F494372

General Info

Members Datasets Scaffolds Average Seq Length
1497 517 2836 415

Family's Representative Sequence

Representative Sequence 3300002704|JGI25155J39150_1000002|JGI25155J39150_100000234
Length 442
Sequence MTTQTRFFARHAGVALAVTAMFYSSMTLAQAPAAKAAAPTKATVATPAAGGAVNLNQTVKIAWLDPLSGLMAAVGTNQLKGFQFLAEQFSKKNKAGVKFEIIGIDNKLSPQETTNALKSAIDQGARYVVQGNGSGPALAIMDALSKYNERNPGKEVVYLNYAAVDPDLTNSKCEYWHFRLDADTSMKMEALTAFMKEQPDIKKVYLINQNYSHGQQVAKFAKANLASKRPDIQIVGEDLHPLAQVRDFAPYIAKIKQSGADTVITGNWGSDLSLLVKAANEAGLNNVKFYTYYAGVTGTPTALGAGSAGRVYMVAYNHLNMGGEIQQIQAEYKKKFNDDFYTGAIFHAFTILTEAMAQTKSTEPAVVAKAMEGLRFKSFNGDVEMRKTDHQLQQGLYIDKWEKAGGKYPYDAENTGYTFVPVKYYEPYVASTPTSCQMKRPG

Samples

Sample ID Description Type Environment
1 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
106 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
107 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
138 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
139 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
144 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
145 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
152 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
153 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
154 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
157 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
158 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
165 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
167 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
170 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
229 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
230 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
234 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
241 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
242 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
243 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
244 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
245 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
246 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
247 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
248 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
249 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
250 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
251 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
252 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
253 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
254 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
255 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
256 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
257 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
258 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
259 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
260 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
261 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
262 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
263 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
264 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
265 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
266 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
267 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
268 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
269 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
270 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
271 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
272 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
273 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
274 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
275 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
276 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
277 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
278 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
279 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
280 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
282 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
283 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
284 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
285 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
286 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
287 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
288 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
289 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
290 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
291 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
292 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
293 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
294 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
295 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
296 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
297 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
298 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
299 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
300 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
301 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
302 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
303 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
304 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
305 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
306 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
307 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
308 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
309 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
310 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
311 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
312 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
313 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
314 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
315 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
316 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
317 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
318 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
319 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
320 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
321 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
322 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
323 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
324 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
325 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
326 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
327 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
328 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
329 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
330 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
331 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
332 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
333 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
334 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
335 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
336 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
337 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
338 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
339 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
340 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
341 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
342 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
343 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
344 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
345 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
346 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
347 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
348 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
349 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
350 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
351 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
352 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
353 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
354 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
355 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
356 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
357 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
358 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
359 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
360 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
361 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
362 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
363 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
364 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
365 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
369 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
370 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
375 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
376 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
377 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
378 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
379 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
380 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
381 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
382 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
383 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
384 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
385 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
386 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
387 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
395 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
396 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
397 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
398 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
399 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
400 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
401 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
402 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
403 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
404 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
405 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
406 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
407 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
408 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
409 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
410 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
411 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
412 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
413 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
414 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
415 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
416 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
417 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
418 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
419 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
420 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
421 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
422 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
423 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
424 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
425 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
426 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
427 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
428 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
429 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
430 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
431 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
432 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
433 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
434 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
435 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
436 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
437 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
438 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
439 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
440 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
442 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
443 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
444 2547132374 Acidovorax radicis N35 Isolate Unclassified
445 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
446 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
447 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
448 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
449 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
450 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
451 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
452 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
453 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
454 2643221570 Acidovorax sp. Root568 Isolate Unclassified
455 2643221585 Pelomonas sp. Root662 Isolate Unclassified
456 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
457 2643221596 Acidovorax sp. Root70 Isolate Unclassified
458 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
459 2643221609 Acidovorax sp. Root217 Isolate Unclassified
460 2643221611 Acidovorax sp. Root219 Isolate Unclassified
461 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
462 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
463 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
464 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
465 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
466 2643221652 Acidovorax sp. Root402 Isolate Unclassified
467 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
468 2643221656 Pelomonas sp. Root405 Isolate Unclassified
469 2643221658 Variovorax sp. Root411 Isolate Unclassified
470 2643221660 Methylibium sp. Root1272 Isolate Unclassified
471 2643221672 Variovorax sp. Root434 Isolate Unclassified
472 2643221683 Variovorax sp. Root473 Isolate Unclassified
473 2643221717 Acidovorax sp. Root267 Isolate Unclassified
474 2721755523 Delftia sp. HK171 Isolate Unclassified
475 2738541277 Variovorax sp. GV051 Isolate Unclassified
476 2738541307 Variovorax sp. GV008 Isolate Unclassified
477 2738541337 Pelomonas sp. BT06 Isolate Unclassified
478 2738543012 Acidovorax sp. CF301 Isolate Unclassified
479 2738543013 Variovorax sp. BT01 Isolate Unclassified
480 2738543019 Variovorax sp. GV040 Isolate Unclassified
481 2816332133 Acidovorax radicis 2721A Isolate Unclassified
482 2818991446 Variovorax sp. 1180 Isolate Unclassified
483 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
484 2831864461 Roseateles noduli HZ7 Isolate Nodule
485 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
486 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
487 2842677519 Variovorax sp. R-72495 Isolate Unclassified
488 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
489 2842733646 Variovorax sp. R-72446 Isolate Unclassified
490 2842747753 Variovorax sp. R-72060 Isolate Unclassified
491 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
492 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
493 2885198086 Variovorax sp. 679 Isolate Unclassified
494 2885211737 Variovorax sp. 553 Isolate Unclassified
495 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
496 2899924645 Variovorax sp. 369 Isolate Unclassified
497 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
498 2904456579 Variovorax sp. 2002 Isolate Unclassified
499 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
500 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
501 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
502 2928037797 Variovorax sp. 1126 Isolate Unclassified
503 2928044640 Variovorax sp. 1128 Isolate Unclassified
504 2928051484 Variovorax sp. 1133 Isolate Unclassified
505 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
506 2928070936 Variovorax gossypii 1167 Isolate Unclassified
507 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
508 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
509 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
510 2929520902 Variovorax beijingensis 502 Isolate Unclassified
511 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
512 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
513 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
514 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
515 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
516 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
517 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.38
Metatranscriptomes 0.2
Isolates 8.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.45
Nodule 1.14
Rhizoplane 1.94
Rhizosphere 60.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000002 3300002704 Bacteria 292156
2 JGI24740J21852_10020775 3300001979 Bacteria 2284
3 JGI25156J39149_1000003 3300002705 Bacteria 305434
4 JGI25156J39149_1000837 3300002705 Bacteria 15529
5 JGI25156J39149_1008895 3300002705 Bacteria 2486
6 JGI25156J39149_1012858 3300002705 Bacteria 1813
7 JGI25154J39366_1000009 3300002738 Bacteria 305408
8 JGI25154J39366_1002448 3300002738 Bacteria 4797
9 JGI25158J39367_1001490 3300002739 Bacteria 4085
10 JGI25157J39369_1000002 3300002741 Bacteria 305434
11 JGI25157J39369_1000251 3300002741 Bacteria 40025
12 JGI25152J39213_1000738 3300002773 Bacteria 16742
13 JGI25152J39213_1006919 3300002773 Bacteria 2999
14 JGI25150J39212_1000868 3300002774 Bacteria 10033
15 JGI25150J39212_1004489 3300002774 Bacteria 3101
16 JGI25159J45721_1000417 3300002987 Bacteria 19666
17 JGI25159J45721_1001150 3300002987 Bacteria 11299
18 JGI25159J45721_1001933 3300002987 Bacteria 8263
19 JGI25159J45721_1008673 3300002987 Bacteria 2770
20 JGI25151J46595_10006428 3300003187 Bacteria 5909
21 JGI25151J46595_10007156 3300003187 Bacteria 5500
22 JGI25151J46595_10016665 3300003187 Bacteria 3206
23 rootH1_10009119 3300003316 Bacteria 6425
24 rootH2_10036890 3300003320 Bacteria 1933
25 rootL2_10023281 3300003322 Bacteria 3269
26 rootL2_10040743 3300003322 Bacteria 1927
27 JGI25160J50197_1000472 3300003354 Bacteria 24628
28 JGI25161J50226_1000032 3300003374 Bacteria 138440
29 JGI25161J50226_1000064 3300003374 Bacteria 99448
30 Ga0055533_1000028 3300003756 Bacteria 311012
31 Ga0055533_1000057 3300003756 Bacteria 194035
32 Ga0055525_1000522 3300003759 Bacteria 18499
33 Ga0055535_1000856 3300003761 Bacteria 21517
34 Ga0055535_1001176 3300003761 Bacteria 15121
35 Ga0055542_1000021 3300003762 Bacteria 331499
36 Ga0055529_1000331 3300003763 Bacteria 53202
37 Ga0055526_1001029 3300003771 Bacteria 20391
38 Ga0055526_1024152 3300003771 Bacteria 2001
39 Ga0055537_1000036 3300003773 Bacteria 96045
40 Ga0055537_1000221 3300003773 Bacteria 41984
41 Ga0055537_1000565 3300003773 Bacteria 20867
42 Ga0055537_1002864 3300003773 Bacteria 5526
43 Ga0055537_1010531 3300003773 Bacteria 1944
44 Ga0055524_1000012 3300003775 Bacteria 260384
45 Ga0055524_1000287 3300003775 Bacteria 48964
46 Ga0055524_1000554 3300003775 Bacteria 28221
47 Ga0055524_1013988 3300003775 Bacteria 2997
48 Ga0055536_1003447 3300003781 Bacteria 8482
49 Ga0055536_1003631 3300003781 Bacteria 8227
50 Ga0055536_1004360 3300003781 Bacteria 7268
51 Ga0055536_1010599 3300003781 Bacteria 3635
52 Ga0055536_1012824 3300003781 Bacteria 3076
53 Ga0055534_1000018 3300003784 Bacteria 138136
54 Ga0055534_1000220 3300003784 Bacteria 41988
55 Ga0055534_1001383 3300003784 Bacteria 9696
56 Ga0055534_1004361 3300003784 Bacteria 4125
57 Ga0055528_1000509 3300003790 Bacteria 30550
58 Ga0055528_1003825 3300003790 Bacteria 7407
59 Ga0055528_1007055 3300003790 Bacteria 5021
60 Ga0055530_10000218 3300003791 Bacteria 51314
61 Ga0055530_10000430 3300003791 Bacteria 37250
62 Ga0055530_10002887 3300003791 Bacteria 10467
63 Ga0055530_10003706 3300003791 Bacteria 8509
64 Ga0055530_10008617 3300003791 Bacteria 4048
65 Ga0055540_1000012 3300003792 Bacteria 262667
66 Ga0055540_1000016 3300003792 Bacteria 232942
67 Ga0055540_1000039 3300003792 Bacteria 161844
68 Ga0055540_1000062 3300003792 Bacteria 128474
69 Ga0055540_1000420 3300003792 Bacteria 33992
70 Ga0055540_1000492 3300003792 Bacteria 30076
71 Ga0055540_1002048 3300003792 Bacteria 11151
72 Ga0055540_1006044 3300003792 Bacteria 4903
73 Ga0055540_1008499 3300003792 Bacteria 3689
74 Ga0055531_10000309 3300003794 Bacteria 48285
75 Ga0055531_10000313 3300003794 Bacteria 47791
76 Ga0055531_10000542 3300003794 Bacteria 33438
77 Ga0055531_10002364 3300003794 Bacteria 12685
78 Ga0055531_10003057 3300003794 Bacteria 10840
79 Ga0055531_10009223 3300003794 Bacteria 5075
80 Ga0055531_10012926 3300003794 Bacteria 3888
81 Ga0055531_10014062 3300003794 Bacteria 3635
82 Ga0055531_10020585 3300003794 Bacteria 2602
83 Ga0055543_1003006 3300004625 Bacteria 5217
84 Ga0055543_1005865 3300004625 Bacteria 3067
85 Ga0055543_1005952 3300004625 Bacteria 3029
86 Ga0055543_1006341 3300004625 Bacteria 2870
87 Ga0055543_1008256 3300004625 Bacteria 2318
88 Ga0065165_1000354 3300005262 Bacteria 75337
89 Ga0065165_1000935 3300005262 Bacteria 37344
90 Ga0065165_1001664 3300005262 Bacteria 22493
91 Ga0065165_1014104 3300005262 Bacteria 3120
92 Ga0065165_1015749 3300005262 Bacteria 2870
93 Ga0065165_1027589 3300005262 Bacteria 1847
94 Ga0065165_1031101 3300005262 Bacteria 1691
95 Ga0065714_10074978 3300005288 Bacteria 2964
96 Ga0065704_10105517 3300005289 Bacteria 2109
97 Ga0065704_10108668 3300005289 Bacteria 2022
98 Ga0065704_10126163 3300005289 Bacteria 1693
99 Ga0065712_10077432 3300005290 Bacteria 3482
100 Ga0065715_10025844 3300005293 Bacteria 1564
101 Ga0065715_10122914 3300005293 Bacteria 2192
102 Ga0065715_10207777 3300005293 Bacteria 1329
103 Ga0065707_10086952 3300005295 Bacteria 5233
104 Ga0070658_10088236 3300005327 Bacteria 2554
105 Ga0070658_10169512 3300005327 Bacteria 1834
106 Ga0070676_10000305 3300005328 Bacteria 22094
107 Ga0070676_10001353 3300005328 Bacteria 12331
108 Ga0070676_10001456 3300005328 Bacteria 11960
109 Ga0070676_10012035 3300005328 Bacteria 4715
110 Ga0070676_10021974 3300005328 Bacteria 3575
111 Ga0070683_100007952 3300005329 Bacteria 8995
112 Ga0070683_100297331 3300005329 Bacteria 1536
113 Ga0070690_100005973 3300005330 Bacteria 6875
114 Ga0070690_100010484 3300005330 Bacteria 5396
115 Ga0070690_100037982 3300005330 Bacteria 3036
116 Ga0070670_100012432 3300005331 Bacteria 7286
117 Ga0070670_100017269 3300005331 Bacteria 6189
118 Ga0070670_100025196 3300005331 Bacteria 5119
119 Ga0070670_100040203 3300005331 Bacteria 4022
120 Ga0070670_100075565 3300005331 Bacteria 2894
121 Ga0070670_100222624 3300005331 Bacteria 1642
122 Ga0070677_10004130 3300005333 Bacteria 4715
123 Ga0068869_100041163 3300005334 Bacteria 3307
124 Ga0068869_100045673 3300005334 Bacteria 3155
125 Ga0068869_100126844 3300005334 Bacteria 1958
126 Ga0070666_10007102 3300005335 Bacteria 6905
127 Ga0070666_10042863 3300005335 Bacteria 3028
128 Ga0070666_10145344 3300005335 Bacteria 1653
129 Ga0070680_100002531 3300005336 Bacteria 13546
130 Ga0070682_100098288 3300005337 Bacteria 1928
131 Ga0070682_100145677 3300005337 Bacteria 1619
132 Ga0068868_100003758 3300005338 Bacteria 10601
133 Ga0068868_100007012 3300005338 Bacteria 8009
134 Ga0068868_100010416 3300005338 Bacteria 6731
135 Ga0068868_100024715 3300005338 Bacteria 4561
136 Ga0068868_100026439 3300005338 Bacteria 4423
137 Ga0068868_100079207 3300005338 Bacteria 2632
138 Ga0068868_100089432 3300005338 Bacteria 2479
139 Ga0068868_100135869 3300005338 Bacteria 2015
140 Ga0068868_100226829 3300005338 Bacteria 1566
141 Ga0070660_100017780 3300005339 Bacteria 5186
142 Ga0070660_100104942 3300005339 Bacteria 2242
143 Ga0070660_100249041 3300005339 Bacteria 1448
144 Ga0070689_100005827 3300005340 Bacteria 8458
145 Ga0070687_100027806 3300005343 Bacteria 2736
146 Ga0070687_100051223 3300005343 Bacteria 2136
147 Ga0070661_100002137 3300005344 Bacteria 13617
148 Ga0070661_100004541 3300005344 Bacteria 9553
149 Ga0070661_100027419 3300005344 Bacteria 4101
150 Ga0070661_100225554 3300005344 Bacteria 1438
151 Ga0070668_100000930 3300005347 Bacteria 20445
152 Ga0070668_100002014 3300005347 Bacteria 14861
153 Ga0070668_100014358 3300005347 Bacteria 5918
154 Ga0070668_100129226 3300005347 Bacteria 2026
155 Ga0070669_100003934 3300005353 Bacteria 10748
156 Ga0070669_100008074 3300005353 Bacteria 7520
157 Ga0070669_100059655 3300005353 Bacteria 2802
158 Ga0070669_100197831 3300005353 Bacteria 1580
159 Ga0070675_100000703 3300005354 Bacteria 23209
160 Ga0070675_100002563 3300005354 Bacteria 13606
161 Ga0070675_100005844 3300005354 Bacteria 9423
162 Ga0070675_100008566 3300005354 Bacteria 7941
163 Ga0070675_100012697 3300005354 Bacteria 6607
164 Ga0070675_100018066 3300005354 Bacteria 5612
165 Ga0070675_100136272 3300005354 Bacteria 2095
166 Ga0070675_100155626 3300005354 Bacteria 1962
167 Ga0070671_100005574 3300005355 Bacteria 10029
168 Ga0070671_100018775 3300005355 Bacteria 5620
169 Ga0070671_100034852 3300005355 Bacteria 4168
170 Ga0070671_100047811 3300005355 Bacteria 3556
171 Ga0070671_100074851 3300005355 Bacteria 2829
172 Ga0070674_100000518 3300005356 Bacteria 19349
173 Ga0070674_100002778 3300005356 Bacteria 9676
174 Ga0070674_100002952 3300005356 Bacteria 9433
175 Ga0070674_100003318 3300005356 Bacteria 9011
176 Ga0070674_100004623 3300005356 Bacteria 7864
177 Ga0070674_100025030 3300005356 Bacteria 3879
178 Ga0070674_100039485 3300005356 Bacteria 3188
179 Ga0070674_100058684 3300005356 Bacteria 2676
180 Ga0070674_100069552 3300005356 Bacteria 2484
181 Ga0070673_100002198 3300005364 Bacteria 11789
182 Ga0070673_100002713 3300005364 Bacteria 10854
183 Ga0070673_100006984 3300005364 Bacteria 7395
184 Ga0070673_100014798 3300005364 Bacteria 5454
185 Ga0070673_100017830 3300005364 Bacteria 5058
186 Ga0070673_100141075 3300005364 Bacteria 2032
187 Ga0070673_100163511 3300005364 Bacteria 1895
188 Ga0070673_100211707 3300005364 Bacteria 1674
189 Ga0070673_100216577 3300005364 Bacteria 1655
190 Ga0070688_100077724 3300005365 Bacteria 2139
191 Ga0070659_100000178 3300005366 Bacteria 48934
192 Ga0070659_100013767 3300005366 Bacteria 6031
193 Ga0070659_100036994 3300005366 Bacteria 3804
194 Ga0070659_100090482 3300005366 Bacteria 2452
195 Ga0070667_100000887 3300005367 Bacteria 27641
196 Ga0070667_100001423 3300005367 Bacteria 21447
197 Ga0070667_100022085 3300005367 Bacteria 5278
198 Ga0070667_100166632 3300005367 Bacteria 1943
199 Ga0070667_100255817 3300005367 Bacteria 1567
200 Ga0070700_100011768 3300005441 Bacteria 4856
201 Ga0070700_100060568 3300005441 Bacteria 2386
202 Ga0070663_100067903 3300005455 Bacteria 2587
203 Ga0070663_100123499 3300005455 Bacteria 1958
204 Ga0070678_100000683 3300005456 Bacteria 16725
205 Ga0070678_100027992 3300005456 Bacteria 3836
206 Ga0070678_100093366 3300005456 Bacteria 2314
207 Ga0070678_100140093 3300005456 Bacteria 1934
208 Ga0070678_100160270 3300005456 Bacteria 1822
209 Ga0070678_100160965 3300005456 Bacteria 1818
210 Ga0070678_100183807 3300005456 Bacteria 1713
211 Ga0070678_100227746 3300005456 Bacteria 1552
212 Ga0070662_100000646 3300005457 Bacteria 21061
213 Ga0070662_100010127 3300005457 Bacteria 6177
214 Ga0070662_100019033 3300005457 Bacteria 4655
215 Ga0070662_100090650 3300005457 Bacteria 2295
216 Ga0070681_10303528 3300005458 Bacteria 1506
217 Ga0068867_100000234 3300005459 Bacteria 36383
218 Ga0068867_100001306 3300005459 Bacteria 17230
219 Ga0068867_100004484 3300005459 Bacteria 9810
220 Ga0068867_100006316 3300005459 Bacteria 8384
221 Ga0068867_100006419 3300005459 Bacteria 8306
222 Ga0068867_100006718 3300005459 Bacteria 8133
223 Ga0068867_100006852 3300005459 Bacteria 8058
224 Ga0068867_100010351 3300005459 Bacteria 6580
225 Ga0068867_100014751 3300005459 Bacteria 5538
226 Ga0068867_100079902 3300005459 Bacteria 2462
227 Ga0070685_10116931 3300005466 Bacteria 1651
228 Ga0070706_100006474 3300005467 Bacteria 11054
229 Ga0070707_100266424 3300005468 Bacteria 1666
230 Ga0070699_100104211 3300005518 Bacteria 2488
231 Ga0070679_100060332 3300005530 Bacteria 3780
232 Ga0070679_100076637 3300005530 Bacteria 3333
233 Ga0070679_100152598 3300005530 Bacteria 2286
234 Ga0070684_100002660 3300005535 Bacteria 13192
235 Ga0070684_100134427 3300005535 Bacteria 2233
236 Ga0068853_100035486 3300005539 Bacteria 4236
237 Ga0068853_100046733 3300005539 Bacteria 3713
238 Ga0068853_100087126 3300005539 Bacteria 2739
239 Ga0068853_100259887 3300005539 Bacteria 1596
240 Ga0070672_100000150 3300005543 Bacteria 38126
241 Ga0070672_100000188 3300005543 Bacteria 34174
242 Ga0070672_100003178 3300005543 Bacteria 10627
243 Ga0070672_100029365 3300005543 Bacteria 4122
244 Ga0070672_100061568 3300005543 Bacteria 2959
245 Ga0070672_100090311 3300005543 Bacteria 2470
246 Ga0070672_100098835 3300005543 Bacteria 2364
247 Ga0070672_100204136 3300005543 Bacteria 1653
248 Ga0070665_100235466 3300005548 Bacteria 1831
249 Ga0068855_100008323 3300005563 Bacteria 12537
250 Ga0068855_100017415 3300005563 Bacteria 8643
251 Ga0068855_100231884 3300005563 Bacteria 2067
252 Ga0068855_100276875 3300005563 Bacteria 1865
253 Ga0068855_100277889 3300005563 Bacteria 1860
254 Ga0070664_100034043 3300005564 Bacteria 4272
255 Ga0070664_100064440 3300005564 Bacteria 3125
256 Ga0068857_100000422 3300005577 Bacteria 29970
257 Ga0068857_100025951 3300005577 Bacteria 5161
258 Ga0068857_100033075 3300005577 Bacteria 4572
259 Ga0068857_100137230 3300005577 Bacteria 2209
260 Ga0068854_100001586 3300005578 Bacteria 13835
261 Ga0068854_100072293 3300005578 Bacteria 2525
262 Ga0068854_100137384 3300005578 Bacteria 1872
263 Ga0068856_100004817 3300005614 Bacteria 13375
264 Ga0068856_100050218 3300005614 Bacteria 4112
265 Ga0068856_100105028 3300005614 Bacteria 2819
266 Ga0068852_100003415 3300005616 Bacteria 11092
267 Ga0068852_100040628 3300005616 Bacteria 3926
268 Ga0068852_100041540 3300005616 Bacteria 3887
269 Ga0068852_100111142 3300005616 Bacteria 2491
270 Ga0068852_100180723 3300005616 Bacteria 1983
271 Ga0068852_100185549 3300005616 Bacteria 1959
272 Ga0068859_100003146 3300005617 Bacteria 16781
273 Ga0068859_100030836 3300005617 Bacteria 5381
274 Ga0068859_100090165 3300005617 Bacteria 3117
275 Ga0068859_100148499 3300005617 Bacteria 2419
276 Ga0068859_100154049 3300005617 Bacteria 2375
277 Ga0068864_100001395 3300005618 Bacteria 20021
278 Ga0068864_100006994 3300005618 Bacteria 9256
279 Ga0068864_100012986 3300005618 Bacteria 6893
280 Ga0068864_100031021 3300005618 Bacteria 4533
281 Ga0068864_100094537 3300005618 Bacteria 2642
282 Ga0068866_10027755 3300005718 Bacteria 2690
283 Ga0068861_100000357 3300005719 Bacteria 26082
284 Ga0068861_100005099 3300005719 Bacteria 8855
285 Ga0068861_100024110 3300005719 Bacteria 4396
286 Ga0068861_100026409 3300005719 Bacteria 4221
287 Ga0068861_100148574 3300005719 Bacteria 1920
288 Ga0068851_10061466 3300005834 Bacteria 1925
289 Ga0068851_10066642 3300005834 Bacteria 1856
290 Ga0068851_10090274 3300005834 Bacteria 1612
291 Ga0068851_10103958 3300005834 Bacteria 1509
292 Ga0068870_10025973 3300005840 Bacteria 2913
293 Ga0068863_100004937 3300005841 Bacteria 13152
294 Ga0068863_100006024 3300005841 Bacteria 11893
295 Ga0068863_100045223 3300005841 Bacteria 4178
296 Ga0068863_100077904 3300005841 Bacteria 3137
297 Ga0068863_100163097 3300005841 Bacteria 2136
298 Ga0068863_100171074 3300005841 Bacteria 2084
299 Ga0068863_100192095 3300005841 Bacteria 1962
300 Ga0068858_100001070 3300005842 Bacteria 28311
301 Ga0068858_100005932 3300005842 Bacteria 11927
302 Ga0068858_100006988 3300005842 Bacteria 10963
303 Ga0068860_100001404 3300005843 Bacteria 26110
304 Ga0068860_100001441 3300005843 Bacteria 25753
305 Ga0068860_100003633 3300005843 Bacteria 15860
306 Ga0068860_100018213 3300005843 Bacteria 6835
307 Ga0068860_100056492 3300005843 Bacteria 3731
308 Ga0068860_100069015 3300005843 Bacteria 3359
309 Ga0068862_100008643 3300005844 Bacteria 8424
310 Ga0068862_100012198 3300005844 Bacteria 7103
311 Ga0068862_100014297 3300005844 Bacteria 6585
312 Ga0068862_100089917 3300005844 Bacteria 2673
313 Ga0075365_10000234 3300006038 Bacteria 18998
314 Ga0075365_10013483 3300006038 Bacteria 4892
315 Ga0075365_10017690 3300006038 Bacteria 4368
316 Ga0075365_10040013 3300006038 Bacteria 3055
317 Ga0075364_10081580 3300006051 Bacteria 2139
318 Ga0075432_10015726 3300006058 Bacteria 2582
319 Ga0075362_10013909 3300006177 Bacteria 3234
320 Ga0075362_10019047 3300006177 Bacteria 2849
321 Ga0075362_10025386 3300006177 Bacteria 2522
322 Ga0075362_10025904 3300006177 Bacteria 2501
323 Ga0075362_10051494 3300006177 Bacteria 1843
324 Ga0075367_10023649 3300006178 Bacteria 3459
325 Ga0075367_10046511 3300006178 Bacteria 2550
326 Ga0075367_10062297 3300006178 Bacteria 2227
327 Ga0075367_10138911 3300006178 Bacteria 1505
328 Ga0075369_10001213 3300006186 Bacteria 8746
329 Ga0075369_10048776 3300006186 Bacteria 1828
330 Ga0075369_10052095 3300006186 Bacteria 1774
331 Ga0075366_10003302 3300006195 Bacteria 8485
332 Ga0075366_10005390 3300006195 Bacteria 6930
333 Ga0075366_10011482 3300006195 Bacteria 5003
334 Ga0075366_10044896 3300006195 Bacteria 2619
335 Ga0075366_10050413 3300006195 Bacteria 2471
336 Ga0075366_10058716 3300006195 Bacteria 2285
337 Ga0075366_10088581 3300006195 Bacteria 1853
338 Ga0075366_10097862 3300006195 Bacteria 1760
339 Ga0097621_100040696 3300006237 Bacteria 3738
340 Ga0097621_100048451 3300006237 Bacteria 3447
341 Ga0097621_100060446 3300006237 Bacteria 3106
342 Ga0097621_100061415 3300006237 Bacteria 3082
343 Ga0097621_100151552 3300006237 Bacteria 1988
344 Ga0075370_10000246 3300006353 Bacteria 19428
345 Ga0075370_10001169 3300006353 Bacteria 11034
346 Ga0075370_10003627 3300006353 Bacteria 7385
347 Ga0075370_10003633 3300006353 Bacteria 7381
348 Ga0075370_10006991 3300006353 Bacteria 5720
349 Ga0075370_10008378 3300006353 Bacteria 5319
350 Ga0075370_10017146 3300006353 Bacteria 3909
351 Ga0075370_10028091 3300006353 Bacteria 3125
352 Ga0075370_10028308 3300006353 Bacteria 3114
353 Ga0075370_10031633 3300006353 Bacteria 2954
354 Ga0075370_10037655 3300006353 Bacteria 2720
355 Ga0075370_10043263 3300006353 Bacteria 2545
356 Ga0075370_10052826 3300006353 Bacteria 2306
357 Ga0075370_10059175 3300006353 Bacteria 2180
358 Ga0068871_100014788 3300006358 Bacteria 5827
359 Ga0068871_100026057 3300006358 Bacteria 4558
360 Ga0068871_100051277 3300006358 Bacteria 3341
361 Ga0068871_100073545 3300006358 Bacteria 2818
362 Ga0068871_100129646 3300006358 Bacteria 2137
363 Ga0075429_100095617 3300006880 Bacteria 2591
364 Ga0068865_100002164 3300006881 Bacteria 11577
365 Ga0068865_100004824 3300006881 Bacteria 8148
366 Ga0068865_100005297 3300006881 Bacteria 7806
367 Ga0068865_100025563 3300006881 Bacteria 3885
368 Ga0068865_100195010 3300006881 Bacteria 1569
369 Ga0097620_100003146 3300006931 Bacteria 16781
370 Ga0097620_100030836 3300006931 Bacteria 5381
371 Ga0097620_100090164 3300006931 Bacteria 3117
372 Ga0097620_100148494 3300006931 Bacteria 2419
373 Ga0097620_100154058 3300006931 Bacteria 2375
374 Ga0099823_1007351 3300006944 Bacteria 11174
375 Ga0079104_1000011 3300006946 Bacteria 359962
376 Ga0079104_1000019 3300006946 Bacteria 269313
377 Ga0099826_10000096 3300006948 Bacteria 41938
378 Ga0099826_10007062 3300006948 Bacteria 8243
379 Ga0105244_10003175 3300009036 Bacteria 11930
380 Ga0105244_10101048 3300009036 Bacteria 1410
381 Ga0105250_10017928 3300009092 Bacteria 2873
382 Ga0105240_10000951 3300009093 Bacteria 51613
383 Ga0105240_10001089 3300009093 Bacteria 47935
384 Ga0105245_10009930 3300009098 Bacteria 8293
385 Ga0105245_10071820 3300009098 Bacteria 3144
386 Ga0105245_10105118 3300009098 Bacteria 2618
387 Ga0114129_10134779 3300009147 Bacteria 3389
388 Ga0105243_10000400 3300009148 Bacteria 45768
389 Ga0105243_10001880 3300009148 Bacteria 17890
390 Ga0105243_10003082 3300009148 Bacteria 13722
391 Ga0105243_10015844 3300009148 Bacteria 5703
392 Ga0105243_10020381 3300009148 Bacteria 5028
393 Ga0105243_10247510 3300009148 Bacteria 1590
394 Ga0105243_10267990 3300009148 Bacteria 1532
395 Ga0105241_10043500 3300009174 Bacteria 3402
396 Ga0105242_10006688 3300009176 Bacteria 8899
397 Ga0105242_10028293 3300009176 Bacteria 4461
398 Ga0105242_10034606 3300009176 Bacteria 4050
399 Ga0105242_10035127 3300009176 Bacteria 4020
400 Ga0105242_10173431 3300009176 Bacteria 1897
401 Ga0105248_10014279 3300009177 Bacteria 8743
402 Ga0105248_10021294 3300009177 Bacteria 7185
403 Ga0105248_10107959 3300009177 Bacteria 3139
404 Ga0105248_10135771 3300009177 Bacteria 2775
405 Ga0105248_10173519 3300009177 Bacteria 2430
406 Ga0105248_10173966 3300009177 Bacteria 2427
407 Ga0105237_10003603 3300009545 Bacteria 18306
408 Ga0105237_10030715 3300009545 Bacteria 5454
409 Ga0105237_10057916 3300009545 Bacteria 3877
410 Ga0105238_10007548 3300009551 Bacteria 10891
411 Ga0105238_10007948 3300009551 Bacteria 10612
412 Ga0105238_10020812 3300009551 Bacteria 6681
413 Ga0105238_10112379 3300009551 Bacteria 2703
414 Ga0105249_10001498 3300009553 Bacteria 20478
415 Ga0105249_10004113 3300009553 Bacteria 12563
416 Ga0105249_10152584 3300009553 Bacteria 2225
417 Ga0105239_10005179 3300010375 Bacteria 15367
418 Ga0105239_10100070 3300010375 Bacteria 3206
419 Ga0105246_10024888 3300011119 Bacteria 3896
420 Ga0105246_10116819 3300011119 Bacteria 1970
421 Ga0157319_1000009 3300012497 Bacteria 227971
422 Ga0157373_10008552 3300013100 Bacteria 7603
423 Ga0157373_10012879 3300013100 Bacteria 6140
424 Ga0157373_10133603 3300013100 Bacteria 1744
425 Ga0157370_10000583 3300013104 Bacteria 45511
426 Ga0157370_10019170 3300013104 Bacteria 6874
427 Ga0157370_10129097 3300013104 Bacteria 2358
428 Ga0157369_10009941 3300013105 Bacteria 10868
429 Ga0157369_10021442 3300013105 Bacteria 7227
430 Ga0157369_10035074 3300013105 Bacteria 5502
431 Ga0157374_10016391 3300013296 Bacteria 6511
432 Ga0157374_10037469 3300013296 Bacteria 4451
433 Ga0157374_10102555 3300013296 Bacteria 2744
434 Ga0157374_10183801 3300013296 Bacteria 2043
435 Ga0157374_10204401 3300013296 Bacteria 1935
436 Ga0157378_10034311 3300013297 Bacteria 4487
437 Ga0163162_10011301 3300013306 Bacteria 8707
438 Ga0163162_10022647 3300013306 Bacteria 6193
439 Ga0163162_10029102 3300013306 Bacteria 5466
440 Ga0163162_10074236 3300013306 Bacteria 3459
441 Ga0163162_10075996 3300013306 Bacteria 3420
442 Ga0163162_10122944 3300013306 Bacteria 2700
443 Ga0163162_10308257 3300013306 Bacteria 1715
444 Ga0157372_10002878 3300013307 Bacteria 18606
445 Ga0157372_10026418 3300013307 Bacteria 6318
446 Ga0157372_10039703 3300013307 Bacteria 5196
447 Ga0157375_10003456 3300013308 Bacteria 13690
448 Ga0157375_10017862 3300013308 Bacteria 6416
449 Ga0157375_10036590 3300013308 Bacteria 4698
450 Ga0157375_10038720 3300013308 Bacteria 4580
451 Ga0157375_10042838 3300013308 Bacteria 4385
452 Ga0157375_10063319 3300013308 Bacteria 3679
453 Ga0157375_10335149 3300013308 Bacteria 1678
454 Ga0157375_10445857 3300013308 Bacteria 1460
455 Ga0163163_10005453 3300014325 Bacteria 10993
456 Ga0163163_10294718 3300014325 Bacteria 1674
457 Ga0157380_10002934 3300014326 Bacteria 11595
458 Ga0157380_10003080 3300014326 Bacteria 11367
459 Ga0157380_10023913 3300014326 Bacteria 4616
460 Ga0157380_10105348 3300014326 Bacteria 2357
461 Ga0182008_10000398 3300014497 Bacteria 33725
462 Ga0182008_10001698 3300014497 Bacteria 14453
463 Ga0182008_10007000 3300014497 Bacteria 6254
464 Ga0182008_10013166 3300014497 Bacteria 4350
465 Ga0182008_10015404 3300014497 Bacteria 3989
466 Ga0182008_10034149 3300014497 Bacteria 2550
467 Ga0182008_10042429 3300014497 Bacteria 2266
468 Ga0157377_10000014 3300014745 Bacteria 213961
469 Ga0157379_10007780 3300014968 Bacteria 9280
470 Ga0157379_10012988 3300014968 Bacteria 7288
471 Ga0157379_10017193 3300014968 Bacteria 6370
472 Ga0157379_10027948 3300014968 Bacteria 5019
473 Ga0157379_10030440 3300014968 Bacteria 4805
474 Ga0157379_10095832 3300014968 Bacteria 2663
475 Ga0157379_10275757 3300014968 Bacteria 1530
476 Ga0157376_10002109 3300014969 Bacteria 13382
477 Ga0157376_10018872 3300014969 Bacteria 5301
478 Ga0157376_10035383 3300014969 Bacteria 4040
479 Ga0157376_10097017 3300014969 Bacteria 2567
480 Ga0157376_10130519 3300014969 Bacteria 2241
481 Ga0157376_10279849 3300014969 Bacteria 1571
482 Ga0182006_1001743 3300015261 Bacteria 12616
483 Ga0182006_1014199 3300015261 Bacteria 3437
484 Ga0182006_1035107 3300015261 Bacteria 2001
485 Ga0182006_1039934 3300015261 Bacteria 1849
486 Ga0182007_10003330 3300015262 Bacteria 7604
487 Ga0182007_10029258 3300015262 Bacteria 1887
488 Ga0183362_10001 3300015683 Bacteria 2046624
489 Ga0163161_10000149 3300017792 Bacteria 64127
490 Ga0163161_10004629 3300017792 Bacteria 9576
491 Ga0163161_10007626 3300017792 Bacteria 7485
492 Ga0163161_10010900 3300017792 Bacteria 6303
493 Ga0163161_10013402 3300017792 Bacteria 5704
494 Ga0163161_10018680 3300017792 Bacteria 4860
495 Ga0163161_10028738 3300017792 Bacteria 3950
496 Ga0163161_10046965 3300017792 Bacteria 3117
497 Ga0163161_10064859 3300017792 Bacteria 2665
498 Ga0163161_10087430 3300017792 Bacteria 2302
499 Ga0213872_10001558 3300021361 Bacteria 14675
500 Ga0213872_10024989 3300021361 Bacteria 2747
501 Ga0213872_10041667 3300021361 Bacteria 2095
502 Ga0213876_10028678 3300021384 Bacteria 2935
503 Ga0209435_100001 3300025206 Bacteria 1424171
504 Ga0209436_108179 3300025208 Bacteria 2107
505 Ga0209674_100007 3300025226 Bacteria 1077082
506 Ga0209672_100751 3300025228 Bacteria 15798
507 Ga0209672_103873 3300025228 Bacteria 2944
508 Ga0209147_102627 3300025229 Bacteria 4230
509 Ga0209563_100033 3300025230 Bacteria 457883
510 Ga0209563_103671 3300025230 Bacteria 3118
511 Ga0207427_101232 3300025231 Bacteria 9812
512 Ga0209258_100058 3300025242 Bacteria 331567
513 Ga0209258_100353 3300025242 Bacteria 63996
514 Ga0207425_1000218 3300025245 Bacteria 45206
515 Ga0207425_1001283 3300025245 Bacteria 10899
516 Ga0207425_1002538 3300025245 Bacteria 6365
517 Ga0207425_1006474 3300025245 Bacteria 3201
518 Ga0207425_1012416 3300025245 Bacteria 1999
519 Ga0207425_1015207 3300025245 Bacteria 1732
520 Ga0209646_1000001 3300025246 Bacteria 3092932
521 Ga0209646_1000053 3300025246 Bacteria 284737
522 Ga0209026_1000003 3300025250 Bacteria 1060571
523 Ga0209026_1000020 3300025250 Bacteria 376211
524 Ga0209026_1002653 3300025250 Bacteria 6505
525 Ga0209677_100132 3300025253 Bacteria 72060
526 Ga0209677_100161 3300025253 Bacteria 59768
527 Ga0209677_103481 3300025253 Bacteria 5069
528 Ga0209148_1000071 3300025254 Bacteria 331551
529 Ga0209148_1003552 3300025254 Bacteria 4233
530 Ga0209759_1000001 3300025256 Bacteria 2799452
531 Ga0209759_1000017 3300025256 Bacteria 376232
532 Ga0209759_1000913 3300025256 Bacteria 21908
533 Ga0209759_1001199 3300025256 Bacteria 16128
534 Ga0209759_1002284 3300025256 Bacteria 8656
535 Ga0209129_1000023 3300025258 Bacteria 420646
536 Ga0209129_1000041 3300025258 Bacteria 307590
537 Ga0209129_1001863 3300025258 Bacteria 11142
538 Ga0209129_1007583 3300025258 Bacteria 3196
539 Ga0209129_1008749 3300025258 Bacteria 2767
540 Ga0209565_1000004 3300025263 Bacteria 983150
541 Ga0209565_1000075 3300025263 Bacteria 162259
542 Ga0209565_1000327 3300025263 Bacteria 42380
543 Ga0209565_1000609 3300025263 Bacteria 23714
544 Ga0209565_1000693 3300025263 Bacteria 20872
545 Ga0209565_1003001 3300025263 Bacteria 5719
546 Ga0209455_1000136 3300025272 Bacteria 146375
547 Ga0209673_1000066 3300025273 Bacteria 250037
548 Ga0209673_1000289 3300025273 Bacteria 93941
549 Ga0209673_1000357 3300025273 Bacteria 82249
550 Ga0209673_1000362 3300025273 Bacteria 81651
551 Ga0209673_1000798 3300025273 Bacteria 41767
552 Ga0209673_1006734 3300025273 Bacteria 5472
553 Ga0209673_1009202 3300025273 Bacteria 4307
554 Ga0209673_1009683 3300025273 Bacteria 4141
555 Ga0209673_1017231 3300025273 Bacteria 2668
556 Ga0209673_1019046 3300025273 Bacteria 2476
557 Ga0209130_1000069 3300025284 Bacteria 179177
558 Ga0209130_1000082 3300025284 Bacteria 164441
559 Ga0209130_1000094 3300025284 Bacteria 145569
560 Ga0209130_1002257 3300025284 Bacteria 9954
561 Ga0209130_1003786 3300025284 Bacteria 6155
562 Ga0209675_1000061 3300025291 Bacteria 181096
563 Ga0209675_1000074 3300025291 Bacteria 162260
564 Ga0209675_1000177 3300025291 Bacteria 73574
565 Ga0209675_1000325 3300025291 Bacteria 42380
566 Ga0209675_1001059 3300025291 Bacteria 17058
567 Ga0209675_1001796 3300025291 Bacteria 11724
568 Ga0209675_1004674 3300025291 Bacteria 6008
569 Ga0209675_1005211 3300025291 Bacteria 5510
570 Ga0209675_1012304 3300025291 Bacteria 2769
571 Ga0209676_1000005 3300025292 Bacteria 1076001
572 Ga0209676_1000029 3300025292 Bacteria 520536
573 Ga0209676_1000105 3300025292 Bacteria 224151
574 Ga0209676_1000142 3300025292 Bacteria 175752
575 Ga0209676_1000186 3300025292 Bacteria 142440
576 Ga0209676_1003917 3300025292 Bacteria 8635
577 Ga0209676_1017519 3300025292 Bacteria 2532
578 Ga0209025_1000351 3300025294 Bacteria 99585
579 Ga0209025_1000579 3300025294 Bacteria 66370
580 Ga0209025_1000644 3300025294 Bacteria 61330
581 Ga0209025_1005852 3300025294 Bacteria 9833
582 Ga0209025_1010713 3300025294 Bacteria 6167
583 Ga0209025_1022914 3300025294 Bacteria 3290
584 Ga0209025_1027340 3300025294 Bacteria 2831
585 Ga0209564_1000003 3300025295 Bacteria 1585848
586 Ga0209564_1000029 3300025295 Bacteria 505995
587 Ga0209564_1000090 3300025295 Bacteria 249298
588 Ga0209564_1000527 3300025295 Bacteria 62263
589 Ga0209564_1005458 3300025295 Bacteria 7254
590 Ga0209564_1005474 3300025295 Bacteria 7234
591 Ga0209564_1009963 3300025295 Bacteria 4441
592 Ga0209564_1022209 3300025295 Bacteria 2251
593 Ga0209758_1000043 3300025297 Bacteria 402310
594 Ga0209758_1000044 3300025297 Bacteria 398448
595 Ga0209758_1000057 3300025297 Bacteria 333111
596 Ga0209758_1020115 3300025297 Bacteria 3177
597 Ga0209758_1041408 3300025297 Bacteria 1722
598 Ga0209050_1000003 3300025298 Bacteria 1609245
599 Ga0209050_1000007 3300025298 Bacteria 1187891
600 Ga0209050_1000082 3300025298 Bacteria 266864
601 Ga0209050_1000149 3300025298 Bacteria 163252
602 Ga0209050_1000569 3300025298 Bacteria 59887
603 Ga0209050_1001141 3300025298 Bacteria 31960
604 Ga0209050_1001330 3300025298 Bacteria 27524
605 Ga0209050_1004588 3300025298 Bacteria 9259
606 Ga0209050_1005248 3300025298 Bacteria 8259
607 Ga0209050_1006884 3300025298 Bacteria 6593
608 Ga0209256_1000001 3300025299 Bacteria 2166974
609 Ga0209256_1000020 3300025299 Bacteria 542402
610 Ga0209256_1000022 3300025299 Bacteria 481843
611 Ga0209256_1000024 3300025299 Bacteria 448909
612 Ga0209256_1002170 3300025299 Bacteria 16860
613 Ga0209256_1002204 3300025299 Bacteria 16682
614 Ga0207426_1000001 3300025302 Bacteria 1341301
615 Ga0207426_1000025 3300025302 Bacteria 532921
616 Ga0207426_1000031 3300025302 Bacteria 460699
617 Ga0207426_1001168 3300025302 Bacteria 23518
618 Ga0209051_1000003 3300025303 Bacteria 1609245
619 Ga0209051_1000029 3300025303 Bacteria 403675
620 Ga0209051_1000036 3300025303 Bacteria 339863
621 Ga0209051_1000063 3300025303 Bacteria 249739
622 Ga0209051_1000064 3300025303 Bacteria 231735
623 Ga0209051_1000078 3300025303 Bacteria 201965
624 Ga0209051_1000213 3300025303 Bacteria 98755
625 Ga0209051_1000243 3300025303 Bacteria 91605
626 Ga0209051_1000455 3300025303 Bacteria 54195
627 Ga0209051_1001500 3300025303 Bacteria 19504
628 Ga0209051_1004021 3300025303 Bacteria 9305
629 Ga0209051_1006392 3300025303 Bacteria 6651
630 Ga0209051_1006879 3300025303 Bacteria 6318
631 Ga0209051_1008919 3300025303 Bacteria 5238
632 Ga0209257_1000011 3300025304 Bacteria 1112630
633 Ga0209257_1000012 3300025304 Bacteria 1111138
634 Ga0209257_1000018 3300025304 Bacteria 836016
635 Ga0209257_1000021 3300025304 Bacteria 771986
636 Ga0209257_1000030 3300025304 Bacteria 689812
637 Ga0209257_1000109 3300025304 Bacteria 239439
638 Ga0209257_1000118 3300025304 Bacteria 225963
639 Ga0209257_1000226 3300025304 Bacteria 133836
640 Ga0209257_1000980 3300025304 Bacteria 38745
641 Ga0209257_1002930 3300025304 Bacteria 15721
642 Ga0209257_1003485 3300025304 Bacteria 13420
643 Ga0209257_1018343 3300025304 Bacteria 2698
644 Ga0209257_1019700 3300025304 Bacteria 2527
645 Ga0207697_10006077 3300025315 Bacteria 5519
646 Ga0207697_10020917 3300025315 Bacteria 2679
647 Ga0207697_10023400 3300025315 Bacteria 2529
648 Ga0207697_10055501 3300025315 Bacteria 1642
649 Ga0207656_10003985 3300025321 Bacteria 5119
650 Ga0207656_10012705 3300025321 Bacteria 3206
651 Ga0207656_10013411 3300025321 Bacteria 3132
652 Ga0207656_10020257 3300025321 Bacteria 2642
653 Ga0207656_10025458 3300025321 Bacteria 2402
654 Ga0207696_1015363 3300025711 Bacteria 2598
655 Ga0207655_1026542 3300025728 Bacteria 2780
656 Ga0207682_10000759 3300025893 Bacteria 14883
657 Ga0207682_10013091 3300025893 Bacteria 3233
658 Ga0207642_10029763 3300025899 Bacteria 2265
659 Ga0207680_10001601 3300025903 Bacteria 10703
660 Ga0207645_10003471 3300025907 Bacteria 11944
661 Ga0207645_10004926 3300025907 Bacteria 9791
662 Ga0207645_10011577 3300025907 Bacteria 6015
663 Ga0207645_10012714 3300025907 Bacteria 5707
664 Ga0207645_10018093 3300025907 Bacteria 4644
665 Ga0207645_10028617 3300025907 Bacteria 3597
666 Ga0207643_10012919 3300025908 Bacteria 4516
667 Ga0207705_10123016 3300025909 Bacteria 1927
668 Ga0207684_10011095 3300025910 Bacteria 7887
669 Ga0207654_10034398 3300025911 Bacteria 2815
670 Ga0207695_10002904 3300025913 Bacteria 24801
671 Ga0207695_10018222 3300025913 Bacteria 8125
672 Ga0207695_10155131 3300025913 Bacteria 2225
673 Ga0207671_10005965 3300025914 Bacteria 11041
674 Ga0207671_10103190 3300025914 Bacteria 2162
675 Ga0207662_10029873 3300025918 Bacteria 3160
676 Ga0207657_10035067 3300025919 Bacteria 4504
677 Ga0207657_10050686 3300025919 Bacteria 3611
678 Ga0207657_10056390 3300025919 Bacteria 3390
679 Ga0207657_10129827 3300025919 Bacteria 2066
680 Ga0207649_10009799 3300025920 Bacteria 5249
681 Ga0207649_10097267 3300025920 Bacteria 1941
682 Ga0207652_10015168 3300025921 Bacteria 6252
683 Ga0207652_10139706 3300025921 Bacteria 2165
684 Ga0207646_10157201 3300025922 Bacteria 2051
685 Ga0207681_10000899 3300025923 Bacteria 19447
686 Ga0207681_10010511 3300025923 Bacteria 5669
687 Ga0207694_10016398 3300025924 Bacteria 5594
688 Ga0207694_10034080 3300025924 Bacteria 3903
689 Ga0207694_10043051 3300025924 Bacteria 3484
690 Ga0207694_10149216 3300025924 Bacteria 1883
691 Ga0207650_10000878 3300025925 Bacteria 22741
692 Ga0207650_10002442 3300025925 Bacteria 12942
693 Ga0207650_10014659 3300025925 Bacteria 5445
694 Ga0207650_10140005 3300025925 Bacteria 1901
695 Ga0207659_10000135 3300025926 Bacteria 43365
696 Ga0207659_10000207 3300025926 Bacteria 35338
697 Ga0207659_10001596 3300025926 Bacteria 13455
698 Ga0207659_10006224 3300025926 Bacteria 7300
699 Ga0207659_10032239 3300025926 Bacteria 3594
700 Ga0207659_10141460 3300025926 Bacteria 1868
701 Ga0207659_10259042 3300025926 Bacteria 1414
702 Ga0207687_10015611 3300025927 Bacteria 4982
703 Ga0207687_10098169 3300025927 Bacteria 2150
704 Ga0207644_10001220 3300025931 Bacteria 16541
705 Ga0207644_10001228 3300025931 Bacteria 16510
706 Ga0207644_10021457 3300025931 Bacteria 4400
707 Ga0207644_10041528 3300025931 Bacteria 3254
708 Ga0207644_10046621 3300025931 Bacteria 3089
709 Ga0207644_10244143 3300025931 Bacteria 1431
710 Ga0207690_10000359 3300025932 Bacteria 30319
711 Ga0207690_10039046 3300025932 Bacteria 3095
712 Ga0207690_10102670 3300025932 Bacteria 2045
713 Ga0207690_10224641 3300025932 Bacteria 1438
714 Ga0207706_10000654 3300025933 Bacteria 36592
715 Ga0207706_10002883 3300025933 Bacteria 16654
716 Ga0207706_10002944 3300025933 Bacteria 16449
717 Ga0207706_10017782 3300025933 Bacteria 6403
718 Ga0207706_10073320 3300025933 Bacteria 3010
719 Ga0207706_10078450 3300025933 Bacteria 2904
720 Ga0207706_10200717 3300025933 Bacteria 1749
721 Ga0207686_10013697 3300025934 Bacteria 4493
722 Ga0207686_10025763 3300025934 Bacteria 3426
723 Ga0207686_10073882 3300025934 Bacteria 2201
724 Ga0207709_10000038 3300025935 Bacteria 266638
725 Ga0207709_10000147 3300025935 Bacteria 97401
726 Ga0207709_10000214 3300025935 Bacteria 74364
727 Ga0207709_10004723 3300025935 Bacteria 7828
728 Ga0207709_10009501 3300025935 Bacteria 5351
729 Ga0207709_10020370 3300025935 Bacteria 3741
730 Ga0207709_10032522 3300025935 Bacteria 3055
731 Ga0207670_10039836 3300025936 Bacteria 3080
732 Ga0207669_10001219 3300025937 Bacteria 10928
733 Ga0207669_10001590 3300025937 Bacteria 9667
734 Ga0207669_10004703 3300025937 Bacteria 6041
735 Ga0207669_10006838 3300025937 Bacteria 5244
736 Ga0207669_10009417 3300025937 Bacteria 4650
737 Ga0207669_10013232 3300025937 Bacteria 4090
738 Ga0207669_10021720 3300025937 Bacteria 3394
739 Ga0207669_10052263 3300025937 Bacteria 2453
740 Ga0207704_10002775 3300025938 Bacteria 7905
741 Ga0207704_10005625 3300025938 Bacteria 5785
742 Ga0207704_10029924 3300025938 Bacteria 3046
743 Ga0207691_10001187 3300025940 Bacteria 25907
744 Ga0207691_10001712 3300025940 Bacteria 21616
745 Ga0207691_10039447 3300025940 Bacteria 4369
746 Ga0207691_10133271 3300025940 Bacteria 2193
747 Ga0207691_10150673 3300025940 Bacteria 2045
748 Ga0207711_10004508 3300025941 Bacteria 11863
749 Ga0207711_10045951 3300025941 Bacteria 3731
750 Ga0207711_10048324 3300025941 Bacteria 3640
751 Ga0207711_10120738 3300025941 Bacteria 2339
752 Ga0207711_10144084 3300025941 Bacteria 2145
753 Ga0207689_10005835 3300025942 Bacteria 10916
754 Ga0207689_10006945 3300025942 Bacteria 9952
755 Ga0207689_10023078 3300025942 Bacteria 5225
756 Ga0207689_10101824 3300025942 Bacteria 2359
757 Ga0207689_10153379 3300025942 Bacteria 1899
758 Ga0207661_10012975 3300025944 Bacteria 6080
759 Ga0207679_10000220 3300025945 Bacteria 45059
760 Ga0207679_10003707 3300025945 Bacteria 9470
761 Ga0207679_10017872 3300025945 Bacteria 4741
762 Ga0207679_10072079 3300025945 Bacteria 2608
763 Ga0207667_10025000 3300025949 Bacteria 6547
764 Ga0207667_10054838 3300025949 Bacteria 4192
765 Ga0207667_10103527 3300025949 Bacteria 2936
766 Ga0207651_10000798 3300025960 Bacteria 13560
767 Ga0207651_10002450 3300025960 Bacteria 8878
768 Ga0207651_10013478 3300025960 Bacteria 4680
769 Ga0207651_10018259 3300025960 Bacteria 4168
770 Ga0207651_10047090 3300025960 Bacteria 2904
771 Ga0207651_10047832 3300025960 Bacteria 2887
772 Ga0207651_10055284 3300025960 Bacteria 2725
773 Ga0207651_10110123 3300025960 Bacteria 2065
774 Ga0207712_10000828 3300025961 Bacteria 22710
775 Ga0207668_10001541 3300025972 Bacteria 13480
776 Ga0207668_10014399 3300025972 Bacteria 4894
777 Ga0207668_10025183 3300025972 Bacteria 3848
778 Ga0207668_10117088 3300025972 Bacteria 2010
779 Ga0207668_10183343 3300025972 Bacteria 1653
780 Ga0207640_10006017 3300025981 Bacteria 6631
781 Ga0207640_10095449 3300025981 Bacteria 2071
782 Ga0207658_10000860 3300025986 Bacteria 25382
783 Ga0207658_10003454 3300025986 Bacteria 11183
784 Ga0207658_10005178 3300025986 Bacteria 8976
785 Ga0207658_10056497 3300025986 Bacteria 2913
786 Ga0207677_10005607 3300026023 Bacteria 6819
787 Ga0207677_10012083 3300026023 Bacteria 4948
788 Ga0207677_10014359 3300026023 Bacteria 4623
789 Ga0207677_10015442 3300026023 Bacteria 4492
790 Ga0207677_10026317 3300026023 Bacteria 3646
791 Ga0207677_10079217 3300026023 Bacteria 2349
792 Ga0207677_10153967 3300026023 Bacteria 1778
793 Ga0207703_10001624 3300026035 Bacteria 20249
794 Ga0207703_10002139 3300026035 Bacteria 17362
795 Ga0207703_10009455 3300026035 Bacteria 7654
796 Ga0207639_10039741 3300026041 Bacteria 3507
797 Ga0207678_10160314 3300026067 Bacteria 1921
798 Ga0207678_10199620 3300026067 Bacteria 1710
799 Ga0207708_10073767 3300026075 Bacteria 2616
800 Ga0207708_10075749 3300026075 Bacteria 2580
801 Ga0207702_10002918 3300026078 Bacteria 16003
802 Ga0207702_10011208 3300026078 Bacteria 7478
803 Ga0207702_10099543 3300026078 Bacteria 2563
804 Ga0207702_10240766 3300026078 Bacteria 1695
805 Ga0207641_10001135 3300026088 Bacteria 26751
806 Ga0207641_10005572 3300026088 Bacteria 10729
807 Ga0207641_10019756 3300026088 Bacteria 5530
808 Ga0207641_10020064 3300026088 Bacteria 5488
809 Ga0207641_10036047 3300026088 Bacteria 4127
810 Ga0207641_10052146 3300026088 Bacteria 3464
811 Ga0207641_10070520 3300026088 Bacteria 3003
812 Ga0207641_10218443 3300026088 Bacteria 1766
813 Ga0207641_10314327 3300026088 Bacteria 1483
814 Ga0207648_10000062 3300026089 Bacteria 99889
815 Ga0207648_10002388 3300026089 Bacteria 20214
816 Ga0207648_10004104 3300026089 Bacteria 15074
817 Ga0207648_10006529 3300026089 Bacteria 11575
818 Ga0207648_10007879 3300026089 Bacteria 10392
819 Ga0207648_10022340 3300026089 Bacteria 5684
820 Ga0207648_10076245 3300026089 Bacteria 2923
821 Ga0207648_10144260 3300026089 Bacteria 2100
822 Ga0207648_10148564 3300026089 Bacteria 2068
823 Ga0207648_10159701 3300026089 Bacteria 1991
824 Ga0207676_10001093 3300026095 Bacteria 20538
825 Ga0207676_10007428 3300026095 Bacteria 7772
826 Ga0207676_10026622 3300026095 Bacteria 4301
827 Ga0207676_10037688 3300026095 Bacteria 3686
828 Ga0207676_10108534 3300026095 Bacteria 2317
829 Ga0207674_10001725 3300026116 Bacteria 27953
830 Ga0207674_10015020 3300026116 Bacteria 8530
831 Ga0207674_10041759 3300026116 Bacteria 4741
832 Ga0207674_10052794 3300026116 Bacteria 4145
833 Ga0207674_10112297 3300026116 Bacteria 2699
834 Ga0207675_100000868 3300026118 Bacteria 30104
835 Ga0207675_100002203 3300026118 Bacteria 19364
836 Ga0207675_100004188 3300026118 Bacteria 13958
837 Ga0207675_100005109 3300026118 Bacteria 12629
838 Ga0207683_10001181 3300026121 Bacteria 23629
839 Ga0207683_10023663 3300026121 Bacteria 5284
840 Ga0207683_10044028 3300026121 Bacteria 3901
841 Ga0207683_10044881 3300026121 Bacteria 3864
842 Ga0207683_10046127 3300026121 Bacteria 3812
843 Ga0207683_10108741 3300026121 Bacteria 2481
844 Ga0207683_10164978 3300026121 Bacteria 2004
845 Ga0207683_10177045 3300026121 Bacteria 1933
846 Ga0207683_10181255 3300026121 Bacteria 1910
847 Ga0207698_10004390 3300026142 Bacteria 8592
848 Ga0207698_10012848 3300026142 Bacteria 5500
849 Ga0207698_10024454 3300026142 Bacteria 4239
850 Ga0207698_10051797 3300026142 Bacteria 3140
851 Ga0207698_10099612 3300026142 Bacteria 2404
852 Ga0207698_10134379 3300026142 Bacteria 2120
853 Ga0207698_10200427 3300026142 Bacteria 1787
854 Ga0207698_10273412 3300026142 Bacteria 1559
855 Ga0209281_1000005 3300027111 Bacteria 1242284
856 Ga0209281_1000149 3300027111 Bacteria 167880
857 Ga0209389_1010627 3300027296 Bacteria 8307
858 Ga0209984_1002311 3300027424 Bacteria 2126
859 Ga0209968_1000125 3300027526 Bacteria 13613
860 Ga0209970_1000690 3300027614 Bacteria 5862
861 Ga0209282_1000228 3300027666 Bacteria 29111
862 Ga0209282_1000864 3300027666 Bacteria 15661
863 Ga0209971_1007153 3300027682 Bacteria 2646
864 Ga0209966_1000014 3300027695 Bacteria 81913
865 Ga0209974_10001071 3300027876 Bacteria 9696
866 Ga0209974_10014591 3300027876 Bacteria 2612
867 Ga0268266_10072143 3300028379 Bacteria 2993
868 Ga0268265_10030110 3300028380 Bacteria 3905
869 Ga0268265_10042246 3300028380 Bacteria 3381
870 Ga0268265_10083622 3300028380 Bacteria 2528
871 Ga0268264_10001193 3300028381 Bacteria 25104
872 Ga0268264_10001745 3300028381 Bacteria 19956
873 Ga0268264_10023892 3300028381 Bacteria 4986
874 Ga0268264_10093386 3300028381 Bacteria 2599
875 Ga0268264_10116829 3300028381 Bacteria 2345
876 Ga0268264_10126132 3300028381 Bacteria 2262
877 Ga0265336_10000012 3300028666 Bacteria 261478
878 Ga0307517_10001025 3300028786 Bacteria 47474
879 Ga0307515_10000064 3300028794 Bacteria 245452
880 Ga0307515_10000137 3300028794 Bacteria 173516
881 Ga0307515_10000139 3300028794 Bacteria 173074
882 Ga0307515_10000187 3300028794 Bacteria 151904
883 Ga0307515_10000727 3300028794 Bacteria 75922
884 Ga0307515_10000998 3300028794 Bacteria 64720
885 Ga0307515_10001587 3300028794 Bacteria 50732
886 Ga0307515_10002977 3300028794 Bacteria 35954
887 Ga0307515_10007083 3300028794 Bacteria 22277
888 Ga0307515_10014464 3300028794 Bacteria 14626
889 Ga0307515_10021785 3300028794 Bacteria 11339
890 Ga0307515_10068465 3300028794 Bacteria 4876
891 Ga0307515_10110315 3300028794 Bacteria 3221
892 Ga0265324_10003636 3300029957 Bacteria 7236
893 Ga0307512_10049207 3300030522 Bacteria 3402
894 Ga0314311_1018086 3300030733 Bacteria 2224
895 Ga0316178_1128022 3300030735 Bacteria 6105
896 Ga0316180_1003872 3300030736 Bacteria 2649
897 Ga0316183_1046777 3300030742 Bacteria 3782
898 Ga0316181_1014423 3300030744 Bacteria 6558
899 Ga0265330_10000117 3300031235 Bacteria 63961
900 Ga0265332_10000002 3300031238 Bacteria 709510
901 Ga0265332_10000033 3300031238 Bacteria 153334
902 Ga0265332_10000125 3300031238 Bacteria 63932
903 Ga0265331_10001854 3300031250 Bacteria 14925
904 Ga0265327_10000309 3300031251 Bacteria 94387
905 Ga0265327_10000779 3300031251 Bacteria 49235
906 Ga0265327_10001589 3300031251 Bacteria 27701
907 Ga0265327_10011830 3300031251 Bacteria 5962
908 Ga0265316_10000833 3300031344 Bacteria 34174
909 Ga0307513_10000019 3300031456 Bacteria 231194
910 Ga0307513_10000051 3300031456 Bacteria 149733
911 Ga0307513_10002833 3300031456 Bacteria 23769
912 Ga0307513_10007462 3300031456 Bacteria 14170
913 Ga0307513_10008369 3300031456 Bacteria 13245
914 Ga0307513_10058693 3300031456 Bacteria 4087
915 Ga0307513_10310883 3300031456 Bacteria 1338
916 Ga0307509_10000092 3300031507 Bacteria 124019
917 Ga0307509_10003532 3300031507 Bacteria 23562
918 Ga0307509_10037154 3300031507 Bacteria 5325
919 Ga0307509_10038946 3300031507 Bacteria 5181
920 Ga0307509_10056231 3300031507 Bacteria 4177
921 Ga0307509_10095060 3300031507 Bacteria 3037
922 Ga0307509_10103755 3300031507 Bacteria 2870
923 Ga0307509_10146780 3300031507 Bacteria 2283
924 Ga0307408_100000008 3300031548 Bacteria 456355
925 Ga0307408_100000407 3300031548 Bacteria 38725
926 Ga0307408_100006921 3300031548 Bacteria 7505
927 Ga0307408_100025292 3300031548 Bacteria 4066
928 Ga0307408_100051504 3300031548 Bacteria 2965
929 Ga0307408_100071443 3300031548 Bacteria 2566
930 Ga0307408_100075069 3300031548 Bacteria 2511
931 Ga0307408_100119969 3300031548 Bacteria 2035
932 Ga0307408_100124722 3300031548 Bacteria 2000
933 Ga0307508_10000004 3300031616 Bacteria 287547
934 Ga0307508_10001570 3300031616 Bacteria 25499
935 Ga0307514_10003976 3300031649 Bacteria 13806
936 Ga0307514_10040375 3300031649 Bacteria 3679
937 Ga0307514_10040483 3300031649 Bacteria 3673
938 Ga0265314_10000012 3300031711 Bacteria 415184
939 Ga0265314_10147752 3300031711 Bacteria 1445
940 Ga0307516_10000109 3300031730 Bacteria 94762
941 Ga0307516_10003586 3300031730 Bacteria 19792
942 Ga0307516_10005086 3300031730 Bacteria 15898
943 Ga0307516_10007069 3300031730 Bacteria 12982
944 Ga0307516_10019753 3300031730 Bacteria 6971
945 Ga0307516_10050860 3300031730 Bacteria 4063
946 Ga0307516_10172547 3300031730 Bacteria 1902
947 Ga0307516_10210361 3300031730 Bacteria 1660
948 Ga0307405_10062736 3300031731 Bacteria 2354
949 Ga0307405_10123767 3300031731 Bacteria 1774
950 Ga0307405_10154149 3300031731 Bacteria 1619
951 Ga0307405_10185738 3300031731 Bacteria 1496
952 Ga0307413_10145654 3300031824 Bacteria 1643
953 Ga0307410_10005512 3300031852 Bacteria 6707
954 Ga0307406_10000050 3300031901 Bacteria 66438
955 Ga0307406_10000440 3300031901 Bacteria 24253
956 Ga0307406_10003882 3300031901 Bacteria 8142
957 Ga0307406_10004637 3300031901 Bacteria 7485
958 Ga0307406_10071343 3300031901 Bacteria 2276
959 Ga0307412_10013847 3300031911 Bacteria 4741
960 Ga0307412_10029763 3300031911 Bacteria 3430
961 Ga0307412_10088191 3300031911 Bacteria 2163
962 Ga0307409_100004771 3300031995 Bacteria 7684
963 Ga0307409_100048315 3300031995 Bacteria 3237
964 Ga0307416_100003421 3300032002 Bacteria 9318
965 Ga0307416_100013163 3300032002 Bacteria 5613
966 Ga0307416_100073184 3300032002 Bacteria 2856
967 Ga0307414_10007644 3300032004 Bacteria 6084
968 Ga0307414_10023583 3300032004 Bacteria 3906
969 Ga0307414_10030258 3300032004 Bacteria 3534
970 Ga0307414_10092110 3300032004 Bacteria 2255
971 Ga0307414_10117542 3300032004 Bacteria 2037
972 Ga0307414_10129557 3300032004 Bacteria 1956
973 Ga0307411_10005288 3300032005 Bacteria 6322
974 Ga0307411_10014448 3300032005 Bacteria 4393
975 Ga0307411_10110231 3300032005 Bacteria 1967
976 Ga0307411_10113643 3300032005 Bacteria 1943
977 Ga0307411_10155332 3300032005 Bacteria 1706
978 Ga0307415_100007187 3300032126 Bacteria 6073
979 Ga0307507_10012966 3300033179 Bacteria 10205
980 Ga0307507_10048731 3300033179 Bacteria 4116
981 Ga0307510_10002759 3300033180 Bacteria 20117
982 Ga0373934_0006495 3300035086 Bacteria 4339
983 Ga0373932_0012678 3300035112 Bacteria 2080
984 Ga0373939_0000008 3300035114 Bacteria 77597
985 Ga0373957_0091396 3300035120 Bacteria 1210
986 Ga0373931_0000533 3300035691 Bacteria 15615
987 Ga0373931_0025052 3300035691 Bacteria 3029
988 Ga0373937_0025203 3300036401 Bacteria 5370
989 Ga0373925_0003362 3300037068 Bacteria 12410
990 Ga0373925_0147863 3300037068 Bacteria 1843
991 Ga0395899_0000992 3300037312 Bacteria 26097
992 Ga0395899_0013417 3300037312 Bacteria 6269
993 Ga0395899_0025496 3300037312 Bacteria 4463
994 Ga0395899_0027819 3300037312 Bacteria 4260
995 Ga0395900_0004787 3300037418 Bacteria 14263
996 Ga0395900_0020937 3300037418 Bacteria 6683
997 Ga0395900_0026497 3300037418 Bacteria 5936
998 Ga0395900_0029664 3300037418 Bacteria 5612
999 Ga0395900_0079616 3300037418 Bacteria 3367
1000 Ga0395898_0006328 3300037466 Bacteria 12651
1001 Ga0395898_0036706 3300037466 Bacteria 4865
1002 Ga0395898_0054593 3300037466 Bacteria 3898
1003 Ga0395905_0000148 3300037471 Bacteria 116301
1004 Ga0395905_0000382 3300037471 Bacteria 63066
1005 Ga0395905_0002029 3300037471 Bacteria 23136
1006 Ga0395905_0003923 3300037471 Bacteria 15650
1007 Ga0395905_0005758 3300037471 Bacteria 12595
1008 Ga0395905_0006766 3300037471 Bacteria 11482
1009 Ga0395905_0015358 3300037471 Bacteria 7278
1010 Ga0395905_0017190 3300037471 Bacteria 6870
1011 Ga0395905_0021027 3300037471 Bacteria 6179
1012 Ga0395905_0029796 3300037471 Bacteria 5143
1013 Ga0395905_0032872 3300037471 Bacteria 4876
1014 Ga0395905_0050244 3300037471 Bacteria 3907
1015 Ga0395905_0054783 3300037471 Bacteria 3732
1016 Ga0395905_0084413 3300037471 Bacteria 2975
1017 Ga0395905_0095056 3300037471 Bacteria 2796
1018 Ga0395901_0010348 3300038443 Bacteria 9448
1019 Ga0395901_0034728 3300038443 Bacteria 5208
1020 Ga0395901_0049039 3300038443 Bacteria 4386
1021 Ga0395901_0106293 3300038443 Bacteria 2946
1022 Ga0395901_0150472 3300038443 Bacteria 2446
1023 Ga0395901_0327295 3300038443 Bacteria 1585
1024 Ga0436365_0538258 3300039437 Bacteria 1412
1025 Ga0436361_0026531 3300039447 Bacteria 11861
1026 Ga0436361_0258710 3300039447 Bacteria 1489
1027 Ga0436361_0572364 3300039447 Bacteria 7145
1028 Ga0436361_0848510 3300039447 Bacteria 27411
1029 Ga0436363_0660497 3300039450 Bacteria 10660
1030 Ga0439436_0016367 3300041404 Bacteria 2225
1031 Ga0439439_0011910 3300041406 Bacteria 2097
1032 Ga0439447_025116 3300041407 Bacteria 1537
1033 Ga0439466_0015578 3300041411 Bacteria 2761
1034 Ga0451789_0102886 3300041443 Bacteria 3368
1035 Ga0451789_0982253 3300041443 Bacteria 2279
1036 Ga0451798_0381267 3300041458 Bacteria 3331
1037 Ga0451802_1471416 3300041460 Bacteria 1826
1038 Ga0451804_0153252 3300041463 Bacteria 2499
1039 Ga0451851_0707665 3300041507 Bacteria 1935
1040 Ga0439437_004350 3300042000 Bacteria 1543
1041 Ga0439445_0013762 3300042004 Bacteria 1961
1042 Ga0439432_021391 3300042006 Bacteria 2145
1043 Ga0439432_037869 3300042006 Bacteria 1537
1044 Ga0439449_0001661 3300042007 Bacteria 8742
1045 Ga0439449_0002564 3300042007 Bacteria 7100
1046 Ga0439449_0002664 3300042007 Bacteria 6951
1047 Ga0439449_0062728 3300042007 Bacteria 1371
1048 Ga0439452_010143 3300042010 Bacteria 2751
1049 Ga0439462_0001024 3300042015 Bacteria 5994
1050 Ga0450911_001627 3300042115 Bacteria 5005
1051 Ga0450917_000573 3300042120 Bacteria 2755
1052 Ga0450923_009925 3300042125 Bacteria 1677
1053 Ga0450888_000521 3300042126 Bacteria 3636
1054 Ga0450890_000453 3300042127 Bacteria 5991
1055 Ga0450892_001840 3300042130 Bacteria 1916
1056 Ga0439446_0014972 3300042156 Bacteria 2147
1057 Ga0439459_0004826 3300042438 Bacteria 2186
1058 Ga0439464_0004333 3300042439 Bacteria 3627
1059 Ga0450893_0001792 3300042532 Bacteria 3307
1060 Ga0451577_0000114 3300042876 Bacteria 175957
1061 Ga0451577_0001993 3300042876 Bacteria 25464
1062 Ga0451577_0003232 3300042876 Bacteria 18320
1063 Ga0451577_0028693 3300042876 Bacteria 5031
1064 Ga0451577_0099799 3300042876 Bacteria 2593
1065 Ga0451577_0242541 3300042876 Bacteria 1631
1066 Ga0466969_0000002 3300044656 Bacteria 178693
1067 Ga0466969_0004958 3300044656 Bacteria 7088
1068 Ga0466969_0010775 3300044656 Bacteria 4842
1069 Ga0466972_0001432 3300044658 Bacteria 11582
1070 Ga0466972_0001996 3300044658 Bacteria 9985
1071 Ga0453683_0016380 3300044673 Bacteria 4782
1072 Ga0466965_0008514 3300044683 Bacteria 4744
1073 Ga0466966_0005727 3300044684 Bacteria 8181
1074 Ga0466966_0024374 3300044684 Bacteria 3958
1075 Ga0466966_0026318 3300044684 Bacteria 3798
1076 Ga0466966_0136381 3300044684 Bacteria 1500
1077 Ga0466961_0010534 3300044693 Bacteria 5896
1078 Ga0466961_0023826 3300044693 Bacteria 3938
1079 Ga0466961_0061473 3300044693 Bacteria 2387
1080 Ga0466964_0001984 3300044706 Bacteria 7181
1081 Ga0466964_0002512 3300044706 Bacteria 6523
1082 Ga0466964_0019378 3300044706 Bacteria 2614
1083 Ga0453684_0000606 3300044712 Bacteria 132056
1084 Ga0453684_0006765 3300044712 Bacteria 21578
1085 Ga0453684_0029871 3300044712 Bacteria 7721
1086 Ga0453684_0073573 3300044712 Bacteria 4306
1087 Ga0453684_0099934 3300044712 Bacteria 3552
1088 Ga0453684_0256555 3300044712 Bacteria 2005
1089 Ga0453684_0331768 3300044712 Bacteria 1720
1090 Ga0466971_0010968 3300044719 Bacteria 3964
1091 Ga0466970_0011589 3300044765 Bacteria 4497
1092 Ga0466970_0015713 3300044765 Bacteria 3897
1093 Ga0466957_0001959 3300044842 Bacteria 10945
1094 Ga0466957_0025793 3300044842 Bacteria 3484
1095 Ga0466959_0000666 3300045049 Bacteria 20034
1096 Ga0466959_0003830 3300045049 Bacteria 9978
1097 Ga0466959_0008467 3300045049 Bacteria 7274
1098 Ga0466959_0019965 3300045049 Bacteria 4931
1099 Ga0466959_0050801 3300045049 Bacteria 3043
1100 Ga0451576_0001159 3300045051 Bacteria 47493
1101 Ga0451576_0024264 3300045051 Bacteria 6552
1102 Ga0451576_0185201 3300045051 Bacteria 2174
1103 Ga0451576_0230389 3300045051 Bacteria 1935
1104 Ga0466958_0018392 3300045836 Bacteria 4055
1105 Ga0466967_0006653 3300045976 Bacteria 8218
1106 Ga0495592_0000085 3300046454 Bacteria 82502
1107 Ga0495590_0030763 3300046457 Bacteria 1881
1108 Ga0495629_0100170 3300046459 Bacteria 2022
1109 Ga0495650_0008300 3300046471 Bacteria 6083
1110 Ga0495650_0014309 3300046471 Bacteria 4136
1111 Ga0495639_0014497 3300046475 Bacteria 3413
1112 Ga0495639_0061082 3300046475 Bacteria 1727
1113 Ga0495583_0000017 3300046506 Bacteria 310888
1114 Ga0495606_0007405 3300046507 Bacteria 9841
1115 Ga0495610_0035905 3300046512 Bacteria 2539
1116 Ga0495643_0008485 3300046522 Bacteria 6498
1117 Ga0495663_0015081 3300046525 Bacteria 2175
1118 Ga0495642_0013344 3300046528 Bacteria 3176
1119 Ga0495654_0019169 3300046530 Bacteria 3579
1120 Ga0495640_0077443 3300046533 Bacteria 2217
1121 Ga0495598_0007958 3300046537 Bacteria 2452
1122 Ga0495621_0028065 3300046539 Bacteria 1911
1123 Ga0495621_0035437 3300046539 Bacteria 1729
1124 Ga0495597_0000860 3300046542 Bacteria 23777
1125 Ga0495656_0001200 3300046615 Bacteria 8448
1126 Ga0495656_0007392 3300046615 Bacteria 3880
1127 Ga0495668_0012058 3300046616 Bacteria 5144
1128 Ga0495668_0024872 3300046616 Bacteria 3405
1129 Ga0495668_0025999 3300046616 Bacteria 3324
1130 Ga0495668_0035048 3300046616 Bacteria 2813
1131 Ga0495625_0000044 3300046660 Bacteria 203855
1132 Ga0495625_0000639 3300046660 Bacteria 50372
1133 Ga0495625_0024244 3300046660 Bacteria 4619
1134 Ga0495625_0159359 3300046660 Bacteria 1513
1135 Ga0495658_0008307 3300046683 Bacteria 5144
1136 Ga0495671_0042892 3300046692 Bacteria 2272
1137 Ga0495649_0000151 3300046694 Bacteria 60742
1138 Ga0495649_0002613 3300046694 Bacteria 12571
1139 Ga0495589_0007070 3300046794 Bacteria 5886
1140 Ga0495660_0010693 3300046810 Bacteria 5333
1141 Ga0495636_0057084 3300047318 Bacteria 1644
1142 Ga0495676_0024202 3300047321 Bacteria 5260
1143 Ga0495676_0225323 3300047321 Bacteria 1290
1144 Ga0495687_001028 3300047443 Bacteria 27765
1145 Ga0495687_014016 3300047443 Bacteria 4148
1146 Ga0495687_018047 3300047443 Bacteria 3499
1147 Ga0495686_0001809 3300047472 Bacteria 21607
1148 Ga0495686_0005751 3300047472 Bacteria 9690
1149 Ga0495686_0072663 3300047472 Bacteria 2115
1150 Ga0495686_0078679 3300047472 Bacteria 2018
1151 Ga0495593_0047176 3300047673 Bacteria 2292
1152 Ga0495593_0052839 3300047673 Bacteria 2146
1153 Ga0495602_0208866 3300048088 Bacteria 1484
1154 Ga0495614_0020043 3300048089 Bacteria 2893
1155 Ga0495615_0005712 3300048090 Bacteria 2257
1156 Ga0496100_0053001 3300048903 Bacteria 2640
1157 Ga0496101_0003019 3300048904 Bacteria 10374
1158 Ga0496102_0006763 3300048905 Bacteria 9791
1159 Ga0496102_0113807 3300048905 Bacteria 2524
1160 Ga0496104_0087344 3300048907 Bacteria 2978
1161 Ga0496105_0008621 3300048908 Bacteria 7927
1162 Ga0496106_0019139 3300048909 Bacteria 5076
1163 Ga0496106_0045643 3300048909 Bacteria 3292
1164 Ga0496106_0060086 3300048909 Bacteria 2881
1165 Ga0496107_0053764 3300048910 Bacteria 2905
1166 Ga0496108_0068001 3300048911 Bacteria 3005
1167 Ga0496109_0107082 3300048912 Bacteria 2597
1168 Ga0496110_0246336 3300048913 Bacteria 1626
1169 Ga0496111_0017144 3300048914 Bacteria 5002
1170 Ga0496112_0284028 3300048915 Bacteria 1602
1171 Ga0496113_0003290 3300048916 Bacteria 9653
1172 Ga0496114_0001821 3300048917 Bacteria 16167
1173 Ga0496114_0194687 3300048917 Bacteria 1774
1174 Ga0496116_0067077 3300048919 Bacteria 2293
1175 Ga0496117_0017641 3300048920 Bacteria 5955
1176 Ga0496118_0076428 3300048921 Bacteria 2381
1177 Ga0496121_0000166 3300048924 Bacteria 145051
1178 Ga0496121_0024477 3300048924 Bacteria 5770
1179 Ga0496121_0117372 3300048924 Bacteria 2016
1180 Ga0496122_0000274 3300048925 Bacteria 115100
1181 Ga0496123_0000262 3300048926 Bacteria 106366
1182 Ga0496123_0022733 3300048926 Bacteria 4822
1183 Ga0496124_0026316 3300048927 Bacteria 5247
1184 Ga0496124_0087183 3300048927 Bacteria 2553
1185 Ga0496124_0129422 3300048927 Bacteria 2007
1186 Ga0496125_0005447 3300048928 Bacteria 14141
1187 Ga0496125_0007916 3300048928 Bacteria 11221
1188 Ga0496125_0010221 3300048928 Bacteria 9513
1189 Ga0496125_0045207 3300048928 Bacteria 3710
1190 Ga0496125_0064393 3300048928 Bacteria 2913
1191 Ga0496125_0106677 3300048928 Bacteria 2044
1192 Ga0496125_0125154 3300048928 Bacteria 1823
1193 Ga0496126_0035583 3300048929 Bacteria 4666
1194 Ga0496126_0039612 3300048929 Bacteria 4371
1195 Ga0496126_0064731 3300048929 Bacteria 3274
1196 Ga0496126_0087756 3300048929 Bacteria 2741
1197 Ga0501298_006817 3300049521 Bacteria 1880
1198 Ga0501300_002934 3300049523 Bacteria 2543
1199 Ga0501315_000613 3300049531 Bacteria 2584
1200 Ga0501317_001883 3300049533 Bacteria 1897
1201 Ga0501031_0000678 3300049568 Bacteria 20287
1202 Ga0501043_0001160 3300049579 Bacteria 23141
1203 Ga0501046_0001185 3300049580 Bacteria 25348
1204 Ga0501047_0001232 3300049581 Bacteria 25329
1205 Ga0501047_0144572 3300049581 Bacteria 2256
1206 Ga0501048_0015099 3300049582 Bacteria 5707
1207 Ga0501199_003264 3300049650 Bacteria 1548
1208 Ga0501211_000039 3300049658 Bacteria 8874
1209 Ga0501222_005437 3300049662 Bacteria 1717
1210 Ga0501227_003642 3300049665 Bacteria 3337
1211 Ga0501233_002550 3300049668 Bacteria 3222
1212 Ga0501235_015347 3300049669 Bacteria 1689
1213 Ga0501249_003156 3300049679 Bacteria 3314
1214 Ga0501255_000879 3300049684 Bacteria 2244
1215 Ga0501221_001616 3300049704 Bacteria 3743
1216 Ga0501229_000147 3300049706 Bacteria 7305
1217 Ga0501080_0135023 3300049742 Bacteria 2283
1218 Ga0501262_000134 3300049759 Bacteria 9160
1219 Ga0501262_000522 3300049759 Bacteria 4560
1220 Ga0501267_002268 3300049764 Bacteria 1714
1221 Ga0501283_005483 3300049779 Bacteria 1746
1222 Ga0501035_0020751 3300049822 Bacteria 6038
1223 nmdc:mga03683_11374_c1 3300050489 Bacteria 3221
1224 nmdc:mga03683_1731_c1 3300050489 Bacteria 6585
1225 nmdc:mga03683_29665_c1 3300050489 Bacteria 2182
1226 nmdc:mga03683_43882_c1 3300050489 Bacteria 1846
1227 nmdc:mga0yw44_1756_c1 3300050492 Bacteria 8832
1228 nmdc:mga0yw44_44339_c1 3300050492 Bacteria 2660
1229 nmdc:mga0yw44_95707_c1 3300050492 Bacteria 1884
1230 nmdc:mga0k408_108946_c1 3300050493 Bacteria 1636
1231 nmdc:mga0k408_127848_c1 3300050493 Bacteria 1508
1232 nmdc:mga0k408_13106_c1 3300050493 Bacteria 4541
1233 nmdc:mga0k408_163046_c1 3300050493 Bacteria 1328
1234 nmdc:mga0k408_3137_c1 3300050493 Bacteria 8761
1235 nmdc:mga0k408_3243_c1 3300050493 Bacteria 8613
1236 nmdc:mga0k408_33152_c1 3300050493 Bacteria 2953
1237 nmdc:mga0k408_34566_c1 3300050493 Bacteria 2894
1238 nmdc:mga0k408_3717_c1 3300050493 Bacteria 8085
1239 nmdc:mga0k408_38735_c1 3300050493 Bacteria 2737
1240 nmdc:mga0k408_41642_c1 3300050493 Bacteria 2645
1241 nmdc:mga0k408_42352_c1 3300050493 Bacteria 2623
1242 nmdc:mga0k408_56179_c1 3300050493 Bacteria 2284
1243 nmdc:mga06z11_79888_c1 3300050494 Bacteria 1752
1244 nmdc:mga07m45_150_c1 3300050496 Bacteria 27900
1245 nmdc:mga07m45_1625_c1 3300050496 Bacteria 10341
1246 nmdc:mga07m45_16722_c1 3300050496 Bacteria 3929
1247 nmdc:mga07m45_2249_c1 3300050496 Bacteria 9010
1248 nmdc:mga07m45_2640_c1 3300050496 Bacteria 1953
1249 nmdc:mga07m45_28765_c1 3300050496 Bacteria 2126
1250 nmdc:mga07m45_29017_c1 3300050496 Bacteria 3056
1251 nmdc:mga07m45_29589_c1 3300050496 Bacteria 3030
1252 nmdc:mga07m45_38568_c1 3300050496 Bacteria 2666
1253 nmdc:mga05p37_22357_c1 3300050507 Bacteria 6444
1254 nmdc:mga09592_3773_c1 3300050508 Bacteria 12196
1255 nmdc:mga0qj67_9921_c1 3300050509 Bacteria 7101
1256 nmdc:mga0sz30_8986_c1 3300050516 Bacteria 3789
1257 Ga0495601_0010718 3300053077 Bacteria 5468
1258 Ga0500610_0024972 3300053079 Bacteria 2975
1259 Ga0500635_0000053 3300053080 Bacteria 74604
1260 Ga0500578_0000011 3300053086 Bacteria 217243
1261 Ga0500578_0020439 3300053086 Bacteria 4255
1262 Ga0500643_005802 3300053087 Bacteria 5262
1263 Ga0500583_0008528 3300053092 Bacteria 3683
1264 Ga0500651_0000053 3300053093 Bacteria 76219
1265 Ga0500651_0039754 3300053093 Bacteria 2961
1266 Ga0500651_0045243 3300053093 Bacteria 2770
1267 Ga0500571_009242 3300053110 Bacteria 5412
1268 Ga0500593_001023 3300053117 Bacteria 10150
1269 Ga0500594_0002798 3300053118 Bacteria 3799
1270 Ga0500594_0009467 3300053118 Bacteria 2244
1271 Ga0500642_0043132 3300053130 Bacteria 1958
1272 Ga0500652_006726 3300053131 Bacteria 3720
1273 Ga0500655_011021 3300053133 Bacteria 1635
1274 Ga0500658_0000012 3300053134 Bacteria 160010
1275 Ga0500658_0029729 3300053134 Bacteria 2127
1276 Ga0500658_0036987 3300053134 Bacteria 1939
1277 Ga0500559_0000017 3300053136 Bacteria 143646
1278 Ga0500559_0008060 3300053136 Bacteria 4636
1279 Ga0500574_000398 3300053141 Bacteria 5473
1280 Ga0500574_014530 3300053141 Bacteria 1859
1281 Ga0500616_0034802 3300053153 Bacteria 2742
1282 Ga0500619_000181 3300053154 Bacteria 15103
1283 Ga0500622_0000097 3300053156 Bacteria 89802
1284 Ga0500622_0001258 3300053156 Bacteria 20685
1285 Ga0500622_0002974 3300053156 Bacteria 11744
1286 Ga0500634_0043295 3300053161 Bacteria 2441
1287 Ga0500636_0057982 3300053177 Bacteria 2265
1288 Ga0500645_000200 3300053730 Bacteria 46278
1289 Ga0500645_001413 3300053730 Bacteria 12233
1290 Ga0587085_004029 3300059506 Bacteria 1642
1291 Ga0466962_0012218 3300061719 Bacteria 4127
1292 Ga0466962_0017271 3300061719 Bacteria 3476
1293 2511247036 2511231002 Bacteria 5042903
1294 2513229123 2513020051 Bacteria 6053213
1295 2513231368 2513020051 Bacteria 6053213
1296 2513231369 2513020051 Bacteria 6053213
1297 2548500586 2547132374 Bacteria 5530232
1298 2548501001 2547132374 Bacteria 5530232
1299 2587730989 2585428057 Bacteria 6737412
1300 2587736841 2585428058 Bacteria 6853932
1301 2587756021 2585428062 Bacteria 6842168
1302 2588291741 2588253510 Bacteria 6901809
1303 2599626607 2599185214 Bacteria 8209958
1304 2599626608 2599185214 Bacteria 8209958
1305 2599675671 2599185226 Bacteria 8233575
1306 2599675672 2599185226 Bacteria 8233575
1307 2599684144 2599185227 Bacteria 8246414
1308 2599684145 2599185227 Bacteria 8246414
1309 2599696158 2599185229 Bacteria 8216126
1310 2599696159 2599185229 Bacteria 8216126
1311 2643742760 2643221544 Bacteria 5886209
1312 2643864414 2643221570 Bacteria 5103772
1313 2643866709 2643221570 Bacteria 5103772
1314 2643933394 2643221585 Bacteria 5812563
1315 2643972430 2643221592 Bacteria 6608788
1316 2643992950 2643221596 Bacteria 5006805
1317 2643993442 2643221596 Bacteria 5006805
1318 2644030817 2643221603 Bacteria 6147767
1319 2644062694 2643221609 Bacteria 6756331
1320 2644076292 2643221611 Bacteria 6820941
1321 2644138562 2643221625 Bacteria 6512927
1322 2644163257 2643221628 Bacteria 5745828
1323 2644163258 2643221628 Bacteria 5745828
1324 2644217621 2643221639 Bacteria 6649903
1325 2644258644 2643221646 Bacteria 6433402
1326 2644272938 2643221648 Bacteria 6521465
1327 2644291883 2643221652 Bacteria 5140275
1328 2644294580 2643221652 Bacteria 5140275
1329 2644305123 2643221654 Bacteria 5273570
1330 2644314643 2643221656 Bacteria 5809961
1331 2644325845 2643221658 Bacteria 6064537
1332 2644327887 2643221658 Bacteria 6064537
1333 2644327888 2643221658 Bacteria 6064537
1334 2644337942 2643221660 Bacteria 4208257
1335 2644397848 2643221672 Bacteria 6322190
1336 2644397849 2643221672 Bacteria 6322190
1337 2644468312 2643221683 Bacteria 5749203
1338 2644468313 2643221683 Bacteria 5749203
1339 2644645886 2643221717 Bacteria 5676132
1340 2644646865 2643221717 Bacteria 5676132
1341 2722884103 2721755523 Bacteria 6430384
1342 2722884104 2721755523 Bacteria 6430384
1343 2738718017 2738541277 Bacteria 7458140
1344 2738718018 2738541277 Bacteria 7458140
1345 2738885086 2738541307 Bacteria 8606193
1346 2738885087 2738541307 Bacteria 8606193
1347 2739056659 2738541337 Bacteria 6183410
1348 2739244626 2738543012 Bacteria 7115078
1349 2739251466 2738543013 Bacteria 5618633
1350 2739278703 2738543019 Bacteria 7459457
1351 2739278704 2738543019 Bacteria 7459457
1352 2816475170 2816332133 Bacteria 7249298
1353 2819595710 2818991446 Bacteria 7757362
1354 2819595711 2818991446 Bacteria 7757362
1355 2831266722 2831265667 Bacteria 7184833
1356 2831266723 2831265667 Bacteria 7184833
1357 2831866193 2831864461 Bacteria 6502356
1358 2838057197 2838054893 Bacteria 7451788
1359 2838057198 2838054893 Bacteria 7451788
1360 2839139836 2839138175 Bacteria 6549354
1361 2839139837 2839138175 Bacteria 6549354
1362 2842679629 2842677519 Bacteria 5615038
1363 2842679630 2842677519 Bacteria 5615038
1364 2842719962 2842718218 Bacteria 4560148
1365 2842735005 2842733646 Bacteria 5716726
1366 2842735006 2842733646 Bacteria 5716726
1367 2842751183 2842747753 Bacteria 5578255
1368 2842751184 2842747753 Bacteria 5578255
1369 2881101915 2881101125 Bacteria 4590519
1370 2885192472 2885192300 Bacteria 5882526
1371 2885192473 2885192300 Bacteria 5882526
1372 2885200254 2885198086 Bacteria 7212419
1373 2885200255 2885198086 Bacteria 7212419
1374 2885213950 2885211737 Bacteria 7212420
1375 2885213951 2885211737 Bacteria 7212420
1376 2886852427 2886848708 Bacteria 5632523
1377 2886853182 2886848708 Bacteria 5632523
1378 2899925056 2899924645 Bacteria 7487985
1379 2899925057 2899924645 Bacteria 7487985
1380 2904455735 2904449895 Bacteria 6927402
1381 2904455736 2904449895 Bacteria 6927402
1382 2904462751 2904456579 Bacteria 6819253
1383 2904462752 2904456579 Bacteria 6819253
1384 2904544814 2904541872 Bacteria 8915136
1385 2904544815 2904541872 Bacteria 8915136
1386 2919467274 2919462493 Bacteria 5817112
1387 2919467275 2919462493 Bacteria 5817112
1388 2919707483 2919704043 Bacteria 5560311
1389 2928038818 2928037797 Bacteria 7273642
1390 2928038819 2928037797 Bacteria 7273642
1391 2928045576 2928044640 Bacteria 7271509
1392 2928045577 2928044640 Bacteria 7271509
1393 2928053192 2928051484 Bacteria 7773759
1394 2928053193 2928051484 Bacteria 7773759
1395 2928066798 2928064002 Bacteria 7419480
1396 2928066799 2928064002 Bacteria 7419480
1397 2928071308 2928070936 Bacteria 8062541
1398 2928071309 2928070936 Bacteria 8062541
1399 2928084757 2928084124 Bacteria 7159212
1400 2928084758 2928084124 Bacteria 7159212
1401 2928119866 2928115317 Bacteria 6477646
1402 2928119867 2928115317 Bacteria 6477646
1403 2929163513 2929160207 Bacteria 9075316
1404 2929163514 2929160207 Bacteria 9075316
1405 2929522718 2929520902 Bacteria 6765052
1406 2945912212 2945909444 Bacteria 7065066
1407 2945912213 2945909444 Bacteria 7065066
1408 2945947732 2945945610 Bacteria 5951079
1409 2945947733 2945945610 Bacteria 5951079
1410 2945977407 2945972063 Bacteria 6086495
1411 2945977408 2945972063 Bacteria 6086495
1412 2945985480 2945984333 Bacteria 7358892
1413 2945985481 2945984333 Bacteria 7358892
1414 2954772051 2954767861 Bacteria 5535784
1415 2954772052 2954767861 Bacteria 5535784
1416 2974323087 2974320154 Bacteria 4571377
1417 2990712678 2990710928 Bacteria 5002431
1418 2990715008 2990710928 Bacteria 5002431
1419 JGI25155J39150_1000002
1420 JGI24740J21852_10020775
1421 JGI25156J39149_1000003
1422 JGI25156J39149_1000837
1423 JGI25156J39149_1008895
1424 JGI25156J39149_1012858
1425 JGI25154J39366_1000009
1426 JGI25154J39366_1002448
1427 JGI25158J39367_1001490
1428 JGI25157J39369_1000002
1429 JGI25157J39369_1000251
1430 JGI25152J39213_1000738
1431 JGI25152J39213_1006919
1432 JGI25150J39212_1000868
1433 JGI25150J39212_1004489
1434 JGI25159J45721_1000417
1435 JGI25159J45721_1001150
1436 JGI25159J45721_1001933
1437 JGI25159J45721_1008673
1438 JGI25151J46595_10006428
1439 JGI25151J46595_10007156
1440 JGI25151J46595_10016665
1441 rootH1_10009119
1442 rootH2_10036890
1443 rootL2_10023281
1444 rootL2_10040743
1445 JGI25160J50197_1000472
1446 JGI25161J50226_1000032
1447 JGI25161J50226_1000064
1448 Ga0055533_1000028
1449 Ga0055533_1000057
1450 Ga0055525_1000522
1451 Ga0055535_1000856
1452 Ga0055535_1001176
1453 Ga0055542_1000021
1454 Ga0055529_1000331
1455 Ga0055526_1001029
1456 Ga0055526_1024152
1457 Ga0055537_1000036
1458 Ga0055537_1000221
1459 Ga0055537_1000565
1460 Ga0055537_1002864
1461 Ga0055537_1010531
1462 Ga0055524_1000012
1463 Ga0055524_1000287
1464 Ga0055524_1000554
1465 Ga0055524_1013988
1466 Ga0055536_1003447
1467 Ga0055536_1003631
1468 Ga0055536_1004360
1469 Ga0055536_1010599
1470 Ga0055536_1012824
1471 Ga0055534_1000018
1472 Ga0055534_1000220
1473 Ga0055534_1001383
1474 Ga0055534_1004361
1475 Ga0055528_1000509
1476 Ga0055528_1003825
1477 Ga0055528_1007055
1478 Ga0055530_10000218
1479 Ga0055530_10000430
1480 Ga0055530_10002887
1481 Ga0055530_10003706
1482 Ga0055530_10008617
1483 Ga0055540_1000012
1484 Ga0055540_1000016
1485 Ga0055540_1000039
1486 Ga0055540_1000062
1487 Ga0055540_1000420
1488 Ga0055540_1000492
1489 Ga0055540_1002048
1490 Ga0055540_1006044
1491 Ga0055540_1008499
1492 Ga0055531_10000309
1493 Ga0055531_10000313
1494 Ga0055531_10000542
1495 Ga0055531_10002364
1496 Ga0055531_10003057
1497 Ga0055531_10009223
1498 Ga0055531_10012926
1499 Ga0055531_10014062
1500 Ga0055531_10020585
1501 Ga0055543_1003006
1502 Ga0055543_1005865
1503 Ga0055543_1005952
1504 Ga0055543_1006341
1505 Ga0055543_1008256
1506 Ga0065165_1000354
1507 Ga0065165_1000935
1508 Ga0065165_1001664
1509 Ga0065165_1014104
1510 Ga0065165_1015749
1511 Ga0065165_1027589
1512 Ga0065165_1031101
1513 Ga0065714_10074978
1514 Ga0065704_10105517
1515 Ga0065704_10108668
1516 Ga0065704_10126163
1517 Ga0065712_10077432
1518 Ga0065715_10025844
1519 Ga0065715_10122914
1520 Ga0065715_10207777
1521 Ga0065707_10086952
1522 Ga0070658_10088236
1523 Ga0070658_10169512
1524 Ga0070676_10000305
1525 Ga0070676_10001353
1526 Ga0070676_10001456
1527 Ga0070676_10012035
1528 Ga0070676_10021974
1529 Ga0070683_100007952
1530 Ga0070683_100297331
1531 Ga0070690_100005973
1532 Ga0070690_100010484
1533 Ga0070690_100037982
1534 Ga0070670_100012432
1535 Ga0070670_100017269
1536 Ga0070670_100025196
1537 Ga0070670_100040203
1538 Ga0070670_100075565
1539 Ga0070670_100222624
1540 Ga0070677_10004130
1541 Ga0068869_100041163
1542 Ga0068869_100045673
1543 Ga0068869_100126844
1544 Ga0070666_10007102
1545 Ga0070666_10042863
1546 Ga0070666_10145344
1547 Ga0070680_100002531
1548 Ga0070682_100098288
1549 Ga0070682_100145677
1550 Ga0068868_100003758
1551 Ga0068868_100007012
1552 Ga0068868_100010416
1553 Ga0068868_100024715
1554 Ga0068868_100026439
1555 Ga0068868_100079207
1556 Ga0068868_100089432
1557 Ga0068868_100135869
1558 Ga0068868_100226829
1559 Ga0070660_100017780
1560 Ga0070660_100104942
1561 Ga0070660_100249041
1562 Ga0070689_100005827
1563 Ga0070687_100027806
1564 Ga0070687_100051223
1565 Ga0070661_100002137
1566 Ga0070661_100004541
1567 Ga0070661_100027419
1568 Ga0070661_100225554
1569 Ga0070668_100000930
1570 Ga0070668_100002014
1571 Ga0070668_100014358
1572 Ga0070668_100129226
1573 Ga0070669_100003934
1574 Ga0070669_100008074
1575 Ga0070669_100059655
1576 Ga0070669_100197831
1577 Ga0070675_100000703
1578 Ga0070675_100002563
1579 Ga0070675_100005844
1580 Ga0070675_100008566
1581 Ga0070675_100012697
1582 Ga0070675_100018066
1583 Ga0070675_100136272
1584 Ga0070675_100155626
1585 Ga0070671_100005574
1586 Ga0070671_100018775
1587 Ga0070671_100034852
1588 Ga0070671_100047811
1589 Ga0070671_100074851
1590 Ga0070674_100000518
1591 Ga0070674_100002778
1592 Ga0070674_100002952
1593 Ga0070674_100003318
1594 Ga0070674_100004623
1595 Ga0070674_100025030
1596 Ga0070674_100039485
1597 Ga0070674_100058684
1598 Ga0070674_100069552
1599 Ga0070673_100002198
1600 Ga0070673_100002713
1601 Ga0070673_100006984
1602 Ga0070673_100014798
1603 Ga0070673_100017830
1604 Ga0070673_100141075
1605 Ga0070673_100163511
1606 Ga0070673_100211707
1607 Ga0070673_100216577
1608 Ga0070688_100077724
1609 Ga0070659_100000178
1610 Ga0070659_100013767
1611 Ga0070659_100036994
1612 Ga0070659_100090482
1613 Ga0070667_100000887
1614 Ga0070667_100001423
1615 Ga0070667_100022085
1616 Ga0070667_100166632
1617 Ga0070667_100255817
1618 Ga0070700_100011768
1619 Ga0070700_100060568
1620 Ga0070663_100067903
1621 Ga0070663_100123499
1622 Ga0070678_100000683
1623 Ga0070678_100027992
1624 Ga0070678_100093366
1625 Ga0070678_100140093
1626 Ga0070678_100160270
1627 Ga0070678_100160965
1628 Ga0070678_100183807
1629 Ga0070678_100227746
1630 Ga0070662_100000646
1631 Ga0070662_100010127
1632 Ga0070662_100019033
1633 Ga0070662_100090650
1634 Ga0070681_10303528
1635 Ga0068867_100000234
1636 Ga0068867_100001306
1637 Ga0068867_100004484
1638 Ga0068867_100006316
1639 Ga0068867_100006419
1640 Ga0068867_100006718
1641 Ga0068867_100006852
1642 Ga0068867_100010351
1643 Ga0068867_100014751
1644 Ga0068867_100079902
1645 Ga0070685_10116931
1646 Ga0070706_100006474
1647 Ga0070707_100266424
1648 Ga0070699_100104211
1649 Ga0070679_100060332
1650 Ga0070679_100076637
1651 Ga0070679_100152598
1652 Ga0070684_100002660
1653 Ga0070684_100134427
1654 Ga0068853_100035486
1655 Ga0068853_100046733
1656 Ga0068853_100087126
1657 Ga0068853_100259887
1658 Ga0070672_100000150
1659 Ga0070672_100000188
1660 Ga0070672_100003178
1661 Ga0070672_100029365
1662 Ga0070672_100061568
1663 Ga0070672_100090311
1664 Ga0070672_100098835
1665 Ga0070672_100204136
1666 Ga0070665_100235466
1667 Ga0068855_100008323
1668 Ga0068855_100017415
1669 Ga0068855_100231884
1670 Ga0068855_100276875
1671 Ga0068855_100277889
1672 Ga0070664_100034043
1673 Ga0070664_100064440
1674 Ga0068857_100000422
1675 Ga0068857_100025951
1676 Ga0068857_100033075
1677 Ga0068857_100137230
1678 Ga0068854_100001586
1679 Ga0068854_100072293
1680 Ga0068854_100137384
1681 Ga0068856_100004817
1682 Ga0068856_100050218
1683 Ga0068856_100105028
1684 Ga0068852_100003415
1685 Ga0068852_100040628
1686 Ga0068852_100041540
1687 Ga0068852_100111142
1688 Ga0068852_100180723
1689 Ga0068852_100185549
1690 Ga0068859_100003146
1691 Ga0068859_100030836
1692 Ga0068859_100090165
1693 Ga0068859_100148499
1694 Ga0068859_100154049
1695 Ga0068864_100001395
1696 Ga0068864_100006994
1697 Ga0068864_100012986
1698 Ga0068864_100031021
1699 Ga0068864_100094537
1700 Ga0068866_10027755
1701 Ga0068861_100000357
1702 Ga0068861_100005099
1703 Ga0068861_100024110
1704 Ga0068861_100026409
1705 Ga0068861_100148574
1706 Ga0068851_10061466
1707 Ga0068851_10066642
1708 Ga0068851_10090274
1709 Ga0068851_10103958
1710 Ga0068870_10025973
1711 Ga0068863_100004937
1712 Ga0068863_100006024
1713 Ga0068863_100045223
1714 Ga0068863_100077904
1715 Ga0068863_100163097
1716 Ga0068863_100171074
1717 Ga0068863_100192095
1718 Ga0068858_100001070
1719 Ga0068858_100005932
1720 Ga0068858_100006988
1721 Ga0068860_100001404
1722 Ga0068860_100001441
1723 Ga0068860_100003633
1724 Ga0068860_100018213
1725 Ga0068860_100056492
1726 Ga0068860_100069015
1727 Ga0068862_100008643
1728 Ga0068862_100012198
1729 Ga0068862_100014297
1730 Ga0068862_100089917
1731 Ga0075365_10000234
1732 Ga0075365_10013483
1733 Ga0075365_10017690
1734 Ga0075365_10040013
1735 Ga0075364_10081580
1736 Ga0075432_10015726
1737 Ga0075362_10013909
1738 Ga0075362_10019047
1739 Ga0075362_10025386
1740 Ga0075362_10025904
1741 Ga0075362_10051494
1742 Ga0075367_10023649
1743 Ga0075367_10046511
1744 Ga0075367_10062297
1745 Ga0075367_10138911
1746 Ga0075369_10001213
1747 Ga0075369_10048776
1748 Ga0075369_10052095
1749 Ga0075366_10003302
1750 Ga0075366_10005390
1751 Ga0075366_10011482
1752 Ga0075366_10044896
1753 Ga0075366_10050413
1754 Ga0075366_10058716
1755 Ga0075366_10088581
1756 Ga0075366_10097862
1757 Ga0097621_100040696
1758 Ga0097621_100048451
1759 Ga0097621_100060446
1760 Ga0097621_100061415
1761 Ga0097621_100151552
1762 Ga0075370_10000246
1763 Ga0075370_10001169
1764 Ga0075370_10003627
1765 Ga0075370_10003633
1766 Ga0075370_10006991
1767 Ga0075370_10008378
1768 Ga0075370_10017146
1769 Ga0075370_10028091
1770 Ga0075370_10028308
1771 Ga0075370_10031633
1772 Ga0075370_10037655
1773 Ga0075370_10043263
1774 Ga0075370_10052826
1775 Ga0075370_10059175
1776 Ga0068871_100014788
1777 Ga0068871_100026057
1778 Ga0068871_100051277
1779 Ga0068871_100073545
1780 Ga0068871_100129646
1781 Ga0075429_100095617
1782 Ga0068865_100002164
1783 Ga0068865_100004824
1784 Ga0068865_100005297
1785 Ga0068865_100025563
1786 Ga0068865_100195010
1787 Ga0097620_100003146
1788 Ga0097620_100030836
1789 Ga0097620_100090164
1790 Ga0097620_100148494
1791 Ga0097620_100154058
1792 Ga0099823_1007351
1793 Ga0079104_1000011
1794 Ga0079104_1000019
1795 Ga0099826_10000096
1796 Ga0099826_10007062
1797 Ga0105244_10003175
1798 Ga0105244_10101048
1799 Ga0105250_10017928
1800 Ga0105240_10000951
1801 Ga0105240_10001089
1802 Ga0105245_10009930
1803 Ga0105245_10071820
1804 Ga0105245_10105118
1805 Ga0114129_10134779
1806 Ga0105243_10000400
1807 Ga0105243_10001880
1808 Ga0105243_10003082
1809 Ga0105243_10015844
1810 Ga0105243_10020381
1811 Ga0105243_10247510
1812 Ga0105243_10267990
1813 Ga0105241_10043500
1814 Ga0105242_10006688
1815 Ga0105242_10028293
1816 Ga0105242_10034606
1817 Ga0105242_10035127
1818 Ga0105242_10173431
1819 Ga0105248_10014279
1820 Ga0105248_10021294
1821 Ga0105248_10107959
1822 Ga0105248_10135771
1823 Ga0105248_10173519
1824 Ga0105248_10173966
1825 Ga0105237_10003603
1826 Ga0105237_10030715
1827 Ga0105237_10057916
1828 Ga0105238_10007548
1829 Ga0105238_10007948
1830 Ga0105238_10020812
1831 Ga0105238_10112379
1832 Ga0105249_10001498
1833 Ga0105249_10004113
1834 Ga0105249_10152584
1835 Ga0105239_10005179
1836 Ga0105239_10100070
1837 Ga0105246_10024888
1838 Ga0105246_10116819
1839 Ga0157319_1000009
1840 Ga0157373_10008552
1841 Ga0157373_10012879
1842 Ga0157373_10133603
1843 Ga0157370_10000583
1844 Ga0157370_10019170
1845 Ga0157370_10129097
1846 Ga0157369_10009941
1847 Ga0157369_10021442
1848 Ga0157369_10035074
1849 Ga0157374_10016391
1850 Ga0157374_10037469
1851 Ga0157374_10102555
1852 Ga0157374_10183801
1853 Ga0157374_10204401
1854 Ga0157378_10034311
1855 Ga0163162_10011301
1856 Ga0163162_10022647
1857 Ga0163162_10029102
1858 Ga0163162_10074236
1859 Ga0163162_10075996
1860 Ga0163162_10122944
1861 Ga0163162_10308257
1862 Ga0157372_10002878
1863 Ga0157372_10026418
1864 Ga0157372_10039703
1865 Ga0157375_10003456
1866 Ga0157375_10017862
1867 Ga0157375_10036590
1868 Ga0157375_10038720
1869 Ga0157375_10042838
1870 Ga0157375_10063319
1871 Ga0157375_10335149
1872 Ga0157375_10445857
1873 Ga0163163_10005453
1874 Ga0163163_10294718
1875 Ga0157380_10002934
1876 Ga0157380_10003080
1877 Ga0157380_10023913
1878 Ga0157380_10105348
1879 Ga0182008_10000398
1880 Ga0182008_10001698
1881 Ga0182008_10007000
1882 Ga0182008_10013166
1883 Ga0182008_10015404
1884 Ga0182008_10034149
1885 Ga0182008_10042429
1886 Ga0157377_10000014
1887 Ga0157379_10007780
1888 Ga0157379_10012988
1889 Ga0157379_10017193
1890 Ga0157379_10027948
1891 Ga0157379_10030440
1892 Ga0157379_10095832
1893 Ga0157379_10275757
1894 Ga0157376_10002109
1895 Ga0157376_10018872
1896 Ga0157376_10035383
1897 Ga0157376_10097017
1898 Ga0157376_10130519
1899 Ga0157376_10279849
1900 Ga0182006_1001743
1901 Ga0182006_1014199
1902 Ga0182006_1035107
1903 Ga0182006_1039934
1904 Ga0182007_10003330
1905 Ga0182007_10029258
1906 Ga0183362_10001
1907 Ga0163161_10000149
1908 Ga0163161_10004629
1909 Ga0163161_10007626
1910 Ga0163161_10010900
1911 Ga0163161_10013402
1912 Ga0163161_10018680
1913 Ga0163161_10028738
1914 Ga0163161_10046965
1915 Ga0163161_10064859
1916 Ga0163161_10087430
1917 Ga0213872_10001558
1918 Ga0213872_10024989
1919 Ga0213872_10041667
1920 Ga0213876_10028678
1921 Ga0209435_100001
1922 Ga0209436_108179
1923 Ga0209674_100007
1924 Ga0209672_100751
1925 Ga0209672_103873
1926 Ga0209147_102627
1927 Ga0209563_100033
1928 Ga0209563_103671
1929 Ga0207427_101232
1930 Ga0209258_100058
1931 Ga0209258_100353
1932 Ga0207425_1000218
1933 Ga0207425_1001283
1934 Ga0207425_1002538
1935 Ga0207425_1006474
1936 Ga0207425_1012416
1937 Ga0207425_1015207
1938 Ga0209646_1000001
1939 Ga0209646_1000053
1940 Ga0209026_1000003
1941 Ga0209026_1000020
1942 Ga0209026_1002653
1943 Ga0209677_100132
1944 Ga0209677_100161
1945 Ga0209677_103481
1946 Ga0209148_1000071
1947 Ga0209148_1003552
1948 Ga0209759_1000001
1949 Ga0209759_1000017
1950 Ga0209759_1000913
1951 Ga0209759_1001199
1952 Ga0209759_1002284
1953 Ga0209129_1000023
1954 Ga0209129_1000041
1955 Ga0209129_1001863
1956 Ga0209129_1007583
1957 Ga0209129_1008749
1958 Ga0209565_1000004
1959 Ga0209565_1000075
1960 Ga0209565_1000327
1961 Ga0209565_1000609
1962 Ga0209565_1000693
1963 Ga0209565_1003001
1964 Ga0209455_1000136
1965 Ga0209673_1000066
1966 Ga0209673_1000289
1967 Ga0209673_1000357
1968 Ga0209673_1000362
1969 Ga0209673_1000798
1970 Ga0209673_1006734
1971 Ga0209673_1009202
1972 Ga0209673_1009683
1973 Ga0209673_1017231
1974 Ga0209673_1019046
1975 Ga0209130_1000069
1976 Ga0209130_1000082
1977 Ga0209130_1000094
1978 Ga0209130_1002257
1979 Ga0209130_1003786
1980 Ga0209675_1000061
1981 Ga0209675_1000074
1982 Ga0209675_1000177
1983 Ga0209675_1000325
1984 Ga0209675_1001059
1985 Ga0209675_1001796
1986 Ga0209675_1004674
1987 Ga0209675_1005211
1988 Ga0209675_1012304
1989 Ga0209676_1000005
1990 Ga0209676_1000029
1991 Ga0209676_1000105
1992 Ga0209676_1000142
1993 Ga0209676_1000186
1994 Ga0209676_1003917
1995 Ga0209676_1017519
1996 Ga0209025_1000351
1997 Ga0209025_1000579
1998 Ga0209025_1000644
1999 Ga0209025_1005852
2000 Ga0209025_1010713
2001 Ga0209025_1022914
2002 Ga0209025_1027340
2003 Ga0209564_1000003
2004 Ga0209564_1000029
2005 Ga0209564_1000090
2006 Ga0209564_1000527
2007 Ga0209564_1005458
2008 Ga0209564_1005474
2009 Ga0209564_1009963
2010 Ga0209564_1022209
2011 Ga0209758_1000043
2012 Ga0209758_1000044
2013 Ga0209758_1000057
2014 Ga0209758_1020115
2015 Ga0209758_1041408
2016 Ga0209050_1000003
2017 Ga0209050_1000007
2018 Ga0209050_1000082
2019 Ga0209050_1000149
2020 Ga0209050_1000569
2021 Ga0209050_1001141
2022 Ga0209050_1001330
2023 Ga0209050_1004588
2024 Ga0209050_1005248
2025 Ga0209050_1006884
2026 Ga0209256_1000001
2027 Ga0209256_1000020
2028 Ga0209256_1000022
2029 Ga0209256_1000024
2030 Ga0209256_1002170
2031 Ga0209256_1002204
2032 Ga0207426_1000001
2033 Ga0207426_1000025
2034 Ga0207426_1000031
2035 Ga0207426_1001168
2036 Ga0209051_1000003
2037 Ga0209051_1000029
2038 Ga0209051_1000036
2039 Ga0209051_1000063
2040 Ga0209051_1000064
2041 Ga0209051_1000078
2042 Ga0209051_1000213
2043 Ga0209051_1000243
2044 Ga0209051_1000455
2045 Ga0209051_1001500
2046 Ga0209051_1004021
2047 Ga0209051_1006392
2048 Ga0209051_1006879
2049 Ga0209051_1008919
2050 Ga0209257_1000011
2051 Ga0209257_1000012
2052 Ga0209257_1000018
2053 Ga0209257_1000021
2054 Ga0209257_1000030
2055 Ga0209257_1000109
2056 Ga0209257_1000118
2057 Ga0209257_1000226
2058 Ga0209257_1000980
2059 Ga0209257_1002930
2060 Ga0209257_1003485
2061 Ga0209257_1018343
2062 Ga0209257_1019700
2063 Ga0207697_10006077
2064 Ga0207697_10020917
2065 Ga0207697_10023400
2066 Ga0207697_10055501
2067 Ga0207656_10003985
2068 Ga0207656_10012705
2069 Ga0207656_10013411
2070 Ga0207656_10020257
2071 Ga0207656_10025458
2072 Ga0207696_1015363
2073 Ga0207655_1026542
2074 Ga0207682_10000759
2075 Ga0207682_10013091
2076 Ga0207642_10029763
2077 Ga0207680_10001601
2078 Ga0207645_10003471
2079 Ga0207645_10004926
2080 Ga0207645_10011577
2081 Ga0207645_10012714
2082 Ga0207645_10018093
2083 Ga0207645_10028617
2084 Ga0207643_10012919
2085 Ga0207705_10123016
2086 Ga0207684_10011095
2087 Ga0207654_10034398
2088 Ga0207695_10002904
2089 Ga0207695_10018222
2090 Ga0207695_10155131
2091 Ga0207671_10005965
2092 Ga0207671_10103190
2093 Ga0207662_10029873
2094 Ga0207657_10035067
2095 Ga0207657_10050686
2096 Ga0207657_10056390
2097 Ga0207657_10129827
2098 Ga0207649_10009799
2099 Ga0207649_10097267
2100 Ga0207652_10015168
2101 Ga0207652_10139706
2102 Ga0207646_10157201
2103 Ga0207681_10000899
2104 Ga0207681_10010511
2105 Ga0207694_10016398
2106 Ga0207694_10034080
2107 Ga0207694_10043051
2108 Ga0207694_10149216
2109 Ga0207650_10000878
2110 Ga0207650_10002442
2111 Ga0207650_10014659
2112 Ga0207650_10140005
2113 Ga0207659_10000135
2114 Ga0207659_10000207
2115 Ga0207659_10001596
2116 Ga0207659_10006224
2117 Ga0207659_10032239
2118 Ga0207659_10141460
2119 Ga0207659_10259042
2120 Ga0207687_10015611
2121 Ga0207687_10098169
2122 Ga0207644_10001220
2123 Ga0207644_10001228
2124 Ga0207644_10021457
2125 Ga0207644_10041528
2126 Ga0207644_10046621
2127 Ga0207644_10244143
2128 Ga0207690_10000359
2129 Ga0207690_10039046
2130 Ga0207690_10102670
2131 Ga0207690_10224641
2132 Ga0207706_10000654
2133 Ga0207706_10002883
2134 Ga0207706_10002944
2135 Ga0207706_10017782
2136 Ga0207706_10073320
2137 Ga0207706_10078450
2138 Ga0207706_10200717
2139 Ga0207686_10013697
2140 Ga0207686_10025763
2141 Ga0207686_10073882
2142 Ga0207709_10000038
2143 Ga0207709_10000147
2144 Ga0207709_10000214
2145 Ga0207709_10004723
2146 Ga0207709_10009501
2147 Ga0207709_10020370
2148 Ga0207709_10032522
2149 Ga0207670_10039836
2150 Ga0207669_10001219
2151 Ga0207669_10001590
2152 Ga0207669_10004703
2153 Ga0207669_10006838
2154 Ga0207669_10009417
2155 Ga0207669_10013232
2156 Ga0207669_10021720
2157 Ga0207669_10052263
2158 Ga0207704_10002775
2159 Ga0207704_10005625
2160 Ga0207704_10029924
2161 Ga0207691_10001187
2162 Ga0207691_10001712
2163 Ga0207691_10039447
2164 Ga0207691_10133271
2165 Ga0207691_10150673
2166 Ga0207711_10004508
2167 Ga0207711_10045951
2168 Ga0207711_10048324
2169 Ga0207711_10120738
2170 Ga0207711_10144084
2171 Ga0207689_10005835
2172 Ga0207689_10006945
2173 Ga0207689_10023078
2174 Ga0207689_10101824
2175 Ga0207689_10153379
2176 Ga0207661_10012975
2177 Ga0207679_10000220
2178 Ga0207679_10003707
2179 Ga0207679_10017872
2180 Ga0207679_10072079
2181 Ga0207667_10025000
2182 Ga0207667_10054838
2183 Ga0207667_10103527
2184 Ga0207651_10000798
2185 Ga0207651_10002450
2186 Ga0207651_10013478
2187 Ga0207651_10018259
2188 Ga0207651_10047090
2189 Ga0207651_10047832
2190 Ga0207651_10055284
2191 Ga0207651_10110123
2192 Ga0207712_10000828
2193 Ga0207668_10001541
2194 Ga0207668_10014399
2195 Ga0207668_10025183
2196 Ga0207668_10117088
2197 Ga0207668_10183343
2198 Ga0207640_10006017
2199 Ga0207640_10095449
2200 Ga0207658_10000860
2201 Ga0207658_10003454
2202 Ga0207658_10005178
2203 Ga0207658_10056497
2204 Ga0207677_10005607
2205 Ga0207677_10012083
2206 Ga0207677_10014359
2207 Ga0207677_10015442
2208 Ga0207677_10026317
2209 Ga0207677_10079217
2210 Ga0207677_10153967
2211 Ga0207703_10001624
2212 Ga0207703_10002139
2213 Ga0207703_10009455
2214 Ga0207639_10039741
2215 Ga0207678_10160314
2216 Ga0207678_10199620
2217 Ga0207708_10073767
2218 Ga0207708_10075749
2219 Ga0207702_10002918
2220 Ga0207702_10011208
2221 Ga0207702_10099543
2222 Ga0207702_10240766
2223 Ga0207641_10001135
2224 Ga0207641_10005572
2225 Ga0207641_10019756
2226 Ga0207641_10020064
2227 Ga0207641_10036047
2228 Ga0207641_10052146
2229 Ga0207641_10070520
2230 Ga0207641_10218443
2231 Ga0207641_10314327
2232 Ga0207648_10000062
2233 Ga0207648_10002388
2234 Ga0207648_10004104
2235 Ga0207648_10006529
2236 Ga0207648_10007879
2237 Ga0207648_10022340
2238 Ga0207648_10076245
2239 Ga0207648_10144260
2240 Ga0207648_10148564
2241 Ga0207648_10159701
2242 Ga0207676_10001093
2243 Ga0207676_10007428
2244 Ga0207676_10026622
2245 Ga0207676_10037688
2246 Ga0207676_10108534
2247 Ga0207674_10001725
2248 Ga0207674_10015020
2249 Ga0207674_10041759
2250 Ga0207674_10052794
2251 Ga0207674_10112297
2252 Ga0207675_100000868
2253 Ga0207675_100002203
2254 Ga0207675_100004188
2255 Ga0207675_100005109
2256 Ga0207683_10001181
2257 Ga0207683_10023663
2258 Ga0207683_10044028
2259 Ga0207683_10044881
2260 Ga0207683_10046127
2261 Ga0207683_10108741
2262 Ga0207683_10164978
2263 Ga0207683_10177045
2264 Ga0207683_10181255
2265 Ga0207698_10004390
2266 Ga0207698_10012848
2267 Ga0207698_10024454
2268 Ga0207698_10051797
2269 Ga0207698_10099612
2270 Ga0207698_10134379
2271 Ga0207698_10200427
2272 Ga0207698_10273412
2273 Ga0209281_1000005
2274 Ga0209281_1000149
2275 Ga0209389_1010627
2276 Ga0209984_1002311
2277 Ga0209968_1000125
2278 Ga0209970_1000690
2279 Ga0209282_1000228
2280 Ga0209282_1000864
2281 Ga0209971_1007153
2282 Ga0209966_1000014
2283 Ga0209974_10001071
2284 Ga0209974_10014591
2285 Ga0268266_10072143
2286 Ga0268265_10030110
2287 Ga0268265_10042246
2288 Ga0268265_10083622
2289 Ga0268264_10001193
2290 Ga0268264_10001745
2291 Ga0268264_10023892
2292 Ga0268264_10093386
2293 Ga0268264_10116829
2294 Ga0268264_10126132
2295 Ga0265336_10000012
2296 Ga0307517_10001025
2297 Ga0307515_10000064
2298 Ga0307515_10000137
2299 Ga0307515_10000139
2300 Ga0307515_10000187
2301 Ga0307515_10000727
2302 Ga0307515_10000998
2303 Ga0307515_10001587
2304 Ga0307515_10002977
2305 Ga0307515_10007083
2306 Ga0307515_10014464
2307 Ga0307515_10021785
2308 Ga0307515_10068465
2309 Ga0307515_10110315
2310 Ga0265324_10003636
2311 Ga0307512_10049207
2312 Ga0314311_1018086
2313 Ga0316178_1128022
2314 Ga0316180_1003872
2315 Ga0316183_1046777
2316 Ga0316181_1014423
2317 Ga0265330_10000117
2318 Ga0265332_10000002
2319 Ga0265332_10000033
2320 Ga0265332_10000125
2321 Ga0265331_10001854
2322 Ga0265327_10000309
2323 Ga0265327_10000779
2324 Ga0265327_10001589
2325 Ga0265327_10011830
2326 Ga0265316_10000833
2327 Ga0307513_10000019
2328 Ga0307513_10000051
2329 Ga0307513_10002833
2330 Ga0307513_10007462
2331 Ga0307513_10008369
2332 Ga0307513_10058693
2333 Ga0307513_10310883
2334 Ga0307509_10000092
2335 Ga0307509_10003532
2336 Ga0307509_10037154
2337 Ga0307509_10038946
2338 Ga0307509_10056231
2339 Ga0307509_10095060
2340 Ga0307509_10103755
2341 Ga0307509_10146780
2342 Ga0307408_100000008
2343 Ga0307408_100000407
2344 Ga0307408_100006921
2345 Ga0307408_100025292
2346 Ga0307408_100051504
2347 Ga0307408_100071443
2348 Ga0307408_100075069
2349 Ga0307408_100119969
2350 Ga0307408_100124722
2351 Ga0307508_10000004
2352 Ga0307508_10001570
2353 Ga0307514_10003976
2354 Ga0307514_10040375
2355 Ga0307514_10040483
2356 Ga0265314_10000012
2357 Ga0265314_10147752
2358 Ga0307516_10000109
2359 Ga0307516_10003586
2360 Ga0307516_10005086
2361 Ga0307516_10007069
2362 Ga0307516_10019753
2363 Ga0307516_10050860
2364 Ga0307516_10172547
2365 Ga0307516_10210361
2366 Ga0307405_10062736
2367 Ga0307405_10123767
2368 Ga0307405_10154149
2369 Ga0307405_10185738
2370 Ga0307413_10145654
2371 Ga0307410_10005512
2372 Ga0307406_10000050
2373 Ga0307406_10000440
2374 Ga0307406_10003882
2375 Ga0307406_10004637
2376 Ga0307406_10071343
2377 Ga0307412_10013847
2378 Ga0307412_10029763
2379 Ga0307412_10088191
2380 Ga0307409_100004771
2381 Ga0307409_100048315
2382 Ga0307416_100003421
2383 Ga0307416_100013163
2384 Ga0307416_100073184
2385 Ga0307414_10007644
2386 Ga0307414_10023583
2387 Ga0307414_10030258
2388 Ga0307414_10092110
2389 Ga0307414_10117542
2390 Ga0307414_10129557
2391 Ga0307411_10005288
2392 Ga0307411_10014448
2393 Ga0307411_10110231
2394 Ga0307411_10113643
2395 Ga0307411_10155332
2396 Ga0307415_100007187
2397 Ga0307507_10012966
2398 Ga0307507_10048731
2399 Ga0307510_10002759
2400 Ga0373934_0006495
2401 Ga0373932_0012678
2402 Ga0373939_0000008
2403 Ga0373957_0091396
2404 Ga0373931_0000533
2405 Ga0373931_0025052
2406 Ga0373937_0025203
2407 Ga0373925_0003362
2408 Ga0373925_0147863
2409 Ga0395899_0000992
2410 Ga0395899_0013417
2411 Ga0395899_0025496
2412 Ga0395899_0027819
2413 Ga0395900_0004787
2414 Ga0395900_0020937
2415 Ga0395900_0026497
2416 Ga0395900_0029664
2417 Ga0395900_0079616
2418 Ga0395898_0006328
2419 Ga0395898_0036706
2420 Ga0395898_0054593
2421 Ga0395905_0000148
2422 Ga0395905_0000382
2423 Ga0395905_0002029
2424 Ga0395905_0003923
2425 Ga0395905_0005758
2426 Ga0395905_0006766
2427 Ga0395905_0015358
2428 Ga0395905_0017190
2429 Ga0395905_0021027
2430 Ga0395905_0029796
2431 Ga0395905_0032872
2432 Ga0395905_0050244
2433 Ga0395905_0054783
2434 Ga0395905_0084413
2435 Ga0395905_0095056
2436 Ga0395901_0010348
2437 Ga0395901_0034728
2438 Ga0395901_0049039
2439 Ga0395901_0106293
2440 Ga0395901_0150472
2441 Ga0395901_0327295
2442 Ga0436365_0538258
2443 Ga0436361_0026531
2444 Ga0436361_0258710
2445 Ga0436361_0572364
2446 Ga0436361_0848510
2447 Ga0436363_0660497
2448 Ga0439436_0016367
2449 Ga0439439_0011910
2450 Ga0439447_025116
2451 Ga0439466_0015578
2452 Ga0451789_0102886
2453 Ga0451789_0982253
2454 Ga0451798_0381267
2455 Ga0451802_1471416
2456 Ga0451804_0153252
2457 Ga0451851_0707665
2458 Ga0439437_004350
2459 Ga0439445_0013762
2460 Ga0439432_021391
2461 Ga0439432_037869
2462 Ga0439449_0001661
2463 Ga0439449_0002564
2464 Ga0439449_0002664
2465 Ga0439449_0062728
2466 Ga0439452_010143
2467 Ga0439462_0001024
2468 Ga0450911_001627
2469 Ga0450917_000573
2470 Ga0450923_009925
2471 Ga0450888_000521
2472 Ga0450890_000453
2473 Ga0450892_001840
2474 Ga0439446_0014972
2475 Ga0439459_0004826
2476 Ga0439464_0004333
2477 Ga0450893_0001792
2478 Ga0451577_0000114
2479 Ga0451577_0001993
2480 Ga0451577_0003232
2481 Ga0451577_0028693
2482 Ga0451577_0099799
2483 Ga0451577_0242541
2484 Ga0466969_0000002
2485 Ga0466969_0004958
2486 Ga0466969_0010775
2487 Ga0466972_0001432
2488 Ga0466972_0001996
2489 Ga0453683_0016380
2490 Ga0466965_0008514
2491 Ga0466966_0005727
2492 Ga0466966_0024374
2493 Ga0466966_0026318
2494 Ga0466966_0136381
2495 Ga0466961_0010534
2496 Ga0466961_0023826
2497 Ga0466961_0061473
2498 Ga0466964_0001984
2499 Ga0466964_0002512
2500 Ga0466964_0019378
2501 Ga0453684_0000606
2502 Ga0453684_0006765
2503 Ga0453684_0029871
2504 Ga0453684_0073573
2505 Ga0453684_0099934
2506 Ga0453684_0256555
2507 Ga0453684_0331768
2508 Ga0466971_0010968
2509 Ga0466970_0011589
2510 Ga0466970_0015713
2511 Ga0466957_0001959
2512 Ga0466957_0025793
2513 Ga0466959_0000666
2514 Ga0466959_0003830
2515 Ga0466959_0008467
2516 Ga0466959_0019965
2517 Ga0466959_0050801
2518 Ga0451576_0001159
2519 Ga0451576_0024264
2520 Ga0451576_0185201
2521 Ga0451576_0230389
2522 Ga0466958_0018392
2523 Ga0466967_0006653
2524 Ga0495592_0000085
2525 Ga0495590_0030763
2526 Ga0495629_0100170
2527 Ga0495650_0008300
2528 Ga0495650_0014309
2529 Ga0495639_0014497
2530 Ga0495639_0061082
2531 Ga0495583_0000017
2532 Ga0495606_0007405
2533 Ga0495610_0035905
2534 Ga0495643_0008485
2535 Ga0495663_0015081
2536 Ga0495642_0013344
2537 Ga0495654_0019169
2538 Ga0495640_0077443
2539 Ga0495598_0007958
2540 Ga0495621_0028065
2541 Ga0495621_0035437
2542 Ga0495597_0000860
2543 Ga0495656_0001200
2544 Ga0495656_0007392
2545 Ga0495668_0012058
2546 Ga0495668_0024872
2547 Ga0495668_0025999
2548 Ga0495668_0035048
2549 Ga0495625_0000044
2550 Ga0495625_0000639
2551 Ga0495625_0024244
2552 Ga0495625_0159359
2553 Ga0495658_0008307
2554 Ga0495671_0042892
2555 Ga0495649_0000151
2556 Ga0495649_0002613
2557 Ga0495589_0007070
2558 Ga0495660_0010693
2559 Ga0495636_0057084
2560 Ga0495676_0024202
2561 Ga0495676_0225323
2562 Ga0495687_001028
2563 Ga0495687_014016
2564 Ga0495687_018047
2565 Ga0495686_0001809
2566 Ga0495686_0005751
2567 Ga0495686_0072663
2568 Ga0495686_0078679
2569 Ga0495593_0047176
2570 Ga0495593_0052839
2571 Ga0495602_0208866
2572 Ga0495614_0020043
2573 Ga0495615_0005712
2574 Ga0496100_0053001
2575 Ga0496101_0003019
2576 Ga0496102_0006763
2577 Ga0496102_0113807
2578 Ga0496104_0087344
2579 Ga0496105_0008621
2580 Ga0496106_0019139
2581 Ga0496106_0045643
2582 Ga0496106_0060086
2583 Ga0496107_0053764
2584 Ga0496108_0068001
2585 Ga0496109_0107082
2586 Ga0496110_0246336
2587 Ga0496111_0017144
2588 Ga0496112_0284028
2589 Ga0496113_0003290
2590 Ga0496114_0001821
2591 Ga0496114_0194687
2592 Ga0496116_0067077
2593 Ga0496117_0017641
2594 Ga0496118_0076428
2595 Ga0496121_0000166
2596 Ga0496121_0024477
2597 Ga0496121_0117372
2598 Ga0496122_0000274
2599 Ga0496123_0000262
2600 Ga0496123_0022733
2601 Ga0496124_0026316
2602 Ga0496124_0087183
2603 Ga0496124_0129422
2604 Ga0496125_0005447
2605 Ga0496125_0007916
2606 Ga0496125_0010221
2607 Ga0496125_0045207
2608 Ga0496125_0064393
2609 Ga0496125_0106677
2610 Ga0496125_0125154
2611 Ga0496126_0035583
2612 Ga0496126_0039612
2613 Ga0496126_0064731
2614 Ga0496126_0087756
2615 Ga0501298_006817
2616 Ga0501300_002934
2617 Ga0501315_000613
2618 Ga0501317_001883
2619 Ga0501031_0000678
2620 Ga0501043_0001160
2621 Ga0501046_0001185
2622 Ga0501047_0001232
2623 Ga0501047_0144572
2624 Ga0501048_0015099
2625 Ga0501199_003264
2626 Ga0501211_000039
2627 Ga0501222_005437
2628 Ga0501227_003642
2629 Ga0501233_002550
2630 Ga0501235_015347
2631 Ga0501249_003156
2632 Ga0501255_000879
2633 Ga0501221_001616
2634 Ga0501229_000147
2635 Ga0501080_0135023
2636 Ga0501262_000134
2637 Ga0501262_000522
2638 Ga0501267_002268
2639 Ga0501283_005483
2640 Ga0501035_0020751
2641 nmdc:mga03683_11374_c1
2642 nmdc:mga03683_1731_c1
2643 nmdc:mga03683_29665_c1
2644 nmdc:mga03683_43882_c1
2645 nmdc:mga0yw44_1756_c1
2646 nmdc:mga0yw44_44339_c1
2647 nmdc:mga0yw44_95707_c1
2648 nmdc:mga0k408_108946_c1
2649 nmdc:mga0k408_127848_c1
2650 nmdc:mga0k408_13106_c1
2651 nmdc:mga0k408_163046_c1
2652 nmdc:mga0k408_3137_c1
2653 nmdc:mga0k408_3243_c1
2654 nmdc:mga0k408_33152_c1
2655 nmdc:mga0k408_34566_c1
2656 nmdc:mga0k408_3717_c1
2657 nmdc:mga0k408_38735_c1
2658 nmdc:mga0k408_41642_c1
2659 nmdc:mga0k408_42352_c1
2660 nmdc:mga0k408_56179_c1
2661 nmdc:mga06z11_79888_c1
2662 nmdc:mga07m45_150_c1
2663 nmdc:mga07m45_1625_c1
2664 nmdc:mga07m45_16722_c1
2665 nmdc:mga07m45_2249_c1
2666 nmdc:mga07m45_2640_c1
2667 nmdc:mga07m45_28765_c1
2668 nmdc:mga07m45_29017_c1
2669 nmdc:mga07m45_29589_c1
2670 nmdc:mga07m45_38568_c1
2671 nmdc:mga05p37_22357_c1
2672 nmdc:mga09592_3773_c1
2673 nmdc:mga0qj67_9921_c1
2674 nmdc:mga0sz30_8986_c1
2675 Ga0495601_0010718
2676 Ga0500610_0024972
2677 Ga0500635_0000053
2678 Ga0500578_0000011
2679 Ga0500578_0020439
2680 Ga0500643_005802
2681 Ga0500583_0008528
2682 Ga0500651_0000053
2683 Ga0500651_0039754
2684 Ga0500651_0045243
2685 Ga0500571_009242
2686 Ga0500593_001023
2687 Ga0500594_0002798
2688 Ga0500594_0009467
2689 Ga0500642_0043132
2690 Ga0500652_006726
2691 Ga0500655_011021
2692 Ga0500658_0000012
2693 Ga0500658_0029729
2694 Ga0500658_0036987
2695 Ga0500559_0000017
2696 Ga0500559_0008060
2697 Ga0500574_000398
2698 Ga0500574_014530
2699 Ga0500616_0034802
2700 Ga0500619_000181
2701 Ga0500622_0000097
2702 Ga0500622_0001258
2703 Ga0500622_0002974
2704 Ga0500634_0043295
2705 Ga0500636_0057982
2706 Ga0500645_000200
2707 Ga0500645_001413
2708 Ga0587085_004029
2709 Ga0466962_0012218
2710 Ga0466962_0017271
2711 2511247036
2712 2513229123
2713 2513231368
2714 2513231369
2715 2548500586
2716 2548501001
2717 2587730989
2718 2587736841
2719 2587756021
2720 2588291741
2721 2599626607
2722 2599626608
2723 2599675671
2724 2599675672
2725 2599684144
2726 2599684145
2727 2599696158
2728 2599696159
2729 2643742760
2730 2643864414
2731 2643866709
2732 2643933394
2733 2643972430
2734 2643992950
2735 2643993442
2736 2644030817
2737 2644062694
2738 2644076292
2739 2644138562
2740 2644163257
2741 2644163258
2742 2644217621
2743 2644258644
2744 2644272938
2745 2644291883
2746 2644294580
2747 2644305123
2748 2644314643
2749 2644325845
2750 2644327887
2751 2644327888
2752 2644337942
2753 2644397848
2754 2644397849
2755 2644468312
2756 2644468313
2757 2644645886
2758 2644646865
2759 2722884103
2760 2722884104
2761 2738718017
2762 2738718018
2763 2738885086
2764 2738885087
2765 2739056659
2766 2739244626
2767 2739251466
2768 2739278703
2769 2739278704
2770 2816475170
2771 2819595710
2772 2819595711
2773 2831266722
2774 2831266723
2775 2831866193
2776 2838057197
2777 2838057198
2778 2839139836
2779 2839139837
2780 2842679629
2781 2842679630
2782 2842719962
2783 2842735005
2784 2842735006
2785 2842751183
2786 2842751184
2787 2881101915
2788 2885192472
2789 2885192473
2790 2885200254
2791 2885200255
2792 2885213950
2793 2885213951
2794 2886852427
2795 2886853182
2796 2899925056
2797 2899925057
2798 2904455735
2799 2904455736
2800 2904462751
2801 2904462752
2802 2904544814
2803 2904544815
2804 2919467274
2805 2919467275
2806 2919707483
2807 2928038818
2808 2928038819
2809 2928045576
2810 2928045577
2811 2928053192
2812 2928053193
2813 2928066798
2814 2928066799
2815 2928071308
2816 2928071309
2817 2928084757
2818 2928084758
2819 2928119866
2820 2928119867
2821 2929163513
2822 2929163514
2823 2929522718
2824 2945912212
2825 2945912213
2826 2945947732
2827 2945947733
2828 2945977407
2829 2945977408
2830 2945985480
2831 2945985481
2832 2954772051
2833 2954772052
2834 2974323087
2835 2990712678
2836 2990715008

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

58

407

0.92

PF13433

Peripla_BP_5

Periplasmic binding protein domain

183

415

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ip9-assembly1.cif.gz_A structure of atu2422-gaba receptor in complex with gaba 0.8894 27 390
4evr-assembly1.cif.gz_A crystal structure of abc transporter from r. palustris - solute binding protein (rpa0668) in complex with benzoate 0.8873 27 405
1z18-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8852 26 391
3ipc-assembly1.cif.gz_A structure of atu2422-gaba f77a mutant receptor in complex with leucine 0.8851 27 390
3ip9-assembly1.cif.gz_A structure of atu2422-gaba receptor in complex with gaba 0.8846 27 390
ID Description Score Start End Superfamily
4xfkA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.897 154 409 3.40.50.2300
4xfkA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8824 154 409 3.40.50.2300
af_P04816_25_358_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8763 28 366 3.40.190.10
4jb2A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8721 154 282 3.40.50.2300
af_P04816_25_358_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8666 28 366 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A3N7JYL7-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9963 23 409
AF-A0A4Q3N6Q6-F1-model_v4 deleted 0.996 128 409
AF-A0A4Q3N6Q6-F1-model_v4 deleted 0.9855 128 409
AF-A0A3S0G2G8-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9816 27 399 GO:0006865
AF-A0A5F0UYF6-F1-model_v4 deleted 0.9722 281 409

Map