 | 3300041458 | Bacteria | 3331 |
| 1037 | Ga0451802_1471416 | 3300041460 | Bacteria | 1826 |
| 1038 | Ga0451804_0153252 | 3300041463 | Bacteria | 2499 |
| 1039 | Ga0451851_0707665 | 3300041507 | Bacteria | 1935 |
| 1040 | Ga0439437_004350 | 3300042000 | Bacteria | 1543 |
| 1041 | Ga0439445_0013762 | 3300042004 | Bacteria | 1961 |
| 1042 | Ga0439432_021391 | 3300042006 | Bacteria | 2145 |
| 1043 | Ga0439432_037869 | 3300042006 | Bacteria | 1537 |
| 1044 | Ga0439449_0001661 | 3300042007 | Bacteria | 8742 |
| 1045 | Ga0439449_0002564 | 3300042007 | Bacteria | 7100 |
| 1046 | Ga0439449_0002664 | 3300042007 | Bacteria | 6951 |
| 1047 | Ga0439449_0062728 | 3300042007 | Bacteria | 1371 |
| 1048 | Ga0439452_010143 | 3300042010 | Bacteria | 2751 |
| 1049 | Ga0439462_0001024 | 3300042015 | Bacteria | 5994 |
| 1050 | Ga0450911_001627 | 3300042115 | Bacteria | 5005 |
| 1051 | Ga0450917_000573 | 3300042120 | Bacteria | 2755 |
| 1052 | Ga0450923_009925 | 3300042125 | Bacteria | 1677 |
| 1053 | Ga0450888_000521 | 3300042126 | Bacteria | 3636 |
| 1054 | Ga0450890_000453 | 3300042127 | Bacteria | 5991 |
| 1055 | Ga0450892_001840 | 3300042130 | Bacteria | 1916 |
| 1056 | Ga0439446_0014972 | 3300042156 | Bacteria | 2147 |
| 1057 | Ga0439459_0004826 | 3300042438 | Bacteria | 2186 |
| 1058 | Ga0439464_0004333 | 3300042439 | Bacteria | 3627 |
| 1059 | Ga0450893_0001792 | 3300042532 | Bacteria | 3307 |
| 1060 | Ga0451577_0000114 | 3300042876 | Bacteria | 175957 |
| 1061 | Ga0451577_0001993 | 3300042876 | Bacteria | 25464 |
| 1062 | Ga0451577_0003232 | 3300042876 | Bacteria | 18320 |
| 1063 | Ga0451577_0028693 | 3300042876 | Bacteria | 5031 |
| 1064 | Ga0451577_0099799 | 3300042876 | Bacteria | 2593 |
| 1065 | Ga0451577_0242541 | 3300042876 | Bacteria | 1631 |
| 1066 | Ga0466969_0000002 | 3300044656 | Bacteria | 178693 |
| 1067 | Ga0466969_0004958 | 3300044656 | Bacteria | 7088 |
| 1068 | Ga0466969_0010775 | 3300044656 | Bacteria | 4842 |
| 1069 | Ga0466972_0001432 | 3300044658 | Bacteria | 11582 |
| 1070 | Ga0466972_0001996 | 3300044658 | Bacteria | 9985 |
| 1071 | Ga0453683_0016380 | 3300044673 | Bacteria | 4782 |
| 1072 | Ga0466965_0008514 | 3300044683 | Bacteria | 4744 |
| 1073 | Ga0466966_0005727 | 3300044684 | Bacteria | 8181 |
| 1074 | Ga0466966_0024374 | 3300044684 | Bacteria | 3958 |
| 1075 | Ga0466966_0026318 | 3300044684 | Bacteria | 3798 |
| 1076 | Ga0466966_0136381 | 3300044684 | Bacteria | 1500 |
| 1077 | Ga0466961_0010534 | 3300044693 | Bacteria | 5896 |
| 1078 | Ga0466961_0023826 | 3300044693 | Bacteria | 3938 |
| 1079 | Ga0466961_0061473 | 3300044693 | Bacteria | 2387 |
| 1080 | Ga0466964_0001984 | 3300044706 | Bacteria | 7181 |
| 1081 | Ga0466964_0002512 | 3300044706 | Bacteria | 6523 |
| 1082 | Ga0466964_0019378 | 3300044706 | Bacteria | 2614 |
| 1083 | Ga0453684_0000606 | 3300044712 | Bacteria | 132056 |
| 1084 | Ga0453684_0006765 | 3300044712 | Bacteria | 21578 |
| 1085 | Ga0453684_0029871 | 3300044712 | Bacteria | 7721 |
| 1086 | Ga0453684_0073573 | 3300044712 | Bacteria | 4306 |
| 1087 | Ga0453684_0099934 | 3300044712 | Bacteria | 3552 |
| 1088 | Ga0453684_0256555 | 3300044712 | Bacteria | 2005 |
| 1089 | Ga0453684_0331768 | 3300044712 | Bacteria | 1720 |
| 1090 | Ga0466971_0010968 | 3300044719 | Bacteria | 3964 |
| 1091 | Ga0466970_0011589 | 3300044765 | Bacteria | 4497 |
| 1092 | Ga0466970_0015713 | 3300044765 | Bacteria | 3897 |
| 1093 | Ga0466957_0001959 | 3300044842 | Bacteria | 10945 |
| 1094 | Ga0466957_0025793 | 3300044842 | Bacteria | 3484 |
| 1095 | Ga0466959_0000666 | 3300045049 | Bacteria | 20034 |
| 1096 | Ga0466959_0003830 | 3300045049 | Bacteria | 9978 |
| 1097 | Ga0466959_0008467 | 3300045049 | Bacteria | 7274 |
| 1098 | Ga0466959_0019965 | 3300045049 | Bacteria | 4931 |
| 1099 | Ga0466959_0050801 | 3300045049 | Bacteria | 3043 |
| 1100 | Ga0451576_0001159 | 3300045051 | Bacteria | 47493 |
| 1101 | Ga0451576_0024264 | 3300045051 | Bacteria | 6552 |
| 1102 | Ga0451576_0185201 | 3300045051 | Bacteria | 2174 |
| 1103 | Ga0451576_0230389 | 3300045051 | Bacteria | 1935 |
| 1104 | Ga0466958_0018392 | 3300045836 | Bacteria | 4055 |
| 1105 | Ga0466967_0006653 | 3300045976 | Bacteria | 8218 |
| 1106 | Ga0495592_0000085 | 3300046454 | Bacteria | 82502 |
| 1107 | Ga0495590_0030763 | 3300046457 | Bacteria | 1881 |
| 1108 | Ga0495629_0100170 | 3300046459 | Bacteria | 2022 |
| 1109 | Ga0495650_0008300 | 3300046471 | Bacteria | 6083 |
| 1110 | Ga0495650_0014309 | 3300046471 | Bacteria | 4136 |
| 1111 | Ga0495639_0014497 | 3300046475 | Bacteria | 3413 |
| 1112 | Ga0495639_0061082 | 3300046475 | Bacteria | 1727 |
| 1113 | Ga0495583_0000017 | 3300046506 | Bacteria | 310888 |
| 1114 | Ga0495606_0007405 | 3300046507 | Bacteria | 9841 |
| 1115 | Ga0495610_0035905 | 3300046512 | Bacteria | 2539 |
| 1116 | Ga0495643_0008485 | 3300046522 | Bacteria | 6498 |
| 1117 | Ga0495663_0015081 | 3300046525 | Bacteria | 2175 |
| 1118 | Ga0495642_0013344 | 3300046528 | Bacteria | 3176 |
| 1119 | Ga0495654_0019169 | 3300046530 | Bacteria | 3579 |
| 1120 | Ga0495640_0077443 | 3300046533 | Bacteria | 2217 |
| 1121 | Ga0495598_0007958 | 3300046537 | Bacteria | 2452 |
| 1122 | Ga0495621_0028065 | 3300046539 | Bacteria | 1911 |
| 1123 | Ga0495621_0035437 | 3300046539 | Bacteria | 1729 |
| 1124 | Ga0495597_0000860 | 3300046542 | Bacteria | 23777 |
| 1125 | Ga0495656_0001200 | 3300046615 | Bacteria | 8448 |
| 1126 | Ga0495656_0007392 | 3300046615 | Bacteria | 3880 |
| 1127 | Ga0495668_0012058 | 3300046616 | Bacteria | 5144 |
| 1128 | Ga0495668_0024872 | 3300046616 | Bacteria | 3405 |
| 1129 | Ga0495668_0025999 | 3300046616 | Bacteria | 3324 |
| 1130 | Ga0495668_0035048 | 3300046616 | Bacteria | 2813 |
| 1131 | Ga0495625_0000044 | 3300046660 | Bacteria | 203855 |
| 1132 | Ga0495625_0000639 | 3300046660 | Bacteria | 50372 |
| 1133 | Ga0495625_0024244 | 3300046660 | Bacteria | 4619 |
| 1134 | Ga0495625_0159359 | 3300046660 | Bacteria | 1513 |
| 1135 | Ga0495658_0008307 | 3300046683 | Bacteria | 5144 |
| 1136 | Ga0495671_0042892 | 3300046692 | Bacteria | 2272 |
| 1137 | Ga0495649_0000151 | 3300046694 | Bacteria | 60742 |
| 1138 | Ga0495649_0002613 | 3300046694 | Bacteria | 12571 |
| 1139 | Ga0495589_0007070 | 3300046794 | Bacteria | 5886 |
| 1140 | Ga0495660_0010693 | 3300046810 | Bacteria | 5333 |
| 1141 | Ga0495636_0057084 | 3300047318 | Bacteria | 1644 |
| 1142 | Ga0495676_0024202 | 3300047321 | Bacteria | 5260 |
| 1143 | Ga0495676_0225323 | 3300047321 | Bacteria | 1290 |
| 1144 | Ga0495687_001028 | 3300047443 | Bacteria | 27765 |
| 1145 | Ga0495687_014016 | 3300047443 | Bacteria | 4148 |
| 1146 | Ga0495687_018047 | 3300047443 | Bacteria | 3499 |
| 1147 | Ga0495686_0001809 | 3300047472 | Bacteria | 21607 |
| 1148 | Ga0495686_0005751 | 3300047472 | Bacteria | 9690 |
| 1149 | Ga0495686_0072663 | 3300047472 | Bacteria | 2115 |
| 1150 | Ga0495686_0078679 | 3300047472 | Bacteria | 2018 |
| 1151 | Ga0495593_0047176 | 3300047673 | Bacteria | 2292 |
| 1152 | Ga0495593_0052839 | 3300047673 | Bacteria | 2146 |
| 1153 | Ga0495602_0208866 | 3300048088 | Bacteria | 1484 |
| 1154 | Ga0495614_0020043 | 3300048089 | Bacteria | 2893 |
| 1155 | Ga0495615_0005712 | 3300048090 | Bacteria | 2257 |
| 1156 | Ga0496100_0053001 | 3300048903 | Bacteria | 2640 |
| 1157 | Ga0496101_0003019 | 3300048904 | Bacteria | 10374 |
| 1158 | Ga0496102_0006763 | 3300048905 | Bacteria | 9791 |
| 1159 | Ga0496102_0113807 | 3300048905 | Bacteria | 2524 |
| 1160 | Ga0496104_0087344 | 3300048907 | Bacteria | 2978 |
| 1161 | Ga0496105_0008621 | 3300048908 | Bacteria | 7927 |
| 1162 | Ga0496106_0019139 | 3300048909 | Bacteria | 5076 |
| 1163 | Ga0496106_0045643 | 3300048909 | Bacteria | 3292 |
| 1164 | Ga0496106_0060086 | 3300048909 | Bacteria | 2881 |
| 1165 | Ga0496107_0053764 | 3300048910 | Bacteria | 2905 |
| 1166 | Ga0496108_0068001 | 3300048911 | Bacteria | 3005 |
| 1167 | Ga0496109_0107082 | 3300048912 | Bacteria | 2597 |
| 1168 | Ga0496110_0246336 | 3300048913 | Bacteria | 1626 |
| 1169 | Ga0496111_0017144 | 3300048914 | Bacteria | 5002 |
| 1170 | Ga0496112_0284028 | 3300048915 | Bacteria | 1602 |
| 1171 | Ga0496113_0003290 | 3300048916 | Bacteria | 9653 |
| 1172 | Ga0496114_0001821 | 3300048917 | Bacteria | 16167 |
| 1173 | Ga0496114_0194687 | 3300048917 | Bacteria | 1774 |
| 1174 | Ga0496116_0067077 | 3300048919 | Bacteria | 2293 |
| 1175 | Ga0496117_0017641 | 3300048920 | Bacteria | 5955 |
| 1176 | Ga0496118_0076428 | 3300048921 | Bacteria | 2381 |
| 1177 | Ga0496121_0000166 | 3300048924 | Bacteria | 145051 |
| 1178 | Ga0496121_0024477 | 3300048924 | Bacteria | 5770 |
| 1179 | Ga0496121_0117372 | 3300048924 | Bacteria | 2016 |
| 1180 | Ga0496122_0000274 | 3300048925 | Bacteria | 115100 |
| 1181 | Ga0496123_0000262 | 3300048926 | Bacteria | 106366 |
| 1182 | Ga0496123_0022733 | 3300048926 | Bacteria | 4822 |
| 1183 | Ga0496124_0026316 | 3300048927 | Bacteria | 5247 |
| 1184 | Ga0496124_0087183 | 3300048927 | Bacteria | 2553 |
| 1185 | Ga0496124_0129422 | 3300048927 | Bacteria | 2007 |
| 1186 | Ga0496125_0005447 | 3300048928 | Bacteria | 14141 |
| 1187 | Ga0496125_0007916 | 3300048928 | Bacteria | 11221 |
| 1188 | Ga0496125_0010221 | 3300048928 | Bacteria | 9513 |
| 1189 | Ga0496125_0045207 | 3300048928 | Bacteria | 3710 |
| 1190 | Ga0496125_0064393 | 3300048928 | Bacteria | 2913 |
| 1191 | Ga0496125_0106677 | 3300048928 | Bacteria | 2044 |
| 1192 | Ga0496125_0125154 | 3300048928 | Bacteria | 1823 |
| 1193 | Ga0496126_0035583 | 3300048929 | Bacteria | 4666 |
| 1194 | Ga0496126_0039612 | 3300048929 | Bacteria | 4371 |
| 1195 | Ga0496126_0064731 | 3300048929 | Bacteria | 3274 |
| 1196 | Ga0496126_0087756 | 3300048929 | Bacteria | 2741 |
| 1197 | Ga0501298_006817 | 3300049521 | Bacteria | 1880 |
| 1198 | Ga0501300_002934 | 3300049523 | Bacteria | 2543 |
| 1199 | Ga0501315_000613 | 3300049531 | Bacteria | 2584 |
| 1200 | Ga0501317_001883 | 3300049533 | Bacteria | 1897 |
| 1201 | Ga0501031_0000678 | 3300049568 | Bacteria | 20287 |
| 1202 | Ga0501043_0001160 | 3300049579 | Bacteria | 23141 |
| 1203 | Ga0501046_0001185 | 3300049580 | Bacteria | 25348 |
| 1204 | Ga0501047_0001232 | 3300049581 | Bacteria | 25329 |
| 1205 | Ga0501047_0144572 | 3300049581 | Bacteria | 2256 |
| 1206 | Ga0501048_0015099 | 3300049582 | Bacteria | 5707 |
| 1207 | Ga0501199_003264 | 3300049650 | Bacteria | 1548 |
| 1208 | Ga0501211_000039 | 3300049658 | Bacteria | 8874 |
| 1209 | Ga0501222_005437 | 3300049662 | Bacteria | 1717 |
| 1210 | Ga0501227_003642 | 3300049665 | Bacteria | 3337 |
| 1211 | Ga0501233_002550 | 3300049668 | Bacteria | 3222 |
| 1212 | Ga0501235_015347 | 3300049669 | Bacteria | 1689 |
| 1213 | Ga0501249_003156 | 3300049679 | Bacteria | 3314 |
| 1214 | Ga0501255_000879 | 3300049684 | Bacteria | 2244 |
| 1215 | Ga0501221_001616 | 3300049704 | Bacteria | 3743 |
| 1216 | Ga0501229_000147 | 3300049706 | Bacteria | 7305 |
| 1217 | Ga0501080_0135023 | 3300049742 | Bacteria | 2283 |
| 1218 | Ga0501262_000134 | 3300049759 | Bacteria | 9160 |
| 1219 | Ga0501262_000522 | 3300049759 | Bacteria | 4560 |
| 1220 | Ga0501267_002268 | 3300049764 | Bacteria | 1714 |
| 1221 | Ga0501283_005483 | 3300049779 | Bacteria | 1746 |
| 1222 | Ga0501035_0020751 | 3300049822 | Bacteria | 6038 |
| 1223 | nmdc:mga03683_11374_c1 | 3300050489 | Bacteria | 3221 |
| 1224 | nmdc:mga03683_1731_c1 | 3300050489 | Bacteria | 6585 |
| 1225 | nmdc:mga03683_29665_c1 | 3300050489 | Bacteria | 2182 |
| 1226 | nmdc:mga03683_43882_c1 | 3300050489 | Bacteria | 1846 |
| 1227 | nmdc:mga0yw44_1756_c1 | 3300050492 | Bacteria | 8832 |
| 1228 | nmdc:mga0yw44_44339_c1 | 3300050492 | Bacteria | 2660 |
| 1229 | nmdc:mga0yw44_95707_c1 | 3300050492 | Bacteria | 1884 |
| 1230 | nmdc:mga0k408_108946_c1 | 3300050493 | Bacteria | 1636 |
| 1231 | nmdc:mga0k408_127848_c1 | 3300050493 | Bacteria | 1508 |
| 1232 | nmdc:mga0k408_13106_c1 | 3300050493 | Bacteria | 4541 |
| 1233 | nmdc:mga0k408_163046_c1 | 3300050493 | Bacteria | 1328 |
| 1234 | nmdc:mga0k408_3137_c1 | 3300050493 | Bacteria | 8761 |
| 1235 | nmdc:mga0k408_3243_c1 | 3300050493 | Bacteria | 8613 |
| 1236 | nmdc:mga0k408_33152_c1 | 3300050493 | Bacteria | 2953 |
| 1237 | nmdc:mga0k408_34566_c1 | 3300050493 | Bacteria | 2894 |
| 1238 | nmdc:mga0k408_3717_c1 | 3300050493 | Bacteria | 8085 |
| 1239 | nmdc:mga0k408_38735_c1 | 3300050493 | Bacteria | 2737 |
| 1240 | nmdc:mga0k408_41642_c1 | 3300050493 | Bacteria | 2645 |
| 1241 | nmdc:mga0k408_42352_c1 | 3300050493 | Bacteria | 2623 |
| 1242 | nmdc:mga0k408_56179_c1 | 3300050493 | Bacteria | 2284 |
| 1243 | nmdc:mga06z11_79888_c1 | 3300050494 | Bacteria | 1752 |
| 1244 | nmdc:mga07m45_150_c1 | 3300050496 | Bacteria | 27900 |
| 1245 | nmdc:mga07m45_1625_c1 | 3300050496 | Bacteria | 10341 |
| 1246 | nmdc:mga07m45_16722_c1 | 3300050496 | Bacteria | 3929 |
| 1247 | nmdc:mga07m45_2249_c1 | 3300050496 | Bacteria | 9010 |
| 1248 | nmdc:mga07m45_2640_c1 | 3300050496 | Bacteria | 1953 |
| 1249 | nmdc:mga07m45_28765_c1 | 3300050496 | Bacteria | 2126 |
| 1250 | nmdc:mga07m45_29017_c1 | 3300050496 | Bacteria | 3056 |
| 1251 | nmdc:mga07m45_29589_c1 | 3300050496 | Bacteria | 3030 |
| 1252 | nmdc:mga07m45_38568_c1 | 3300050496 | Bacteria | 2666 |
| 1253 | nmdc:mga05p37_22357_c1 | 3300050507 | Bacteria | 6444 |
| 1254 | nmdc:mga09592_3773_c1 | 3300050508 | Bacteria | 12196 |
| 1255 | nmdc:mga0qj67_9921_c1 | 3300050509 | Bacteria | 7101 |
| 1256 | nmdc:mga0sz30_8986_c1 | 3300050516 | Bacteria | 3789 |
| 1257 | Ga0495601_0010718 | 3300053077 | Bacteria | 5468 |
| 1258 | Ga0500610_0024972 | 3300053079 | Bacteria | 2975 |
| 1259 | Ga0500635_0000053 | 3300053080 | Bacteria | 74604 |
| 1260 | Ga0500578_0000011 | 3300053086 | Bacteria | 217243 |
| 1261 | Ga0500578_0020439 | 3300053086 | Bacteria | 4255 |
| 1262 | Ga0500643_005802 | 3300053087 | Bacteria | 5262 |
| 1263 | Ga0500583_0008528 | 3300053092 | Bacteria | 3683 |
| 1264 | Ga0500651_0000053 | 3300053093 | Bacteria | 76219 |
| 1265 | Ga0500651_0039754 | 3300053093 | Bacteria | 2961 |
| 1266 | Ga0500651_0045243 | 3300053093 | Bacteria | 2770 |
| 1267 | Ga0500571_009242 | 3300053110 | Bacteria | 5412 |
| 1268 | Ga0500593_001023 | 3300053117 | Bacteria | 10150 |
| 1269 | Ga0500594_0002798 | 3300053118 | Bacteria | 3799 |
| 1270 | Ga0500594_0009467 | 3300053118 | Bacteria | 2244 |
| 1271 | Ga0500642_0043132 | 3300053130 | Bacteria | 1958 |
| 1272 | Ga0500652_006726 | 3300053131 | Bacteria | 3720 |
| 1273 | Ga0500655_011021 | 3300053133 | Bacteria | 1635 |
| 1274 | Ga0500658_0000012 | 3300053134 | Bacteria | 160010 |
| 1275 | Ga0500658_0029729 | 3300053134 | Bacteria | 2127 |
| 1276 | Ga0500658_0036987 | 3300053134 | Bacteria | 1939 |
| 1277 | Ga0500559_0000017 | 3300053136 | Bacteria | 143646 |
| 1278 | Ga0500559_0008060 | 3300053136 | Bacteria | 4636 |
| 1279 | Ga0500574_000398 | 3300053141 | Bacteria | 5473 |
| 1280 | Ga0500574_014530 | 3300053141 | Bacteria | 1859 |
| 1281 | Ga0500616_0034802 | 3300053153 | Bacteria | 2742 |
| 1282 | Ga0500619_000181 | 3300053154 | Bacteria | 15103 |
| 1283 | Ga0500622_0000097 | 3300053156 | Bacteria | 89802 |
| 1284 | Ga0500622_0001258 | 3300053156 | Bacteria | 20685 |
| 1285 | Ga0500622_0002974 | 3300053156 | Bacteria | 11744 |
| 1286 | Ga0500634_0043295 | 3300053161 | Bacteria | 2441 |
| 1287 | Ga0500636_0057982 | 3300053177 | Bacteria | 2265 |
| 1288 | Ga0500645_000200 | 3300053730 | Bacteria | 46278 |
| 1289 | Ga0500645_001413 | 3300053730 | Bacteria | 12233 |
| 1290 | Ga0587085_004029 | 3300059506 | Bacteria | 1642 |
| 1291 | Ga0466962_0012218 | 3300061719 | Bacteria | 4127 |
| 1292 | Ga0466962_0017271 | 3300061719 | Bacteria | 3476 |
| 1293 | 2511247036 | 2511231002 | Bacteria | 5042903 |
| 1294 | 2513229123 | 2513020051 | Bacteria | 6053213 |
| 1295 | 2513231368 | 2513020051 | Bacteria | 6053213 |
| 1296 | 2513231369 | 2513020051 | Bacteria | 6053213 |
| 1297 | 2548500586 | 2547132374 | Bacteria | 5530232 |
| 1298 | 2548501001 | 2547132374 | Bacteria | 5530232 |
| 1299 | 2587730989 | 2585428057 | Bacteria | 6737412 |
| 1300 | 2587736841 | 2585428058 | Bacteria | 6853932 |
| 1301 | 2587756021 | 2585428062 | Bacteria | 6842168 |
| 1302 | 2588291741 | 2588253510 | Bacteria | 6901809 |
| 1303 | 2599626607 | 2599185214 | Bacteria | 8209958 |
| 1304 | 2599626608 | 2599185214 | Bacteria | 8209958 |
| 1305 | 2599675671 | 2599185226 | Bacteria | 8233575 |
| 1306 | 2599675672 | 2599185226 | Bacteria | 8233575 |
| 1307 | 2599684144 | 2599185227 | Bacteria | 8246414 |
| 1308 | 2599684145 | 2599185227 | Bacteria | 8246414 |
| 1309 | 2599696158 | 2599185229 | Bacteria | 8216126 |
| 1310 | 2599696159 | 2599185229 | Bacteria | 8216126 |
| 1311 | 2643742760 | 2643221544 | Bacteria | 5886209 |
| 1312 | 2643864414 | 2643221570 | Bacteria | 5103772 |
| 1313 | 2643866709 | 2643221570 | Bacteria | 5103772 |
| 1314 | 2643933394 | 2643221585 | Bacteria | 5812563 |
| 1315 | 2643972430 | 2643221592 | Bacteria | 6608788 |
| 1316 | 2643992950 | 2643221596 | Bacteria | 5006805 |
| 1317 | 2643993442 | 2643221596 | Bacteria | 5006805 |
| 1318 | 2644030817 | 2643221603 | Bacteria | 6147767 |
| 1319 | 2644062694 | 2643221609 | Bacteria | 6756331 |
| 1320 | 2644076292 | 2643221611 | Bacteria | 6820941 |
| 1321 | 2644138562 | 2643221625 | Bacteria | 6512927 |
| 1322 | 2644163257 | 2643221628 | Bacteria | 5745828 |
| 1323 | 2644163258 | 2643221628 | Bacteria | 5745828 |
| 1324 | 2644217621 | 2643221639 | Bacteria | 6649903 |
| 1325 | 2644258644 | 2643221646 | Bacteria | 6433402 |
| 1326 | 2644272938 | 2643221648 | Bacteria | 6521465 |
| 1327 | 2644291883 | 2643221652 | Bacteria | 5140275 |
| 1328 | 2644294580 | 2643221652 | Bacteria | 5140275 |
| 1329 | 2644305123 | 2643221654 | Bacteria | 5273570 |
| 1330 | 2644314643 | 2643221656 | Bacteria | 5809961 |
| 1331 | 2644325845 | 2643221658 | Bacteria | 6064537 |
| 1332 | 2644327887 | 2643221658 | Bacteria | 6064537 |
| 1333 | 2644327888 | 2643221658 | Bacteria | 6064537 |
| 1334 | 2644337942 | 2643221660 | Bacteria | 4208257 |
| 1335 | 2644397848 | 2643221672 | Bacteria | 6322190 |
| 1336 | 2644397849 | 2643221672 | Bacteria | 6322190 |
| 1337 | 2644468312 | 2643221683 | Bacteria | 5749203 |
| 1338 | 2644468313 | 2643221683 | Bacteria | 5749203 |
| 1339 | 2644645886 | 2643221717 | Bacteria | 5676132 |
| 1340 | 2644646865 | 2643221717 | Bacteria | 5676132 |
| 1341 | 2722884103 | 2721755523 | Bacteria | 6430384 |
| 1342 | 2722884104 | 2721755523 | Bacteria | 6430384 |
| 1343 | 2738718017 | 2738541277 | Bacteria | 7458140 |
| 1344 | 2738718018 | 2738541277 | Bacteria | 7458140 |
| 1345 | 2738885086 | 2738541307 | Bacteria | 8606193 |
| 1346 | 2738885087 | 2738541307 | Bacteria | 8606193 |
| 1347 | 2739056659 | 2738541337 | Bacteria | 6183410 |
| 1348 | 2739244626 | 2738543012 | Bacteria | 7115078 |
| 1349 | 2739251466 | 2738543013 | Bacteria | 5618633 |
| 1350 | 2739278703 | 2738543019 | Bacteria | 7459457 |
| 1351 | 2739278704 | 2738543019 | Bacteria | 7459457 |
| 1352 | 2816475170 | 2816332133 | Bacteria | 7249298 |
| 1353 | 2819595710 | 2818991446 | Bacteria | 7757362 |
| 1354 | 2819595711 | 2818991446 | Bacteria | 7757362 |
| 1355 | 2831266722 | 2831265667 | Bacteria | 7184833 |
| 1356 | 2831266723 | 2831265667 | Bacteria | 7184833 |
| 1357 | 2831866193 | 2831864461 | Bacteria | 6502356 |
| 1358 | 2838057197 | 2838054893 | Bacteria | 7451788 |
| 1359 | 2838057198 | 2838054893 | Bacteria | 7451788 |
| 1360 | 2839139836 | 2839138175 | Bacteria | 6549354 |
| 1361 | 2839139837 | 2839138175 | Bacteria | 6549354 |
| 1362 | 2842679629 | 2842677519 | Bacteria | 5615038 |
| 1363 | 2842679630 | 2842677519 | Bacteria | 5615038 |
| 1364 | 2842719962 | 2842718218 | Bacteria | 4560148 |
| 1365 | 2842735005 | 2842733646 | Bacteria | 5716726 |
| 1366 | 2842735006 | 2842733646 | Bacteria | 5716726 |
| 1367 | 2842751183 | 2842747753 | Bacteria | 5578255 |
| 1368 | 2842751184 | 2842747753 | Bacteria | 5578255 |
| 1369 | 2881101915 | 2881101125 | Bacteria | 4590519 |
| 1370 | 2885192472 | 2885192300 | Bacteria | 5882526 |
| 1371 | 2885192473 | 2885192300 | Bacteria | 5882526 |
| 1372 | 2885200254 | 2885198086 | Bacteria | 7212419 |
| 1373 | 2885200255 | 2885198086 | Bacteria | 7212419 |
| 1374 | 2885213950 | 2885211737 | Bacteria | 7212420 |
| 1375 | 2885213951 | 2885211737 | Bacteria | 7212420 |
| 1376 | 2886852427 | 2886848708 | Bacteria | 5632523 |
| 1377 | 2886853182 | 2886848708 | Bacteria | 5632523 |
| 1378 | 2899925056 | 2899924645 | Bacteria | 7487985 |
| 1379 | 2899925057 | 2899924645 | Bacteria | 7487985 |
| 1380 | 2904455735 | 2904449895 | Bacteria | 6927402 |
| 1381 | 2904455736 | 2904449895 | Bacteria | 6927402 |
| 1382 | 2904462751 | 2904456579 | Bacteria | 6819253 |
| 1383 | 2904462752 | 2904456579 | Bacteria | 6819253 |
| 1384 | 2904544814 | 2904541872 | Bacteria | 8915136 |
| 1385 | 2904544815 | 2904541872 | Bacteria | 8915136 |
| 1386 | 2919467274 | 2919462493 | Bacteria | 5817112 |
| 1387 | 2919467275 | 2919462493 | Bacteria | 5817112 |
| 1388 | 2919707483 | 2919704043 | Bacteria | 5560311 |
| 1389 | 2928038818 | 2928037797 | Bacteria | 7273642 |
| 1390 | 2928038819 | 2928037797 | Bacteria | 7273642 |
| 1391 | 2928045576 | 2928044640 | Bacteria | 7271509 |
| 1392 | 2928045577 | 2928044640 | Bacteria | 7271509 |
| 1393 | 2928053192 | 2928051484 | Bacteria | 7773759 |
| 1394 | 2928053193 | 2928051484 | Bacteria | 7773759 |
| 1395 | 2928066798 | 2928064002 | Bacteria | 7419480 |
| 1396 | 2928066799 | 2928064002 | Bacteria | 7419480 |
| 1397 | 2928071308 | 2928070936 | Bacteria | 8062541 |
| 1398 | 2928071309 | 2928070936 | Bacteria | 8062541 |
| 1399 | 2928084757 | 2928084124 | Bacteria | 7159212 |
| 1400 | 2928084758 | 2928084124 | Bacteria | 7159212 |
| 1401 | 2928119866 | 2928115317 | Bacteria | 6477646 |
| 1402 | 2928119867 | 2928115317 | Bacteria | 6477646 |
| 1403 | 2929163513 | 2929160207 | Bacteria | 9075316 |
| 1404 | 2929163514 | 2929160207 | Bacteria | 9075316 |
| 1405 | 2929522718 | 2929520902 | Bacteria | 6765052 |
| 1406 | 2945912212 | 2945909444 | Bacteria | 7065066 |
| 1407 | 2945912213 | 2945909444 | Bacteria | 7065066 |
| 1408 | 2945947732 | 2945945610 | Bacteria | 5951079 |
| 1409 | 2945947733 | 2945945610 | Bacteria | 5951079 |
| 1410 | 2945977407 | 2945972063 | Bacteria | 6086495 |
| 1411 | 2945977408 | 2945972063 | Bacteria | 6086495 |
| 1412 | 2945985480 | 2945984333 | Bacteria | 7358892 |
| 1413 | 2945985481 | 2945984333 | Bacteria | 7358892 |
| 1414 | 2954772051 | 2954767861 | Bacteria | 5535784 |
| 1415 | 2954772052 | 2954767861 | Bacteria | 5535784 |
| 1416 | 2974323087 | 2974320154 | Bacteria | 4571377 |
| 1417 | 2990712678 | 2990710928 | Bacteria | 5002431 |
| 1418 | 2990715008 | 2990710928 | Bacteria | 5002431 |
| 1419 | JGI25155J39150_1000002 | |||
| 1420 | JGI24740J21852_10020775 | |||
| 1421 | JGI25156J39149_1000003 | |||
| 1422 | JGI25156J39149_1000837 | |||
| 1423 | JGI25156J39149_1008895 | |||
| 1424 | JGI25156J39149_1012858 | |||
| 1425 | JGI25154J39366_1000009 | |||
| 1426 | JGI25154J39366_1002448 | |||
| 1427 | JGI25158J39367_1001490 | |||
| 1428 | JGI25157J39369_1000002 | |||
| 1429 | JGI25157J39369_1000251 | |||
| 1430 | JGI25152J39213_1000738 | |||
| 1431 | JGI25152J39213_1006919 | |||
| 1432 | JGI25150J39212_1000868 | |||
| 1433 | JGI25150J39212_1004489 | |||
| 1434 | JGI25159J45721_1000417 | |||
| 1435 | JGI25159J45721_1001150 | |||
| 1436 | JGI25159J45721_1001933 | |||
| 1437 | JGI25159J45721_1008673 | |||
| 1438 | JGI25151J46595_10006428 | |||
| 1439 | JGI25151J46595_10007156 | |||
| 1440 | JGI25151J46595_10016665 | |||
| 1441 | rootH1_10009119 | |||
| 1442 | rootH2_10036890 | |||
| 1443 | rootL2_10023281 | |||
| 1444 | rootL2_10040743 | |||
| 1445 | JGI25160J50197_1000472 | |||
| 1446 | JGI25161J50226_1000032 | |||
| 1447 | JGI25161J50226_1000064 | |||
| 1448 | Ga0055533_1000028 | |||
| 1449 | Ga0055533_1000057 | |||
| 1450 | Ga0055525_1000522 | |||
| 1451 | Ga0055535_1000856 | |||
| 1452 | Ga0055535_1001176 | |||
| 1453 | Ga0055542_1000021 | |||
| 1454 | Ga0055529_1000331 | |||
| 1455 | Ga0055526_1001029 | |||
| 1456 | Ga0055526_1024152 | |||
| 1457 | Ga0055537_1000036 | |||
| 1458 | Ga0055537_1000221 | |||
| 1459 | Ga0055537_1000565 | |||
| 1460 | Ga0055537_1002864 | |||
| 1461 | Ga0055537_1010531 | |||
| 1462 | Ga0055524_1000012 | |||
| 1463 | Ga0055524_1000287 | |||
| 1464 | Ga0055524_1000554 | |||
| 1465 | Ga0055524_1013988 | |||
| 1466 | Ga0055536_1003447 | |||
| 1467 | Ga0055536_1003631 | |||
| 1468 | Ga0055536_1004360 | |||
| 1469 | Ga0055536_1010599 | |||
| 1470 | Ga0055536_1012824 | |||
| 1471 | Ga0055534_1000018 | |||
| 1472 | Ga0055534_1000220 | |||
| 1473 | Ga0055534_1001383 | |||
| 1474 | Ga0055534_1004361 | |||
| 1475 | Ga0055528_1000509 | |||
| 1476 | Ga0055528_1003825 | |||
| 1477 | Ga0055528_1007055 | |||
| 1478 | Ga0055530_10000218 | |||
| 1479 | Ga0055530_10000430 | |||
| 1480 | Ga0055530_10002887 | |||
| 1481 | Ga0055530_10003706 | |||
| 1482 | Ga0055530_10008617 | |||
| 1483 | Ga0055540_1000012 | |||
| 1484 | Ga0055540_1000016 | |||
| 1485 | Ga0055540_1000039 | |||
| 1486 | Ga0055540_1000062 | |||
| 1487 | Ga0055540_1000420 | |||
| 1488 | Ga0055540_1000492 | |||
| 1489 | Ga0055540_1002048 | |||
| 1490 | Ga0055540_1006044 | |||
| 1491 | Ga0055540_1008499 | |||
| 1492 | Ga0055531_10000309 | |||
| 1493 | Ga0055531_10000313 | |||
| 1494 | Ga0055531_10000542 | |||
| 1495 | Ga0055531_10002364 | |||
| 1496 | Ga0055531_10003057 | |||
| 1497 | Ga0055531_10009223 | |||
| 1498 | Ga0055531_10012926 | |||
| 1499 | Ga0055531_10014062 | |||
| 1500 | Ga0055531_10020585 | |||
| 1501 | Ga0055543_1003006 | |||
| 1502 | Ga0055543_1005865 | |||
| 1503 | Ga0055543_1005952 | |||
| 1504 | Ga0055543_1006341 | |||
| 1505 | Ga0055543_1008256 | |||
| 1506 | Ga0065165_1000354 | |||
| 1507 | Ga0065165_1000935 | |||
| 1508 | Ga0065165_1001664 | |||
| 1509 | Ga0065165_1014104 | |||
| 1510 | Ga0065165_1015749 | |||
| 1511 | Ga0065165_1027589 | |||
| 1512 | Ga0065165_1031101 | |||
| 1513 | Ga0065714_10074978 | |||
| 1514 | Ga0065704_10105517 | |||
| 1515 | Ga0065704_10108668 | |||
| 1516 | Ga0065704_10126163 | |||
| 1517 | Ga0065712_10077432 | |||
| 1518 | Ga0065715_10025844 | |||
| 1519 | Ga0065715_10122914 | |||
| 1520 | Ga0065715_10207777 | |||
| 1521 | Ga0065707_10086952 | |||
| 1522 | Ga0070658_10088236 | |||
| 1523 | Ga0070658_10169512 | |||
| 1524 | Ga0070676_10000305 | |||
| 1525 | Ga0070676_10001353 | |||
| 1526 | Ga0070676_10001456 | |||
| 1527 | Ga0070676_10012035 | |||
| 1528 | Ga0070676_10021974 | |||
| 1529 | Ga0070683_100007952 | |||
| 1530 | Ga0070683_100297331 | |||
| 1531 | Ga0070690_100005973 | |||
| 1532 | Ga0070690_100010484 | |||
| 1533 | Ga0070690_100037982 | |||
| 1534 | Ga0070670_100012432 | |||
| 1535 | Ga0070670_100017269 | |||
| 1536 | Ga0070670_100025196 | |||
| 1537 | Ga0070670_100040203 | |||
| 1538 | Ga0070670_100075565 | |||
| 1539 | Ga0070670_100222624 | |||
| 1540 | Ga0070677_10004130 | |||
| 1541 | Ga0068869_100041163 | |||
| 1542 | Ga0068869_100045673 | |||
| 1543 | Ga0068869_100126844 | |||
| 1544 | Ga0070666_10007102 | |||
| 1545 | Ga0070666_10042863 | |||
| 1546 | Ga0070666_10145344 | |||
| 1547 | Ga0070680_100002531 | |||
| 1548 | Ga0070682_100098288 | |||
| 1549 | Ga0070682_100145677 | |||
| 1550 | Ga0068868_100003758 | |||
| 1551 | Ga0068868_100007012 | |||
| 1552 | Ga0068868_100010416 | |||
| 1553 | Ga0068868_100024715 | |||
| 1554 | Ga0068868_100026439 | |||
| 1555 | Ga0068868_100079207 | |||
| 1556 | Ga0068868_100089432 | |||
| 1557 | Ga0068868_100135869 | |||
| 1558 | Ga0068868_100226829 | |||
| 1559 | Ga0070660_100017780 | |||
| 1560 | Ga0070660_100104942 | |||
| 1561 | Ga0070660_100249041 | |||
| 1562 | Ga0070689_100005827 | |||
| 1563 | Ga0070687_100027806 | |||
| 1564 | Ga0070687_100051223 | |||
| 1565 | Ga0070661_100002137 | |||
| 1566 | Ga0070661_100004541 | |||
| 1567 | Ga0070661_100027419 | |||
| 1568 | Ga0070661_100225554 | |||
| 1569 | Ga0070668_100000930 | |||
| 1570 | Ga0070668_100002014 | |||
| 1571 | Ga0070668_100014358 | |||
| 1572 | Ga0070668_100129226 | |||
| 1573 | Ga0070669_100003934 | |||
| 1574 | Ga0070669_100008074 | |||
| 1575 | Ga0070669_100059655 | |||
| 1576 | Ga0070669_100197831 | |||
| 1577 | Ga0070675_100000703 | |||
| 1578 | Ga0070675_100002563 | |||
| 1579 | Ga0070675_100005844 | |||
| 1580 | Ga0070675_100008566 | |||
| 1581 | Ga0070675_100012697 | |||
| 1582 | Ga0070675_100018066 | |||
| 1583 | Ga0070675_100136272 | |||
| 1584 | Ga0070675_100155626 | |||
| 1585 | Ga0070671_100005574 | |||
| 1586 | Ga0070671_100018775 | |||
| 1587 | Ga0070671_100034852 | |||
| 1588 | Ga0070671_100047811 | |||
| 1589 | Ga0070671_100074851 | |||
| 1590 | Ga0070674_100000518 | |||
| 1591 | Ga0070674_100002778 | |||
| 1592 | Ga0070674_100002952 | |||
| 1593 | Ga0070674_100003318 | |||
| 1594 | Ga0070674_100004623 | |||
| 1595 | Ga0070674_100025030 | |||
| 1596 | Ga0070674_100039485 | |||
| 1597 | Ga0070674_100058684 | |||
| 1598 | Ga0070674_100069552 | |||
| 1599 | Ga0070673_100002198 | |||
| 1600 | Ga0070673_100002713 | |||
| 1601 | Ga0070673_100006984 | |||
| 1602 | Ga0070673_100014798 | |||
| 1603 | Ga0070673_100017830 | |||
| 1604 | Ga0070673_100141075 | |||
| 1605 | Ga0070673_100163511 | |||
| 1606 | Ga0070673_100211707 | |||
| 1607 | Ga0070673_100216577 | |||
| 1608 | Ga0070688_100077724 | |||
| 1609 | Ga0070659_100000178 | |||
| 1610 | Ga0070659_100013767 | |||
| 1611 | Ga0070659_100036994 | |||
| 1612 | Ga0070659_100090482 | |||
| 1613 | Ga0070667_100000887 | |||
| 1614 | Ga0070667_100001423 | |||
| 1615 | Ga0070667_100022085 | |||
| 1616 | Ga0070667_100166632 | |||
| 1617 | Ga0070667_100255817 | |||
| 1618 | Ga0070700_100011768 | |||
| 1619 | Ga0070700_100060568 | |||
| 1620 | Ga0070663_100067903 | |||
| 1621 | Ga0070663_100123499 | |||
| 1622 | Ga0070678_100000683 | |||
| 1623 | Ga0070678_100027992 | |||
| 1624 | Ga0070678_100093366 | |||
| 1625 | Ga0070678_100140093 | |||
| 1626 | Ga0070678_100160270 | |||
| 1627 | Ga0070678_100160965 | |||
| 1628 | Ga0070678_100183807 | |||
| 1629 | Ga0070678_100227746 | |||
| 1630 | Ga0070662_100000646 | |||
| 1631 | Ga0070662_100010127 | |||
| 1632 | Ga0070662_100019033 | |||
| 1633 | Ga0070662_100090650 | |||
| 1634 | Ga0070681_10303528 | |||
| 1635 | Ga0068867_100000234 | |||
| 1636 | Ga0068867_100001306 | |||
| 1637 | Ga0068867_100004484 | |||
| 1638 | Ga0068867_100006316 | |||
| 1639 | Ga0068867_100006419 | |||
| 1640 | Ga0068867_100006718 | |||
| 1641 | Ga0068867_100006852 | |||
| 1642 | Ga0068867_100010351 | |||
| 1643 | Ga0068867_100014751 | |||
| 1644 | Ga0068867_100079902 | |||
| 1645 | Ga0070685_10116931 | |||
| 1646 | Ga0070706_100006474 | |||
| 1647 | Ga0070707_100266424 | |||
| 1648 | Ga0070699_100104211 | |||
| 1649 | Ga0070679_100060332 | |||
| 1650 | Ga0070679_100076637 | |||
| 1651 | Ga0070679_100152598 | |||
| 1652 | Ga0070684_100002660 | |||
| 1653 | Ga0070684_100134427 | |||
| 1654 | Ga0068853_100035486 | |||
| 1655 | Ga0068853_100046733 | |||
| 1656 | Ga0068853_100087126 | |||
| 1657 | Ga0068853_100259887 | |||
| 1658 | Ga0070672_100000150 | |||
| 1659 | Ga0070672_100000188 | |||
| 1660 | Ga0070672_100003178 | |||
| 1661 | Ga0070672_100029365 | |||
| 1662 | Ga0070672_100061568 | |||
| 1663 | Ga0070672_100090311 | |||
| 1664 | Ga0070672_100098835 | |||
| 1665 | Ga0070672_100204136 | |||
| 1666 | Ga0070665_100235466 | |||
| 1667 | Ga0068855_100008323 | |||
| 1668 | Ga0068855_100017415 | |||
| 1669 | Ga0068855_100231884 | |||
| 1670 | Ga0068855_100276875 | |||
| 1671 | Ga0068855_100277889 | |||
| 1672 | Ga0070664_100034043 | |||
| 1673 | Ga0070664_100064440 | |||
| 1674 | Ga0068857_100000422 | |||
| 1675 | Ga0068857_100025951 | |||
| 1676 | Ga0068857_100033075 | |||
| 1677 | Ga0068857_100137230 | |||
| 1678 | Ga0068854_100001586 | |||
| 1679 | Ga0068854_100072293 | |||
| 1680 | Ga0068854_100137384 | |||
| 1681 | Ga0068856_100004817 | |||
| 1682 | Ga0068856_100050218 | |||
| 1683 | Ga0068856_100105028 | |||
| 1684 | Ga0068852_100003415 | |||
| 1685 | Ga0068852_100040628 | |||
| 1686 | Ga0068852_100041540 | |||
| 1687 | Ga0068852_100111142 | |||
| 1688 | Ga0068852_100180723 | |||
| 1689 | Ga0068852_100185549 | |||
| 1690 | Ga0068859_100003146 | |||
| 1691 | Ga0068859_100030836 | |||
| 1692 | Ga0068859_100090165 | |||
| 1693 | Ga0068859_100148499 | |||
| 1694 | Ga0068859_100154049 | |||
| 1695 | Ga0068864_100001395 | |||
| 1696 | Ga0068864_100006994 | |||
| 1697 | Ga0068864_100012986 | |||
| 1698 | Ga0068864_100031021 | |||
| 1699 | Ga0068864_100094537 | |||
| 1700 | Ga0068866_10027755 | |||
| 1701 | Ga0068861_100000357 | |||
| 1702 | Ga0068861_100005099 | |||
| 1703 | Ga0068861_100024110 | |||
| 1704 | Ga0068861_100026409 | |||
| 1705 | Ga0068861_100148574 | |||
| 1706 | Ga0068851_10061466 | |||
| 1707 | Ga0068851_10066642 | |||
| 1708 | Ga0068851_10090274 | |||
| 1709 | Ga0068851_10103958 | |||
| 1710 | Ga0068870_10025973 | |||
| 1711 | Ga0068863_100004937 | |||
| 1712 | Ga0068863_100006024 | |||
| 1713 | Ga0068863_100045223 | |||
| 1714 | Ga0068863_100077904 | |||
| 1715 | Ga0068863_100163097 | |||
| 1716 | Ga0068863_100171074 | |||
| 1717 | Ga0068863_100192095 | |||
| 1718 | Ga0068858_100001070 | |||
| 1719 | Ga0068858_100005932 | |||
| 1720 | Ga0068858_100006988 | |||
| 1721 | Ga0068860_100001404 | |||
| 1722 | Ga0068860_100001441 | |||
| 1723 | Ga0068860_100003633 | |||
| 1724 | Ga0068860_100018213 | |||
| 1725 | Ga0068860_100056492 | |||
| 1726 | Ga0068860_100069015 | |||
| 1727 | Ga0068862_100008643 | |||
| 1728 | Ga0068862_100012198 | |||
| 1729 | Ga0068862_100014297 | |||
| 1730 | Ga0068862_100089917 | |||
| 1731 | Ga0075365_10000234 | |||
| 1732 | Ga0075365_10013483 | |||
| 1733 | Ga0075365_10017690 | |||
| 1734 | Ga0075365_10040013 | |||
| 1735 | Ga0075364_10081580 | |||
| 1736 | Ga0075432_10015726 | |||
| 1737 | Ga0075362_10013909 | |||
| 1738 | Ga0075362_10019047 | |||
| 1739 | Ga0075362_10025386 | |||
| 1740 | Ga0075362_10025904 | |||
| 1741 | Ga0075362_10051494 | |||
| 1742 | Ga0075367_10023649 | |||
| 1743 | Ga0075367_10046511 | |||
| 1744 | Ga0075367_10062297 | |||
| 1745 | Ga0075367_10138911 | |||
| 1746 | Ga0075369_10001213 | |||
| 1747 | Ga0075369_10048776 | |||
| 1748 | Ga0075369_10052095 | |||
| 1749 | Ga0075366_10003302 | |||
| 1750 | Ga0075366_10005390 | |||
| 1751 | Ga0075366_10011482 | |||
| 1752 | Ga0075366_10044896 | |||
| 1753 | Ga0075366_10050413 | |||
| 1754 | Ga0075366_10058716 | |||
| 1755 | Ga0075366_10088581 | |||
| 1756 | Ga0075366_10097862 | |||
| 1757 | Ga0097621_100040696 | |||
| 1758 | Ga0097621_100048451 | |||
| 1759 | Ga0097621_100060446 | |||
| 1760 | Ga0097621_100061415 | |||
| 1761 | Ga0097621_100151552 | |||
| 1762 | Ga0075370_10000246 | |||
| 1763 | Ga0075370_10001169 | |||
| 1764 | Ga0075370_10003627 | |||
| 1765 | Ga0075370_10003633 | |||
| 1766 | Ga0075370_10006991 | |||
| 1767 | Ga0075370_10008378 | |||
| 1768 | Ga0075370_10017146 | |||
| 1769 | Ga0075370_10028091 | |||
| 1770 | Ga0075370_10028308 | |||
| 1771 | Ga0075370_10031633 | |||
| 1772 | Ga0075370_10037655 | |||
| 1773 | Ga0075370_10043263 | |||
| 1774 | Ga0075370_10052826 | |||
| 1775 | Ga0075370_10059175 | |||
| 1776 | Ga0068871_100014788 | |||
| 1777 | Ga0068871_100026057 | |||
| 1778 | Ga0068871_100051277 | |||
| 1779 | Ga0068871_100073545 | |||
| 1780 | Ga0068871_100129646 | |||
| 1781 | Ga0075429_100095617 | |||
| 1782 | Ga0068865_100002164 | |||
| 1783 | Ga0068865_100004824 | |||
| 1784 | Ga0068865_100005297 | |||
| 1785 | Ga0068865_100025563 | |||
| 1786 | Ga0068865_100195010 | |||
| 1787 | Ga0097620_100003146 | |||
| 1788 | Ga0097620_100030836 | |||
| 1789 | Ga0097620_100090164 | |||
| 1790 | Ga0097620_100148494 | |||
| 1791 | Ga0097620_100154058 | |||
| 1792 | Ga0099823_1007351 | |||
| 1793 | Ga0079104_1000011 | |||
| 1794 | Ga0079104_1000019 | |||
| 1795 | Ga0099826_10000096 | |||
| 1796 | Ga0099826_10007062 | |||
| 1797 | Ga0105244_10003175 | |||
| 1798 | Ga0105244_10101048 | |||
| 1799 | Ga0105250_10017928 | |||
| 1800 | Ga0105240_10000951 | |||
| 1801 | Ga0105240_10001089 | |||
| 1802 | Ga0105245_10009930 | |||
| 1803 | Ga0105245_10071820 | |||
| 1804 | Ga0105245_10105118 | |||
| 1805 | Ga0114129_10134779 | |||
| 1806 | Ga0105243_10000400 | |||
| 1807 | Ga0105243_10001880 | |||
| 1808 | Ga0105243_10003082 | |||
| 1809 | Ga0105243_10015844 | |||
| 1810 | Ga0105243_10020381 | |||
| 1811 | Ga0105243_10247510 | |||
| 1812 | Ga0105243_10267990 | |||
| 1813 | Ga0105241_10043500 | |||
| 1814 | Ga0105242_10006688 | |||
| 1815 | Ga0105242_10028293 | |||
| 1816 | Ga0105242_10034606 | |||
| 1817 | Ga0105242_10035127 | |||
| 1818 | Ga0105242_10173431 | |||
| 1819 | Ga0105248_10014279 | |||
| 1820 | Ga0105248_10021294 | |||
| 1821 | Ga0105248_10107959 | |||
| 1822 | Ga0105248_10135771 | |||
| 1823 | Ga0105248_10173519 | |||
| 1824 | Ga0105248_10173966 | |||
| 1825 | Ga0105237_10003603 | |||
| 1826 | Ga0105237_10030715 | |||
| 1827 | Ga0105237_10057916 | |||
| 1828 | Ga0105238_10007548 | |||
| 1829 | Ga0105238_10007948 | |||
| 1830 | Ga0105238_10020812 | |||
| 1831 | Ga0105238_10112379 | |||
| 1832 | Ga0105249_10001498 | |||
| 1833 | Ga0105249_10004113 | |||
| 1834 | Ga0105249_10152584 | |||
| 1835 | Ga0105239_10005179 | |||
| 1836 | Ga0105239_10100070 | |||
| 1837 | Ga0105246_10024888 | |||
| 1838 | Ga0105246_10116819 | |||
| 1839 | Ga0157319_1000009 | |||
| 1840 | Ga0157373_10008552 | |||
| 1841 | Ga0157373_10012879 | |||
| 1842 | Ga0157373_10133603 | |||
| 1843 | Ga0157370_10000583 | |||
| 1844 | Ga0157370_10019170 | |||
| 1845 | Ga0157370_10129097 | |||
| 1846 | Ga0157369_10009941 | |||
| 1847 | Ga0157369_10021442 | |||
| 1848 | Ga0157369_10035074 | |||
| 1849 | Ga0157374_10016391 | |||
| 1850 | Ga0157374_10037469 | |||
| 1851 | Ga0157374_10102555 | |||
| 1852 | Ga0157374_10183801 | |||
| 1853 | Ga0157374_10204401 | |||
| 1854 | Ga0157378_10034311 | |||
| 1855 | Ga0163162_10011301 | |||
| 1856 | Ga0163162_10022647 | |||
| 1857 | Ga0163162_10029102 | |||
| 1858 | Ga0163162_10074236 | |||
| 1859 | Ga0163162_10075996 | |||
| 1860 | Ga0163162_10122944 | |||
| 1861 | Ga0163162_10308257 | |||
| 1862 | Ga0157372_10002878 | |||
| 1863 | Ga0157372_10026418 | |||
| 1864 | Ga0157372_10039703 | |||
| 1865 | Ga0157375_10003456 | |||
| 1866 | Ga0157375_10017862 | |||
| 1867 | Ga0157375_10036590 | |||
| 1868 | Ga0157375_10038720 | |||
| 1869 | Ga0157375_10042838 | |||
| 1870 | Ga0157375_10063319 | |||
| 1871 | Ga0157375_10335149 | |||
| 1872 | Ga0157375_10445857 | |||
| 1873 | Ga0163163_10005453 | |||
| 1874 | Ga0163163_10294718 | |||
| 1875 | Ga0157380_10002934 | |||
| 1876 | Ga0157380_10003080 | |||
| 1877 | Ga0157380_10023913 | |||
| 1878 | Ga0157380_10105348 | |||
| 1879 | Ga0182008_10000398 | |||
| 1880 | Ga0182008_10001698 | |||
| 1881 | Ga0182008_10007000 | |||
| 1882 | Ga0182008_10013166 | |||
| 1883 | Ga0182008_10015404 | |||
| 1884 | Ga0182008_10034149 | |||
| 1885 | Ga0182008_10042429 | |||
| 1886 | Ga0157377_10000014 | |||
| 1887 | Ga0157379_10007780 | |||
| 1888 | Ga0157379_10012988 | |||
| 1889 | Ga0157379_10017193 | |||
| 1890 | Ga0157379_10027948 | |||
| 1891 | Ga0157379_10030440 | |||
| 1892 | Ga0157379_10095832 | |||
| 1893 | Ga0157379_10275757 | |||
| 1894 | Ga0157376_10002109 | |||
| 1895 | Ga0157376_10018872 | |||
| 1896 | Ga0157376_10035383 | |||
| 1897 | Ga0157376_10097017 | |||
| 1898 | Ga0157376_10130519 | |||
| 1899 | Ga0157376_10279849 | |||
| 1900 | Ga0182006_1001743 | |||
| 1901 | Ga0182006_1014199 | |||
| 1902 | Ga0182006_1035107 | |||
| 1903 | Ga0182006_1039934 | |||
| 1904 | Ga0182007_10003330 | |||
| 1905 | Ga0182007_10029258 | |||
| 1906 | Ga0183362_10001 | |||
| 1907 | Ga0163161_10000149 | |||
| 1908 | Ga0163161_10004629 | |||
| 1909 | Ga0163161_10007626 | |||
| 1910 | Ga0163161_10010900 | |||
| 1911 | Ga0163161_10013402 | |||
| 1912 | Ga0163161_10018680 | |||
| 1913 | Ga0163161_10028738 | |||
| 1914 | Ga0163161_10046965 | |||
| 1915 | Ga0163161_10064859 | |||
| 1916 | Ga0163161_10087430 | |||
| 1917 | Ga0213872_10001558 | |||
| 1918 | Ga0213872_10024989 | |||
| 1919 | Ga0213872_10041667 | |||
| 1920 | Ga0213876_10028678 | |||
| 1921 | Ga0209435_100001 | |||
| 1922 | Ga0209436_108179 | |||
| 1923 | Ga0209674_100007 | |||
| 1924 | Ga0209672_100751 | |||
| 1925 | Ga0209672_103873 | |||
| 1926 | Ga0209147_102627 | |||
| 1927 | Ga0209563_100033 | |||
| 1928 | Ga0209563_103671 | |||
| 1929 | Ga0207427_101232 | |||
| 1930 | Ga0209258_100058 | |||
| 1931 | Ga0209258_100353 | |||
| 1932 | Ga0207425_1000218 | |||
| 1933 | Ga0207425_1001283 | |||
| 1934 | Ga0207425_1002538 | |||
| 1935 | Ga0207425_1006474 | |||
| 1936 | Ga0207425_1012416 | |||
| 1937 | Ga0207425_1015207 | |||
| 1938 | Ga0209646_1000001 | |||
| 1939 | Ga0209646_1000053 | |||
| 1940 | Ga0209026_1000003 | |||
| 1941 | Ga0209026_1000020 | |||
| 1942 | Ga0209026_1002653 | |||
| 1943 | Ga0209677_100132 | |||
| 1944 | Ga0209677_100161 | |||
| 1945 | Ga0209677_103481 | |||
| 1946 | Ga0209148_1000071 | |||
| 1947 | Ga0209148_1003552 | |||
| 1948 | Ga0209759_1000001 | |||
| 1949 | Ga0209759_1000017 | |||
| 1950 | Ga0209759_1000913 | |||
| 1951 | Ga0209759_1001199 | |||
| 1952 | Ga0209759_1002284 | |||
| 1953 | Ga0209129_1000023 | |||
| 1954 | Ga0209129_1000041 | |||
| 1955 | Ga0209129_1001863 | |||
| 1956 | Ga0209129_1007583 | |||
| 1957 | Ga0209129_1008749 | |||
| 1958 | Ga0209565_1000004 | |||
| 1959 | Ga0209565_1000075 | |||
| 1960 | Ga0209565_1000327 | |||
| 1961 | Ga0209565_1000609 | |||
| 1962 | Ga0209565_1000693 | |||
| 1963 | Ga0209565_1003001 | |||
| 1964 | Ga0209455_1000136 | |||
| 1965 | Ga0209673_1000066 | |||
| 1966 | Ga0209673_1000289 | |||
| 1967 | Ga0209673_1000357 | |||
| 1968 | Ga0209673_1000362 | |||
| 1969 | Ga0209673_1000798 | |||
| 1970 | Ga0209673_1006734 | |||
| 1971 | Ga0209673_1009202 | |||
| 1972 | Ga0209673_1009683 | |||
| 1973 | Ga0209673_1017231 | |||
| 1974 | Ga0209673_1019046 | |||
| 1975 | Ga0209130_1000069 | |||
| 1976 | Ga0209130_1000082 | |||
| 1977 | Ga0209130_1000094 | |||
| 1978 | Ga0209130_1002257 | |||
| 1979 | Ga0209130_1003786 | |||
| 1980 | Ga0209675_1000061 | |||
| 1981 | Ga0209675_1000074 | |||
| 1982 | Ga0209675_1000177 | |||
| 1983 | Ga0209675_1000325 | |||
| 1984 | Ga0209675_1001059 | |||
| 1985 | Ga0209675_1001796 | |||
| 1986 | Ga0209675_1004674 | |||
| 1987 | Ga0209675_1005211 | |||
| 1988 | Ga0209675_1012304 | |||
| 1989 | Ga0209676_1000005 | |||
| 1990 | Ga0209676_1000029 | |||
| 1991 | Ga0209676_1000105 | |||
| 1992 | Ga0209676_1000142 | |||
| 1993 | Ga0209676_1000186 | |||
| 1994 | Ga0209676_1003917 | |||
| 1995 | Ga0209676_1017519 | |||
| 1996 | Ga0209025_1000351 | |||
| 1997 | Ga0209025_1000579 | |||
| 1998 | Ga0209025_1000644 | |||
| 1999 | Ga0209025_1005852 | |||
| 2000 | Ga0209025_1010713 | |||
| 2001 | Ga0209025_1022914 | |||
| 2002 | Ga0209025_1027340 | |||
| 2003 | Ga0209564_1000003 | |||
| 2004 | Ga0209564_1000029 | |||
| 2005 | Ga0209564_1000090 | |||
| 2006 | Ga0209564_1000527 | |||
| 2007 | Ga0209564_1005458 | |||
| 2008 | Ga0209564_1005474 | |||
| 2009 | Ga0209564_1009963 | |||
| 2010 | Ga0209564_1022209 | |||
| 2011 | Ga0209758_1000043 | |||
| 2012 | Ga0209758_1000044 | |||
| 2013 | Ga0209758_1000057 | |||
| 2014 | Ga0209758_1020115 | |||
| 2015 | Ga0209758_1041408 | |||
| 2016 | Ga0209050_1000003 | |||
| 2017 | Ga0209050_1000007 | |||
| 2018 | Ga0209050_1000082 | |||
| 2019 | Ga0209050_1000149 | |||
| 2020 | Ga0209050_1000569 | |||
| 2021 | Ga0209050_1001141 | |||
| 2022 | Ga0209050_1001330 | |||
| 2023 | Ga0209050_1004588 | |||
| 2024 | Ga0209050_1005248 | |||
| 2025 | Ga0209050_1006884 | |||
| 2026 | Ga0209256_1000001 | |||
| 2027 | Ga0209256_1000020 | |||
| 2028 | Ga0209256_1000022 | |||
| 2029 | Ga0209256_1000024 | |||
| 2030 | Ga0209256_1002170 | |||
| 2031 | Ga0209256_1002204 | |||
| 2032 | Ga0207426_1000001 | |||
| 2033 | Ga0207426_1000025 | |||
| 2034 | Ga0207426_1000031 | |||
| 2035 | Ga0207426_1001168 | |||
| 2036 | Ga0209051_1000003 | |||
| 2037 | Ga0209051_1000029 | |||
| 2038 | Ga0209051_1000036 | |||
| 2039 | Ga0209051_1000063 | |||
| 2040 | Ga0209051_1000064 | |||
| 2041 | Ga0209051_1000078 | |||
| 2042 | Ga0209051_1000213 | |||
| 2043 | Ga0209051_1000243 | |||
| 2044 | Ga0209051_1000455 | |||
| 2045 | Ga0209051_1001500 | |||
| 2046 | Ga0209051_1004021 | |||
| 2047 | Ga0209051_1006392 | |||
| 2048 | Ga0209051_1006879 | |||
| 2049 | Ga0209051_1008919 | |||
| 2050 | Ga0209257_1000011 | |||
| 2051 | Ga0209257_1000012 | |||
| 2052 | Ga0209257_1000018 | |||
| 2053 | Ga0209257_1000021 | |||
| 2054 | Ga0209257_1000030 | |||
| 2055 | Ga0209257_1000109 | |||
| 2056 | Ga0209257_1000118 | |||
| 2057 | Ga0209257_1000226 | |||
| 2058 | Ga0209257_1000980 | |||
| 2059 | Ga0209257_1002930 | |||
| 2060 | Ga0209257_1003485 | |||
| 2061 | Ga0209257_1018343 | |||
| 2062 | Ga0209257_1019700 | |||
| 2063 | Ga0207697_10006077 | |||
| 2064 | Ga0207697_10020917 | |||
| 2065 | Ga0207697_10023400 | |||
| 2066 | Ga0207697_10055501 | |||
| 2067 | Ga0207656_10003985 | |||
| 2068 | Ga0207656_10012705 | |||
| 2069 | Ga0207656_10013411 | |||
| 2070 | Ga0207656_10020257 | |||
| 2071 | Ga0207656_10025458 | |||
| 2072 | Ga0207696_1015363 | |||
| 2073 | Ga0207655_1026542 | |||
| 2074 | Ga0207682_10000759 | |||
| 2075 | Ga0207682_10013091 | |||
| 2076 | Ga0207642_10029763 | |||
| 2077 | Ga0207680_10001601 | |||
| 2078 | Ga0207645_10003471 | |||
| 2079 | Ga0207645_10004926 | |||
| 2080 | Ga0207645_10011577 | |||
| 2081 | Ga0207645_10012714 | |||
| 2082 | Ga0207645_10018093 | |||
| 2083 | Ga0207645_10028617 | |||
| 2084 | Ga0207643_10012919 | |||
| 2085 | Ga0207705_10123016 | |||
| 2086 | Ga0207684_10011095 | |||
| 2087 | Ga0207654_10034398 | |||
| 2088 | Ga0207695_10002904 | |||
| 2089 | Ga0207695_10018222 | |||
| 2090 | Ga0207695_10155131 | |||
| 2091 | Ga0207671_10005965 | |||
| 2092 | Ga0207671_10103190 | |||
| 2093 | Ga0207662_10029873 | |||
| 2094 | Ga0207657_10035067 | |||
| 2095 | Ga0207657_10050686 | |||
| 2096 | Ga0207657_10056390 | |||
| 2097 | Ga0207657_10129827 | |||
| 2098 | Ga0207649_10009799 | |||
| 2099 | Ga0207649_10097267 | |||
| 2100 | Ga0207652_10015168 | |||
| 2101 | Ga0207652_10139706 | |||
| 2102 | Ga0207646_10157201 | |||
| 2103 | Ga0207681_10000899 | |||
| 2104 | Ga0207681_10010511 | |||
| 2105 | Ga0207694_10016398 | |||
| 2106 | Ga0207694_10034080 | |||
| 2107 | Ga0207694_10043051 | |||
| 2108 | Ga0207694_10149216 | |||
| 2109 | Ga0207650_10000878 | |||
| 2110 | Ga0207650_10002442 | |||
| 2111 | Ga0207650_10014659 | |||
| 2112 | Ga0207650_10140005 | |||
| 2113 | Ga0207659_10000135 | |||
| 2114 | Ga0207659_10000207 | |||
| 2115 | Ga0207659_10001596 | |||
| 2116 | Ga0207659_10006224 | |||
| 2117 | Ga0207659_10032239 | |||
| 2118 | Ga0207659_10141460 | |||
| 2119 | Ga0207659_10259042 | |||
| 2120 | Ga0207687_10015611 | |||
| 2121 | Ga0207687_10098169 | |||
| 2122 | Ga0207644_10001220 | |||
| 2123 | Ga0207644_10001228 | |||
| 2124 | Ga0207644_10021457 | |||
| 2125 | Ga0207644_10041528 | |||
| 2126 | Ga0207644_10046621 | |||
| 2127 | Ga0207644_10244143 | |||
| 2128 | Ga0207690_10000359 | |||
| 2129 | Ga0207690_10039046 | |||
| 2130 | Ga0207690_10102670 | |||
| 2131 | Ga0207690_10224641 | |||
| 2132 | Ga0207706_10000654 | |||
| 2133 | Ga0207706_10002883 | |||
| 2134 | Ga0207706_10002944 | |||
| 2135 | Ga0207706_10017782 | |||
| 2136 | Ga0207706_10073320 | |||
| 2137 | Ga0207706_10078450 | |||
| 2138 | Ga0207706_10200717 | |||
| 2139 | Ga0207686_10013697 | |||
| 2140 | Ga0207686_10025763 | |||
| 2141 | Ga0207686_10073882 | |||
| 2142 | Ga0207709_10000038 | |||
| 2143 | Ga0207709_10000147 | |||
| 2144 | Ga0207709_10000214 | |||
| 2145 | Ga0207709_10004723 | |||
| 2146 | Ga0207709_10009501 | |||
| 2147 | Ga0207709_10020370 | |||
| 2148 | Ga0207709_10032522 | |||
| 2149 | Ga0207670_10039836 | |||
| 2150 | Ga0207669_10001219 | |||
| 2151 | Ga0207669_10001590 | |||
| 2152 | Ga0207669_10004703 | |||
| 2153 | Ga0207669_10006838 | |||
| 2154 | Ga0207669_10009417 | |||
| 2155 | Ga0207669_10013232 | |||
| 2156 | Ga0207669_10021720 | |||
| 2157 | Ga0207669_10052263 | |||
| 2158 | Ga0207704_10002775 | |||
| 2159 | Ga0207704_10005625 | |||
| 2160 | Ga0207704_10029924 | |||
| 2161 | Ga0207691_10001187 | |||
| 2162 | Ga0207691_10001712 | |||
| 2163 | Ga0207691_10039447 | |||
| 2164 | Ga0207691_10133271 | |||
| 2165 | Ga0207691_10150673 | |||
| 2166 | Ga0207711_10004508 | |||
| 2167 | Ga0207711_10045951 | |||
| 2168 | Ga0207711_10048324 | |||
| 2169 | Ga0207711_10120738 | |||
| 2170 | Ga0207711_10144084 | |||
| 2171 | Ga0207689_10005835 | |||
| 2172 | Ga0207689_10006945 | |||
| 2173 | Ga0207689_10023078 | |||
| 2174 | Ga0207689_10101824 | |||
| 2175 | Ga0207689_10153379 | |||
| 2176 | Ga0207661_10012975 | |||
| 2177 | Ga0207679_10000220 | |||
| 2178 | Ga0207679_10003707 | |||
| 2179 | Ga0207679_10017872 | |||
| 2180 | Ga0207679_10072079 | |||
| 2181 | Ga0207667_10025000 | |||
| 2182 | Ga0207667_10054838 | |||
| 2183 | Ga0207667_10103527 | |||
| 2184 | Ga0207651_10000798 | |||
| 2185 | Ga0207651_10002450 | |||
| 2186 | Ga0207651_10013478 | |||
| 2187 | Ga0207651_10018259 | |||
| 2188 | Ga0207651_10047090 | |||
| 2189 | Ga0207651_10047832 | |||
| 2190 | Ga0207651_10055284 | |||
| 2191 | Ga0207651_10110123 | |||
| 2192 | Ga0207712_10000828 | |||
| 2193 | Ga0207668_10001541 | |||
| 2194 | Ga0207668_10014399 | |||
| 2195 | Ga0207668_10025183 | |||
| 2196 | Ga0207668_10117088 | |||
| 2197 | Ga0207668_10183343 | |||
| 2198 | Ga0207640_10006017 | |||
| 2199 | Ga0207640_10095449 | |||
| 2200 | Ga0207658_10000860 | |||
| 2201 | Ga0207658_10003454 | |||
| 2202 | Ga0207658_10005178 | |||
| 2203 | Ga0207658_10056497 | |||
| 2204 | Ga0207677_10005607 | |||
| 2205 | Ga0207677_10012083 | |||
| 2206 | Ga0207677_10014359 | |||
| 2207 | Ga0207677_10015442 | |||
| 2208 | Ga0207677_10026317 | |||
| 2209 | Ga0207677_10079217 | |||
| 2210 | Ga0207677_10153967 | |||
| 2211 | Ga0207703_10001624 | |||
| 2212 | Ga0207703_10002139 | |||
| 2213 | Ga0207703_10009455 | |||
| 2214 | Ga0207639_10039741 | |||
| 2215 | Ga0207678_10160314 | |||
| 2216 | Ga0207678_10199620 | |||
| 2217 | Ga0207708_10073767 | |||
| 2218 | Ga0207708_10075749 | |||
| 2219 | Ga0207702_10002918 | |||
| 2220 | Ga0207702_10011208 | |||
| 2221 | Ga0207702_10099543 | |||
| 2222 | Ga0207702_10240766 | |||
| 2223 | Ga0207641_10001135 | |||
| 2224 | Ga0207641_10005572 | |||
| 2225 | Ga0207641_10019756 | |||
| 2226 | Ga0207641_10020064 | |||
| 2227 | Ga0207641_10036047 | |||
| 2228 | Ga0207641_10052146 | |||
| 2229 | Ga0207641_10070520 | |||
| 2230 | Ga0207641_10218443 | |||
| 2231 | Ga0207641_10314327 | |||
| 2232 | Ga0207648_10000062 | |||
| 2233 | Ga0207648_10002388 | |||
| 2234 | Ga0207648_10004104 | |||
| 2235 | Ga0207648_10006529 | |||
| 2236 | Ga0207648_10007879 | |||
| 2237 | Ga0207648_10022340 | |||
| 2238 | Ga0207648_10076245 | |||
| 2239 | Ga0207648_10144260 | |||
| 2240 | Ga0207648_10148564 | |||
| 2241 | Ga0207648_10159701 | |||
| 2242 | Ga0207676_10001093 | |||
| 2243 | Ga0207676_10007428 | |||
| 2244 | Ga0207676_10026622 | |||
| 2245 | Ga0207676_10037688 | |||
| 2246 | Ga0207676_10108534 | |||
| 2247 | Ga0207674_10001725 | |||
| 2248 | Ga0207674_10015020 | |||
| 2249 | Ga0207674_10041759 | |||
| 2250 | Ga0207674_10052794 | |||
| 2251 | Ga0207674_10112297 | |||
| 2252 | Ga0207675_100000868 | |||
| 2253 | Ga0207675_100002203 | |||
| 2254 | Ga0207675_100004188 | |||
| 2255 | Ga0207675_100005109 | |||
| 2256 | Ga0207683_10001181 | |||
| 2257 | Ga0207683_10023663 | |||
| 2258 | Ga0207683_10044028 | |||
| 2259 | Ga0207683_10044881 | |||
| 2260 | Ga0207683_10046127 | |||
| 2261 | Ga0207683_10108741 | |||
| 2262 | Ga0207683_10164978 | |||
| 2263 | Ga0207683_10177045 | |||
| 2264 | Ga0207683_10181255 | |||
| 2265 | Ga0207698_10004390 | |||
| 2266 | Ga0207698_10012848 | |||
| 2267 | Ga0207698_10024454 | |||
| 2268 | Ga0207698_10051797 | |||
| 2269 | Ga0207698_10099612 | |||
| 2270 | Ga0207698_10134379 | |||
| 2271 | Ga0207698_10200427 | |||
| 2272 | Ga0207698_10273412 | |||
| 2273 | Ga0209281_1000005 | |||
| 2274 | Ga0209281_1000149 | |||
| 2275 | Ga0209389_1010627 | |||
| 2276 | Ga0209984_1002311 | |||
| 2277 | Ga0209968_1000125 | |||
| 2278 | Ga0209970_1000690 | |||
| 2279 | Ga0209282_1000228 | |||
| 2280 | Ga0209282_1000864 | |||
| 2281 | Ga0209971_1007153 | |||
| 2282 | Ga0209966_1000014 | |||
| 2283 | Ga0209974_10001071 | |||
| 2284 | Ga0209974_10014591 | |||
| 2285 | Ga0268266_10072143 | |||
| 2286 | Ga0268265_10030110 | |||
| 2287 | Ga0268265_10042246 | |||
| 2288 | Ga0268265_10083622 | |||
| 2289 | Ga0268264_10001193 | |||
| 2290 | Ga0268264_10001745 | |||
| 2291 | Ga0268264_10023892 | |||
| 2292 | Ga0268264_10093386 | |||
| 2293 | Ga0268264_10116829 | |||
| 2294 | Ga0268264_10126132 | |||
| 2295 | Ga0265336_10000012 | |||
| 2296 | Ga0307517_10001025 | |||
| 2297 | Ga0307515_10000064 | |||
| 2298 | Ga0307515_10000137 | |||
| 2299 | Ga0307515_10000139 | |||
| 2300 | Ga0307515_10000187 | |||
| 2301 | Ga0307515_10000727 | |||
| 2302 | Ga0307515_10000998 | |||
| 2303 | Ga0307515_10001587 | |||
| 2304 | Ga0307515_10002977 | |||
| 2305 | Ga0307515_10007083 | |||
| 2306 | Ga0307515_10014464 | |||
| 2307 | Ga0307515_10021785 | |||
| 2308 | Ga0307515_10068465 | |||
| 2309 | Ga0307515_10110315 | |||
| 2310 | Ga0265324_10003636 | |||
| 2311 | Ga0307512_10049207 | |||
| 2312 | Ga0314311_1018086 | |||
| 2313 | Ga0316178_1128022 | |||
| 2314 | Ga0316180_1003872 | |||
| 2315 | Ga0316183_1046777 | |||
| 2316 | Ga0316181_1014423 | |||
| 2317 | Ga0265330_10000117 | |||
| 2318 | Ga0265332_10000002 | |||
| 2319 | Ga0265332_10000033 | |||
| 2320 | Ga0265332_10000125 | |||
| 2321 | Ga0265331_10001854 | |||
| 2322 | Ga0265327_10000309 | |||
| 2323 | Ga0265327_10000779 | |||
| 2324 | Ga0265327_10001589 | |||
| 2325 | Ga0265327_10011830 | |||
| 2326 | Ga0265316_10000833 | |||
| 2327 | Ga0307513_10000019 | |||
| 2328 | Ga0307513_10000051 | |||
| 2329 | Ga0307513_10002833 | |||
| 2330 | Ga0307513_10007462 | |||
| 2331 | Ga0307513_10008369 | |||
| 2332 | Ga0307513_10058693 | |||
| 2333 | Ga0307513_10310883 | |||
| 2334 | Ga0307509_10000092 | |||
| 2335 | Ga0307509_10003532 | |||
| 2336 | Ga0307509_10037154 | |||
| 2337 | Ga0307509_10038946 | |||
| 2338 | Ga0307509_10056231 | |||
| 2339 | Ga0307509_10095060 | |||
| 2340 | Ga0307509_10103755 | |||
| 2341 | Ga0307509_10146780 | |||
| 2342 | Ga0307408_100000008 | |||
| 2343 | Ga0307408_100000407 | |||
| 2344 | Ga0307408_100006921 | |||
| 2345 | Ga0307408_100025292 | |||
| 2346 | Ga0307408_100051504 | |||
| 2347 | Ga0307408_100071443 | |||
| 2348 | Ga0307408_100075069 | |||
| 2349 | Ga0307408_100119969 | |||
| 2350 | Ga0307408_100124722 | |||
| 2351 | Ga0307508_10000004 | |||
| 2352 | Ga0307508_10001570 | |||
| 2353 | Ga0307514_10003976 | |||
| 2354 | Ga0307514_10040375 | |||
| 2355 | Ga0307514_10040483 | |||
| 2356 | Ga0265314_10000012 | |||
| 2357 | Ga0265314_10147752 | |||
| 2358 | Ga0307516_10000109 | |||
| 2359 | Ga0307516_10003586 | |||
| 2360 | Ga0307516_10005086 | |||
| 2361 | Ga0307516_10007069 | |||
| 2362 | Ga0307516_10019753 | |||
| 2363 | Ga0307516_10050860 | |||
| 2364 | Ga0307516_10172547 | |||
| 2365 | Ga0307516_10210361 | |||
| 2366 | Ga0307405_10062736 | |||
| 2367 | Ga0307405_10123767 | |||
| 2368 | Ga0307405_10154149 | |||
| 2369 | Ga0307405_10185738 | |||
| 2370 | Ga0307413_10145654 | |||
| 2371 | Ga0307410_10005512 | |||
| 2372 | Ga0307406_10000050 | |||
| 2373 | Ga0307406_10000440 | |||
| 2374 | Ga0307406_10003882 | |||
| 2375 | Ga0307406_10004637 | |||
| 2376 | Ga0307406_10071343 | |||
| 2377 | Ga0307412_10013847 | |||
| 2378 | Ga0307412_10029763 | |||
| 2379 | Ga0307412_10088191 | |||
| 2380 | Ga0307409_100004771 | |||
| 2381 | Ga0307409_100048315 | |||
| 2382 | Ga0307416_100003421 | |||
| 2383 | Ga0307416_100013163 | |||
| 2384 | Ga0307416_100073184 | |||
| 2385 | Ga0307414_10007644 | |||
| 2386 | Ga0307414_10023583 | |||
| 2387 | Ga0307414_10030258 | |||
| 2388 | Ga0307414_10092110 | |||
| 2389 | Ga0307414_10117542 | |||
| 2390 | Ga0307414_10129557 | |||
| 2391 | Ga0307411_10005288 | |||
| 2392 | Ga0307411_10014448 | |||
| 2393 | Ga0307411_10110231 | |||
| 2394 | Ga0307411_10113643 | |||
| 2395 | Ga0307411_10155332 | |||
| 2396 | Ga0307415_100007187 | |||
| 2397 | Ga0307507_10012966 | |||
| 2398 | Ga0307507_10048731 | |||
| 2399 | Ga0307510_10002759 | |||
| 2400 | Ga0373934_0006495 | |||
| 2401 | Ga0373932_0012678 | |||
| 2402 | Ga0373939_0000008 | |||
| 2403 | Ga0373957_0091396 | |||
| 2404 | Ga0373931_0000533 | |||
| 2405 | Ga0373931_0025052 | |||
| 2406 | Ga0373937_0025203 | |||
| 2407 | Ga0373925_0003362 | |||
| 2408 | Ga0373925_0147863 | |||
| 2409 | Ga0395899_0000992 | |||
| 2410 | Ga0395899_0013417 | |||
| 2411 | Ga0395899_0025496 | |||
| 2412 | Ga0395899_0027819 | |||
| 2413 | Ga0395900_0004787 | |||
| 2414 | Ga0395900_0020937 | |||
| 2415 | Ga0395900_0026497 | |||
| 2416 | Ga0395900_0029664 | |||
| 2417 | Ga0395900_0079616 | |||
| 2418 | Ga0395898_0006328 | |||
| 2419 | Ga0395898_0036706 | |||
| 2420 | Ga0395898_0054593 | |||
| 2421 | Ga0395905_0000148 | |||
| 2422 | Ga0395905_0000382 | |||
| 2423 | Ga0395905_0002029 | |||
| 2424 | Ga0395905_0003923 | |||
| 2425 | Ga0395905_0005758 | |||
| 2426 | Ga0395905_0006766 | |||
| 2427 | Ga0395905_0015358 | |||
| 2428 | Ga0395905_0017190 | |||
| 2429 | Ga0395905_0021027 | |||
| 2430 | Ga0395905_0029796 | |||
| 2431 | Ga0395905_0032872 | |||
| 2432 | Ga0395905_0050244 | |||
| 2433 | Ga0395905_0054783 | |||
| 2434 | Ga0395905_0084413 | |||
| 2435 | Ga0395905_0095056 | |||
| 2436 | Ga0395901_0010348 | |||
| 2437 | Ga0395901_0034728 | |||
| 2438 | Ga0395901_0049039 | |||
| 2439 | Ga0395901_0106293 | |||
| 2440 | Ga0395901_0150472 | |||
| 2441 | Ga0395901_0327295 | |||
| 2442 | Ga0436365_0538258 | |||
| 2443 | Ga0436361_0026531 | |||
| 2444 | Ga0436361_0258710 | |||
| 2445 | Ga0436361_0572364 | |||
| 2446 | Ga0436361_0848510 | |||
| 2447 | Ga0436363_0660497 | |||
| 2448 | Ga0439436_0016367 | |||
| 2449 | Ga0439439_0011910 | |||
| 2450 | Ga0439447_025116 | |||
| 2451 | Ga0439466_0015578 | |||
| 2452 | Ga0451789_0102886 | |||
| 2453 | Ga0451789_0982253 | |||
| 2454 | Ga0451798_0381267 | |||
| 2455 | Ga0451802_1471416 | |||
| 2456 | Ga0451804_0153252 | |||
| 2457 | Ga0451851_0707665 | |||
| 2458 | Ga0439437_004350 | |||
| 2459 | Ga0439445_0013762 | |||
| 2460 | Ga0439432_021391 | |||
| 2461 | Ga0439432_037869 | |||
| 2462 | Ga0439449_0001661 | |||
| 2463 | Ga0439449_0002564 | |||
| 2464 | Ga0439449_0002664 | |||
| 2465 | Ga0439449_0062728 | |||
| 2466 | Ga0439452_010143 | |||
| 2467 | Ga0439462_0001024 | |||
| 2468 | Ga0450911_001627 | |||
| 2469 | Ga0450917_000573 | |||
| 2470 | Ga0450923_009925 | |||
| 2471 | Ga0450888_000521 | |||
| 2472 | Ga0450890_000453 | |||
| 2473 | Ga0450892_001840 | |||
| 2474 | Ga0439446_0014972 | |||
| 2475 | Ga0439459_0004826 | |||
| 2476 | Ga0439464_0004333 | |||
| 2477 | Ga0450893_0001792 | |||
| 2478 | Ga0451577_0000114 | |||
| 2479 | Ga0451577_0001993 | |||
| 2480 | Ga0451577_0003232 | |||
| 2481 | Ga0451577_0028693 | |||
| 2482 | Ga0451577_0099799 | |||
| 2483 | Ga0451577_0242541 | |||
| 2484 | Ga0466969_0000002 | |||
| 2485 | Ga0466969_0004958 | |||
| 2486 | Ga0466969_0010775 | |||
| 2487 | Ga0466972_0001432 | |||
| 2488 | Ga0466972_0001996 | |||
| 2489 | Ga0453683_0016380 | |||
| 2490 | Ga0466965_0008514 | |||
| 2491 | Ga0466966_0005727 | |||
| 2492 | Ga0466966_0024374 | |||
| 2493 | Ga0466966_0026318 | |||
| 2494 | Ga0466966_0136381 | |||
| 2495 | Ga0466961_0010534 | |||
| 2496 | Ga0466961_0023826 | |||
| 2497 | Ga0466961_0061473 | |||
| 2498 | Ga0466964_0001984 | |||
| 2499 | Ga0466964_0002512 | |||
| 2500 | Ga0466964_0019378 | |||
| 2501 | Ga0453684_0000606 | |||
| 2502 | Ga0453684_0006765 | |||
| 2503 | Ga0453684_0029871 | |||
| 2504 | Ga0453684_0073573 | |||
| 2505 | Ga0453684_0099934 | |||
| 2506 | Ga0453684_0256555 | |||
| 2507 | Ga0453684_0331768 | |||
| 2508 | Ga0466971_0010968 | |||
| 2509 | Ga0466970_0011589 | |||
| 2510 | Ga0466970_0015713 | |||
| 2511 | Ga0466957_0001959 | |||
| 2512 | Ga0466957_0025793 | |||
| 2513 | Ga0466959_0000666 | |||
| 2514 | Ga0466959_0003830 | |||
| 2515 | Ga0466959_0008467 | |||
| 2516 | Ga0466959_0019965 | |||
| 2517 | Ga0466959_0050801 | |||
| 2518 | Ga0451576_0001159 | |||
| 2519 | Ga0451576_0024264 | |||
| 2520 | Ga0451576_0185201 | |||
| 2521 | Ga0451576_0230389 | |||
| 2522 | Ga0466958_0018392 | |||
| 2523 | Ga0466967_0006653 | |||
| 2524 | Ga0495592_0000085 | |||
| 2525 | Ga0495590_0030763 | |||
| 2526 | Ga0495629_0100170 | |||
| 2527 | Ga0495650_0008300 | |||
| 2528 | Ga0495650_0014309 | |||
| 2529 | Ga0495639_0014497 | |||
| 2530 | Ga0495639_0061082 | |||
| 2531 | Ga0495583_0000017 | |||
| 2532 | Ga0495606_0007405 | |||
| 2533 | Ga0495610_0035905 | |||
| 2534 | Ga0495643_0008485 | |||
| 2535 | Ga0495663_0015081 | |||
| 2536 | Ga0495642_0013344 | |||
| 2537 | Ga0495654_0019169 | |||
| 2538 | Ga0495640_0077443 | |||
| 2539 | Ga0495598_0007958 | |||
| 2540 | Ga0495621_0028065 | |||
| 2541 | Ga0495621_0035437 | |||
| 2542 | Ga0495597_0000860 | |||
| 2543 | Ga0495656_0001200 | |||
| 2544 | Ga0495656_0007392 | |||
| 2545 | Ga0495668_0012058 | |||
| 2546 | Ga0495668_0024872 | |||
| 2547 | Ga0495668_0025999 | |||
| 2548 | Ga0495668_0035048 | |||
| 2549 | Ga0495625_0000044 | |||
| 2550 | Ga0495625_0000639 | |||
| 2551 | Ga0495625_0024244 | |||
| 2552 | Ga0495625_0159359 | |||
| 2553 | Ga0495658_0008307 | |||
| 2554 | Ga0495671_0042892 | |||
| 2555 | Ga0495649_0000151 | |||
| 2556 | Ga0495649_0002613 | |||
| 2557 | Ga0495589_0007070 | |||
| 2558 | Ga0495660_0010693 | |||
| 2559 | Ga0495636_0057084 | |||
| 2560 | Ga0495676_0024202 | |||
| 2561 | Ga0495676_0225323 | |||
| 2562 | Ga0495687_001028 | |||
| 2563 | Ga0495687_014016 | |||
| 2564 | Ga0495687_018047 | |||
| 2565 | Ga0495686_0001809 | |||
| 2566 | Ga0495686_0005751 | |||
| 2567 | Ga0495686_0072663 | |||
| 2568 | Ga0495686_0078679 | |||
| 2569 | Ga0495593_0047176 | |||
| 2570 | Ga0495593_0052839 | |||
| 2571 | Ga0495602_0208866 | |||
| 2572 | Ga0495614_0020043 | |||
| 2573 | Ga0495615_0005712 | |||
| 2574 | Ga0496100_0053001 | |||
| 2575 | Ga0496101_0003019 | |||
| 2576 | Ga0496102_0006763 | |||
| 2577 | Ga0496102_0113807 | |||
| 2578 | Ga0496104_0087344 | |||
| 2579 | Ga0496105_0008621 | |||
| 2580 | Ga0496106_0019139 | |||
| 2581 | Ga0496106_0045643 | |||
| 2582 | Ga0496106_0060086 | |||
| 2583 | Ga0496107_0053764 | |||
| 2584 | Ga0496108_0068001 | |||
| 2585 | Ga0496109_0107082 | |||
| 2586 | Ga0496110_0246336 | |||
| 2587 | Ga0496111_0017144 | |||
| 2588 | Ga0496112_0284028 | |||
| 2589 | Ga0496113_0003290 | |||
| 2590 | Ga0496114_0001821 | |||
| 2591 | Ga0496114_0194687 | |||
| 2592 | Ga0496116_0067077 | |||
| 2593 | Ga0496117_0017641 | |||
| 2594 | Ga0496118_0076428 | |||
| 2595 | Ga0496121_0000166 | |||
| 2596 | Ga0496121_0024477 | |||
| 2597 | Ga0496121_0117372 | |||
| 2598 | Ga0496122_0000274 | |||
| 2599 | Ga0496123_0000262 | |||
| 2600 | Ga0496123_0022733 | |||
| 2601 | Ga0496124_0026316 | |||
| 2602 | Ga0496124_0087183 | |||
| 2603 | Ga0496124_0129422 | |||
| 2604 | Ga0496125_0005447 | |||
| 2605 | Ga0496125_0007916 | |||
| 2606 | Ga0496125_0010221 | |||
| 2607 | Ga0496125_0045207 | |||
| 2608 | Ga0496125_0064393 | |||
| 2609 | Ga0496125_0106677 | |||
| 2610 | Ga0496125_0125154 | |||
| 2611 | Ga0496126_0035583 | |||
| 2612 | Ga0496126_0039612 | |||
| 2613 | Ga0496126_0064731 | |||
| 2614 | Ga0496126_0087756 | |||
| 2615 | Ga0501298_006817 | |||
| 2616 | Ga0501300_002934 | |||
| 2617 | Ga0501315_000613 | |||
| 2618 | Ga0501317_001883 | |||
| 2619 | Ga0501031_0000678 | |||
| 2620 | Ga0501043_0001160 | |||
| 2621 | Ga0501046_0001185 | |||
| 2622 | Ga0501047_0001232 | |||
| 2623 | Ga0501047_0144572 | |||
| 2624 | Ga0501048_0015099 | |||
| 2625 | Ga0501199_003264 | |||
| 2626 | Ga0501211_000039 | |||
| 2627 | Ga0501222_005437 | |||
| 2628 | Ga0501227_003642 | |||
| 2629 | Ga0501233_002550 | |||
| 2630 | Ga0501235_015347 | |||
| 2631 | Ga0501249_003156 | |||
| 2632 | Ga0501255_000879 | |||
| 2633 | Ga0501221_001616 | |||
| 2634 | Ga0501229_000147 | |||
| 2635 | Ga0501080_0135023 | |||
| 2636 | Ga0501262_000134 | |||
| 2637 | Ga0501262_000522 | |||
| 2638 | Ga0501267_002268 | |||
| 2639 | Ga0501283_005483 | |||
| 2640 | Ga0501035_0020751 | |||
| 2641 | nmdc:mga03683_11374_c1 | |||
| 2642 | nmdc:mga03683_1731_c1 | |||
| 2643 | nmdc:mga03683_29665_c1 | |||
| 2644 | nmdc:mga03683_43882_c1 | |||
| 2645 | nmdc:mga0yw44_1756_c1 | |||
| 2646 | nmdc:mga0yw44_44339_c1 | |||
| 2647 | nmdc:mga0yw44_95707_c1 | |||
| 2648 | nmdc:mga0k408_108946_c1 | |||
| 2649 | nmdc:mga0k408_127848_c1 | |||
| 2650 | nmdc:mga0k408_13106_c1 | |||
| 2651 | nmdc:mga0k408_163046_c1 | |||
| 2652 | nmdc:mga0k408_3137_c1 | |||
| 2653 | nmdc:mga0k408_3243_c1 | |||
| 2654 | nmdc:mga0k408_33152_c1 | |||
| 2655 | nmdc:mga0k408_34566_c1 | |||
| 2656 | nmdc:mga0k408_3717_c1 | |||
| 2657 | nmdc:mga0k408_38735_c1 | |||
| 2658 | nmdc:mga0k408_41642_c1 | |||
| 2659 | nmdc:mga0k408_42352_c1 | |||
| 2660 | nmdc:mga0k408_56179_c1 | |||
| 2661 | nmdc:mga06z11_79888_c1 | |||
| 2662 | nmdc:mga07m45_150_c1 | |||
| 2663 | nmdc:mga07m45_1625_c1 | |||
| 2664 | nmdc:mga07m45_16722_c1 | |||
| 2665 | nmdc:mga07m45_2249_c1 | |||
| 2666 | nmdc:mga07m45_2640_c1 | |||
| 2667 | nmdc:mga07m45_28765_c1 | |||
| 2668 | nmdc:mga07m45_29017_c1 | |||
| 2669 | nmdc:mga07m45_29589_c1 | |||
| 2670 | nmdc:mga07m45_38568_c1 | |||
| 2671 | nmdc:mga05p37_22357_c1 | |||
| 2672 | nmdc:mga09592_3773_c1 | |||
| 2673 | nmdc:mga0qj67_9921_c1 | |||
| 2674 | nmdc:mga0sz30_8986_c1 | |||
| 2675 | Ga0495601_0010718 | |||
| 2676 | Ga0500610_0024972 | |||
| 2677 | Ga0500635_0000053 | |||
| 2678 | Ga0500578_0000011 | |||
| 2679 | Ga0500578_0020439 | |||
| 2680 | Ga0500643_005802 | |||
| 2681 | Ga0500583_0008528 | |||
| 2682 | Ga0500651_0000053 | |||
| 2683 | Ga0500651_0039754 | |||
| 2684 | Ga0500651_0045243 | |||
| 2685 | Ga0500571_009242 | |||
| 2686 | Ga0500593_001023 | |||
| 2687 | Ga0500594_0002798 | |||
| 2688 | Ga0500594_0009467 | |||
| 2689 | Ga0500642_0043132 | |||
| 2690 | Ga0500652_006726 | |||
| 2691 | Ga0500655_011021 | |||
| 2692 | Ga0500658_0000012 | |||
| 2693 | Ga0500658_0029729 | |||
| 2694 | Ga0500658_0036987 | |||
| 2695 | Ga0500559_0000017 | |||
| 2696 | Ga0500559_0008060 | |||
| 2697 | Ga0500574_000398 | |||
| 2698 | Ga0500574_014530 | |||
| 2699 | Ga0500616_0034802 | |||
| 2700 | Ga0500619_000181 | |||
| 2701 | Ga0500622_0000097 | |||
| 2702 | Ga0500622_0001258 | |||
| 2703 | Ga0500622_0002974 | |||
| 2704 | Ga0500634_0043295 | |||
| 2705 | Ga0500636_0057982 | |||
| 2706 | Ga0500645_000200 | |||
| 2707 | Ga0500645_001413 | |||
| 2708 | Ga0587085_004029 | |||
| 2709 | Ga0466962_0012218 | |||
| 2710 | Ga0466962_0017271 | |||
| 2711 | 2511247036 | |||
| 2712 | 2513229123 | |||
| 2713 | 2513231368 | |||
| 2714 | 2513231369 | |||
| 2715 | 2548500586 | |||
| 2716 | 2548501001 | |||
| 2717 | 2587730989 | |||
| 2718 | 2587736841 | |||
| 2719 | 2587756021 | |||
| 2720 | 2588291741 | |||
| 2721 | 2599626607 | |||
| 2722 | 2599626608 | |||
| 2723 | 2599675671 | |||
| 2724 | 2599675672 | |||
| 2725 | 2599684144 | |||
| 2726 | 2599684145 | |||
| 2727 | 2599696158 | |||
| 2728 | 2599696159 | |||
| 2729 | 2643742760 | |||
| 2730 | 2643864414 | |||
| 2731 | 2643866709 | |||
| 2732 | 2643933394 | |||
| 2733 | 2643972430 | |||
| 2734 | 2643992950 | |||
| 2735 | 2643993442 | |||
| 2736 | 2644030817 | |||
| 2737 | 2644062694 | |||
| 2738 | 2644076292 | |||
| 2739 | 2644138562 | |||
| 2740 | 2644163257 | |||
| 2741 | 2644163258 | |||
| 2742 | 2644217621 | |||
| 2743 | 2644258644 | |||
| 2744 | 2644272938 | |||
| 2745 | 2644291883 | |||
| 2746 | 2644294580 | |||
| 2747 | 2644305123 | |||
| 2748 | 2644314643 | |||
| 2749 | 2644325845 | |||
| 2750 | 2644327887 | |||
| 2751 | 2644327888 | |||
| 2752 | 2644337942 | |||
| 2753 | 2644397848 | |||
| 2754 | 2644397849 | |||
| 2755 | 2644468312 | |||
| 2756 | 2644468313 | |||
| 2757 | 2644645886 | |||
| 2758 | 2644646865 | |||
| 2759 | 2722884103 | |||
| 2760 | 2722884104 | |||
| 2761 | 2738718017 | |||
| 2762 | 2738718018 | |||
| 2763 | 2738885086 | |||
| 2764 | 2738885087 | |||
| 2765 | 2739056659 | |||
| 2766 | 2739244626 | |||
| 2767 | 2739251466 | |||
| 2768 | 2739278703 | |||
| 2769 | 2739278704 | |||
| 2770 | 2816475170 | |||
| 2771 | 2819595710 | |||
| 2772 | 2819595711 | |||
| 2773 | 2831266722 | |||
| 2774 | 2831266723 | |||
| 2775 | 2831866193 | |||
| 2776 | 2838057197 | |||
| 2777 | 2838057198 | |||
| 2778 | 2839139836 | |||
| 2779 | 2839139837 | |||
| 2780 | 2842679629 | |||
| 2781 | 2842679630 | |||
| 2782 | 2842719962 | |||
| 2783 | 2842735005 | |||
| 2784 | 2842735006 | |||
| 2785 | 2842751183 | |||
| 2786 | 2842751184 | |||
| 2787 | 2881101915 | |||
| 2788 | 2885192472 | |||
| 2789 | 2885192473 | |||
| 2790 | 2885200254 | |||
| 2791 | 2885200255 | |||
| 2792 | 2885213950 | |||
| 2793 | 2885213951 | |||
| 2794 | 2886852427 | |||
| 2795 | 2886853182 | |||
| 2796 | 2899925056 | |||
| 2797 | 2899925057 | |||
| 2798 | 2904455735 | |||
| 2799 | 2904455736 | |||
| 2800 | 2904462751 | |||
| 2801 | 2904462752 | |||
| 2802 | 2904544814 | |||
| 2803 | 2904544815 | |||
| 2804 | 2919467274 | |||
| 2805 | 2919467275 | |||
| 2806 | 2919707483 | |||
| 2807 | 2928038818 | |||
| 2808 | 2928038819 | |||
| 2809 | 2928045576 | |||
| 2810 | 2928045577 | |||
| 2811 | 2928053192 | |||
| 2812 | 2928053193 | |||
| 2813 | 2928066798 | |||
| 2814 | 2928066799 | |||
| 2815 | 2928071308 | |||
| 2816 | 2928071309 | |||
| 2817 | 2928084757 | |||
| 2818 | 2928084758 | |||
| 2819 | 2928119866 | |||
| 2820 | 2928119867 | |||
| 2821 | 2929163513 | |||
| 2822 | 2929163514 | |||
| 2823 | 2929522718 | |||
| 2824 | 2945912212 | |||
| 2825 | 2945912213 | |||
| 2826 | 2945947732 | |||
| 2827 | 2945947733 | |||
| 2828 | 2945977407 | |||
| 2829 | 2945977408 | |||
| 2830 | 2945985480 | |||
| 2831 | 2945985481 | |||
| 2832 | 2954772051 | |||
| 2833 | 2954772052 | |||
| 2834 | 2974323087 | |||
| 2835 | 2990712678 | |||
| 2836 | 2990715008 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ip9-assembly1.cif.gz_A | structure of atu2422-gaba receptor in complex with gaba | 0.8894 | 27 | 390 |
| 4evr-assembly1.cif.gz_A | crystal structure of abc transporter from r. palustris - solute binding protein (rpa0668) in complex with benzoate | 0.8873 | 27 | 405 |
| 1z18-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8852 | 26 | 391 |
| 3ipc-assembly1.cif.gz_A | structure of atu2422-gaba f77a mutant receptor in complex with leucine | 0.8851 | 27 | 390 |
| 3ip9-assembly1.cif.gz_A | structure of atu2422-gaba receptor in complex with gaba | 0.8846 | 27 | 390 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4xfkA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.897 | 154 | 409 | 3.40.50.2300 |
| 4xfkA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8824 | 154 | 409 | 3.40.50.2300 |
| af_P04816_25_358_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8763 | 28 | 366 | 3.40.190.10 |
| 4jb2A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8721 | 154 | 282 | 3.40.50.2300 |
| af_P04816_25_358_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8666 | 28 | 366 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N7JYL7-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9963 | 23 | 409 |
|
| AF-A0A4Q3N6Q6-F1-model_v4 | deleted | 0.996 | 128 | 409 |
|
| AF-A0A4Q3N6Q6-F1-model_v4 | deleted | 0.9855 | 128 | 409 |
|
| AF-A0A3S0G2G8-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9816 | 27 | 399 |
GO:0006865
|
| AF-A0A5F0UYF6-F1-model_v4 | deleted | 0.9722 | 281 | 409 |
|