metagRoot

F494377

General Info

Members	Datasets	Scaffolds	Average Seq Length
1497	817	1168	155

Family's Representative Sequence

Representative Sequence	3300039447\|Ga0436361_1132730\|Ga0436361_1132730_50_538
Length	162
Sequence	MARRREIPKREILPDPKYKDLLVAKFVNCMMKHGKKSAAEKAFYGAIDIIDAKGPQAMAPFKNGVEVFRAAVENSRPLVEVKSRRVGGSNYQVPVEVRPERRQALAIRWLIEFSRGRPGRSMGERLAGELLDAANKRGGTIKRREDVHKMADANKAFAHYRW

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
3	2511231027	Phyllobacterium sp. YR531	Isolate	Rhizosphere
4	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
5	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
6	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
7	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
8	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
9	2513237091	Sinorhizobium meliloti RRI128	Isolate	Nodule
10	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
11	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
12	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
13	2513237159	Rhizobium giardinii bv. giardinii H152	Isolate	Nodule
14	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
15	2513237351	Mesorhizobium alhagi CCNWXJ12-2	Isolate	Nodule
16	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
17	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
18	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
19	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
20	2537561587	Agrobacterium tumefaciens Cherry 2E-2-2	Isolate	Rhizosphere
21	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
22	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
23	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
24	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
25	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
26	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
27	2551306091	Sinorhizobium meliloti C0431A	Isolate	Nodule
28	2551306092	Sinorhizobium meliloti AK75	Isolate	Nodule
29	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
30	2554235003	Agrobacterium tumefaciens WRT31	Isolate	Rhizosphere
31	2558860242	Agrobacterium fabacearum P4	Isolate	Rhizosphere
32	2558860983	Allorhizobium undicola ATCC 700741	Isolate	Rhizoplane
33	2582581283	Rhizobium sp. OK665	Isolate	Rhizosphere
34	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
35	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
36	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
37	2599185156	Rhizobium sp. NFR03	Isolate	Rhizoplane
38	2599185210	Rhizobium sp. NFACC06-2	Isolate	Rhizoplane
39	2599185236	Rhizobium sp. NFR07	Isolate	Rhizoplane
40	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
41	2600254933	Rhizobium sp. NFR12	Isolate	Rhizoplane
42	2600255279	Rhizobium sp. NFIX01	Isolate	Rhizoplane
43	2600255308	Rhizobium sp. NFIX02	Isolate	Rhizoplane
44	2643221557	Ensifer sp. Root558	Isolate	Unclassified
45	2643221558	Rhizobium sp. Root149	Isolate	Unclassified
46	2643221568	Rhizobium sp. Root564	Isolate	Unclassified
47	2643221582	Rhizobium sp. Root651	Isolate	Unclassified
48	2643221607	Rhizobium sp. Root73	Isolate	Unclassified
49	2643221610	Ensifer sp. Root74	Isolate	Unclassified
50	2643221618	Ensifer sp. Root231	Isolate	Unclassified
51	2643221626	Ensifer sp. Root31	Isolate	Unclassified
52	2643221636	Rhizobium sp. Root1204	Isolate	Unclassified
53	2643221637	Rhizobium sp. Root1212	Isolate	Unclassified
54	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
55	2643221659	Ensifer sp. Root127	Isolate	Unclassified
56	2643221668	Ensifer sp. Root423	Isolate	Unclassified
57	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
58	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
59	2643221686	Rhizobium sp. Root1334	Isolate	Unclassified
60	2643221688	Rhizobium sp. Root482	Isolate	Unclassified
61	2643221689	Rhizobium sp. Root483D2	Isolate	Unclassified
62	2643221693	Rhizobium sp. Root491	Isolate	Unclassified
63	2643221698	Ensifer sp. Root142	Isolate	Unclassified
64	2643221712	Ensifer sp. Root258	Isolate	Unclassified
65	2643221718	Rhizobium sp. Root268	Isolate	Unclassified
66	2643221723	Ensifer sp. Root278	Isolate	Unclassified
67	2643221726	Ensifer sp. Root954	Isolate	Unclassified
68	2738541317	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
69	2757320392	Phyllobacterium leguminum ORS 1419	Isolate	Nodule
70	2765235802	Phyllobacterium bourgognense 31-25a	Isolate	Rhizoplane
71	2767802442	Phyllobacterium brassicacearum 29-15	Isolate	Rhizoplane
72	2775506902	Phyllobacterium zundukense Tri-48	Isolate	Unclassified
73	2775506904	Phyllobacterium zundukense Tri-38	Isolate	Unclassified
74	2775507049	Rhizobium sp. ACO-34A	Isolate	Unclassified
75	2791355253	Rhizobium rhizosphaerae RD15	Isolate	Rhizosphere
76	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
77	2802428859	Sinorhizobium medicae SF3.41	Isolate	Nodule
78	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
79	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
80	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
81	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
82	2808606387	Rhizobium sp. SJZ105	Isolate	Rhizosphere
83	2818991439	Agrobacterium tumefaciens 1187	Isolate	Unclassified
84	2821123053	Rhizobium cellulosilyticum 1193	Isolate	Unclassified
85	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
86	2838675328	Agrobacterium radiobacter SEMIA 410	Isolate	Nodule
87	2838714209	Agrobacterium radiobacter SEMIA 435	Isolate	Nodule
88	2838719591	Agrobacterium radiobacter SEMIA 436	Isolate	Nodule
89	2838724970	Agrobacterium radiobacter SEMIA 437	Isolate	Nodule
90	2838736955	Rhizobium cellulosilyticum SEMIA 448	Isolate	Nodule
91	2839993093	Phyllobacterium endophyticum PEPV15	Isolate	Unclassified
92	2840764183	Phyllobacterium sophorae CCBAU 03422	Isolate	Unclassified
93	2840878972	Albibacillus kandeliae J95	Isolate	Rhizosphere
94	2841840854	Rhizobium cellulosilyticum SEMIA 444	Isolate	Nodule
95	2841846520	Agrobacterium radiobacter SEMIA 440	Isolate	Nodule
96	2841859092	Agrobacterium radiobacter SEMIA 4026	Isolate	Nodule
97	2842124991	Agrobacterium radiobacter SEMIA 434	Isolate	Nodule
98	2842130223	Agrobacterium radiobacter SEMIA 441	Isolate	Nodule
99	2842140634	Rhizobium cellulosilyticum SEMIA 452	Isolate	Nodule
100	2842152218	Agrobacterium radiobacter SEMIA 457	Isolate	Nodule
101	2842170452	Agrobacterium radiobacter SEMIA 461	Isolate	Nodule
102	2842175837	Agrobacterium radiobacter SEMIA 462	Isolate	Nodule
103	2842187318	Agrobacterium radiobacter SEMIA 464	Isolate	Nodule
104	2842211629	Agrobacterium radiobacter SEMIA 472	Isolate	Nodule
105	2842224351	Agrobacterium radiobacter SEMIA 480	Isolate	Nodule
106	2842515876	Agrobacterium radiobacter SEMIA 4072	Isolate	Nodule
107	2842521101	Rhizobium giardinii SEMIA 4084	Isolate	Nodule
108	2842871566	Phyllobacterium sp. R-73111	Isolate	Unclassified
109	2842922631	Pararhizobium sp. R-72066	Isolate	Unclassified
110	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
111	2848694841	Nostoc sp. RF31YmG	Isolate	Unclassified
112	2854911287	Brucella lupini LUP21	Isolate	Unclassified
113	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
114	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
115	2857531043	Neorhizobium sp. R-72160	Isolate	Unclassified
116	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
117	2871474448	Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1	Isolate	Nodule
118	2886627955	Nostoc sp. PA-18-2419 JC1668	Isolate	Unclassified
119	2891048133	Martelella lutilitoris GH2-6	Isolate	Rhizosphere
120	2894652903	Phyllobacterium sp. SYP-B3895	Isolate	Rhizosphere
121	2894817345	Aureimonas psammosilenae YIM DR1026	Isolate	Unclassified
122	2899792073	Agrobacterium deltaense CNPSo 3391	Isolate	Nodule
123	2899803654	Agrobacterium sp. a22-2	Isolate	Unclassified
124	2899845264	Agrobacterium fabacearum CNPSo 675	Isolate	Unclassified
125	2904578770	Phyllobacterium sp. 586	Isolate	Unclassified
126	2913308742	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
127	2913844669	Nostocales cyanobacterium LEGE 12452	Isolate	Unclassified
128	2913912277	Desmonostoc muscorum LEGE 12446	Isolate	Unclassified
129	2915650412	Ochrobactrum sp. CM-21-5	Isolate	Rhizosphere
130	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
131	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
132	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
133	2916000859	Sinorhizobium meliloti USDA1562	Isolate	Nodule
134	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
135	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
136	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
137	2916028427	Sinorhizobium meliloti USDA1613	Isolate	Nodule
138	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
139	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
140	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
141	2916055098	Sinorhizobium meliloti USDA1770	Isolate	Nodule
142	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
143	2916068649	Sinorhizobium meliloti USDA1220	Isolate	Nodule
144	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
145	2919114240	Agrobacterium tumefaciens 1457	Isolate	Rhizosphere
146	2919119836	Phyllobacterium sp. 1468	Isolate	Rhizosphere
147	2919166419	Agrobacterium cavarae 2074	Isolate	Unclassified
148	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
149	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
150	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
151	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
152	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
153	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
154	2921257292	Sinorhizobium meliloti USDA1320	Isolate	Nodule
155	2921263974	Sinorhizobium meliloti USDA1107	Isolate	Nodule
156	2921282425	Sinorhizobium meliloti USDA1203	Isolate	Nodule
157	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
158	2924144063	Sinorhizobium meliloti USDA1022	Isolate	Nodule
159	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
160	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
161	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
162	2924172951	Sinorhizobium meliloti USDA1626	Isolate	Nodule
163	2924179722	Sinorhizobium meliloti USDA1280	Isolate	Nodule
164	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
165	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
166	2924200457	Sinorhizobium meliloti USDA1007	Isolate	Nodule
167	2924207177	Sinorhizobium meliloti USDA1589	Isolate	Nodule
168	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
169	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
170	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
171	2926754445	Agrobacterium radiobacter SLBN-94	Isolate	Rhizosphere
172	2926760298	Agrobacterium tumefaciens SLBN-170	Isolate	Rhizosphere
173	2928521798	Phyllobacterium ifriqiyense 1451	Isolate	Rhizosphere
174	2929138655	Agrobacterium sp. R-72433 Hybrid assembly	Isolate	Unclassified
175	2933006813	Rhizobium sp. SEMIA 439	Isolate	Unclassified
176	2933011516	Rhizobium sp. SEMIA 4032	Isolate	Unclassified
177	2933594066	Agrobacterium fabrum 35/80	Isolate	Nodule
178	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
179	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
180	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
181	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
182	2937023124	Sinorhizobium meliloti USDA1335	Isolate	Nodule
183	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
184	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
185	2937042894	Sinorhizobium meliloti USDA1687	Isolate	Nodule
186	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
187	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
188	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
189	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
190	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
191	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
192	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
193	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
194	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
195	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
196	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
197	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
198	2941499720	Ensifer sp. 4252	Isolate	Rhizosphere
199	2954011201	Phyllobacterium ifrigiyense W4I11	Isolate	Rhizosphere
200	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
201	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
202	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
203	2957395598	Sinorhizobium meliloti USDA1237	Isolate	Nodule
204	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
205	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
206	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
207	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
208	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
209	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
210	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
211	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
212	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
213	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
214	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
215	2957478035	Sinorhizobium meliloti USDA1171	Isolate	Nodule
216	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
217	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
218	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
219	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
220	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
221	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
222	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
223	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
224	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
225	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
226	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
227	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
228	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
229	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
230	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
231	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
232	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
233	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
234	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
235	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
236	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
237	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
238	2964615318	Sinorhizobium meliloti USDA1248	Isolate	Nodule
239	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
240	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
241	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
242	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
243	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
244	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
245	2964663802	Sinorhizobium meliloti USDA1688	Isolate	Nodule
246	2964670856	Sinorhizobium meliloti USDA1211	Isolate	Nodule
247	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
248	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
249	2964691889	Sinorhizobium meliloti USDA1379	Isolate	Nodule
250	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
251	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
252	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
253	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
254	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
255	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
256	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
257	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
258	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
259	2967699805	Sinorhizobium meliloti USDA1695	Isolate	Nodule
260	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
261	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
262	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
263	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
264	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
265	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
266	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
267	2967755722	Sinorhizobium meliloti USDA1302	Isolate	Nodule
268	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
269	2967769361	Sinorhizobium meliloti USDA1005	Isolate	Nodule
270	2967775926	Sinorhizobium meliloti USDA1678	Isolate	Nodule
271	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
272	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
273	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
274	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
275	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
276	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
277	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
278	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
279	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
280	2970082768	Sinorhizobium meliloti USDA1803	Isolate	Nodule
281	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
282	2970095765	Sinorhizobium meliloti USDA1225	Isolate	Nodule
283	2970102677	Sinorhizobium meliloti USDA1325	Isolate	Nodule
284	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
285	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
286	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
287	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
288	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
289	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
290	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
291	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
292	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
293	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
294	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
295	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
296	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
297	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
298	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
299	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
300	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
301	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
302	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
303	2977558990	Sinorhizobium meliloti USDA1222	Isolate	Nodule
304	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
305	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
306	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
307	2978969890	Agrobacterium sp. SORGH_AS 787	Isolate	Unclassified
308	2979089926	Agrobacterium sp. SORGH_AS 745	Isolate	Unclassified
309	2979095461	Agrobacterium tumefaciens SORGH_AS 749	Isolate	Unclassified
310	2979100975	Agrobacterium pusense SORGH_AS 755	Isolate	Unclassified
311	2984509177	Agrobacterium pusense SORGH_AS260	Isolate	Aerial Root
312	2984518228	Agrobacterium pusense SORGH_AS285	Isolate	Aerial Root
313	2984537506	Agrobacterium sp. SORGH_AS440	Isolate	Aerial Root
314	2984587000	Agrobacterium larrymoorei SORGH_AS974	Isolate	Aerial Root
315	2984601300	Rhizobium pusense SORGH_AS1083	Isolate	Aerial Root
316	2995392953	Martelella limonii NBRC 109441	Isolate	Unclassified
317	3000405567	Rhodobacteraceae bacterium LNNU 3342	Isolate	Rhizosphere
318	3002141150	Phyllobacterium sp. 628	Isolate	Unclassified
319	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
320	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
321	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
322	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
323	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
324	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
325	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
326	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
327	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
328	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
329	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
330	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
331	3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
332	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
333	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
334	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
335	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
336	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
337	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
338	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
339	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
340	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
341	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
342	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
343	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
344	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
345	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
346	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
347	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
348	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
349	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
350	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
351	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
352	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
353	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
354	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
355	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
356	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
357	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
358	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
359	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
360	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
361	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
362	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
363	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
364	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
365	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
366	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
367	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
368	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
369	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
370	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
371	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
372	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
373	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
374	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
375	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
376	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
377	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
378	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
379	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
380	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
381	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
382	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
383	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
384	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
385	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
386	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
387	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
388	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
389	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
390	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
391	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
392	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
393	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
394	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
395	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
396	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
397	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
398	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
399	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
400	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
401	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
402	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
403	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
404	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
405	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
406	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
407	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
408	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
409	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
410	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
411	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
412	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
413	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
414	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
415	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
416	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
417	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
418	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
419	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
420	3300013249	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06	Metagenome	Rhizosphere
421	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
422	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
423	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
424	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
425	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
426	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
427	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
428	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
429	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
430	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
431	3300019188	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
432	3300019190	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
433	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
434	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
435	3300020075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
436	3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3)	Metatranscriptome	Rhizosphere
437	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
438	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
439	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
440	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
441	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
442	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
443	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
444	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
445	3300022729	Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2	Metagenome	Unclassified
446	3300022730	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2	Metagenome	Rhizosphere
447	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
448	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
449	3300023017	Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3	Metagenome	Unclassified
450	3300023224	Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4	Metagenome	Unclassified
451	3300023553	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE3 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
452	3300023556	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
453	3300023557	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
454	3300023558	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
455	3300023559	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA3 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
456	3300023560	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
457	3300023561	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
458	3300023562	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
459	3300023563	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
460	3300023564	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
461	3300023664	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
462	3300023666	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
463	3300023668	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE4 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
464	3300023672	Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
465	3300023680	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
466	3300023682	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
467	3300023684	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
468	3300023686	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
469	3300023688	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
470	3300023689	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
471	3300023690	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI1 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
472	3300024123	Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5	Metagenome	Unclassified
473	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
474	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
475	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
476	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
477	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
478	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
479	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
480	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
481	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
482	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
483	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
484	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
485	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
486	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
487	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
488	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
489	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
490	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
491	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
492	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
493	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
494	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
495	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
496	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
497	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
498	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
499	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
500	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
501	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
502	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
503	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
504	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
505	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
506	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
507	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
508	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
509	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
510	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
511	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
512	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
513	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
514	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
515	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
516	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
517	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
518	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
519	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
520	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
521	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
522	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
523	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
524	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
525	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
526	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
527	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
528	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
529	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
530	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
531	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
532	3300028019	Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1	Metagenome	Unclassified
533	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
534	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
535	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
536	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
537	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
538	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
539	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
540	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
541	3300031591	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
542	3300031592	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
543	3300031614	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
544	3300031615	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
545	3300031632	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
546	3300031633	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
547	3300031634	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU1 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
548	3300031635	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
549	3300031636	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
550	3300031664	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
551	3300031666	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
552	3300031667	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
553	3300031678	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
554	3300031686	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
555	3300031690	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
556	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
557	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
558	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
559	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
560	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
561	3300031810	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Unclassified
562	3300031815	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Unclassified
563	3300031816	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Unclassified
564	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
565	3300031828	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Unclassified
566	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
567	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
568	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
569	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
570	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
571	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
572	3300032120	Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
573	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
574	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
575	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
576	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
577	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
578	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
579	3300033524	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
580	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
581	3300033529	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
582	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
583	3300033544	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5	Metagenome	Unclassified
584	3300033545	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4	Metagenome	Unclassified
585	3300033546	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2	Metagenome	Unclassified
586	3300033547	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1	Metagenome	Unclassified
587	3300033548	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6	Metagenome	Unclassified
588	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
589	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
590	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
591	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
592	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
593	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
594	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
595	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
596	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
597	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
598	3300036242	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
599	3300036458	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
600	3300036534	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
601	3300036535	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
602	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
603	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
604	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
605	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
606	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
607	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
608	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
609	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
610	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
611	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
612	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
613	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
614	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
615	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
616	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
617	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
618	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
619	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
620	3300041444	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT	Metatranscriptome	Rhizoplane
621	3300041446	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT	Metatranscriptome	Rhizoplane
622	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
623	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
624	3300041461	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT	Metatranscriptome	Rhizoplane
625	3300041462	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG	Metagenome	Rhizoplane
626	3300041508	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT	Metatranscriptome	Unclassified
627	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
628	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
629	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
630	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
631	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
632	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
633	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
634	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
635	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
636	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
637	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
638	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
639	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
640	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
641	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
642	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
643	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
644	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
645	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
646	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
647	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
648	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
649	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
650	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
651	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
652	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
653	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
654	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
655	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
656	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
657	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
658	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
659	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
660	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
661	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
662	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
663	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
664	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
665	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
666	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
667	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
668	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
669	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
670	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
671	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
672	3300049127	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
673	3300049128	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
674	3300049129	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
675	3300049130	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
676	3300049160	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
677	3300049161	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
678	3300049162	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
679	3300049527	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
680	3300049528	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
681	3300049529	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
682	3300049530	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
683	3300049531	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
684	3300049532	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
685	3300049533	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
686	3300049534	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
687	3300049535	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
688	3300049536	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
689	3300049537	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
690	3300049540	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
691	3300049552	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
692	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
693	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
694	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
695	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
696	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
697	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
698	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
699	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
700	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
701	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
702	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
703	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
704	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
705	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
706	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
707	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
708	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
709	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
710	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
711	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
712	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
713	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
714	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
715	3300049677	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control	Metagenome	Rhizosphere
716	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
717	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
718	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
719	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
720	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
721	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
722	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
723	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
724	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
725	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
726	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
727	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
728	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
729	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
730	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
731	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
732	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
733	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
734	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
735	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
736	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
737	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
738	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
739	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
740	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
741	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
742	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
743	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
744	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
745	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
746	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
747	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
748	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
749	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
750	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
751	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
752	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
753	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
754	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
755	3300053733	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere	Metagenome	Endosphere
756	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
757	3300059477	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
758	3300059490	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
759	3300059491	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
760	3300059492	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
761	3300059493	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
762	3300059503	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
763	3300059504	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
764	3300059505	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
765	3300059506	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
766	3300059507	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
767	3300059508	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
768	3300059509	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
769	3300059510	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
770	3300059511	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
771	3300059512	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
772	3300059513	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
773	3300059604	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
774	3300059605	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
775	3300059607	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
776	3300059609	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
777	3300059623	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
778	3300059624	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
779	3300059626	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
780	3300059629	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
781	3300059630	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
782	3300059631	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
783	3300059639	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
784	3300059640	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
785	3300059641	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
786	3300059642	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
787	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
788	3300059644	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
789	3300059645	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
790	3300059646	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
791	3300059647	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
792	3300059648	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
793	3300059649	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
794	3300059651	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
795	3300059652	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
796	3300059653	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
797	3300059654	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
798	3300059655	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
799	3300059658	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
800	3300059660	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
801	3300060247	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
802	3300060344	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
803	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
804	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
805	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
806	642555144	Nostoc punctiforme PCC 73102	Isolate	Unclassified
807	648276728	Sinorhizobium meliloti BL225C	Isolate	Nodule
808	650716007	Agrobacterium fabacearum H13-3	Isolate	Rhizosphere
809	8003570095	Agrobacterium rhizogenes GBBC3284	Isolate	Unclassified
810	8003992118	Sinorhizobium meliloti RRI128	Isolate	Nodule
811	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule
812	8018150411	Rhizobium straminoryzae SM12	Isolate	Rhizosphere
813	8024486573	Rhizobium tubonense CCBAU 85046	Isolate	Nodule
814	8045864390	Aurantimonas endophytica KCTC 52296	Isolate	Unclassified
815	8054460903	Agrobacterium vaccinii B7.6	Isolate	Unclassified
816	8055431914	Allorhizobium sonneratiae BGMRC 0089	Isolate	Unclassified
817	8056875544	Rhizobium halophilum TRM95001	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	58.32
Metatranscriptomes	19.71
Isolates	21.98

Biome Distribution

Category	Percentage (%)
Aerial Root	0.33
Bulb	0
Endosphere	5.95
Nodule	15.9
Rhizoplane	1.54
Rhizosphere	64.53
Stem	0
Stem Tuber	0
Unclassified	11.76

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_1389529	2162886007	Bacteria	7151
2	JGI25159J45721_1001952	3300002987	Bacteria	8213
3	JGI25406J46586_10008069	3300003203	Bacteria	4779
4	JGI25160J50197_1004230	3300003354	Bacteria	6239
5	JGI25161J50226_1002211	3300003374	Bacteria	5165
6	Ga0006562J51391_1010415	3300003578	Bacteria	4248
7	Ga0055526_1008996	3300003771	Bacteria	4884
8	Ga0055524_1007170	3300003775	Bacteria	4770
9	Ga0055536_1003806	3300003781	Bacteria	7954
10	Ga0055540_1021361	3300003792	Bacteria	1684
11	Ga0055531_10005861	3300003794	Bacteria	7095
12	Ga0058692_1006179	3300003856	Bacteria	3321
13	Ga0058692_1024612	3300003856	Bacteria	1206
14	Ga0055543_1002033	3300004625	Bacteria	7120
15	Ga0058861_11942464	3300004800	Bacteria	1998
16	Ga0065165_1005547	3300005262	Bacteria	7027
17	Ga0065704_10440748	3300005289	Bacteria	714
18	Ga0065707_10025495	3300005295	Bacteria	1136
19	Ga0065707_10033700	3300005295	Bacteria	1699
20	Ga0065707_10157702	3300005295	Bacteria	1592
21	Ga0070658_11148970	3300005327	Bacteria	675
22	Ga0070676_10370972	3300005328	Bacteria	989
23	Ga0070683_101990787	3300005329	Bacteria	558
24	Ga0070690_100475008	3300005330	Bacteria	931
25	Ga0070690_100685505	3300005330	Bacteria	786
26	Ga0068869_100742563	3300005334	Bacteria	840
27	Ga0068869_101098948	3300005334	Bacteria	696
28	Ga0070680_100217943	3300005336	Bacteria	1610
29	Ga0070680_100803460	3300005336	Bacteria	810
30	Ga0068868_101705859	3300005338	Bacteria	594
31	Ga0070660_100439813	3300005339	Bacteria	1081
32	Ga0070691_10063694	3300005341	Bacteria	1778
33	Ga0070692_10026471	3300005345	Bacteria	2867
34	Ga0070669_100489096	3300005353	Bacteria	1019
35	Ga0070673_101395420	3300005364	Bacteria	659
36	Ga0070673_101539381	3300005364	Bacteria	628
37	Ga0070703_10005588	3300005406	Bacteria	3518
38	Ga0070709_10687360	3300005434	Bacteria	795
39	Ga0070709_10752389	3300005434	Bacteria	762
40	Ga0070714_100032363	3300005435	Bacteria	4364
41	Ga0070714_100165157	3300005435	Bacteria	2006
42	Ga0070714_100708344	3300005435	Bacteria	972
43	Ga0070714_102093727	3300005435	Bacteria	551
44	Ga0070713_100011962	3300005436	Bacteria	6349
45	Ga0070713_100131656	3300005436	Bacteria	2206
46	Ga0070713_100379574	3300005436	Bacteria	1317
47	Ga0070713_100739284	3300005436	Bacteria	941
48	Ga0070713_101234206	3300005436	Bacteria	724
49	Ga0070701_10166564	3300005438	Bacteria	1280
50	Ga0070711_101531383	3300005439	Bacteria	582
51	Ga0070705_100458742	3300005440	Bacteria	958
52	Ga0070705_100510181	3300005440	Bacteria	914
53	Ga0070700_100059343	3300005441	Bacteria	2408
54	Ga0070700_100087745	3300005441	Bacteria	2023
55	Ga0070694_100097911	3300005444	Bacteria	2070
56	Ga0070694_100480779	3300005444	Bacteria	985
57	Ga0070694_100626602	3300005444	Bacteria	868
58	Ga0070708_100000929	3300005445	Bacteria	22153
59	Ga0070708_100001716	3300005445	Bacteria	16850
60	Ga0070708_100003460	3300005445	Bacteria	12350
61	Ga0070708_100039163	3300005445	Bacteria	4145
62	Ga0070708_100092548	3300005445	Bacteria	2755
63	Ga0070708_100195512	3300005445	Bacteria	1892
64	Ga0070708_100405614	3300005445	Bacteria	1285
65	Ga0070708_100445328	3300005445	Bacteria	1222
66	Ga0070708_100451696	3300005445	Bacteria	1212
67	Ga0070708_100457963	3300005445	Bacteria	1203
68	Ga0070708_100465650	3300005445	Bacteria	1192
69	Ga0070708_100682126	3300005445	Bacteria	967
70	Ga0070708_100712203	3300005445	Bacteria	944
71	Ga0070708_100945653	3300005445	Bacteria	808
72	Ga0070708_100990088	3300005445	Bacteria	788
73	Ga0070708_101003999	3300005445	Bacteria	782
74	Ga0070708_101088610	3300005445	Bacteria	749
75	Ga0070708_101357593	3300005445	Bacteria	663
76	Ga0070708_101494383	3300005445	Bacteria	629
77	Ga0070708_101923514	3300005445	Bacteria	548
78	Ga0070678_101269104	3300005456	Bacteria	685
79	Ga0070662_100503136	3300005457	Bacteria	1011
80	Ga0070681_10034374	3300005458	Bacteria	5089
81	Ga0070681_10440471	3300005458	Bacteria	1215
82	Ga0068867_100299091	3300005459	Bacteria	1326
83	Ga0070685_10482286	3300005466	Bacteria	874
84	Ga0070706_100000206	3300005467	Bacteria	74074
85	Ga0070706_100001515	3300005467	Bacteria	24359
86	Ga0070706_100001725	3300005467	Bacteria	22674
87	Ga0070706_100004461	3300005467	Bacteria	13519
88	Ga0070706_100007484	3300005467	Bacteria	10238
89	Ga0070706_100008741	3300005467	Bacteria	9435
90	Ga0070706_100040167	3300005467	Bacteria	4319
91	Ga0070706_100048490	3300005467	Bacteria	3920
92	Ga0070706_100060322	3300005467	Bacteria	3501
93	Ga0070706_100066062	3300005467	Bacteria	3346
94	Ga0070706_100072299	3300005467	Bacteria	3191
95	Ga0070706_100084896	3300005467	Bacteria	2933
96	Ga0070706_100114493	3300005467	Bacteria	2511
97	Ga0070706_100164552	3300005467	Bacteria	2071
98	Ga0070706_100329215	3300005467	Bacteria	1424
99	Ga0070706_100433955	3300005467	Bacteria	1223
100	Ga0070706_100852442	3300005467	Bacteria	842
101	Ga0070706_101065114	3300005467	Bacteria	745
102	Ga0070706_101538649	3300005467	Bacteria	607
103	Ga0070707_100001328	3300005468	Bacteria	24359
104	Ga0070707_100003498	3300005468	Bacteria	14822
105	Ga0070707_100004619	3300005468	Bacteria	12884
106	Ga0070707_100010303	3300005468	Bacteria	8703
107	Ga0070707_100011027	3300005468	Bacteria	8416
108	Ga0070707_100026834	3300005468	Bacteria	5472
109	Ga0070707_100030653	3300005468	Bacteria	5122
110	Ga0070707_100032771	3300005468	Bacteria	4951
111	Ga0070707_100033899	3300005468	Bacteria	4869
112	Ga0070707_100051482	3300005468	Bacteria	3948
113	Ga0070707_100113892	3300005468	Bacteria	2624
114	Ga0070707_100143901	3300005468	Bacteria	2320
115	Ga0070707_100230076	3300005468	Bacteria	1805
116	Ga0070707_100403239	3300005468	Bacteria	1327
117	Ga0070707_100468828	3300005468	Bacteria	1220
118	Ga0070707_100655420	3300005468	Bacteria	1012
119	Ga0070707_100677994	3300005468	Bacteria	993
120	Ga0070707_100841730	3300005468	Bacteria	881
121	Ga0070707_100904873	3300005468	Bacteria	847
122	Ga0070707_101054565	3300005468	Bacteria	778
123	Ga0070707_101772781	3300005468	Bacteria	585
124	Ga0070698_100001641	3300005471	Bacteria	24942
125	Ga0070698_100007551	3300005471	Bacteria	11758
126	Ga0070698_100012734	3300005471	Bacteria	8907
127	Ga0070698_100015059	3300005471	Bacteria	8176
128	Ga0070698_100020633	3300005471	Bacteria	6909
129	Ga0070698_100030185	3300005471	Bacteria	5623
130	Ga0070698_100033295	3300005471	Bacteria	5338
131	Ga0070698_100044978	3300005471	Bacteria	4519
132	Ga0070698_100053331	3300005471	Bacteria	4109
133	Ga0070698_100079721	3300005471	Bacteria	3270
134	Ga0070698_100099857	3300005471	Bacteria	2875
135	Ga0070698_100102099	3300005471	Bacteria	2839
136	Ga0070698_100114297	3300005471	Bacteria	2664
137	Ga0070698_100130533	3300005471	Bacteria	2468
138	Ga0070698_100189887	3300005471	Bacteria	1992
139	Ga0070698_100280013	3300005471	Bacteria	1599
140	Ga0070698_100289356	3300005471	Bacteria	1570
141	Ga0070698_100321288	3300005471	Bacteria	1478
142	Ga0070698_100576155	3300005471	Bacteria	1065
143	Ga0070698_100718742	3300005471	Bacteria	941
144	Ga0070698_101255644	3300005471	Bacteria	690
145	Ga0070699_100000685	3300005518	Bacteria	31595
146	Ga0070699_100001702	3300005518	Bacteria	20040
147	Ga0070699_100048373	3300005518	Bacteria	3680
148	Ga0070699_100110949	3300005518	Bacteria	2408
149	Ga0070699_100166689	3300005518	Bacteria	1951
150	Ga0070699_100214737	3300005518	Bacteria	1713
151	Ga0070699_100247999	3300005518	Bacteria	1590
152	Ga0070699_100345040	3300005518	Bacteria	1341
153	Ga0070699_100369094	3300005518	Bacteria	1294
154	Ga0070699_100646275	3300005518	Bacteria	965
155	Ga0070699_100859356	3300005518	Bacteria	830
156	Ga0070699_100989805	3300005518	Bacteria	771
157	Ga0070679_100114843	3300005530	Bacteria	2678
158	Ga0070697_100000181	3300005536	Bacteria	51962
159	Ga0070697_100002291	3300005536	Bacteria	14690
160	Ga0070697_100006299	3300005536	Bacteria	9182
161	Ga0070697_100007417	3300005536	Bacteria	8542
162	Ga0070697_100023392	3300005536	Bacteria	4913
163	Ga0070697_100024799	3300005536	Bacteria	4776
164	Ga0070697_100026334	3300005536	Bacteria	4645
165	Ga0070697_100051695	3300005536	Bacteria	3339
166	Ga0070697_100075397	3300005536	Bacteria	2772
167	Ga0070697_100092427	3300005536	Bacteria	2503
168	Ga0070697_100161119	3300005536	Bacteria	1895
169	Ga0070697_100177162	3300005536	Bacteria	1806
170	Ga0070697_100180057	3300005536	Bacteria	1792
171	Ga0070697_100221066	3300005536	Bacteria	1614
172	Ga0070697_100231753	3300005536	Bacteria	1575
173	Ga0070697_101004901	3300005536	Bacteria	741
174	Ga0070697_101101992	3300005536	Bacteria	707
175	Ga0070697_101386888	3300005536	Bacteria	627
176	Ga0070695_100040418	3300005545	Bacteria	2952
177	Ga0070695_100041521	3300005545	Bacteria	2916
178	Ga0070695_100046885	3300005545	Bacteria	2758
179	Ga0070695_100118365	3300005545	Bacteria	1809
180	Ga0070695_100148622	3300005545	Bacteria	1633
181	Ga0070695_100330907	3300005545	Bacteria	1135
182	Ga0070695_100628799	3300005545	Bacteria	845
183	Ga0070696_100500634	3300005546	Bacteria	966
184	Ga0070696_100500635	3300005546	Bacteria	966
185	Ga0070693_100241249	3300005547	Bacteria	1194
186	Ga0070665_100050499	3300005548	Bacteria	4173
187	Ga0070665_100084353	3300005548	Bacteria	3182
188	Ga0070704_100015660	3300005549	Bacteria	4770
189	Ga0070704_100185437	3300005549	Bacteria	1668
190	Ga0068855_101297479	3300005563	Bacteria	754
191	Ga0070664_100097239	3300005564	Bacteria	2556
192	Ga0068857_100079419	3300005577	Bacteria	2928
193	Ga0068857_100303574	3300005577	Bacteria	1472
194	Ga0068857_101224964	3300005577	Bacteria	727
195	Ga0068852_100813634	3300005616	Bacteria	949
196	Ga0068859_100069346	3300005617	Bacteria	3561
197	Ga0068859_101474578	3300005617	Bacteria	751
198	Ga0068861_101773129	3300005719	Bacteria	612
199	Ga0068858_101386803	3300005842	Bacteria	692
200	Ga0068862_100004463	3300005844	Bacteria	11802
201	Ga0068862_100149855	3300005844	Bacteria	2075
202	Ga0081539_10004590	3300005985	Bacteria	15078
203	Ga0070717_10003938	3300006028	Bacteria	10684
204	Ga0070717_10004446	3300006028	Bacteria	10125
205	Ga0070717_10029395	3300006028	Bacteria	4408
206	Ga0070717_10054737	3300006028	Bacteria	3291
207	Ga0070717_10609564	3300006028	Bacteria	990
208	Ga0070717_11103945	3300006028	Bacteria	722
209	Ga0070717_11365822	3300006028	Bacteria	644
210	Ga0075365_10073164	3300006038	Bacteria	2310
211	Ga0075365_10096119	3300006038	Bacteria	2024
212	Ga0075365_10440231	3300006038	Bacteria	920
213	Ga0075368_10013484	3300006042	Bacteria	3003
214	Ga0075363_100025525	3300006048	Bacteria	3015
215	Ga0075364_10020008	3300006051	Bacteria	4208
216	Ga0075364_10139546	3300006051	Bacteria	1629
217	Ga0075364_10255778	3300006051	Bacteria	1190
218	Ga0070716_100127363	3300006173	Bacteria	1604
219	Ga0070716_100162570	3300006173	Bacteria	1448
220	Ga0070716_100505023	3300006173	Bacteria	893
221	Ga0070716_100717104	3300006173	Bacteria	766
222	Ga0070716_100739249	3300006173	Bacteria	756
223	Ga0070716_100964005	3300006173	Bacteria	672
224	Ga0070716_101405370	3300006173	Bacteria	567
225	Ga0070712_101583384	3300006175	Bacteria	573
226	Ga0075362_10045931	3300006177	Bacteria	1941
227	Ga0075362_10094636	3300006177	Bacteria	1390
228	Ga0075362_10259856	3300006177	Bacteria	855
229	Ga0075362_10387610	3300006177	Bacteria	703
230	Ga0075367_10107076	3300006178	Bacteria	1713
231	Ga0075367_10118973	3300006178	Bacteria	1627
232	Ga0075367_10139346	3300006178	Bacteria	1502
233	Ga0075369_10069258	3300006186	Bacteria	1551
234	Ga0075369_10099873	3300006186	Bacteria	1301
235	Ga0075366_10019467	3300006195	Bacteria	3928
236	Ga0075366_10583437	3300006195	Bacteria	693
237	Ga0075370_10124463	3300006353	Bacteria	1502
238	Ga0075370_10197963	3300006353	Bacteria	1185
239	Ga0075370_10254570	3300006353	Bacteria	1041
240	Ga0075430_100349862	3300006846	Bacteria	1220
241	Ga0075430_100748103	3300006846	Bacteria	806
242	Ga0075431_100002843	3300006847	Bacteria	16747
243	Ga0075431_100030949	3300006847	Bacteria	5512
244	Ga0075431_100274487	3300006847	Bacteria	1708
245	Ga0075433_10005065	3300006852	Bacteria	10331
246	Ga0075433_10021001	3300006852	Bacteria	5469
247	Ga0075433_10124141	3300006852	Bacteria	2293
248	Ga0075433_10227430	3300006852	Bacteria	1657
249	Ga0075433_10391343	3300006852	Bacteria	1227
250	Ga0075433_10724193	3300006852	Bacteria	871
251	Ga0075433_10972776	3300006852	Bacteria	740
252	Ga0075434_100108110	3300006871	Bacteria	2792
253	Ga0075434_100169179	3300006871	Bacteria	2205
254	Ga0075434_100372705	3300006871	Bacteria	1448
255	Ga0075434_101439819	3300006871	Bacteria	699
256	Ga0075429_100012038	3300006880	Bacteria	7496
257	Ga0075429_100081451	3300006880	Bacteria	2822
258	Ga0075429_100551003	3300006880	Bacteria	1010
259	Ga0075429_100594209	3300006880	Bacteria	970
260	Ga0075429_100929255	3300006880	Bacteria	761
261	Ga0075436_100001748	3300006914	Bacteria	14884
262	Ga0075436_100055496	3300006914	Bacteria	2735
263	Ga0075436_100139607	3300006914	Bacteria	1702
264	Ga0075436_100151950	3300006914	Bacteria	1629
265	Ga0075436_100164187	3300006914	Bacteria	1566
266	Ga0075436_100662588	3300006914	Bacteria	771
267	Ga0097620_100069341	3300006931	Bacteria	3561
268	Ga0097620_101474415	3300006931	Bacteria	751
269	Ga0079104_1001046	3300006946	Bacteria	21097
270	Ga0079104_1001880	3300006946	Bacteria	12709
271	Ga0079104_1010738	3300006946	Bacteria	2987
272	Ga0099826_10014724	3300006948	Bacteria	5909
273	Ga0075435_100061649	3300007076	Bacteria	3043
274	Ga0075435_100089339	3300007076	Bacteria	2540
275	Ga0075435_100236855	3300007076	Bacteria	1551
276	Ga0075435_100920654	3300007076	Bacteria	763
277	Ga0075435_101033165	3300007076	Bacteria	718
278	Ga0099794_10000427	3300007265	Bacteria	14056
279	Ga0099794_10051470	3300007265	Bacteria	1983
280	Ga0099794_10113415	3300007265	Bacteria	1360
281	Ga0099794_10286708	3300007265	Bacteria	852
282	Ga0099794_10577189	3300007265	Bacteria	595
283	Ga0105251_10243206	3300009011	Bacteria	811
284	Ga0111539_10433107	3300009094	Bacteria	1531
285	Ga0105245_10674339	3300009098	Bacteria	1065
286	Ga0105245_12063261	3300009098	Bacteria	624
287	Ga0114129_10029485	3300009147	Bacteria	7772
288	Ga0114129_10032319	3300009147	Bacteria	7396
289	Ga0114129_10053448	3300009147	Bacteria	5664
290	Ga0114129_10148514	3300009147	Bacteria	3209
291	Ga0114129_10492862	3300009147	Bacteria	1601
292	Ga0114129_10840012	3300009147	Bacteria	1168
293	Ga0114129_11924678	3300009147	Bacteria	717
294	Ga0105243_10411366	3300009148	Bacteria	1259
295	Ga0105243_11574604	3300009148	Bacteria	683
296	Ga0105237_10880145	3300009545	Bacteria	902
297	Ga0105238_11153045	3300009551	Bacteria	799
298	Ga0105249_11741799	3300009553	Bacteria	696
299	Ga0099796_10076572	3300010159	Bacteria	1219
300	Ga0105239_10278814	3300010375	Bacteria	1881
301	Ga0105239_10510499	3300010375	Bacteria	1367
302	Ga0105246_10554334	3300011119	Bacteria	986
303	Ga0157373_10053492	3300013100	Bacteria	2870
304	Ga0157373_10076414	3300013100	Bacteria	2363
305	Ga0157373_10119091	3300013100	Bacteria	1856
306	Ga0157371_10002103	3300013102	Bacteria	19452
307	Ga0157371_10013303	3300013102	Bacteria	6258
308	Ga0157370_10076939	3300013104	Bacteria	3143
309	Ga0157369_10320661	3300013105	Bacteria	1611
310	Ga0157369_10970679	3300013105	Bacteria	870
311	Ga0171463_1011	3300013249	Bacteria	230603
312	Ga0163162_12231727	3300013306	Bacteria	629
313	Ga0163162_13068152	3300013306	Bacteria	536
314	Ga0157372_12718220	3300013307	Bacteria	568
315	Ga0157375_11639177	3300013308	Bacteria	761
316	Ga0157375_12713233	3300013308	Bacteria	592
317	Ga0163163_12939672	3300014325	Bacteria	532
318	Ga0157380_10238574	3300014326	Bacteria	1638
319	Ga0157380_10411910	3300014326	Bacteria	1286
320	Ga0157377_10048672	3300014745	Bacteria	2380
321	Ga0157376_10748434	3300014969	Bacteria	986
322	Ga0182005_1156131	3300015265	Bacteria	667
323	Ga0183363_1181	3300015690	Bacteria	13522
324	Ga0163161_11461801	3300017792	Bacteria	599
325	Ga0163161_11516177	3300017792	Bacteria	589
326	Ga0184599_137719	3300019188	Eukaryota	2139
327	Ga0184600_146945	3300019190	Eukaryota	1785
328	Ga0197907_10165516	3300020069	Bacteria	2365
329	Ga0197907_10269474	3300020069	Bacteria	1198
330	Ga0197907_10963634	3300020069	Bacteria	4511
331	Ga0206356_11118200	3300020070	Bacteria	1815
332	Ga0206349_1028517	3300020075	Bacteria	1878
333	Ga0206355_1050267	3300020076	Bacteria	1131
334	Ga0206355_1295704	3300020076	Bacteria	2434
335	Ga0206355_1330036	3300020076	Bacteria	1849
336	Ga0206351_10088825	3300020077	Bacteria	4524
337	Ga0206351_10534597	3300020077	Bacteria	1108
338	Ga0206352_10464902	3300020078	Bacteria	2027
339	Ga0206352_10852376	3300020078	Bacteria	988
340	Ga0206352_11018243	3300020078	Bacteria	2306
341	Ga0206350_10648347	3300020080	Bacteria	3232
342	Ga0206354_10594368	3300020081	Bacteria	1831
343	Ga0206353_10225215	3300020082	Bacteria	1242
344	Ga0206353_10488048	3300020082	Bacteria	1977
345	Ga0206353_11967016	3300020082	Bacteria	1238
346	Ga0213876_10107326	3300021384	Bacteria	1482
347	Ga0213876_10110237	3300021384	Bacteria	1461
348	Ga0213875_10207084	3300021388	Bacteria	923
349	Ga0224712_10000117	3300022467	Bacteria	12804
350	Ga0224712_10007383	3300022467	Bacteria	3198
351	Ga0228599_100006	3300022729	Eukaryota	11804
352	Ga0224570_103548	3300022730	Eukaryota	979
353	Ga0228711_1000015	3300022739	Bacteria	126974
354	Ga0228710_1000015	3300022740	Bacteria	133640
355	Ga0224574_100003	3300023017	Eukaryota	21924
356	Ga0224575_100001	3300023224	Eukaryota	56175
357	Ga0247524_100006	3300023553	Eukaryota	8933
358	Ga0247519_100040	3300023556	Eukaryota	5248
359	Ga0247521_100004	3300023557	Eukaryota	8932
360	Ga0247526_100030	3300023558	Eukaryota	5931
361	Ga0247529_100006	3300023559	Eukaryota	8933
362	Ga0247514_100008	3300023560	Eukaryota	8928
363	Ga0247518_103828	3300023561	Eukaryota	1773
364	Ga0247516_100008	3300023562	Eukaryota	8933
365	Ga0247530_100004	3300023563	Eukaryota	8933
366	Ga0247515_103436	3300023564	Eukaryota	1773
367	Ga0247527_100022	3300023664	Eukaryota	5397
368	Ga0247531_100006	3300023666	Eukaryota	8931
369	Ga0247525_102717	3300023668	Eukaryota	1773
370	Ga0247553_101559	3300023672	Eukaryota	993
371	Ga0247528_100005	3300023680	Eukaryota	8932
372	Ga0247513_101884	3300023682	Eukaryota	2027
373	Ga0247523_100004	3300023684	Eukaryota	8932
374	Ga0247520_100012	3300023686	Eukaryota	7192
375	Ga0247522_100007	3300023688	Eukaryota	8903
376	Ga0247517_100006	3300023689	Eukaryota	8933
377	Ga0247512_100007	3300023690	Eukaryota	8353
378	Ga0228600_1000116	3300024123	Eukaryota	11822
379	Ga0209436_103950	3300025208	Bacteria	3769
380	Ga0207425_1011340	3300025245	Bacteria	2131
381	Ga0207425_1070065	3300025245	Bacteria	602
382	Ga0209565_1066120	3300025263	Bacteria	618
383	Ga0209130_1000007	3300025284	Bacteria	591584
384	Ga0209676_1001829	3300025292	Bacteria	17635
385	Ga0209025_1000405	3300025294	Bacteria	87670
386	Ga0209025_1006805	3300025294	Bacteria	8744
387	Ga0209025_1039067	3300025294	Bacteria	2077
388	Ga0209564_1000140	3300025295	Bacteria	179856
389	Ga0209758_1046113	3300025297	Bacteria	1575
390	Ga0209050_1002189	3300025298	Bacteria	17630
391	Ga0209256_1004445	3300025299	Bacteria	8796
392	Ga0209256_1009251	3300025299	Bacteria	4355
393	Ga0207426_1000064	3300025302	Bacteria	358276
394	Ga0209051_1009497	3300025303	Bacteria	5008
395	Ga0209257_1000817	3300025304	Bacteria	45150
396	Ga0207653_10002676	3300025885	Bacteria	5657
397	Ga0207653_10007851	3300025885	Bacteria	3326
398	Ga0207653_10017512	3300025885	Bacteria	2255
399	Ga0207653_10038907	3300025885	Bacteria	1555
400	Ga0207653_10161743	3300025885	Bacteria	829
401	Ga0207692_10465398	3300025898	Bacteria	798
402	Ga0207647_10298133	3300025904	Bacteria	918
403	Ga0207685_10280825	3300025905	Bacteria	817
404	Ga0207699_10051125	3300025906	Bacteria	2441
405	Ga0207699_10342842	3300025906	Bacteria	1053
406	Ga0207643_10017661	3300025908	Bacteria	3903
407	Ga0207684_10000002	3300025910	Bacteria	1042751
408	Ga0207684_10000026	3300025910	Bacteria	316711
409	Ga0207684_10000148	3300025910	Bacteria	124604
410	Ga0207684_10000222	3300025910	Bacteria	87705
411	Ga0207684_10000231	3300025910	Bacteria	84968
412	Ga0207684_10001809	3300025910	Bacteria	22385
413	Ga0207684_10005389	3300025910	Bacteria	11818
414	Ga0207684_10008180	3300025910	Bacteria	9316
415	Ga0207684_10016282	3300025910	Bacteria	6384
416	Ga0207684_10019194	3300025910	Bacteria	5849
417	Ga0207684_10028984	3300025910	Bacteria	4715
418	Ga0207684_10037204	3300025910	Bacteria	4130
419	Ga0207684_10092173	3300025910	Bacteria	2582
420	Ga0207684_10102406	3300025910	Bacteria	2448
421	Ga0207684_10140942	3300025910	Bacteria	2072
422	Ga0207684_10845306	3300025910	Bacteria	772
423	Ga0207684_10909371	3300025910	Bacteria	739
424	Ga0207684_10946990	3300025910	Bacteria	722
425	Ga0207684_11193836	3300025910	Bacteria	630
426	Ga0207693_10426382	3300025915	Bacteria	1037
427	Ga0207693_10694607	3300025915	Bacteria	788
428	Ga0207660_10286164	3300025917	Bacteria	1309
429	Ga0207662_10020862	3300025918	Bacteria	3740
430	Ga0207662_10058365	3300025918	Bacteria	2310
431	Ga0207662_10248423	3300025918	Bacteria	1167
432	Ga0207662_10812920	3300025918	Bacteria	659
433	Ga0207649_11132146	3300025920	Bacteria	618
434	Ga0207646_10000093	3300025922	Bacteria	119533
435	Ga0207646_10000394	3300025922	Bacteria	58624
436	Ga0207646_10000571	3300025922	Bacteria	48299
437	Ga0207646_10001232	3300025922	Bacteria	32150
438	Ga0207646_10001680	3300025922	Bacteria	26958
439	Ga0207646_10002394	3300025922	Bacteria	22126
440	Ga0207646_10002570	3300025922	Bacteria	21439
441	Ga0207646_10003624	3300025922	Bacteria	17281
442	Ga0207646_10003786	3300025922	Bacteria	16836
443	Ga0207646_10004986	3300025922	Bacteria	14166
444	Ga0207646_10017005	3300025922	Bacteria	6817
445	Ga0207646_10023663	3300025922	Bacteria	5638
446	Ga0207646_10038709	3300025922	Bacteria	4294
447	Ga0207646_10062137	3300025922	Bacteria	3334
448	Ga0207646_10062825	3300025922	Bacteria	3315
449	Ga0207646_10064804	3300025922	Bacteria	3261
450	Ga0207646_10066361	3300025922	Bacteria	3222
451	Ga0207646_10147087	3300025922	Bacteria	2123
452	Ga0207646_10151377	3300025922	Bacteria	2092
453	Ga0207646_10168780	3300025922	Bacteria	1976
454	Ga0207646_10184157	3300025922	Bacteria	1886
455	Ga0207646_10362100	3300025922	Bacteria	1310
456	Ga0207646_10474461	3300025922	Bacteria	1128
457	Ga0207646_10539308	3300025922	Bacteria	1050
458	Ga0207646_10867389	3300025922	Bacteria	802
459	Ga0207646_10967796	3300025922	Bacteria	753
460	Ga0207681_10539300	3300025923	Bacteria	959
461	Ga0207650_10020895	3300025925	Bacteria	4624
462	Ga0207687_10400083	3300025927	Bacteria	1129
463	Ga0207700_10034554	3300025928	Bacteria	3631
464	Ga0207664_10001195	3300025929	Bacteria	17277
465	Ga0207664_10027357	3300025929	Bacteria	4322
466	Ga0207664_10215250	3300025929	Bacteria	1664
467	Ga0207664_10331140	3300025929	Bacteria	1345
468	Ga0207664_10420959	3300025929	Bacteria	1190
469	Ga0207664_10469450	3300025929	Bacteria	1125
470	Ga0207664_10637367	3300025929	Bacteria	958
471	Ga0207664_11481268	3300025929	Bacteria	600
472	Ga0207706_10596377	3300025933	Bacteria	949
473	Ga0207686_10125162	3300025934	Bacteria	1755
474	Ga0207709_10123204	3300025935	Bacteria	1754
475	Ga0207709_10235862	3300025935	Bacteria	1328
476	Ga0207670_11301885	3300025936	Bacteria	616
477	Ga0207665_10042708	3300025939	Bacteria	3030
478	Ga0207665_10071718	3300025939	Bacteria	2365
479	Ga0207665_10851991	3300025939	Bacteria	722
480	Ga0207691_10311956	3300025940	Bacteria	1350
481	Ga0207689_10740493	3300025942	Bacteria	829
482	Ga0207661_12021407	3300025944	Bacteria	522
483	Ga0207679_10229262	3300025945	Bacteria	1567
484	Ga0207667_11813801	3300025949	Bacteria	574
485	Ga0207651_10637955	3300025960	Bacteria	934
486	Ga0207651_11141149	3300025960	Bacteria	699
487	Ga0207712_11312276	3300025961	Bacteria	647
488	Ga0207703_10878481	3300026035	Bacteria	858
489	Ga0207639_11401101	3300026041	Bacteria	656
490	Ga0207708_10080944	3300026075	Bacteria	2495
491	Ga0207708_10088215	3300026075	Bacteria	2389
492	Ga0207708_10427221	3300026075	Bacteria	1100
493	Ga0207648_11218057	3300026089	Bacteria	707
494	Ga0207648_11264166	3300026089	Bacteria	693
495	Ga0207676_10124942	3300026095	Bacteria	2177
496	Ga0207675_100058279	3300026118	Bacteria	3604
497	Ga0207683_10595527	3300026121	Bacteria	1023
498	Ga0207683_11155057	3300026121	Bacteria	718
499	Ga0207698_10998813	3300026142	Bacteria	847
500	Ga0209281_1000211	3300027111	Bacteria	130597
501	Ga0209281_1001101	3300027111	Bacteria	19712
502	Ga0209281_1001121	3300027111	Bacteria	19243
503	Ga0209371_1001144	3300027312	Bacteria	19422
504	Ga0209371_1009180	3300027312	Bacteria	3171
505	Ga0209981_1015327	3300027378	Bacteria	1073
506	Ga0209968_1020559	3300027526	Bacteria	1067
507	Ga0209999_1021798	3300027543	Bacteria	1177
508	Ga0209282_1000054	3300027666	Bacteria	101427
509	Ga0209282_1023636	3300027666	Bacteria	3864
510	Ga0209588_1000036	3300027671	Bacteria	65612
511	Ga0209588_1012885	3300027671	Bacteria	2544
512	Ga0209966_1016139	3300027695	Bacteria	1410
513	Ga0209813_10002736	3300027866	Bacteria	4067
514	Ga0224573_1000103	3300028019	Eukaryota	11817
515	Ga0268266_10243599	3300028379	Bacteria	1660
516	Ga0268266_10987993	3300028379	Bacteria	814
517	Ga0268265_10364405	3300028380	Bacteria	1324
518	Ga0307515_10013202	3300028794	Bacteria	15454
519	Ga0307515_10334184	3300028794	Bacteria	1172
520	Ga0268256_1000978	3300030500	Bacteria	19422
521	Ga0316183_1056906	3300030742	Bacteria	851
522	Ga0316181_1097706	3300030744	Bacteria	1390
523	Ga0265320_10014519	3300031240	Bacteria	4480
524	Ga0307513_10115481	3300031456	Bacteria	2667
525	Ga0310116_100009	3300031591	Eukaryota	8936
526	Ga0310117_105864	3300031592	Eukaryota	1328
527	Ga0310103_100008	3300031614	Eukaryota	8932
528	Ga0310107_104569	3300031615	Eukaryota	1791
529	Ga0310102_100706	3300031632	Eukaryota	1789
530	Ga0310108_100006	3300031633	Eukaryota	8936
531	Ga0310106_101991	3300031634	Eukaryota	1545
532	Ga0310115_100133	3300031635	Eukaryota	4886
533	Ga0310113_100005	3300031636	Eukaryota	8933
534	Ga0310118_103019	3300031664	Eukaryota	1422
535	Ga0310105_100011	3300031666	Eukaryota	8932
536	Ga0310111_100010	3300031667	Eukaryota	8886
537	Ga0310114_105310	3300031678	Eukaryota	1317
538	Ga0310119_109089	3300031686	Eukaryota	1204
539	Ga0310101_107313	3300031690	Eukaryota	1318
540	Ga0316579_10002901	3300031691	Bacteria	6575
541	Ga0316579_10003090	3300031691	Bacteria	6420
542	Ga0316579_10004574	3300031691	Bacteria	5505
543	Ga0316579_10028959	3300031691	Bacteria	2525
544	Ga0316579_10052788	3300031691	Bacteria	1903
545	Ga0316576_10004377	3300031727	Bacteria	8460
546	Ga0316576_10007763	3300031727	Bacteria	6776
547	Ga0316576_10016986	3300031727	Bacteria	4934
548	Ga0316576_10056921	3300031727	Bacteria	2857
549	Ga0316576_10103016	3300031727	Bacteria	2135
550	Ga0316576_10117646	3300031727	Bacteria	1994
551	Ga0316576_10133544	3300031727	Bacteria	1868
552	Ga0316576_10470372	3300031727	Bacteria	927
553	Ga0316578_10015639	3300031728	Bacteria	4084
554	Ga0316578_10039146	3300031728	Bacteria	2738
555	Ga0316578_10050236	3300031728	Bacteria	2440
556	Ga0316578_10197061	3300031728	Bacteria	1213
557	Ga0316578_10238321	3300031728	Bacteria	1092
558	Ga0316578_10733313	3300031728	Bacteria	574
559	Ga0307405_10177279	3300031731	Bacteria	1527
560	Ga0316577_10010537	3300031733	Bacteria	4993
561	Ga0316577_10010655	3300031733	Bacteria	4968
562	Ga0316577_10013093	3300031733	Bacteria	4528
563	Ga0316577_10015823	3300031733	Bacteria	4151
564	Ga0316577_10018659	3300031733	Bacteria	3837
565	Ga0316577_10023099	3300031733	Bacteria	3453
566	Ga0316577_10040940	3300031733	Bacteria	2591
567	Ga0316577_10054829	3300031733	Bacteria	2225
568	Ga0316577_10066886	3300031733	Bacteria	2006
569	Ga0316577_10066972	3300031733	Bacteria	2005
570	Ga0316577_10107119	3300031733	Bacteria	1568
571	Ga0316577_10286829	3300031733	Bacteria	932
572	Ga0316577_10592642	3300031733	Bacteria	630
573	Ga0316044_100009	3300031810	Eukaryota	8932
574	Ga0316045_104310	3300031815	Eukaryota	1773
575	Ga0316042_100010	3300031816	Eukaryota	8932
576	Ga0307413_10623059	3300031824	Bacteria	886
577	Ga0307413_10626012	3300031824	Bacteria	884
578	Ga0307413_10948563	3300031824	Bacteria	734
579	Ga0316043_100014	3300031828	Eukaryota	8934
580	Ga0307410_10067770	3300031852	Bacteria	2463
581	Ga0307410_10081217	3300031852	Bacteria	2277
582	Ga0307412_10077476	3300031911	Bacteria	2287
583	Ga0307412_10450509	3300031911	Bacteria	1060
584	Ga0307412_10488024	3300031911	Bacteria	1023
585	Ga0307412_11097825	3300031911	Bacteria	708
586	Ga0315914_1000013	3300031967	Bacteria	133640
587	Ga0307409_100287312	3300031995	Bacteria	1523
588	Ga0307409_100802216	3300031995	Bacteria	949
589	Ga0307409_101425341	3300031995	Bacteria	719
590	Ga0307409_101772350	3300031995	Bacteria	646
591	Ga0307416_100143217	3300032002	Bacteria	2177
592	Ga0307414_10379731	3300032004	Bacteria	1221
593	Ga0316053_100381	3300032120	Eukaryota	1972
594	Ga0316583_10058827	3300032133	Bacteria	1349
595	Ga0316585_10015437	3300032137	Bacteria	2291
596	Ga0316585_10015541	3300032137	Bacteria	2285
597	Ga0316585_10056472	3300032137	Bacteria	1264
598	Ga0316580_10060925	3300032139	Bacteria	1159
599	Ga0316580_10212830	3300032139	Bacteria	596
600	Ga0316593_10000242	3300032168	Bacteria	8872
601	Ga0316593_10000272	3300032168	Bacteria	8633
602	Ga0316593_10000413	3300032168	Bacteria	7721
603	Ga0316593_10000444	3300032168	Bacteria	7552
604	Ga0316593_10000704	3300032168	Bacteria	6536
605	Ga0316593_10001313	3300032168	Bacteria	5421
606	Ga0316593_10001356	3300032168	Bacteria	5346
607	Ga0316593_10001505	3300032168	Bacteria	5163
608	Ga0316593_10005832	3300032168	Bacteria	3283
609	Ga0316593_10007846	3300032168	Bacteria	2949
610	Ga0316593_10011696	3300032168	Bacteria	2558
611	Ga0316593_10012587	3300032168	Bacteria	2486
612	Ga0316593_10016568	3300032168	Bacteria	2236
613	Ga0316593_10017721	3300032168	Bacteria	2176
614	Ga0316593_10019943	3300032168	Bacteria	2078
615	Ga0316593_10022318	3300032168	Bacteria	1988
616	Ga0316593_10026025	3300032168	Bacteria	1868
617	Ga0316593_10027404	3300032168	Bacteria	1828
618	Ga0316593_10036452	3300032168	Bacteria	1621
619	Ga0316593_10036940	3300032168	Bacteria	1612
620	Ga0316593_10037516	3300032168	Bacteria	1601
621	Ga0316593_10037596	3300032168	Bacteria	1600
622	Ga0316593_10048645	3300032168	Bacteria	1428
623	Ga0316593_10061220	3300032168	Bacteria	1287
624	Ga0316593_10064218	3300032168	Bacteria	1260
625	Ga0316593_10067349	3300032168	Bacteria	1233
626	Ga0316593_10067785	3300032168	Bacteria	1230
627	Ga0316593_10076915	3300032168	Bacteria	1160
628	Ga0316593_10081687	3300032168	Bacteria	1129
629	Ga0316593_10089202	3300032168	Bacteria	1084
630	Ga0316593_10128069	3300032168	Bacteria	915
631	Ga0316593_10155770	3300032168	Bacteria	833
632	Ga0316593_10163211	3300032168	Bacteria	814
633	Ga0316593_10176036	3300032168	Bacteria	785
634	Ga0316593_10222145	3300032168	Bacteria	702
635	Ga0316593_10307962	3300032168	Bacteria	600
636	Ga0316593_10323290	3300032168	Bacteria	587
637	Ga0316593_10373712	3300032168	Bacteria	548
638	Ga0315913_1000097	3300033430	Bacteria	51051
639	Ga0315915_1000001	3300033464	Bacteria	481518
640	Ga0316592_1000114	3300033524	Bacteria	8470
641	Ga0316592_1000208	3300033524	Bacteria	7142
642	Ga0316592_1000875	3300033524	Bacteria	4558
643	Ga0316592_1001137	3300033524	Bacteria	4175
644	Ga0316592_1002113	3300033524	Bacteria	3377
645	Ga0316592_1008120	3300033524	Bacteria	2064
646	Ga0316592_1008486	3300033524	Bacteria	2033
647	Ga0316592_1010259	3300033524	Bacteria	1887
648	Ga0316592_1013555	3300033524	Bacteria	1682
649	Ga0316592_1015333	3300033524	Bacteria	1595
650	Ga0316592_1020663	3300033524	Bacteria	1399
651	Ga0316592_1029029	3300033524	Bacteria	1200
652	Ga0316592_1029264	3300033524	Bacteria	1195
653	Ga0316592_1038410	3300033524	Bacteria	1056
654	Ga0316592_1053216	3300033524	Bacteria	905
655	Ga0316592_1112015	3300033524	Bacteria	631
656	Ga0316588_1001697	3300033528	Bacteria	3692
657	Ga0316588_1024473	3300033528	Bacteria	1389
658	Ga0316587_1021074	3300033529	Bacteria	1110
659	Ga0316587_1036046	3300033529	Bacteria	885
660	Ga0316596_1000346	3300033541	Bacteria	7573
661	Ga0316596_1000375	3300033541	Bacteria	7368
662	Ga0316596_1002020	3300033541	Bacteria	4265
663	Ga0316596_1004199	3300033541	Bacteria	3214
664	Ga0316596_1008989	3300033541	Bacteria	2393
665	Ga0316596_1012486	3300033541	Bacteria	2089
666	Ga0316596_1014410	3300033541	Bacteria	1959
667	Ga0316596_1015184	3300033541	Bacteria	1917
668	Ga0316596_1016241	3300033541	Bacteria	1863
669	Ga0316596_1018006	3300033541	Bacteria	1782
670	Ga0316596_1020008	3300033541	Bacteria	1701
671	Ga0316596_1022766	3300033541	Bacteria	1602
672	Ga0316596_1029136	3300033541	Bacteria	1428
673	Ga0316596_1029504	3300033541	Bacteria	1420
674	Ga0316596_1033770	3300033541	Bacteria	1334
675	Ga0316596_1035838	3300033541	Bacteria	1297
676	Ga0316596_1038356	3300033541	Bacteria	1255
677	Ga0316596_1048482	3300033541	Bacteria	1122
678	Ga0316596_1055499	3300033541	Bacteria	1052
679	Ga0316596_1056590	3300033541	Bacteria	1043
680	Ga0316596_1062252	3300033541	Bacteria	995
681	Ga0316596_1068201	3300033541	Bacteria	951
682	Ga0316596_1073563	3300033541	Bacteria	916
683	Ga0316596_1080408	3300033541	Bacteria	876
684	Ga0316596_1129390	3300033541	Bacteria	689
685	Ga0316215_1000447	3300033544	Eukaryota	4745
686	Ga0316214_1000021	3300033545	Eukaryota	18265
687	Ga0316213_1000001	3300033546	Eukaryota	56147
688	Ga0316212_1000053	3300033547	Eukaryota	11769
689	Ga0316216_1000028	3300033548	Eukaryota	21119
690	Ga0373959_0053637	3300034820	Bacteria	876
691	Ga0373944_0112923	3300035089	Bacteria	929
692	Ga0373960_0174619	3300035121	Bacteria	747
693	Ga0373943_0004523	3300035170	Bacteria	6290
694	Ga0316574_0004698	3300035398	Bacteria	7198
695	Ga0316574_0005055	3300035398	Bacteria	7005
696	Ga0316574_0035426	3300035398	Bacteria	3050
697	Ga0316574_0099650	3300035398	Bacteria	1859
698	Ga0316574_0113092	3300035398	Bacteria	1741
699	Ga0316574_0201217	3300035398	Bacteria	1279
700	Ga0316574_0404534	3300035398	Bacteria	859
701	Ga0373931_0035337	3300035691	Bacteria	2598
702	Ga0373935_0037307	3300035692	Bacteria	3041
703	Ga0373935_0481351	3300035692	Bacteria	899
704	Ga0373927_0005943	3300035695	Bacteria	8356
705	Ga0373933_0002378	3300035724	Bacteria	10635
706	Ga0373947_0024037	3300035725	Bacteria	3548
707	Ga0373947_0169732	3300035725	Bacteria	1415
708	Ga0310104_00014	3300036242	Eukaryota	8914
709	Ga0310112_010555	3300036458	Eukaryota	1318
710	Ga0310109_004054	3300036534	Eukaryota	1790
711	Ga0310110_000018	3300036535	Eukaryota	8932
712	Ga0316582_0000085	3300036647	Bacteria	24544
713	Ga0316582_0008650	3300036647	Bacteria	5479
714	Ga0316582_0010089	3300036647	Bacteria	5158
715	Ga0316582_0019539	3300036647	Bacteria	3968
716	Ga0316582_0028334	3300036647	Bacteria	3392
717	Ga0316582_0063633	3300036647	Bacteria	2371
718	Ga0316582_0090315	3300036647	Bacteria	2015
719	Ga0316582_0169416	3300036647	Bacteria	1482
720	Ga0316582_0236355	3300036647	Bacteria	1251
721	Ga0316582_0292713	3300036647	Bacteria	1118
722	Ga0316582_0600187	3300036647	Bacteria	758
723	Ga0316584_0017383	3300036712	Bacteria	5168
724	Ga0316584_0029088	3300036712	Bacteria	4078
725	Ga0316584_0030805	3300036712	Bacteria	3964
726	Ga0316584_0034746	3300036712	Bacteria	3737
727	Ga0316584_0041571	3300036712	Bacteria	3427
728	Ga0316584_0157575	3300036712	Bacteria	1688
729	Ga0316584_0309927	3300036712	Bacteria	1141
730	Ga0316584_0350466	3300036712	Bacteria	1060
731	Ga0316584_0405802	3300036712	Bacteria	970
732	Ga0395899_0039776	3300037312	Bacteria	3518
733	Ga0395899_0177466	3300037312	Bacteria	1497
734	Ga0395899_0273327	3300037312	Bacteria	1152
735	Ga0395900_0162645	3300037418	Bacteria	2276
736	Ga0395900_0164523	3300037418	Bacteria	2261
737	Ga0395900_0175343	3300037418	Bacteria	2181
738	Ga0395900_0218794	3300037418	Bacteria	1921
739	Ga0395900_0386359	3300037418	Bacteria	1367
740	Ga0395898_0500709	3300037466	Bacteria	1155
741	Ga0395905_0152904	3300037471	Bacteria	2170
742	Ga0395905_1515849	3300037471	Bacteria	575
743	Ga0316581_0000617	3300037588	Bacteria	7084
744	Ga0316581_0004473	3300037588	Bacteria	3566
745	Ga0316581_0009673	3300037588	Bacteria	2657
746	Ga0316581_0037795	3300037588	Bacteria	1467
747	Ga0436364_0060535	3300037853	Bacteria	1211
748	Ga0395901_0103182	3300038443	Bacteria	2992
749	Ga0395901_0178099	3300038443	Bacteria	2230
750	Ga0395901_0783169	3300038443	Bacteria	944
751	Ga0400483_061237	3300039062	Bacteria	1001
752	Ga0400483_088473	3300039062	Bacteria	1746
753	Ga0400483_121017	3300039062	Bacteria	1093
754	Ga0400483_152177	3300039062	Bacteria	2765
755	Ga0400483_191764	3300039062	Bacteria	2264
756	Ga0400483_240700	3300039062	Eukaryota	1892
757	Ga0400483_251814	3300039062	Bacteria	1487
758	Ga0400489_24036	3300039093	Bacteria	8615
759	Ga0436365_0226428	3300039437	Bacteria	1459
760	Ga0436365_0231838	3300039437	Bacteria	4261
761	Ga0436365_1553927	3300039437	Bacteria	6049
762	Ga0436361_0590615	3300039447	Bacteria	866
763	Ga0436361_1132730	3300039447	Bacteria	1605
764	Ga0436363_1108103	3300039450	Bacteria	1363
765	Ga0436363_1342110	3300039450	Bacteria	5726
766	Ga0436363_1361388	3300039450	Bacteria	669
767	Ga0436362_0473248	3300039453	Bacteria	1972
768	Ga0436362_1186852	3300039453	Bacteria	707
769	Ga0439436_0017530	3300041404	Bacteria	2143
770	Ga0439436_0021212	3300041404	Bacteria	1933
771	Ga0439436_0046399	3300041404	Bacteria	1235
772	Ga0439439_0004984	3300041406	Bacteria	3014
773	Ga0439465_0012258	3300041413	Bacteria	2682
774	Ga0439465_0046024	3300041413	Bacteria	1419
775	Ga0451790_01116	3300041444	Bacteria	1036
776	Ga0451794_05594	3300041446	Bacteria	753
777	Ga0451794_10939	3300041446	Bacteria	688
778	Ga0451793_1821177	3300041452	Bacteria	586
779	Ga0451795_1538807	3300041456	Bacteria	864
780	Ga0451805_003187	3300041461	Bacteria	845
781	Ga0451806_244781	3300041462	Bacteria	566
782	Ga0451852_07416	3300041508	Bacteria	742
783	Ga0451853_0612608	3300041512	Bacteria	679
784	Ga0439449_0013290	3300042007	Bacteria	3097
785	Ga0439456_066597	3300042013	Bacteria	796
786	Ga0439434_0008551	3300042435	Bacteria	3004
787	Ga0450918_002152	3300042531	Bacteria	3765
788	Ga0451577_0023413	3300042876	Bacteria	5633
789	Ga0451577_0105064	3300042876	Bacteria	2524
790	Ga0451577_0458578	3300042876	Bacteria	1157
791	Ga0466969_0206734	3300044656	Bacteria	895
792	Ga0453683_0027900	3300044673	Bacteria	3578
793	Ga0453683_0156349	3300044673	Bacteria	1442
794	Ga0453683_0226327	3300044673	Bacteria	1190
795	Ga0453683_0320829	3300044673	Bacteria	993
796	Ga0466961_0292005	3300044693	Bacteria	997
797	Ga0466963_0801249	3300044694	Bacteria	664
798	Ga0453684_0001800	3300044712	Bacteria	56885
799	Ga0453684_0074307	3300044712	Bacteria	4281
800	Ga0453684_0079481	3300044712	Bacteria	4099
801	Ga0453684_0094742	3300044712	Bacteria	3672
802	Ga0453684_0161323	3300044712	Bacteria	2652
803	Ga0453684_0166881	3300044712	Bacteria	2598
804	Ga0453684_0184721	3300044712	Bacteria	2445
805	Ga0453684_0265980	3300044712	Bacteria	1962
806	Ga0453684_0266516	3300044712	Bacteria	1960
807	Ga0453684_0288982	3300044712	Bacteria	1867
808	Ga0453684_0303607	3300044712	Bacteria	1813
809	Ga0453684_0377087	3300044712	Bacteria	1593
810	Ga0453684_0559084	3300044712	Bacteria	1259
811	Ga0453684_0589085	3300044712	Bacteria	1220
812	Ga0453684_0592277	3300044712	Bacteria	1216
813	Ga0453684_0625310	3300044712	Bacteria	1177
814	Ga0453684_0648500	3300044712	Bacteria	1152
815	Ga0453684_1685930	3300044712	Bacteria	648
816	Ga0451576_0000115	3300045051	Bacteria	208342
817	Ga0451576_0004127	3300045051	Bacteria	19157
818	Ga0451576_0350197	3300045051	Bacteria	1546
819	Ga0451576_0464627	3300045051	Bacteria	1329
820	Ga0451576_0894561	3300045051	Bacteria	931
821	Ga0451576_0912377	3300045051	Bacteria	921
822	Ga0466967_1285394	3300045976	Bacteria	729
823	Ga0466967_1450886	3300045976	Bacteria	683
824	Ga0495629_0060948	3300046459	Bacteria	2637
825	Ga0495638_0050046	3300046460	Bacteria	2610
826	Ga0495650_0092454	3300046471	Bacteria	1148
827	Ga0495585_0576740	3300046492	Bacteria	530
828	Ga0495594_0212470	3300046499	Bacteria	1103
829	Ga0495594_0319836	3300046499	Bacteria	884
830	Ga0495606_0314310	3300046507	Bacteria	844
831	Ga0495643_0289763	3300046522	Bacteria	750
832	Ga0495663_0100831	3300046525	Bacteria	951
833	Ga0495587_0039455	3300046536	Bacteria	2826
834	Ga0495622_0028313	3300046557	Bacteria	2616
835	Ga0495633_0050287	3300046558	Bacteria	1965
836	Ga0495625_0080308	3300046660	Bacteria	2272
837	Ga0495625_0299231	3300046660	Bacteria	1030
838	Ga0495657_0071484	3300046675	Bacteria	2265
839	Ga0495600_0127402	3300046809	Bacteria	1655
840	Ga0495604_0040612	3300047317	Bacteria	3652
841	Ga0495672_0077757	3300047320	Bacteria	1858
842	Ga0496102_1424949	3300048905	Bacteria	612
843	Ga0496109_0502406	3300048912	Bacteria	1145
844	Ga0496110_0947510	3300048913	Bacteria	767
845	Ga0496111_0063527	3300048914	Bacteria	2677
846	Ga0496114_0400431	3300048917	Bacteria	1215
847	Ga0496114_0985917	3300048917	Bacteria	726
848	Ga0496116_0004534	3300048919	Bacteria	13205
849	Ga0496116_0270306	3300048919	Bacteria	831
850	Ga0496117_0000002	3300048920	Bacteria	2483758
851	Ga0496117_0012789	3300048920	Bacteria	7361
852	Ga0496118_0123602	3300048921	Bacteria	1680
853	Ga0496118_0156680	3300048921	Bacteria	1415
854	Ga0496118_0314949	3300048921	Bacteria	852
855	Ga0496119_0009236	3300048922	Bacteria	8497
856	Ga0496119_0019096	3300048922	Bacteria	5066
857	Ga0496119_0023071	3300048922	Bacteria	4429
858	Ga0496119_0253986	3300048922	Bacteria	885
859	Ga0496119_0348092	3300048922	Bacteria	718
860	Ga0496120_0019172	3300048923	Bacteria	4384
861	Ga0496120_0037993	3300048923	Bacteria	2852
862	Ga0496121_0000003	3300048924	Bacteria	1191431
863	Ga0496121_0212935	3300048924	Bacteria	1367
864	Ga0496121_0494991	3300048924	Bacteria	777
865	Ga0496122_0003789	3300048925	Bacteria	19490
866	Ga0496122_0014262	3300048925	Bacteria	7697
867	Ga0496122_0020638	3300048925	Bacteria	5938
868	Ga0496122_0049715	3300048925	Bacteria	3206
869	Ga0496122_0061884	3300048925	Bacteria	2743
870	Ga0496122_0066560	3300048925	Bacteria	2601
871	Ga0496123_0003005	3300048926	Bacteria	19490
872	Ga0496123_0003186	3300048926	Bacteria	18722
873	Ga0496123_0049540	3300048926	Bacteria	2815
874	Ga0496123_0111314	3300048926	Bacteria	1564
875	Ga0496124_0040841	3300048927	Bacteria	4008
876	Ga0496124_0057067	3300048927	Bacteria	3291
877	Ga0496124_0105511	3300048927	Bacteria	2276
878	Ga0496125_0003405	3300048928	Bacteria	19331
879	Ga0496125_0090649	3300048928	Bacteria	2293
880	Ga0496126_0117394	3300048929	Bacteria	2311
881	Ga0496126_0258271	3300048929	Bacteria	1449
882	Ga0501306_000765	3300049127	Bacteria	2686
883	Ga0501306_005433	3300049127	Bacteria	1461
884	Ga0501306_031548	3300049127	Bacteria	790
885	Ga0501306_036263	3300049127	Bacteria	751
886	Ga0501308_000661	3300049128	Bacteria	2365
887	Ga0501308_003600	3300049128	Bacteria	1444
888	Ga0501308_025579	3300049128	Bacteria	765
889	Ga0501309_007963	3300049129	Bacteria	1324
890	Ga0501309_009566	3300049129	Bacteria	1239
891	Ga0501310_001201	3300049130	Bacteria	2327
892	Ga0501304_010964	3300049160	Bacteria	799
893	Ga0501304_015388	3300049160	Bacteria	716
894	Ga0501305_006784	3300049161	Bacteria	1433
895	Ga0501305_034906	3300049161	Bacteria	799
896	Ga0501307_000480	3300049162	Bacteria	2724
897	Ga0501307_003158	3300049162	Bacteria	1599
898	Ga0501307_012020	3300049162	Bacteria	1024
899	Ga0501307_023361	3300049162	Bacteria	819
900	Ga0501311_003311	3300049527	Bacteria	1632
901	Ga0501312_007074	3300049528	Bacteria	1421
902	Ga0501312_027840	3300049528	Bacteria	873
903	Ga0501312_032203	3300049528	Bacteria	827
904	Ga0501313_038506	3300049529	Bacteria	637
905	Ga0501314_011966	3300049530	Bacteria	827
906	Ga0501315_002193	3300049531	Bacteria	1799
907	Ga0501315_011177	3300049531	Bacteria	1091
908	Ga0501316_005188	3300049532	Bacteria	1341
909	Ga0501316_018868	3300049532	Bacteria	856
910	Ga0501317_004405	3300049533	Bacteria	1464
911	Ga0501318_004431	3300049534	Bacteria	1346
912	Ga0501319_001692	3300049535	Bacteria	1314
913	Ga0501320_053858	3300049536	Bacteria	553
914	Ga0501321_005320	3300049537	Bacteria	1267
915	Ga0501324_008543	3300049540	Bacteria	905
916	Ga0501336_005366	3300049552	Bacteria	924
917	Ga0501031_0066005	3300049568	Bacteria	2358
918	Ga0501031_0244515	3300049568	Bacteria	1166
919	Ga0501032_0037906	3300049569	Bacteria	3285
920	Ga0501032_0041372	3300049569	Bacteria	3130
921	Ga0501032_0079518	3300049569	Bacteria	2183
922	Ga0501032_0231337	3300049569	Bacteria	1202
923	Ga0501032_0868076	3300049569	Bacteria	569
924	Ga0501033_0210470	3300049570	Bacteria	1387
925	Ga0501034_0000208	3300049571	Bacteria	111739
926	Ga0501034_0000482	3300049571	Bacteria	65380
927	Ga0501034_0040379	3300049571	Bacteria	4723
928	Ga0501034_0284928	3300049571	Bacteria	1591
929	Ga0501036_0910820	3300049572	Bacteria	721
930	Ga0501037_0005204	3300049573	Bacteria	9460
931	Ga0501037_0046933	3300049573	Bacteria	3166
932	Ga0501038_0024265	3300049574	Bacteria	5410
933	Ga0501039_0241079	3300049575	Bacteria	1421
934	Ga0501039_1144236	3300049575	Bacteria	603
935	Ga0501040_0986865	3300049576	Bacteria	611
936	Ga0501041_0951177	3300049577	Bacteria	552
937	Ga0501043_0042895	3300049579	Bacteria	3556
938	Ga0501046_0006019	3300049580	Bacteria	10788
939	Ga0501046_0014835	3300049580	Bacteria	6560
940	Ga0501046_0160393	3300049580	Bacteria	1692
941	Ga0501046_0263467	3300049580	Bacteria	1266
942	Ga0501046_0289747	3300049580	Bacteria	1198
943	Ga0501046_0306963	3300049580	Bacteria	1158
944	Ga0501047_0001689	3300049581	Bacteria	21471
945	Ga0501047_0068881	3300049581	Bacteria	3408
946	Ga0501047_0096167	3300049581	Bacteria	2840
947	Ga0501047_0229785	3300049581	Bacteria	1709
948	Ga0501047_0247659	3300049581	Bacteria	1631
949	Ga0501048_0000501	3300049582	Bacteria	27413
950	Ga0501048_0068273	3300049582	Bacteria	2512
951	Ga0501048_0546828	3300049582	Bacteria	831
952	Ga0501048_0684347	3300049582	Bacteria	736
953	Ga0501067_0001590	3300049583	Bacteria	12434
954	Ga0501067_0031556	3300049583	Bacteria	2939
955	Ga0501068_0080479	3300049584	Bacteria	1999
956	Ga0501070_0004020	3300049586	Bacteria	12633
957	Ga0501070_0357839	3300049586	Bacteria	1184
958	Ga0501070_0414653	3300049586	Bacteria	1088
959	Ga0501070_0885596	3300049586	Bacteria	697
960	Ga0501071_0244017	3300049587	Bacteria	1355
961	Ga0501072_0634874	3300049588	Bacteria	841
962	Ga0501073_0091330	3300049589	Bacteria	2116
963	Ga0501073_0146311	3300049589	Bacteria	1637
964	Ga0501073_0693345	3300049589	Bacteria	703
965	Ga0501074_0947637	3300049590	Bacteria	605
966	Ga0501075_0293040	3300049591	Bacteria	1240
967	Ga0501076_1191751	3300049592	Bacteria	627
968	Ga0501247_086197	3300049677	Bacteria	513
969	Ga0501257_000906	3300049686	Bacteria	5997
970	Ga0501080_0000005	3300049742	Bacteria	176271
971	Ga0501080_0390309	3300049742	Bacteria	1253
972	Ga0501280_005781	3300049776	Bacteria	1759
973	Ga0501035_0000049	3300049822	Bacteria	145684
974	Ga0501035_0190330	3300049822	Bacteria	1764
975	Ga0501035_0389049	3300049822	Bacteria	1162
976	Ga0501044_0000030	3300049823	Bacteria	173442
977	Ga0501044_0012139	3300049823	Bacteria	9329
978	Ga0501044_0323069	3300049823	Bacteria	1467
979	Ga0501044_0486396	3300049823	Bacteria	1136
980	Ga0501044_0804969	3300049823	Bacteria	819
981	Ga0501045_0090802	3300049824	Bacteria	2257
982	nmdc:mga03683_11969_c1	3300050489	Bacteria	3155
983	nmdc:mga03683_12524_c1	3300050489	Bacteria	3101
984	nmdc:mga03683_299498_c1	3300050489	Bacteria	754
985	nmdc:mga03683_94557_c1	3300050489	Bacteria	1307
986	nmdc:mga03n38_83581_c1	3300050490	Bacteria	1506
987	nmdc:mga00v17_21458_c1	3300050491	Bacteria	3713
988	nmdc:mga00v17_376_c1	3300050491	Bacteria	25303
989	nmdc:mga0yw44_20733_c1	3300050492	Bacteria	3654
990	nmdc:mga0yw44_28579_c1	3300050492	Bacteria	3210
991	nmdc:mga0yw44_72164_c1	3300050492	Bacteria	2145
992	nmdc:mga0k408_241538_c1	3300050493	Bacteria	1078
993	nmdc:mga0k408_37180_c1	3300050493	Bacteria	2795
994	nmdc:mga06z11_110847_c1	3300050494	Bacteria	1519
995	nmdc:mga06z11_58196_c1	3300050494	Bacteria	2005
996	nmdc:mga04h51_50241_c1	3300050495	Bacteria	1396
997	nmdc:mga04h51_56055_c1	3300050495	Bacteria	1337
998	nmdc:mga07m45_505360_c1	3300050496	Bacteria	700
999	nmdc:mga05p37_112879_c1	3300050507	Bacteria	3342
1000	nmdc:mga05p37_122660_c1	3300050507	Bacteria	3192
1001	nmdc:mga05p37_218708_c1	3300050507	Bacteria	2300
1002	nmdc:mga05p37_221730_c1	3300050507	Bacteria	2282
1003	nmdc:mga05p37_362763_c1	3300050507	Bacteria	1703
1004	nmdc:mga05p37_381417_c1	3300050507	Bacteria	1652
1005	nmdc:mga09592_130035_c1	3300050508	Bacteria	2166
1006	nmdc:mga09592_28886_c1	3300050508	Bacteria	4611
1007	nmdc:mga09592_43819_c1	3300050508	Bacteria	3764
1008	nmdc:mga09592_519969_c1	3300050508	Bacteria	1024
1009	nmdc:mga0qj67_114080_c1	3300050509	Bacteria	2182
1010	nmdc:mga0qj67_180132_c1	3300050509	Bacteria	1716
1011	nmdc:mga0qj67_442510_c1	3300050509	Bacteria	1047
1012	nmdc:mga06r32_15477_c1	3300050510	Bacteria	6924
1013	nmdc:mga06r32_226321_c1	3300050510	Bacteria	1859
1014	nmdc:mga0n895_168729_c1	3300050512	Bacteria	2221
1015	nmdc:mga0n895_1967678_c1	3300050512	Unclassified	543
1016	nmdc:mga0n895_241636_c1	3300050512	Bacteria	1833
1017	nmdc:mga0n895_447339_c1	3300050512	Bacteria	1305
1018	nmdc:mga0n895_482310_c1	3300050512	Bacteria	1250
1019	nmdc:mga0n895_804228_c1	3300050512	Bacteria	930
1020	nmdc:mga0n895_814742_c1	3300050512	Bacteria	923
1021	nmdc:mga0n895_896766_c1	3300050512	Bacteria	872
1022	nmdc:mga0rr50_17999_c1	3300050513	Bacteria	4735
1023	nmdc:mga0rr50_218642_c1	3300050513	Bacteria	1573
1024	nmdc:mga08x19_158742_c1	3300050514	Bacteria	1535
1025	nmdc:mga08x19_2020_c1	3300050514	Bacteria	12437
1026	nmdc:mga08x19_225775_c1	3300050514	Bacteria	1288
1027	nmdc:mga08x19_336369_c1	3300050514	Bacteria	1053
1028	nmdc:mga08x19_579543_c1	3300050514	Bacteria	795
1029	nmdc:mga08x19_665064_c1	3300050514	Bacteria	739
1030	nmdc:mga08x19_77818_c1	3300050514	Bacteria	2173
1031	nmdc:mga08x19_80747_c1	3300050514	Bacteria	2135
1032	nmdc:mga08x19_84200_c1	3300050514	Bacteria	2092
1033	nmdc:mga08x19_95215_c1	3300050514	Bacteria	1970
1034	nmdc:mga0a205_11293_c1	3300050515	Bacteria	8224
1035	nmdc:mga0a205_172159_c1	3300050515	Bacteria	2061
1036	nmdc:mga0a205_383906_c1	3300050515	Bacteria	1270
1037	nmdc:mga0a205_42329_c1	3300050515	Bacteria	4388
1038	nmdc:mga0a205_42573_c1	3300050515	Bacteria	4376
1039	nmdc:mga0sz30_15822_c1	3300050516	Bacteria	2986
1040	nmdc:mga0sz30_321519_c1	3300050516	Bacteria	691
1041	Ga0500556_0000009	3300053104	Bacteria	288111
1042	Ga0500572_005244	3300053111	Bacteria	2933
1043	Ga0500595_037704	3300053119	Eukaryota	1575
1044	Ga0500595_045681	3300053119	Bacteria	1382
1045	Ga0500595_063539	3300053119	Bacteria	1109
1046	Ga0500608_000982	3300053122	Eukaryota	10241
1047	Ga0500608_208743	3300053122	Bacteria	800
1048	Ga0500618_002093	3300053125	Bacteria	7933
1049	Ga0500642_0231576	3300053130	Bacteria	853
1050	Ga0500652_056846	3300053131	Bacteria	1605
1051	Ga0500655_026884	3300053133	Bacteria	1097
1052	Ga0500561_0022003	3300053137	Bacteria	1509
1053	Ga0500573_0014889	3300053140	Bacteria	4404
1054	Ga0500616_0022997	3300053153	Bacteria	3476
1055	Ga0500620_140356	3300053155	Bacteria	844
1056	Ga0500624_001960	3300053157	Bacteria	2939
1057	Ga0500634_0006894	3300053161	Bacteria	5543
1058	Ga0500637_0366250	3300053178	Bacteria	761
1059	Ga0500645_031832	3300053730	Bacteria	1584
1060	Ga0500552_000131	3300053733	Bacteria	6371
1061	Ga0501084_0685166	3300054114	Bacteria	865
1062	Ga0501084_1328454	3300054114	Bacteria	603
1063	Ga0587084_000194	3300059477	Bacteria	3943
1064	Ga0587084_014509	3300059477	Bacteria	1100
1065	Ga0587084_018196	3300059477	Bacteria	1023
1066	Ga0587084_020842	3300059477	Bacteria	978
1067	Ga0587084_042169	3300059477	Bacteria	780
1068	Ga0587084_051507	3300059477	Bacteria	730
1069	Ga0587066_000828	3300059490	Bacteria	2820
1070	Ga0587070_027591	3300059491	Bacteria	1007
1071	Ga0587070_027933	3300059491	Bacteria	1003
1072	Ga0587070_032456	3300059491	Bacteria	955
1073	Ga0587070_038524	3300059491	Bacteria	903
1074	Ga0587073_0007397	3300059492	Bacteria	1734
1075	Ga0587077_000467	3300059493	Bacteria	3482
1076	Ga0587077_013755	3300059493	Bacteria	1320
1077	Ga0587077_026811	3300059493	Bacteria	1067
1078	Ga0587080_002394	3300059503	Bacteria	2200
1079	Ga0587080_032482	3300059503	Bacteria	916
1080	Ga0587080_055284	3300059503	Bacteria	760
1081	Ga0587082_002565	3300059504	Bacteria	2070
1082	Ga0587083_0009865	3300059505	Bacteria	1533
1083	Ga0587083_0011635	3300059505	Bacteria	1457
1084	Ga0587083_0014299	3300059505	Bacteria	1365
1085	Ga0587083_0130623	3300059505	Bacteria	659
1086	Ga0587085_006661	3300059506	Bacteria	1413
1087	Ga0587086_026145	3300059507	Bacteria	830
1088	Ga0587088_002354	3300059508	Bacteria	2136
1089	Ga0587088_010530	3300059508	Bacteria	1357
1090	Ga0587089_002184	3300059509	Bacteria	1949
1091	Ga0587090_000116	3300059510	Bacteria	5045
1092	Ga0587090_000346	3300059510	Bacteria	3693
1093	Ga0587090_003870	3300059510	Bacteria	1773
1094	Ga0587090_008630	3300059510	Bacteria	1372
1095	Ga0587091_000076	3300059511	Bacteria	5288
1096	Ga0587091_046513	3300059511	Bacteria	876
1097	Ga0587092_009456	3300059512	Bacteria	1312
1098	Ga0587092_015815	3300059512	Bacteria	1109
1099	Ga0587092_045784	3300059512	Bacteria	777
1100	Ga0587094_028213	3300059513	Bacteria	856
1101	Ga0587094_043974	3300059513	Bacteria	737
1102	Ga0587098_004005	3300059604	Bacteria	1362
1103	Ga0587098_026329	3300059604	Bacteria	774
1104	Ga0587106_088143	3300059605	Bacteria	615
1105	Ga0587125_015386	3300059607	Bacteria	848
1106	Ga0587131_003797	3300059609	Bacteria	887
1107	Ga0587101_006834	3300059623	Bacteria	1325
1108	Ga0587101_018940	3300059623	Bacteria	970
1109	Ga0587101_036287	3300059623	Bacteria	794
1110	Ga0587109_003459	3300059624	Bacteria	2108
1111	Ga0587109_075956	3300059624	Bacteria	735
1112	Ga0587109_143283	3300059624	Bacteria	585
1113	Ga0587115_005210	3300059626	Bacteria	1452
1114	Ga0587127_010510	3300059629	Bacteria	719
1115	Ga0587128_000318	3300059630	Bacteria	3287
1116	Ga0587130_004418	3300059631	Bacteria	1230
1117	Ga0587062_000535	3300059639	Bacteria	2743
1118	Ga0587062_003834	3300059639	Bacteria	1553
1119	Ga0587062_006275	3300059639	Bacteria	1345
1120	Ga0587062_030972	3300059639	Bacteria	819
1121	Ga0587062_040103	3300059639	Bacteria	756
1122	Ga0587067_000490	3300059640	Bacteria	3491
1123	Ga0587068_001964	3300059641	Bacteria	2424
1124	Ga0587068_004823	3300059641	Bacteria	1805
1125	Ga0587068_013373	3300059641	Bacteria	1265
1126	Ga0587068_094306	3300059641	Bacteria	621
1127	Ga0587069_002445	3300059642	Bacteria	1873
1128	Ga0587072_000652	3300059643	Bacteria	3718
1129	Ga0587072_016387	3300059643	Bacteria	1267
1130	Ga0587072_070419	3300059643	Bacteria	738
1131	Ga0587075_009312	3300059644	Bacteria	1277
1132	Ga0587075_076083	3300059644	Bacteria	632
1133	Ga0587075_076138	3300059644	Bacteria	632
1134	Ga0587076_005208	3300059645	Bacteria	1670
1135	Ga0587076_011834	3300059645	Bacteria	1291
1136	Ga0587076_023079	3300059645	Bacteria	1045
1137	Ga0587078_003436	3300059646	Bacteria	1605
1138	Ga0587079_014685	3300059647	Bacteria	1319
1139	Ga0587079_034148	3300059647	Bacteria	994
1140	Ga0587079_034352	3300059647	Bacteria	992
1141	Ga0587079_097372	3300059647	Bacteria	697
1142	Ga0587100_000626	3300059648	Bacteria	1772
1143	Ga0587102_003779	3300059649	Bacteria	1255
1144	Ga0587102_016951	3300059649	Bacteria	788
1145	Ga0587105_003380	3300059651	Bacteria	969
1146	Ga0587105_009059	3300059651	Bacteria	733
1147	Ga0587107_039252	3300059652	Bacteria	758
1148	Ga0587108_000493	3300059653	Bacteria	2042
1149	Ga0587110_010841	3300059654	Bacteria	917
1150	Ga0587110_032839	3300059654	Bacteria	640
1151	Ga0587114_004381	3300059655	Bacteria	1468
1152	Ga0587119_002635	3300059658	Bacteria	1639
1153	Ga0587124_000696	3300059660	Bacteria	1952
1154	Ga0587096_01945	3300060247	Bacteria	746
1155	Ga0587071_025568	3300060344	Bacteria	1109
1156	Ga0587071_029070	3300060344	Bacteria	1055
1157	Ga0587071_032689	3300060344	Bacteria	1010
1158	Ga0587071_071530	3300060344	Bacteria	756
1159	Ga0587071_123172	3300060344	Bacteria	622
1160	Ga0587111_0006620	3300060346	Bacteria	1846
1161	Ga0587111_0018754	3300060346	Bacteria	1305
1162	Ga0587111_0035607	3300060346	Bacteria	1039
1163	Ga0587111_0050132	3300060346	Bacteria	919
1164	Ga0587111_0070214	3300060346	Bacteria	816
1165	Ga0587111_0110532	3300060346	Bacteria	696
1166	Ga0501082_0150048	3300060353	Bacteria	2024
1167	Ga0501082_0381877	3300060353	Bacteria	1229
1168	Ga0530510_1207959	3300061734	Bacteria	580

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049569	Ga0501032_0231337	Ga0501032_0231337_17_466	149
2	3300031727	Ga0316576_10007763	Ga0316576_100077632	151
3	3300031727	Ga0316576_10117646	Ga0316576_101176462	151
4	3300031728	Ga0316578_10238321	Ga0316578_102383212	151
5	3300032139	Ga0316580_10060925	Ga0316580_100609251	151
6	3300033528	Ga0316588_1024473	Ga0316588_10244732	151
7	3300033541	Ga0316596_1012486	Ga0316596_10124862	151
8	3300035398	Ga0316574_0201217	Ga0316574_0201217_130_594	151
9	iso_pu_bacteria	2510065057	2510308691	152
10	iso_pu_bacteria	2511231027	2511388790	152
11	iso_pu_bacteria	2511231052	2511501252	152
12	iso_pu_bacteria	2512047086	2512532678	152
13	iso_pu_bacteria	2512875026	2512971993	152
14	iso_pu_bacteria	2513237086	2513588041	152
15	iso_pu_bacteria	2513237089	2513607232	152
16	iso_pu_bacteria	2513237091	2513620935	152
17	iso_pu_bacteria	2513237140	2513886948	152
18	iso_pu_bacteria	2513237143	2513907182	152
19	iso_pu_bacteria	2513237156	2513988320	152
20	iso_pu_bacteria	2513237159	2514000947	152
21	iso_pu_bacteria	2513237160	2514009033	152
22	iso_pu_bacteria	2513237351	2514589857	152
23	iso_pu_bacteria	2515154107	2515613516	152
24	iso_pu_bacteria	2516653046	2516892535	152
25	iso_pu_bacteria	2517487022	2517569347	152
26	iso_pu_bacteria	2524023207	2524454494	152
27	iso_pu_bacteria	2537561587	2537876780	152
28	iso_pu_bacteria	2551306084	2551676553	152
29	iso_pu_bacteria	2551306085	2551689520	152
30	iso_pu_bacteria	2551306086	2551692074	152
31	iso_pu_bacteria	2551306087	2551704557	152
32	iso_pu_bacteria	2551306089	2551712776	152
33	iso_pu_bacteria	2551306090	2551722341	152
34	iso_pu_bacteria	2551306091	2551728625	152
35	iso_pu_bacteria	2551306092	2551736768	152
36	iso_pu_bacteria	2551306093	2551742246	152
37	iso_pu_bacteria	2554235003	2554248099	152
38	iso_pu_bacteria	2558860242	2559295216	152
39	iso_pu_bacteria	2558860983	2561469517	152
40	iso_pu_bacteria	2582581283	2585169864	152
41	iso_pu_bacteria	2582581306	2585270535	152
42	iso_pu_bacteria	2582581865	2585391696	152
43	iso_pu_bacteria	2582581866	2585398309	152
44	iso_pu_bacteria	2599185156	2599333526	152
45	iso_pu_bacteria	2599185210	2599606574	152
46	iso_pu_bacteria	2599185236	2599724303	152
47	iso_pu_bacteria	2599185352	2600197835	152
48	iso_pu_bacteria	2600254933	2600373088	152
49	iso_pu_bacteria	2600255279	2601613130	152
50	iso_pu_bacteria	2600255308	2601749912	152
51	iso_pu_bacteria	2643221557	2643807795	152
52	iso_pu_bacteria	2643221558	2643811218	152
53	iso_pu_bacteria	2643221568	2643855301	152
54	iso_pu_bacteria	2643221582	2643919718	152
55	iso_pu_bacteria	2643221607	2644050052	152
56	iso_pu_bacteria	2643221610	2644068180	152
57	iso_pu_bacteria	2643221618	2644108088	152
58	iso_pu_bacteria	2643221626	2644150620	152
59	iso_pu_bacteria	2643221636	2644203812	152
60	iso_pu_bacteria	2643221637	2644209280	152
61	iso_pu_bacteria	2643221655	2644312096	152
62	iso_pu_bacteria	2643221659	2644335657	152
63	iso_pu_bacteria	2643221668	2644379396	152
64	iso_pu_bacteria	2643221675	2644419124	152
65	iso_pu_bacteria	2643221680	2644452463	152
66	iso_pu_bacteria	2643221686	2644482966	152
67	iso_pu_bacteria	2643221688	2644494003	152
68	iso_pu_bacteria	2643221689	2644497070	152
69	iso_pu_bacteria	2643221693	2644520555	152
70	iso_pu_bacteria	2643221698	2644545557	152
71	iso_pu_bacteria	2643221712	2644617769	152
72	iso_pu_bacteria	2643221718	2644652799	152
73	iso_pu_bacteria	2643221723	2644675240	152
74	iso_pu_bacteria	2643221726	2644687265	152
75	iso_pu_bacteria	2738541317	2738949025	152
76	iso_pu_bacteria	2757320392	2757572712	152
77	iso_pu_bacteria	2765235802	2765465528	152
78	iso_pu_bacteria	2767802442	2770195554	152
79	iso_pu_bacteria	2775506902	2776271584	152
80	iso_pu_bacteria	2775506904	2776279904	152
81	iso_pu_bacteria	2775507049	2776913072	152
82	iso_pu_bacteria	2791355253	2793282400	152
83	iso_pu_bacteria	2802428858	2802719360	152
84	iso_pu_bacteria	2802428859	2802723079	152
85	iso_pu_bacteria	2802428860	2802734895	152
86	iso_pu_bacteria	2802428861	2802741366	152
87	iso_pu_bacteria	2802428862	2802745065	152
88	iso_pu_bacteria	2802428863	2802751500	152
89	iso_pu_bacteria	2808606387	2808990397	152
90	iso_pu_bacteria	2818991439	2819562515	152
91	iso_pu_bacteria	2821123053	2821124568	152
92	iso_pu_bacteria	2838074704	2838081156	152
93	iso_pu_bacteria	2838675328	2838675929	152
94	iso_pu_bacteria	2838714209	2838714811	152
95	iso_pu_bacteria	2838719591	2838721388	152
96	iso_pu_bacteria	2838724970	2838725571	152
97	iso_pu_bacteria	2838736955	2838742528	152
98	iso_pu_bacteria	2839993093	2839995603	152
99	iso_pu_bacteria	2840764183	2840768010	152
100	iso_pu_bacteria	2840878972	2840880926	152
101	iso_pu_bacteria	2841840854	2841845167	152
102	iso_pu_bacteria	2841846520	2841848355	152
103	iso_pu_bacteria	2841859092	2841864293	152
104	iso_pu_bacteria	2842124991	2842125615	152
105	iso_pu_bacteria	2842130223	2842130824	152
106	iso_pu_bacteria	2842140634	2842146221	152
107	iso_pu_bacteria	2842152218	2842154006	152
108	iso_pu_bacteria	2842170452	2842171055	152
109	iso_pu_bacteria	2842175837	2842177626	152
110	iso_pu_bacteria	2842187318	2842187920	152
111	iso_pu_bacteria	2842211629	2842212231	152
112	iso_pu_bacteria	2842224351	2842226150	152
113	iso_pu_bacteria	2842515876	2842521075	152
114	iso_pu_bacteria	2842521101	2842527583	152
115	iso_pu_bacteria	2842871566	2842872914	152
116	iso_pu_bacteria	2842922631	2842925066	152
117	iso_pu_bacteria	2844163670	2844169870	152
118	iso_pu_bacteria	2848694841	2848697725	152
119	iso_pu_bacteria	2854911287	2854912172	152
120	iso_pu_bacteria	2855825444	2855831605	152
121	iso_pu_bacteria	2855839649	2855840723	152
122	iso_pu_bacteria	2857531043	2857532149	152
123	iso_pu_bacteria	2858800743	2858801250	152
124	iso_pu_bacteria	2871474448	2871481001	152
125	iso_pu_bacteria	2886627955	2886631837	152
126	iso_pu_bacteria	2891048133	2891050814	152
127	iso_pu_bacteria	2894652903	2894657473	152
128	iso_pu_bacteria	2894817345	2894820206	152
129	iso_pu_bacteria	2899792073	2899794891	152
130	iso_pu_bacteria	2899803654	2899807812	152
131	iso_pu_bacteria	2899845264	2899849526	152
132	iso_pu_bacteria	2904578770	2904584128	152
133	iso_pu_bacteria	2913308742	2913309924	152
134	iso_pu_bacteria	2913844669	2913845974	152
135	iso_pu_bacteria	2913912277	2913916078	152
136	iso_pu_bacteria	2915650412	2915652226	152
137	iso_pu_bacteria	2915980308	2915985687	152
138	iso_pu_bacteria	2915986958	2915991782	152
139	iso_pu_bacteria	2915993759	2915994249	152
140	iso_pu_bacteria	2916000859	2916002595	152
141	iso_pu_bacteria	2916007675	2916008334	152
142	iso_pu_bacteria	2916014648	2916018794	152
143	iso_pu_bacteria	2916021584	2916026402	152
144	iso_pu_bacteria	2916028427	2916028800	152
145	iso_pu_bacteria	2916035215	2916041615	152
146	iso_pu_bacteria	2916041962	2916048629	152
147	iso_pu_bacteria	2916048683	2916054746	152
148	iso_pu_bacteria	2916055098	2916061395	152
149	iso_pu_bacteria	2916061851	2916065871	152
150	iso_pu_bacteria	2916068649	2916074757	152
151	iso_pu_bacteria	2916076590	2916078688	152
152	iso_pu_bacteria	2919114240	2919114900	152
153	iso_pu_bacteria	2919119836	2919124999	152
154	iso_pu_bacteria	2919166419	2919171136	152
155	iso_pu_bacteria	2920760137	2920765460	152
156	iso_pu_bacteria	2921201388	2921208163	152
157	iso_pu_bacteria	2921208531	2921209576	152
158	iso_pu_bacteria	2921237296	2921237919	152
159	iso_pu_bacteria	2921244191	2921248053	152
160	iso_pu_bacteria	2921250672	2921256435	152
161	iso_pu_bacteria	2921257292	2921263923	152
162	iso_pu_bacteria	2921263974	2921270705	152
163	iso_pu_bacteria	2921282425	2921285928	152
164	iso_pu_bacteria	2921289301	2921290208	152
165	iso_pu_bacteria	2924144063	2924147648	152
166	iso_pu_bacteria	2924150972	2924151432	152
167	iso_pu_bacteria	2924158325	2924165030	152
168	iso_pu_bacteria	2924165586	2924166716	152
169	iso_pu_bacteria	2924172951	2924173400	152
170	iso_pu_bacteria	2924179722	2924184604	152
171	iso_pu_bacteria	2924186466	2924188446	152
172	iso_pu_bacteria	2924193448	2924200448	152
173	iso_pu_bacteria	2924200457	2924204274	152
174	iso_pu_bacteria	2924207177	2924213720	152
175	iso_pu_bacteria	2924214083	2924214279	152
176	iso_pu_bacteria	2924221636	2924222625	152
177	iso_pu_bacteria	2924228884	2924233697	152
178	iso_pu_bacteria	2926754445	2926755866	152
179	iso_pu_bacteria	2926760298	2926762964	152
180	iso_pu_bacteria	2928521798	2928524371	152
181	iso_pu_bacteria	2929138655	2929140724	152
182	iso_pu_bacteria	2933006813	2933008651	152
183	iso_pu_bacteria	2933011516	2933012093	152
184	iso_pu_bacteria	2933594066	2933596746	152
185	iso_pu_bacteria	2936996657	2937000825	152
186	iso_pu_bacteria	2937002841	2937008132	152
187	iso_pu_bacteria	2937009748	2937016100	152
188	iso_pu_bacteria	2937016420	2937019580	152
189	iso_pu_bacteria	2937023124	2937028808	152
190	iso_pu_bacteria	2937029754	2937034942	152
191	iso_pu_bacteria	2937036028	2937040771	152
192	iso_pu_bacteria	2937042894	2937045141	152
193	iso_pu_bacteria	2937049772	2937050594	152
194	iso_pu_bacteria	2937056579	2937060849	152
195	iso_pu_bacteria	2937063883	2937069343	152
196	iso_pu_bacteria	2937071275	2937076533	152
197	iso_pu_bacteria	2937078374	2937079364	152
198	iso_pu_bacteria	2937084907	2937088469	152
199	iso_pu_bacteria	2937091812	2937096851	152
200	iso_pu_bacteria	2937098957	2937104536	152
201	iso_pu_bacteria	2937106411	2937109561	152
202	iso_pu_bacteria	2937113482	2937118914	152
203	iso_pu_bacteria	2937119839	2937125672	152
204	iso_pu_bacteria	2937126314	2937129949	152
205	iso_pu_bacteria	2941499720	2941499965	152
206	iso_pu_bacteria	2954011201	2954015353	152
207	iso_pu_bacteria	2957375807	2957377151	152
208	iso_pu_bacteria	2957382221	2957385731	152
209	iso_pu_bacteria	2957388812	2957388854	152
210	iso_pu_bacteria	2957395598	2957396195	152
211	iso_pu_bacteria	2957402308	2957406460	152
212	iso_pu_bacteria	2957408893	2957413687	152
213	iso_pu_bacteria	2957415311	2957418187	152
214	iso_pu_bacteria	2957422303	2957427674	152
215	iso_pu_bacteria	2957430029	2957437125	152
216	iso_pu_bacteria	2957437181	2957443015	152
217	iso_pu_bacteria	2957443900	2957450454	152
218	iso_pu_bacteria	2957450854	2957453217	152
219	iso_pu_bacteria	2957457609	2957464217	152
220	iso_pu_bacteria	2957464669	2957468135	152
221	iso_pu_bacteria	2957471148	2957472512	152
222	iso_pu_bacteria	2957478035	2957484395	152
223	iso_pu_bacteria	2957484790	2957485478	152
224	iso_pu_bacteria	2957491536	2957496693	152
225	iso_pu_bacteria	2957498199	2957498741	152
226	iso_pu_bacteria	2957505466	2957506265	152
227	iso_pu_bacteria	2960584000	2960584796	152
228	iso_pu_bacteria	2960591022	2960593504	152
229	iso_pu_bacteria	2960597568	2960603513	152
230	iso_pu_bacteria	2960603979	2960608980	152
231	iso_pu_bacteria	2960610863	2960617129	152
232	iso_pu_bacteria	2960617483	2960623330	152
233	iso_pu_bacteria	2960624210	2960624975	152
234	iso_pu_bacteria	2960631154	2960633896	152
235	iso_pu_bacteria	2960637947	2960638731	152
236	iso_pu_bacteria	2960645483	2960646268	152
237	iso_pu_bacteria	2960652885	2960656992	152
238	iso_pu_bacteria	2960660292	2960667042	152
239	iso_pu_bacteria	2960667422	2960673503	152
240	iso_pu_bacteria	2960674078	2960677314	152
241	iso_pu_bacteria	2960680706	2960685091	152
242	iso_pu_bacteria	2960687367	2960693879	152
243	iso_pu_bacteria	2960693952	2960694304	152
244	iso_pu_bacteria	2964607997	2964611298	152
245	iso_pu_bacteria	2964615318	2964621934	152
246	iso_pu_bacteria	2964621998	2964626429	152
247	iso_pu_bacteria	2964628898	2964629621	152
248	iso_pu_bacteria	2964636051	2964641198	152
249	iso_pu_bacteria	2964643177	2964647045	152
250	iso_pu_bacteria	2964649959	2964652827	152
251	iso_pu_bacteria	2964656573	2964661967	152
252	iso_pu_bacteria	2964663802	2964670563	152
253	iso_pu_bacteria	2964670856	2964678022	152
254	iso_pu_bacteria	2964678106	2964679081	152
255	iso_pu_bacteria	2964685014	2964685721	152
256	iso_pu_bacteria	2964691889	2964692399	152
257	iso_pu_bacteria	2964698721	2964703406	152
258	iso_pu_bacteria	2964705432	2964710575	152
259	iso_pu_bacteria	2964712639	2964717118	152
260	iso_pu_bacteria	2964719344	2964720211	152
261	iso_pu_bacteria	2967664464	2967671068	152
262	iso_pu_bacteria	2967671571	2967672266	152
263	iso_pu_bacteria	2967678726	2967683428	152
264	iso_pu_bacteria	2967686174	2967688616	152
265	iso_pu_bacteria	2967693043	2967694516	152
266	iso_pu_bacteria	2967699805	2967702476	152
267	iso_pu_bacteria	2967706974	2967709461	152
268	iso_pu_bacteria	2967714385	2967718823	152
269	iso_pu_bacteria	2967721400	2967726191	152
270	iso_pu_bacteria	2967728569	2967729671	152
271	iso_pu_bacteria	2967735183	2967739563	152
272	iso_pu_bacteria	2967742019	2967745179	152
273	iso_pu_bacteria	2967748971	2967755125	152
274	iso_pu_bacteria	2967755722	2967761999	152
275	iso_pu_bacteria	2967762386	2967766759	152
276	iso_pu_bacteria	2967769361	2967772564	152
277	iso_pu_bacteria	2967775926	2967777623	152
278	iso_pu_bacteria	2970019648	2970022730	152
279	iso_pu_bacteria	2970026789	2970027651	152
280	iso_pu_bacteria	2970033650	2970036706	152
281	iso_pu_bacteria	2970040964	2970047690	152
282	iso_pu_bacteria	2970047711	2970051775	152
283	iso_pu_bacteria	2970054988	2970060953	152
284	iso_pu_bacteria	2970061556	2970062573	152
285	iso_pu_bacteria	2970068827	2970069350	152
286	iso_pu_bacteria	2970076120	2970079527	152
287	iso_pu_bacteria	2970082768	2970086657	152
288	iso_pu_bacteria	2970088815	2970091758	152
289	iso_pu_bacteria	2970095765	2970097621	152
290	iso_pu_bacteria	2970102677	2970108598	152
291	iso_pu_bacteria	2970109326	2970115897	152
292	iso_pu_bacteria	2970116247	2970120762	152
293	iso_pu_bacteria	2970122695	2970123189	152
294	iso_pu_bacteria	2970129317	2970129794	152
295	iso_pu_bacteria	2970136068	2970137100	152
296	iso_pu_bacteria	2970143518	2970149791	152
297	iso_pu_bacteria	2970149975	2970156667	152
298	iso_pu_bacteria	2970156795	2970157839	152
299	iso_pu_bacteria	2970164137	2970167587	152
300	iso_pu_bacteria	2970170962	2970177747	152
301	iso_pu_bacteria	2970177841	2970178687	152
302	iso_pu_bacteria	2970184632	2970190727	152
303	iso_pu_bacteria	2970191845	2970198885	152
304	iso_pu_bacteria	2977516862	2977520522	152
305	iso_pu_bacteria	2977523885	2977530176	152
306	iso_pu_bacteria	2977530762	2977532325	152
307	iso_pu_bacteria	2977537788	2977541427	152
308	iso_pu_bacteria	2977544691	2977551441	152
309	iso_pu_bacteria	2977551784	2977557519	152
310	iso_pu_bacteria	2977558990	2977561320	152
311	iso_pu_bacteria	2977565890	2977569809	152
312	iso_pu_bacteria	2977572785	2977579460	152
313	iso_pu_bacteria	2977579622	2977583923	152
314	iso_pu_bacteria	2978969890	2978974463	152
315	iso_pu_bacteria	2979089926	2979094543	152
316	iso_pu_bacteria	2979095461	2979098074	152
317	iso_pu_bacteria	2979100975	2979103785	152
318	iso_pu_bacteria	2984509177	2984511649	152
319	iso_pu_bacteria	2984518228	2984521990	152
320	iso_pu_bacteria	2984537506	2984541288	152
321	iso_pu_bacteria	2984587000	2984589801	152
322	iso_pu_bacteria	2984601300	2984603566	152
323	iso_pu_bacteria	2995392953	2995396818	152
324	iso_pu_bacteria	3000405567	3000406738	152
325	iso_pu_bacteria	3002141150	3002143956	152
326	iso_pu_bacteria	642555144	642602858	152
327	iso_pu_bacteria	648276728	648741484	152
328	iso_pu_bacteria	650716007	650740422	152
329	iso_pu_bacteria	8003570095	8003571484	152
330	iso_pu_bacteria	8003992118	8003993221	152
331	iso_pu_bacteria	8003999396	8004000478	152
332	iso_pu_bacteria	8018150411	8018150844	152
333	iso_pu_bacteria	8024486573	8024489508	152
334	iso_pu_bacteria	8045864390	8045865511	152
335	iso_pu_bacteria	8054460903	8054461997	152
336	iso_pu_bacteria	8055431914	8055433332	152
337	iso_pu_bacteria	8056875544	8056879561	152
338	3300005329	Ga0070683_101990787	Ga0070683_1019907871	155
339	3300005353	Ga0070669_100489096	Ga0070669_1004890962	155
340	3300005364	Ga0070673_101395420	Ga0070673_1013954201	155
341	3300005441	Ga0070700_100059343	Ga0070700_1000593433	155
342	3300005444	Ga0070694_100097911	Ga0070694_1000979112	155
343	3300005445	Ga0070708_101923514	Ga0070708_1019235141	155
344	3300005471	Ga0070698_100020633	Ga0070698_1000206333	155
345	3300005617	Ga0068859_100069346	Ga0068859_1000693462	155
346	3300005844	Ga0068862_100004463	Ga0068862_10000446316	155
347	3300006846	Ga0075430_100349862	Ga0075430_1003498622	155
348	3300006846	Ga0075430_100748103	Ga0075430_1007481032	155
349	3300006847	Ga0075431_100030949	Ga0075431_1000309492	155
350	3300006852	Ga0075433_10021001	Ga0075433_100210013	155
351	3300006880	Ga0075429_100551003	Ga0075429_1005510032	155
352	3300006880	Ga0075429_100594209	Ga0075429_1005942092	155
353	3300006880	Ga0075429_100929255	Ga0075429_1009292552	155
354	3300006931	Ga0097620_100069341	Ga0097620_1000693413	155
355	3300009147	Ga0114129_10053448	Ga0114129_100534482	155
356	3300013308	Ga0157375_12713233	Ga0157375_127132331	155
357	3300014325	Ga0163163_12939672	Ga0163163_129396721	155
358	3300019188	Ga0184599_137719	Ga0184599_1377192	155
359	3300019190	Ga0184600_146945	Ga0184600_1469451	155
360	3300022729	Ga0228599_100006	Ga0228599_1000064	155
361	3300022730	Ga0224570_103548	Ga0224570_1035481	155
362	3300023017	Ga0224574_100003	Ga0224574_1000036	155
363	3300023224	Ga0224575_100001	Ga0224575_10000151	155
364	3300023553	Ga0247524_100006	Ga0247524_1000063	155
365	3300023556	Ga0247519_100040	Ga0247519_1000405	155
366	3300023557	Ga0247521_100004	Ga0247521_1000043	155
367	3300023558	Ga0247526_100030	Ga0247526_1000301	155
368	3300023559	Ga0247529_100006	Ga0247529_1000064	155
369	3300023560	Ga0247514_100008	Ga0247514_1000083	155
370	3300023561	Ga0247518_103828	Ga0247518_1038281	155
371	3300023562	Ga0247516_100008	Ga0247516_1000084	155
372	3300023563	Ga0247530_100004	Ga0247530_1000044	155
373	3300023564	Ga0247515_103436	Ga0247515_1034361	155
374	3300023664	Ga0247527_100022	Ga0247527_1000221	155
375	3300023666	Ga0247531_100006	Ga0247531_1000064	155
376	3300023668	Ga0247525_102717	Ga0247525_1027171	155
377	3300023672	Ga0247553_101559	Ga0247553_1015591	155
378	3300023680	Ga0247528_100005	Ga0247528_1000053	155
379	3300023682	Ga0247513_101884	Ga0247513_1018841	155
380	3300023684	Ga0247523_100004	Ga0247523_1000043	155
381	3300023686	Ga0247520_100012	Ga0247520_1000121	155
382	3300023688	Ga0247522_100007	Ga0247522_1000071	155
383	3300023689	Ga0247517_100006	Ga0247517_1000064	155
384	3300023690	Ga0247512_100007	Ga0247512_1000071	155
385	3300024123	Ga0228600_1000116	Ga0228600_10001164	155
386	3300025885	Ga0207653_10038907	Ga0207653_100389071	155
387	3300025944	Ga0207661_12021407	Ga0207661_120214071	155
388	3300026075	Ga0207708_10080944	Ga0207708_100809443	155
389	3300026095	Ga0207676_10124942	Ga0207676_101249422	155
390	3300028019	Ga0224573_1000103	Ga0224573_10001033	155
391	3300031240	Ga0265320_10014519	Ga0265320_100145193	155
392	3300031591	Ga0310116_100009	Ga0310116_1000093	155
393	3300031592	Ga0310117_105864	Ga0310117_1058642	155
394	3300031614	Ga0310103_100008	Ga0310103_1000083	155
395	3300031615	Ga0310107_104569	Ga0310107_1045691	155
396	3300031632	Ga0310102_100706	Ga0310102_1007061	155
397	3300031633	Ga0310108_100006	Ga0310108_1000063	155
398	3300031634	Ga0310106_101991	Ga0310106_1019912	155
399	3300031635	Ga0310115_100133	Ga0310115_1001331	155
400	3300031636	Ga0310113_100005	Ga0310113_1000054	155
401	3300031664	Ga0310118_103019	Ga0310118_1030191	155
402	3300031666	Ga0310105_100011	Ga0310105_1000113	155
403	3300031667	Ga0310111_100010	Ga0310111_1000101	155
404	3300031678	Ga0310114_105310	Ga0310114_1053101	155
405	3300031686	Ga0310119_109089	Ga0310119_1090891	155
406	3300031690	Ga0310101_107313	Ga0310101_1073131	155
407	3300031691	Ga0316579_10004574	Ga0316579_100045745	155
408	3300031691	Ga0316579_10028959	Ga0316579_100289593	155
409	3300031727	Ga0316576_10103016	Ga0316576_101030162	155
410	3300031727	Ga0316576_10470372	Ga0316576_104703721	155
411	3300031733	Ga0316577_10013093	Ga0316577_100130932	155
412	3300031733	Ga0316577_10066886	Ga0316577_100668862	155
413	3300031733	Ga0316577_10286829	Ga0316577_102868292	155
414	3300031810	Ga0316044_100009	Ga0316044_1000093	155
415	3300031815	Ga0316045_104310	Ga0316045_1043101	155
416	3300031816	Ga0316042_100010	Ga0316042_1000103	155
417	3300031828	Ga0316043_100014	Ga0316043_1000143	155
418	3300031852	Ga0307410_10067770	Ga0307410_100677702	155
419	3300031995	Ga0307409_100287312	Ga0307409_1002873122	155
420	3300032120	Ga0316053_100381	Ga0316053_1003812	155
421	3300032168	Ga0316593_10001313	Ga0316593_100013133	155
422	3300032168	Ga0316593_10001356	Ga0316593_100013563	155
423	3300032168	Ga0316593_10011696	Ga0316593_100116964	155
424	3300032168	Ga0316593_10022318	Ga0316593_100223182	155
425	3300032168	Ga0316593_10027404	Ga0316593_100274041	155
426	3300032168	Ga0316593_10048645	Ga0316593_100486452	155
427	3300033524	Ga0316592_1001137	Ga0316592_10011373	155
428	3300033524	Ga0316592_1008120	Ga0316592_10081202	155
429	3300033524	Ga0316592_1029029	Ga0316592_10290292	155
430	3300033541	Ga0316596_1008989	Ga0316596_10089892	155
431	3300033541	Ga0316596_1016241	Ga0316596_10162413	155
432	3300033541	Ga0316596_1062252	Ga0316596_10622522	155
433	3300033544	Ga0316215_1000447	Ga0316215_10004473	155
434	3300033545	Ga0316214_1000021	Ga0316214_10000219	155
435	3300033546	Ga0316213_1000001	Ga0316213_100000150	155
436	3300033547	Ga0316212_1000053	Ga0316212_10000533	155
437	3300033548	Ga0316216_1000028	Ga0316216_10000284	155
438	3300036242	Ga0310104_00014	Ga0310104_00014_8373_8840	155
439	3300036458	Ga0310112_010555	Ga0310112_010555_75_542	155
440	3300036534	Ga0310109_004054	Ga0310109_004054_75_542	155
441	3300036535	Ga0310110_000018	Ga0310110_000018_8391_8858	155
442	3300036647	Ga0316582_0019539	Ga0316582_0019539_2111_2578	155
443	3300036647	Ga0316582_0169416	Ga0316582_0169416_490_957	155
444	3300036647	Ga0316582_0292713	Ga0316582_0292713_118_585	155
445	3300036712	Ga0316584_0041571	Ga0316584_0041571_888_1355	155
446	3300036712	Ga0316584_0405802	Ga0316584_0405802_405_872	155
447	3300042876	Ga0451577_0023413	Ga0451577_0023413_2540_3007	155
448	3300042876	Ga0451577_0458578	Ga0451577_0458578_33_500	155
449	3300044673	Ga0453683_0027900	Ga0453683_0027900_2839_3306	155
450	3300044712	Ga0453684_0001800	Ga0453684_0001800_3235_3702	155
451	3300044712	Ga0453684_0094742	Ga0453684_0094742_2405_2872	155
452	3300044712	Ga0453684_0161323	Ga0453684_0161323_1083_1550	155
453	3300044712	Ga0453684_0166881	Ga0453684_0166881_339_806	155
454	3300044712	Ga0453684_0184721	Ga0453684_0184721_1895_2362	155
455	3300044712	Ga0453684_0265980	Ga0453684_0265980_172_639	155
456	3300044712	Ga0453684_0266516	Ga0453684_0266516_1429_1896	155
457	3300044712	Ga0453684_0288982	Ga0453684_0288982_204_671	155
458	3300044712	Ga0453684_0303607	Ga0453684_0303607_591_1058	155
459	3300044712	Ga0453684_0377087	Ga0453684_0377087_157_624	155
460	3300044712	Ga0453684_0589085	Ga0453684_0589085_171_638	155
461	3300044712	Ga0453684_0625310	Ga0453684_0625310_463_930	155
462	3300044712	Ga0453684_0648500	Ga0453684_0648500_568_1035	155
463	3300044712	Ga0453684_1685930	Ga0453684_1685930_83_550	155
464	3300045051	Ga0451576_0000115	Ga0451576_0000115_2716_3183	155
465	3300045051	Ga0451576_0004127	Ga0451576_0004127_740_1207	155
466	3300045051	Ga0451576_0350197	Ga0451576_0350197_806_1273	155
467	3300048917	Ga0496114_0985917	Ga0496114_0985917_68_535	155
468	3300049162	Ga0501307_012020	Ga0501307_012020_542_1009	155
469	3300049677	Ga0501247_086197	Ga0501247_086197_11_478	155
470	3300050507	nmdc:mga05p37_362763_c1	nmdc:mga05p37_362763_c1_314_781	155
471	3300050508	nmdc:mga09592_130035_c1	nmdc:mga09592_130035_c1_670_1137	155
472	3300050508	nmdc:mga09592_43819_c1	nmdc:mga09592_43819_c1_258_725	155
473	3300050508	nmdc:mga09592_519969_c1	nmdc:mga09592_519969_c1_89_556	155
474	3300050509	nmdc:mga0qj67_114080_c1	nmdc:mga0qj67_114080_c1_1635_2102	155
475	3300050509	nmdc:mga0qj67_180132_c1	nmdc:mga0qj67_180132_c1_1093_1560	155
476	3300050509	nmdc:mga0qj67_442510_c1	nmdc:mga0qj67_442510_c1_29_496	155
477	3300050510	nmdc:mga06r32_226321_c1	nmdc:mga06r32_226321_c1_103_570	155
478	3300050515	nmdc:mga0a205_11293_c1	nmdc:mga0a205_11293_c1_848_1315	155
479	3300053119	Ga0500595_037704	Ga0500595_037704_593_1060	155
480	3300053122	Ga0500608_000982	Ga0500608_000982_8224_8691	155
481	2162886007	SwRhRL2b_contig_1389529	SwRhRL2b_0151.00005510	156
482	3300002987	JGI25159J45721_1001952	JGI25159J45721_10019522	156
483	3300003203	JGI25406J46586_10008069	JGI25406J46586_100080695	156
484	3300003354	JGI25160J50197_1004230	JGI25160J50197_10042302	156
485	3300003374	JGI25161J50226_1002211	JGI25161J50226_10022115	156
486	3300003578	Ga0006562J51391_1010415	Ga0006562J51391_10104153	156
487	3300003771	Ga0055526_1008996	Ga0055526_10089962	156
488	3300003775	Ga0055524_1007170	Ga0055524_10071702	156
489	3300003781	Ga0055536_1003806	Ga0055536_10038062	156
490	3300003792	Ga0055540_1021361	Ga0055540_10213612	156
491	3300003794	Ga0055531_10005861	Ga0055531_100058612	156
492	3300003856	Ga0058692_1006179	Ga0058692_10061793	156
493	3300003856	Ga0058692_1024612	Ga0058692_10246122	156
494	3300004625	Ga0055543_1002033	Ga0055543_10020335	156
495	3300004800	Ga0058861_11942464	Ga0058861_119424641	156
496	3300005262	Ga0065165_1005547	Ga0065165_10055473	156
497	3300005289	Ga0065704_10440748	Ga0065704_104407481	156
498	3300005295	Ga0065707_10025495	Ga0065707_100254952	156
499	3300005295	Ga0065707_10033700	Ga0065707_100337004	156
500	3300005295	Ga0065707_10157702	Ga0065707_101577021	156
501	3300005327	Ga0070658_11148970	Ga0070658_111489701	156
502	3300005328	Ga0070676_10370972	Ga0070676_103709722	156
503	3300005330	Ga0070690_100475008	Ga0070690_1004750081	156
504	3300005330	Ga0070690_100685505	Ga0070690_1006855052	156
505	3300005334	Ga0068869_100742563	Ga0068869_1007425632	156
506	3300005334	Ga0068869_101098948	Ga0068869_1010989481	156
507	3300005336	Ga0070680_100217943	Ga0070680_1002179432	156
508	3300005336	Ga0070680_100803460	Ga0070680_1008034601	156
509	3300005338	Ga0068868_101705859	Ga0068868_1017058591	156
510	3300005339	Ga0070660_100439813	Ga0070660_1004398132	156
511	3300005341	Ga0070691_10063694	Ga0070691_100636942	156
512	3300005345	Ga0070692_10026471	Ga0070692_100264712	156
513	3300005364	Ga0070673_101539381	Ga0070673_1015393811	156
514	3300005406	Ga0070703_10005588	Ga0070703_100055881	156
515	3300005434	Ga0070709_10687360	Ga0070709_106873601	156
516	3300005434	Ga0070709_10752389	Ga0070709_107523891	156
517	3300005435	Ga0070714_100032363	Ga0070714_1000323635	156
518	3300005435	Ga0070714_100165157	Ga0070714_1001651572	156
519	3300005435	Ga0070714_100708344	Ga0070714_1007083441	156
520	3300005435	Ga0070714_102093727	Ga0070714_1020937271	156
521	3300005436	Ga0070713_100011962	Ga0070713_1000119622	156
522	3300005436	Ga0070713_100131656	Ga0070713_1001316564	156
523	3300005436	Ga0070713_100379574	Ga0070713_1003795743	156
524	3300005436	Ga0070713_100739284	Ga0070713_1007392841	156
525	3300005436	Ga0070713_101234206	Ga0070713_1012342062	156
526	3300005438	Ga0070701_10166564	Ga0070701_101665642	156
527	3300005439	Ga0070711_101531383	Ga0070711_1015313831	156
528	3300005440	Ga0070705_100458742	Ga0070705_1004587421	156
529	3300005440	Ga0070705_100510181	Ga0070705_1005101812	156
530	3300005441	Ga0070700_100087745	Ga0070700_1000877452	156
531	3300005444	Ga0070694_100480779	Ga0070694_1004807792	156
532	3300005444	Ga0070694_100626602	Ga0070694_1006266022	156
533	3300005445	Ga0070708_100000929	Ga0070708_10000092910	156
534	3300005445	Ga0070708_100001716	Ga0070708_1000017169	156
535	3300005445	Ga0070708_100003460	Ga0070708_1000034608	156
536	3300005445	Ga0070708_100039163	Ga0070708_1000391632	156
537	3300005445	Ga0070708_100092548	Ga0070708_1000925482	156
538	3300005445	Ga0070708_100195512	Ga0070708_1001955122	156
539	3300005445	Ga0070708_100405614	Ga0070708_1004056142	156
540	3300005445	Ga0070708_100445328	Ga0070708_1004453282	156
541	3300005445	Ga0070708_100451696	Ga0070708_1004516961	156
542	3300005445	Ga0070708_100457963	Ga0070708_1004579632	156
543	3300005445	Ga0070708_100465650	Ga0070708_1004656502	156
544	3300005445	Ga0070708_100682126	Ga0070708_1006821262	156
545	3300005445	Ga0070708_100712203	Ga0070708_1007122032	156
546	3300005445	Ga0070708_100945653	Ga0070708_1009456532	156
547	3300005445	Ga0070708_100990088	Ga0070708_1009900882	156
548	3300005445	Ga0070708_101003999	Ga0070708_1010039992	156
549	3300005445	Ga0070708_101088610	Ga0070708_1010886102	156
550	3300005445	Ga0070708_101357593	Ga0070708_1013575931	156
551	3300005445	Ga0070708_101494383	Ga0070708_1014943831	156
552	3300005456	Ga0070678_101269104	Ga0070678_1012691041	156
553	3300005457	Ga0070662_100503136	Ga0070662_1005031362	156
554	3300005458	Ga0070681_10034374	Ga0070681_100343743	156
555	3300005458	Ga0070681_10440471	Ga0070681_104404712	156
556	3300005459	Ga0068867_100299091	Ga0068867_1002990912	156
557	3300005466	Ga0070685_10482286	Ga0070685_104822861	156
558	3300005467	Ga0070706_100000206	Ga0070706_10000020676	156
559	3300005467	Ga0070706_100001515	Ga0070706_10000151510	156
560	3300005467	Ga0070706_100001725	Ga0070706_10000172510	156
561	3300005467	Ga0070706_100004461	Ga0070706_1000044616	156
562	3300005467	Ga0070706_100007484	Ga0070706_1000074844	156
563	3300005467	Ga0070706_100008741	Ga0070706_1000087413	156
564	3300005467	Ga0070706_100040167	Ga0070706_1000401672	156
565	3300005467	Ga0070706_100048490	Ga0070706_1000484902	156
566	3300005467	Ga0070706_100060322	Ga0070706_1000603222	156
567	3300005467	Ga0070706_100066062	Ga0070706_1000660622	156
568	3300005467	Ga0070706_100072299	Ga0070706_1000722993	156
569	3300005467	Ga0070706_100084896	Ga0070706_1000848962	156
570	3300005467	Ga0070706_100114493	Ga0070706_1001144933	156
571	3300005467	Ga0070706_100164552	Ga0070706_1001645522	156
572	3300005467	Ga0070706_100329215	Ga0070706_1003292152	156
573	3300005467	Ga0070706_100433955	Ga0070706_1004339552	156
574	3300005467	Ga0070706_100852442	Ga0070706_1008524421	156
575	3300005467	Ga0070706_101065114	Ga0070706_1010651142	156
576	3300005467	Ga0070706_101538649	Ga0070706_1015386491	156
577	3300005468	Ga0070707_100001328	Ga0070707_10000132810	156
578	3300005468	Ga0070707_100003498	Ga0070707_1000034982	156
579	3300005468	Ga0070707_100004619	Ga0070707_10000461911	156
580	3300005468	Ga0070707_100010303	Ga0070707_1000103038	156
581	3300005468	Ga0070707_100011027	Ga0070707_1000110276	156
582	3300005468	Ga0070707_100026834	Ga0070707_1000268346	156
583	3300005468	Ga0070707_100030653	Ga0070707_1000306534	156
584	3300005468	Ga0070707_100032771	Ga0070707_1000327717	156
585	3300005468	Ga0070707_100033899	Ga0070707_1000338991	156
586	3300005468	Ga0070707_100051482	Ga0070707_1000514822	156
587	3300005468	Ga0070707_100113892	Ga0070707_1001138922	156
588	3300005468	Ga0070707_100143901	Ga0070707_1001439012	156
589	3300005468	Ga0070707_100230076	Ga0070707_1002300763	156
590	3300005468	Ga0070707_100403239	Ga0070707_1004032392	156
591	3300005468	Ga0070707_100468828	Ga0070707_1004688283	156
592	3300005468	Ga0070707_100655420	Ga0070707_1006554202	156
593	3300005468	Ga0070707_100677994	Ga0070707_1006779942	156
594	3300005468	Ga0070707_100841730	Ga0070707_1008417302	156
595	3300005468	Ga0070707_100904873	Ga0070707_1009048731	156
596	3300005468	Ga0070707_101054565	Ga0070707_1010545652	156
597	3300005468	Ga0070707_101772781	Ga0070707_1017727811	156
598	3300005471	Ga0070698_100001641	Ga0070698_1000016412	156
599	3300005471	Ga0070698_100007551	Ga0070698_1000075512	156
600	3300005471	Ga0070698_100012734	Ga0070698_10001273412	156
601	3300005471	Ga0070698_100015059	Ga0070698_1000150592	156
602	3300005471	Ga0070698_100030185	Ga0070698_1000301856	156
603	3300005471	Ga0070698_100033295	Ga0070698_1000332952	156
604	3300005471	Ga0070698_100044978	Ga0070698_1000449783	156
605	3300005471	Ga0070698_100053331	Ga0070698_1000533312	156
606	3300005471	Ga0070698_100079721	Ga0070698_1000797212	156
607	3300005471	Ga0070698_100099857	Ga0070698_1000998574	156
608	3300005471	Ga0070698_100102099	Ga0070698_1001020994	156
609	3300005471	Ga0070698_100114297	Ga0070698_1001142972	156
610	3300005471	Ga0070698_100130533	Ga0070698_1001305333	156
611	3300005471	Ga0070698_100189887	Ga0070698_1001898874	156
612	3300005471	Ga0070698_100280013	Ga0070698_1002800132	156
613	3300005471	Ga0070698_100289356	Ga0070698_1002893562	156
614	3300005471	Ga0070698_100321288	Ga0070698_1003212882	156
615	3300005471	Ga0070698_100576155	Ga0070698_1005761552	156
616	3300005471	Ga0070698_100718742	Ga0070698_1007187422	156
617	3300005471	Ga0070698_101255644	Ga0070698_1012556441	156
618	3300005518	Ga0070699_100000685	Ga0070699_1000006854	156
619	3300005518	Ga0070699_100001702	Ga0070699_1000017028	156
620	3300005518	Ga0070699_100048373	Ga0070699_1000483732	156
621	3300005518	Ga0070699_100110949	Ga0070699_1001109492	156
622	3300005518	Ga0070699_100166689	Ga0070699_1001666892	156
623	3300005518	Ga0070699_100214737	Ga0070699_1002147372	156
624	3300005518	Ga0070699_100247999	Ga0070699_1002479993	156
625	3300005518	Ga0070699_100345040	Ga0070699_1003450401	156
626	3300005518	Ga0070699_100369094	Ga0070699_1003690942	156
627	3300005518	Ga0070699_100646275	Ga0070699_1006462752	156
628	3300005518	Ga0070699_100859356	Ga0070699_1008593562	156
629	3300005518	Ga0070699_100989805	Ga0070699_1009898052	156
630	3300005530	Ga0070679_100114843	Ga0070679_1001148432	156
631	3300005536	Ga0070697_100000181	Ga0070697_1000001817	156
632	3300005536	Ga0070697_100002291	Ga0070697_1000022914	156
633	3300005536	Ga0070697_100006299	Ga0070697_1000062992	156
634	3300005536	Ga0070697_100007417	Ga0070697_1000074173	156
635	3300005536	Ga0070697_100023392	Ga0070697_1000233926	156
636	3300005536	Ga0070697_100024799	Ga0070697_1000247991	156
637	3300005536	Ga0070697_100026334	Ga0070697_1000263342	156
638	3300005536	Ga0070697_100051695	Ga0070697_1000516952	156
639	3300005536	Ga0070697_100075397	Ga0070697_1000753972	156
640	3300005536	Ga0070697_100092427	Ga0070697_1000924272	156
641	3300005536	Ga0070697_100161119	Ga0070697_1001611192	156
642	3300005536	Ga0070697_100177162	Ga0070697_1001771622	156
643	3300005536	Ga0070697_100180057	Ga0070697_1001800572	156
644	3300005536	Ga0070697_100221066	Ga0070697_1002210661	156
645	3300005536	Ga0070697_100231753	Ga0070697_1002317532	156
646	3300005536	Ga0070697_101004901	Ga0070697_1010049012	156
647	3300005536	Ga0070697_101101992	Ga0070697_1011019922	156
648	3300005536	Ga0070697_101386888	Ga0070697_1013868881	156
649	3300005545	Ga0070695_100040418	Ga0070695_1000404182	156
650	3300005545	Ga0070695_100041521	Ga0070695_1000415212	156
651	3300005545	Ga0070695_100046885	Ga0070695_1000468852	156
652	3300005545	Ga0070695_100118365	Ga0070695_1001183652	156
653	3300005545	Ga0070695_100148622	Ga0070695_1001486222	156
654	3300005545	Ga0070695_100330907	Ga0070695_1003309072	156
655	3300005545	Ga0070695_100628799	Ga0070695_1006287992	156
656	3300005546	Ga0070696_100500634	Ga0070696_1005006342	156
657	3300005546	Ga0070696_100500635	Ga0070696_1005006352	156
658	3300005547	Ga0070693_100241249	Ga0070693_1002412492	156
659	3300005548	Ga0070665_100050499	Ga0070665_1000504996	156
660	3300005548	Ga0070665_100084353	Ga0070665_1000843532	156
661	3300005549	Ga0070704_100015660	Ga0070704_1000156605	156
662	3300005549	Ga0070704_100185437	Ga0070704_1001854371	156
663	3300005563	Ga0068855_101297479	Ga0068855_1012974792	156
664	3300005564	Ga0070664_100097239	Ga0070664_1000972393	156
665	3300005577	Ga0068857_100079419	Ga0068857_1000794192	156
666	3300005577	Ga0068857_100303574	Ga0068857_1003035742	156
667	3300005577	Ga0068857_101224964	Ga0068857_1012249641	156
668	3300005616	Ga0068852_100813634	Ga0068852_1008136342	156
669	3300005617	Ga0068859_101474578	Ga0068859_1014745782	156
670	3300005719	Ga0068861_101773129	Ga0068861_1017731292	156
671	3300005842	Ga0068858_101386803	Ga0068858_1013868031	156
672	3300005844	Ga0068862_100149855	Ga0068862_1001498552	156
673	3300005985	Ga0081539_10004590	Ga0081539_1000459014	156
674	3300006028	Ga0070717_10003938	Ga0070717_100039386	156
675	3300006028	Ga0070717_10004446	Ga0070717_100044462	156
676	3300006028	Ga0070717_10029395	Ga0070717_100293955	156
677	3300006028	Ga0070717_10054737	Ga0070717_100547372	156
678	3300006028	Ga0070717_10609564	Ga0070717_106095642	156
679	3300006028	Ga0070717_11103945	Ga0070717_111039452	156
680	3300006028	Ga0070717_11365822	Ga0070717_113658222	156
681	3300006038	Ga0075365_10073164	Ga0075365_100731643	156
682	3300006038	Ga0075365_10096119	Ga0075365_100961192	156
683	3300006038	Ga0075365_10440231	Ga0075365_104402312	156
684	3300006042	Ga0075368_10013484	Ga0075368_100134845	156
685	3300006048	Ga0075363_100025525	Ga0075363_1000255252	156
686	3300006051	Ga0075364_10020008	Ga0075364_100200082	156
687	3300006051	Ga0075364_10139546	Ga0075364_101395462	156
688	3300006051	Ga0075364_10255778	Ga0075364_102557782	156
689	3300006173	Ga0070716_100127363	Ga0070716_1001273632	156
690	3300006173	Ga0070716_100162570	Ga0070716_1001625702	156
691	3300006173	Ga0070716_100505023	Ga0070716_1005050231	156
692	3300006173	Ga0070716_100717104	Ga0070716_1007171042	156
693	3300006173	Ga0070716_100739249	Ga0070716_1007392492	156
694	3300006173	Ga0070716_100964005	Ga0070716_1009640052	156
695	3300006173	Ga0070716_101405370	Ga0070716_1014053702	156
696	3300006175	Ga0070712_101583384	Ga0070712_1015833841	156
697	3300006177	Ga0075362_10045931	Ga0075362_100459312	156
698	3300006177	Ga0075362_10094636	Ga0075362_100946361	156
699	3300006177	Ga0075362_10259856	Ga0075362_102598562	156
700	3300006177	Ga0075362_10387610	Ga0075362_103876102	156
701	3300006178	Ga0075367_10107076	Ga0075367_101070762	156
702	3300006178	Ga0075367_10118973	Ga0075367_101189733	156
703	3300006178	Ga0075367_10139346	Ga0075367_101393462	156
704	3300006186	Ga0075369_10069258	Ga0075369_100692582	156
705	3300006186	Ga0075369_10099873	Ga0075369_100998732	156
706	3300006195	Ga0075366_10019467	Ga0075366_100194675	156
707	3300006195	Ga0075366_10583437	Ga0075366_105834371	156
708	3300006353	Ga0075370_10124463	Ga0075370_101244632	156
709	3300006353	Ga0075370_10197963	Ga0075370_101979632	156
710	3300006353	Ga0075370_10254570	Ga0075370_102545702	156
711	3300006847	Ga0075431_100002843	Ga0075431_10000284315	156
712	3300006847	Ga0075431_100274487	Ga0075431_1002744872	156
713	3300006852	Ga0075433_10005065	Ga0075433_1000506511	156
714	3300006852	Ga0075433_10124141	Ga0075433_101241412	156
715	3300006852	Ga0075433_10227430	Ga0075433_102274302	156
716	3300006852	Ga0075433_10391343	Ga0075433_103913432	156
717	3300006852	Ga0075433_10724193	Ga0075433_107241931	156
718	3300006852	Ga0075433_10972776	Ga0075433_109727762	156
719	3300006871	Ga0075434_100108110	Ga0075434_1001081105	156
720	3300006871	Ga0075434_100169179	Ga0075434_1001691794	156
721	3300006871	Ga0075434_100372705	Ga0075434_1003727053	156
722	3300006871	Ga0075434_101439819	Ga0075434_1014398192	156
723	3300006880	Ga0075429_100012038	Ga0075429_1000120387	156
724	3300006880	Ga0075429_100081451	Ga0075429_1000814513	156
725	3300006914	Ga0075436_100001748	Ga0075436_1000017489	156
726	3300006914	Ga0075436_100055496	Ga0075436_1000554962	156
727	3300006914	Ga0075436_100139607	Ga0075436_1001396072	156
728	3300006914	Ga0075436_100151950	Ga0075436_1001519502	156
729	3300006914	Ga0075436_100164187	Ga0075436_1001641872	156
730	3300006914	Ga0075436_100662588	Ga0075436_1006625882	156
731	3300006931	Ga0097620_101474415	Ga0097620_1014744152	156
732	3300006946	Ga0079104_1001046	Ga0079104_100104616	156
733	3300006946	Ga0079104_1001880	Ga0079104_10018802	156
734	3300006946	Ga0079104_1010738	Ga0079104_10107382	156
735	3300006948	Ga0099826_10014724	Ga0099826_100147246	156
736	3300007076	Ga0075435_100061649	Ga0075435_1000616493	156
737	3300007076	Ga0075435_100089339	Ga0075435_1000893392	156
738	3300007076	Ga0075435_100236855	Ga0075435_1002368552	156
739	3300007076	Ga0075435_100920654	Ga0075435_1009206542	156
740	3300007076	Ga0075435_101033165	Ga0075435_1010331651	156
741	3300007265	Ga0099794_10000427	Ga0099794_100004276	156
742	3300007265	Ga0099794_10051470	Ga0099794_100514702	156
743	3300007265	Ga0099794_10113415	Ga0099794_101134152	156
744	3300007265	Ga0099794_10286708	Ga0099794_102867082	156
745	3300007265	Ga0099794_10577189	Ga0099794_105771892	156
746	3300009011	Ga0105251_10243206	Ga0105251_102432062	156
747	3300009094	Ga0111539_10433107	Ga0111539_104331071	156
748	3300009098	Ga0105245_10674339	Ga0105245_106743392	156
749	3300009098	Ga0105245_12063261	Ga0105245_120632611	156
750	3300009147	Ga0114129_10029485	Ga0114129_100294852	156
751	3300009147	Ga0114129_10032319	Ga0114129_100323197	156
752	3300009147	Ga0114129_10148514	Ga0114129_101485143	156
753	3300009147	Ga0114129_10492862	Ga0114129_104928622	156
754	3300009147	Ga0114129_10840012	Ga0114129_108400122	156
755	3300009147	Ga0114129_11924678	Ga0114129_119246782	156
756	3300009148	Ga0105243_10411366	Ga0105243_104113662	156
757	3300009148	Ga0105243_11574604	Ga0105243_115746041	156
758	3300009545	Ga0105237_10880145	Ga0105237_108801452	156
759	3300009551	Ga0105238_11153045	Ga0105238_111530452	156
760	3300009553	Ga0105249_11741799	Ga0105249_117417992	156
761	3300010159	Ga0099796_10076572	Ga0099796_100765723	156
762	3300010375	Ga0105239_10278814	Ga0105239_102788142	156
763	3300010375	Ga0105239_10510499	Ga0105239_105104993	156
764	3300011119	Ga0105246_10554334	Ga0105246_105543342	156
765	3300013100	Ga0157373_10053492	Ga0157373_100534922	156
766	3300013100	Ga0157373_10076414	Ga0157373_100764144	156
767	3300013100	Ga0157373_10119091	Ga0157373_101190912	156
768	3300013102	Ga0157371_10002103	Ga0157371_1000210315	156
769	3300013102	Ga0157371_10013303	Ga0157371_100133036	156
770	3300013104	Ga0157370_10076939	Ga0157370_100769393	156
771	3300013105	Ga0157369_10320661	Ga0157369_103206612	156
772	3300013105	Ga0157369_10970679	Ga0157369_109706792	156
773	3300013249	Ga0171463_1011	Ga0171463_101122	156
774	3300013306	Ga0163162_12231727	Ga0163162_122317271	156
775	3300013306	Ga0163162_13068152	Ga0163162_130681521	156
776	3300013307	Ga0157372_12718220	Ga0157372_127182201	156
777	3300013308	Ga0157375_11639177	Ga0157375_116391771	156
778	3300014326	Ga0157380_10238574	Ga0157380_102385742	156
779	3300014326	Ga0157380_10411910	Ga0157380_104119101	156
780	3300014745	Ga0157377_10048672	Ga0157377_100486724	156
781	3300014969	Ga0157376_10748434	Ga0157376_107484341	156
782	3300015265	Ga0182005_1156131	Ga0182005_11561311	156
783	3300015690	Ga0183363_1181	Ga0183363_11814	156
784	3300017792	Ga0163161_11461801	Ga0163161_114618011	156
785	3300017792	Ga0163161_11516177	Ga0163161_115161771	156
786	3300020069	Ga0197907_10165516	Ga0197907_101655162	156
787	3300020069	Ga0197907_10269474	Ga0197907_102694742	156
788	3300020069	Ga0197907_10963634	Ga0197907_109636343	156
789	3300020070	Ga0206356_11118200	Ga0206356_111182003	156
790	3300020075	Ga0206349_1028517	Ga0206349_10285172	156
791	3300020076	Ga0206355_1050267	Ga0206355_10502672	156
792	3300020076	Ga0206355_1295704	Ga0206355_12957042	156
793	3300020076	Ga0206355_1330036	Ga0206355_13300363	156
794	3300020077	Ga0206351_10088825	Ga0206351_100888253	156
795	3300020077	Ga0206351_10534597	Ga0206351_105345972	156
796	3300020078	Ga0206352_10464902	Ga0206352_104649023	156
797	3300020078	Ga0206352_10852376	Ga0206352_108523762	156
798	3300020078	Ga0206352_11018243	Ga0206352_110182432	156
799	3300020080	Ga0206350_10648347	Ga0206350_106483472	156
800	3300020081	Ga0206354_10594368	Ga0206354_105943683	156
801	3300020082	Ga0206353_10225215	Ga0206353_102252151	156
802	3300020082	Ga0206353_10488048	Ga0206353_104880483	156
803	3300020082	Ga0206353_11967016	Ga0206353_119670161	156
804	3300021384	Ga0213876_10107326	Ga0213876_101073262	156
805	3300021384	Ga0213876_10110237	Ga0213876_101102371	156
806	3300021388	Ga0213875_10207084	Ga0213875_102070841	156
807	3300022467	Ga0224712_10000117	Ga0224712_100001173	156
808	3300022467	Ga0224712_10007383	Ga0224712_100073833	156
809	3300022739	Ga0228711_1000015	Ga0228711_100001543	156
810	3300022740	Ga0228710_1000015	Ga0228710_1000015105	156
811	3300025208	Ga0209436_103950	Ga0209436_1039502	156
812	3300025245	Ga0207425_1011340	Ga0207425_10113402	156
813	3300025245	Ga0207425_1070065	Ga0207425_10700651	156
814	3300025263	Ga0209565_1066120	Ga0209565_10661201	156
815	3300025284	Ga0209130_1000007	Ga0209130_1000007318	156
816	3300025292	Ga0209676_1001829	Ga0209676_100182915	156
817	3300025294	Ga0209025_1000405	Ga0209025_100040520	156
818	3300025294	Ga0209025_1006805	Ga0209025_10068055	156
819	3300025294	Ga0209025_1039067	Ga0209025_10390672	156
820	3300025295	Ga0209564_1000140	Ga0209564_1000140180	156
821	3300025297	Ga0209758_1046113	Ga0209758_10461133	156
822	3300025298	Ga0209050_1002189	Ga0209050_100218915	156
823	3300025299	Ga0209256_1004445	Ga0209256_10044452	156
824	3300025299	Ga0209256_1009251	Ga0209256_10092512	156
825	3300025302	Ga0207426_1000064	Ga0207426_1000064318	156
826	3300025303	Ga0209051_1009497	Ga0209051_10094975	156
827	3300025304	Ga0209257_1000817	Ga0209257_100081734	156
828	3300025885	Ga0207653_10002676	Ga0207653_100026765	156
829	3300025885	Ga0207653_10007851	Ga0207653_100078512	156
830	3300025885	Ga0207653_10017512	Ga0207653_100175122	156
831	3300025885	Ga0207653_10161743	Ga0207653_101617432	156
832	3300025898	Ga0207692_10465398	Ga0207692_104653982	156
833	3300025904	Ga0207647_10298133	Ga0207647_102981332	156
834	3300025905	Ga0207685_10280825	Ga0207685_102808252	156
835	3300025906	Ga0207699_10051125	Ga0207699_100511252	156
836	3300025906	Ga0207699_10342842	Ga0207699_103428422	156
837	3300025908	Ga0207643_10017661	Ga0207643_100176611	156
838	3300025910	Ga0207684_10000002	Ga0207684_10000002423	156
839	3300025910	Ga0207684_10000026	Ga0207684_1000002610	156
840	3300025910	Ga0207684_10000148	Ga0207684_1000014811	156
841	3300025910	Ga0207684_10000222	Ga0207684_1000022211	156
842	3300025910	Ga0207684_10000231	Ga0207684_1000023125	156
843	3300025910	Ga0207684_10001809	Ga0207684_100018093	156
844	3300025910	Ga0207684_10005389	Ga0207684_100053898	156
845	3300025910	Ga0207684_10008180	Ga0207684_100081805	156
846	3300025910	Ga0207684_10016282	Ga0207684_100162824	156
847	3300025910	Ga0207684_10019194	Ga0207684_100191942	156
848	3300025910	Ga0207684_10028984	Ga0207684_100289844	156
849	3300025910	Ga0207684_10037204	Ga0207684_100372042	156
850	3300025910	Ga0207684_10092173	Ga0207684_100921734	156
851	3300025910	Ga0207684_10102406	Ga0207684_101024062	156
852	3300025910	Ga0207684_10140942	Ga0207684_101409422	156
853	3300025910	Ga0207684_10845306	Ga0207684_108453062	156
854	3300025910	Ga0207684_10909371	Ga0207684_109093712	156
855	3300025910	Ga0207684_10946990	Ga0207684_109469902	156
856	3300025910	Ga0207684_11193836	Ga0207684_111938362	156
857	3300025915	Ga0207693_10426382	Ga0207693_104263822	156
858	3300025915	Ga0207693_10694607	Ga0207693_106946072	156
859	3300025917	Ga0207660_10286164	Ga0207660_102861642	156
860	3300025918	Ga0207662_10020862	Ga0207662_100208625	156
861	3300025918	Ga0207662_10058365	Ga0207662_100583652	156
862	3300025918	Ga0207662_10248423	Ga0207662_102484232	156
863	3300025918	Ga0207662_10812920	Ga0207662_108129201	156
864	3300025920	Ga0207649_11132146	Ga0207649_111321461	156
865	3300025922	Ga0207646_10000093	Ga0207646_10000093106	156
866	3300025922	Ga0207646_10000394	Ga0207646_1000039411	156
867	3300025922	Ga0207646_10000571	Ga0207646_1000057144	156
868	3300025922	Ga0207646_10001232	Ga0207646_1000123227	156
869	3300025922	Ga0207646_10001680	Ga0207646_100016802	156
870	3300025922	Ga0207646_10002394	Ga0207646_1000239417	156
871	3300025922	Ga0207646_10002570	Ga0207646_1000257019	156
872	3300025922	Ga0207646_10003624	Ga0207646_1000362421	156
873	3300025922	Ga0207646_10003786	Ga0207646_1000378611	156
874	3300025922	Ga0207646_10004986	Ga0207646_100049862	156
875	3300025922	Ga0207646_10017005	Ga0207646_100170058	156
876	3300025922	Ga0207646_10023663	Ga0207646_100236632	156
877	3300025922	Ga0207646_10038709	Ga0207646_100387094	156
878	3300025922	Ga0207646_10062137	Ga0207646_100621372	156
879	3300025922	Ga0207646_10062825	Ga0207646_100628252	156
880	3300025922	Ga0207646_10064804	Ga0207646_100648043	156
881	3300025922	Ga0207646_10066361	Ga0207646_100663612	156
882	3300025922	Ga0207646_10147087	Ga0207646_101470872	156
883	3300025922	Ga0207646_10151377	Ga0207646_101513772	156
884	3300025922	Ga0207646_10168780	Ga0207646_101687803	156
885	3300025922	Ga0207646_10184157	Ga0207646_101841572	156
886	3300025922	Ga0207646_10362100	Ga0207646_103621002	156
887	3300025922	Ga0207646_10474461	Ga0207646_104744612	156
888	3300025922	Ga0207646_10539308	Ga0207646_105393082	156
889	3300025922	Ga0207646_10867389	Ga0207646_108673891	156
890	3300025922	Ga0207646_10967796	Ga0207646_109677962	156
891	3300025923	Ga0207681_10539300	Ga0207681_105393002	156
892	3300025925	Ga0207650_10020895	Ga0207650_100208954	156
893	3300025927	Ga0207687_10400083	Ga0207687_104000832	156
894	3300025928	Ga0207700_10034554	Ga0207700_100345542	156
895	3300025929	Ga0207664_10001195	Ga0207664_100011951	156
896	3300025929	Ga0207664_10027357	Ga0207664_100273572	156
897	3300025929	Ga0207664_10215250	Ga0207664_102152502	156
898	3300025929	Ga0207664_10331140	Ga0207664_103311402	156
899	3300025929	Ga0207664_10420959	Ga0207664_104209591	156
900	3300025929	Ga0207664_10469450	Ga0207664_104694501	156
901	3300025929	Ga0207664_10637367	Ga0207664_106373672	156
902	3300025929	Ga0207664_11481268	Ga0207664_114812681	156
903	3300025933	Ga0207706_10596377	Ga0207706_105963772	156
904	3300025934	Ga0207686_10125162	Ga0207686_101251623	156
905	3300025935	Ga0207709_10123204	Ga0207709_101232043	156
906	3300025935	Ga0207709_10235862	Ga0207709_102358622	156
907	3300025936	Ga0207670_11301885	Ga0207670_113018852	156
908	3300025939	Ga0207665_10042708	Ga0207665_100427082	156
909	3300025939	Ga0207665_10071718	Ga0207665_100717182	156
910	3300025939	Ga0207665_10851991	Ga0207665_108519912	156
911	3300025940	Ga0207691_10311956	Ga0207691_103119562	156
912	3300025942	Ga0207689_10740493	Ga0207689_107404932	156
913	3300025945	Ga0207679_10229262	Ga0207679_102292622	156
914	3300025949	Ga0207667_11813801	Ga0207667_118138012	156
915	3300025960	Ga0207651_10637955	Ga0207651_106379552	156
916	3300025960	Ga0207651_11141149	Ga0207651_111411492	156
917	3300025961	Ga0207712_11312276	Ga0207712_113122761	156
918	3300026035	Ga0207703_10878481	Ga0207703_108784811	156
919	3300026041	Ga0207639_11401101	Ga0207639_114011011	156
920	3300026075	Ga0207708_10088215	Ga0207708_100882152	156
921	3300026075	Ga0207708_10427221	Ga0207708_104272212	156
922	3300026089	Ga0207648_11218057	Ga0207648_112180572	156
923	3300026089	Ga0207648_11264166	Ga0207648_112641662	156
924	3300026118	Ga0207675_100058279	Ga0207675_1000582792	156
925	3300026121	Ga0207683_10595527	Ga0207683_105955272	156
926	3300026121	Ga0207683_11155057	Ga0207683_111550572	156
927	3300026142	Ga0207698_10998813	Ga0207698_109988132	156
928	3300027111	Ga0209281_1000211	Ga0209281_1000211127	156
929	3300027111	Ga0209281_1001101	Ga0209281_10011012	156
930	3300027111	Ga0209281_1001121	Ga0209281_10011212	156
931	3300027312	Ga0209371_1001144	Ga0209371_10011443	156
932	3300027312	Ga0209371_1009180	Ga0209371_10091802	156
933	3300027378	Ga0209981_1015327	Ga0209981_10153272	156
934	3300027526	Ga0209968_1020559	Ga0209968_10205592	156
935	3300027543	Ga0209999_1021798	Ga0209999_10217982	156
936	3300027666	Ga0209282_1000054	Ga0209282_100005490	156
937	3300027666	Ga0209282_1023636	Ga0209282_10236362	156
938	3300027671	Ga0209588_1000036	Ga0209588_100003670	156
939	3300027671	Ga0209588_1012885	Ga0209588_10128852	156
940	3300027695	Ga0209966_1016139	Ga0209966_10161392	156
941	3300027866	Ga0209813_10002736	Ga0209813_100027363	156
942	3300028379	Ga0268266_10243599	Ga0268266_102435992	156
943	3300028379	Ga0268266_10987993	Ga0268266_109879932	156
944	3300028380	Ga0268265_10364405	Ga0268265_103644051	156
945	3300028794	Ga0307515_10013202	Ga0307515_100132023	156
946	3300028794	Ga0307515_10334184	Ga0307515_103341842	156
947	3300030500	Ga0268256_1000978	Ga0268256_10009783	156
948	3300030742	Ga0316183_1056906	Ga0316183_10569062	156
949	3300030744	Ga0316181_1097706	Ga0316181_10977062	156
950	3300031456	Ga0307513_10115481	Ga0307513_101154812	156
951	3300031691	Ga0316579_10002901	Ga0316579_100029013	156
952	3300031691	Ga0316579_10003090	Ga0316579_100030903	156
953	3300031691	Ga0316579_10052788	Ga0316579_100527882	156
954	3300031727	Ga0316576_10004377	Ga0316576_100043773	156
955	3300031727	Ga0316576_10016986	Ga0316576_100169862	156
956	3300031727	Ga0316576_10056921	Ga0316576_100569211	156
957	3300031727	Ga0316576_10133544	Ga0316576_101335442	156
958	3300031728	Ga0316578_10015639	Ga0316578_100156392	156
959	3300031728	Ga0316578_10039146	Ga0316578_100391464	156
960	3300031728	Ga0316578_10050236	Ga0316578_100502362	156
961	3300031728	Ga0316578_10197061	Ga0316578_101970611	156
962	3300031728	Ga0316578_10733313	Ga0316578_107333131	156
963	3300031731	Ga0307405_10177279	Ga0307405_101772793	156
964	3300031733	Ga0316577_10010537	Ga0316577_100105372	156
965	3300031733	Ga0316577_10010655	Ga0316577_100106554	156
966	3300031733	Ga0316577_10015823	Ga0316577_100158233	156
967	3300031733	Ga0316577_10018659	Ga0316577_100186593	156
968	3300031733	Ga0316577_10023099	Ga0316577_100230992	156
969	3300031733	Ga0316577_10040940	Ga0316577_100409402	156
970	3300031733	Ga0316577_10054829	Ga0316577_100548292	156
971	3300031733	Ga0316577_10066972	Ga0316577_100669722	156
972	3300031733	Ga0316577_10107119	Ga0316577_101071191	156
973	3300031733	Ga0316577_10592642	Ga0316577_105926421	156
974	3300031824	Ga0307413_10623059	Ga0307413_106230592	156
975	3300031824	Ga0307413_10626012	Ga0307413_106260122	156
976	3300031824	Ga0307413_10948563	Ga0307413_109485631	156
977	3300031852	Ga0307410_10081217	Ga0307410_100812174	156
978	3300031911	Ga0307412_10077476	Ga0307412_100774762	156
979	3300031911	Ga0307412_10450509	Ga0307412_104505092	156
980	3300031911	Ga0307412_10488024	Ga0307412_104880242	156
981	3300031911	Ga0307412_11097825	Ga0307412_110978251	156
982	3300031967	Ga0315914_1000013	Ga0315914_100001343	156
983	3300031995	Ga0307409_100802216	Ga0307409_1008022162	156
984	3300031995	Ga0307409_101425341	Ga0307409_1014253412	156
985	3300031995	Ga0307409_101772350	Ga0307409_1017723501	156
986	3300032002	Ga0307416_100143217	Ga0307416_1001432173	156
987	3300032004	Ga0307414_10379731	Ga0307414_103797312	156
988	3300032133	Ga0316583_10058827	Ga0316583_100588272	156
989	3300032137	Ga0316585_10015437	Ga0316585_100154372	156
990	3300032137	Ga0316585_10015541	Ga0316585_100155412	156
991	3300032137	Ga0316585_10056472	Ga0316585_100564722	156
992	3300032139	Ga0316580_10212830	Ga0316580_102128301	156
993	3300032168	Ga0316593_10000242	Ga0316593_100002424	156
994	3300032168	Ga0316593_10000272	Ga0316593_100002723	156
995	3300032168	Ga0316593_10000413	Ga0316593_100004133	156
996	3300032168	Ga0316593_10000444	Ga0316593_100004443	156
997	3300032168	Ga0316593_10000704	Ga0316593_100007045	156
998	3300032168	Ga0316593_10001505	Ga0316593_100015053	156
999	3300032168	Ga0316593_10005832	Ga0316593_100058322	156
1000	3300032168	Ga0316593_10007846	Ga0316593_100078462	156
1001	3300032168	Ga0316593_10012587	Ga0316593_100125872	156
1002	3300032168	Ga0316593_10016568	Ga0316593_100165682	156
1003	3300032168	Ga0316593_10017721	Ga0316593_100177212	156
1004	3300032168	Ga0316593_10019943	Ga0316593_100199432	156
1005	3300032168	Ga0316593_10026025	Ga0316593_100260253	156
1006	3300032168	Ga0316593_10036452	Ga0316593_100364522	156
1007	3300032168	Ga0316593_10036940	Ga0316593_100369402	156
1008	3300032168	Ga0316593_10037516	Ga0316593_100375162	156
1009	3300032168	Ga0316593_10037596	Ga0316593_100375963	156
1010	3300032168	Ga0316593_10061220	Ga0316593_100612202	156
1011	3300032168	Ga0316593_10064218	Ga0316593_100642182	156
1012	3300032168	Ga0316593_10067349	Ga0316593_100673492	156
1013	3300032168	Ga0316593_10067785	Ga0316593_100677852	156
1014	3300032168	Ga0316593_10076915	Ga0316593_100769152	156
1015	3300032168	Ga0316593_10081687	Ga0316593_100816872	156
1016	3300032168	Ga0316593_10089202	Ga0316593_100892021	156
1017	3300032168	Ga0316593_10128069	Ga0316593_101280692	156
1018	3300032168	Ga0316593_10155770	Ga0316593_101557701	156
1019	3300032168	Ga0316593_10163211	Ga0316593_101632112	156
1020	3300032168	Ga0316593_10176036	Ga0316593_101760362	156
1021	3300032168	Ga0316593_10222145	Ga0316593_102221452	156
1022	3300032168	Ga0316593_10307962	Ga0316593_103079621	156
1023	3300032168	Ga0316593_10323290	Ga0316593_103232901	156
1024	3300032168	Ga0316593_10373712	Ga0316593_103737121	156
1025	3300033430	Ga0315913_1000097	Ga0315913_100009743	156
1026	3300033464	Ga0315915_1000001	Ga0315915_100000143	156
1027	3300033524	Ga0316592_1000114	Ga0316592_10001143	156
1028	3300033524	Ga0316592_1000208	Ga0316592_10002086	156
1029	3300033524	Ga0316592_1000875	Ga0316592_10008753	156
1030	3300033524	Ga0316592_1002113	Ga0316592_10021133	156
1031	3300033524	Ga0316592_1008486	Ga0316592_10084863	156
1032	3300033524	Ga0316592_1010259	Ga0316592_10102592	156
1033	3300033524	Ga0316592_1013555	Ga0316592_10135552	156
1034	3300033524	Ga0316592_1015333	Ga0316592_10153332	156
1035	3300033524	Ga0316592_1020663	Ga0316592_10206632	156
1036	3300033524	Ga0316592_1029264	Ga0316592_10292642	156
1037	3300033524	Ga0316592_1038410	Ga0316592_10384102	156
1038	3300033524	Ga0316592_1053216	Ga0316592_10532162	156
1039	3300033524	Ga0316592_1112015	Ga0316592_11120151	156
1040	3300033528	Ga0316588_1001697	Ga0316588_10016972	156
1041	3300033529	Ga0316587_1021074	Ga0316587_10210742	156
1042	3300033529	Ga0316587_1036046	Ga0316587_10360461	156
1043	3300033541	Ga0316596_1000346	Ga0316596_10003463	156
1044	3300033541	Ga0316596_1000375	Ga0316596_10003752	156
1045	3300033541	Ga0316596_1002020	Ga0316596_10020203	156
1046	3300033541	Ga0316596_1004199	Ga0316596_10041992	156
1047	3300033541	Ga0316596_1014410	Ga0316596_10144102	156
1048	3300033541	Ga0316596_1015184	Ga0316596_10151842	156
1049	3300033541	Ga0316596_1018006	Ga0316596_10180062	156
1050	3300033541	Ga0316596_1020008	Ga0316596_10200082	156
1051	3300033541	Ga0316596_1022766	Ga0316596_10227663	156
1052	3300033541	Ga0316596_1029136	Ga0316596_10291361	156
1053	3300033541	Ga0316596_1029504	Ga0316596_10295042	156
1054	3300033541	Ga0316596_1033770	Ga0316596_10337702	156
1055	3300033541	Ga0316596_1035838	Ga0316596_10358382	156
1056	3300033541	Ga0316596_1038356	Ga0316596_10383562	156
1057	3300033541	Ga0316596_1048482	Ga0316596_10484821	156
1058	3300033541	Ga0316596_1055499	Ga0316596_10554992	156
1059	3300033541	Ga0316596_1056590	Ga0316596_10565902	156
1060	3300033541	Ga0316596_1068201	Ga0316596_10682012	156
1061	3300033541	Ga0316596_1073563	Ga0316596_10735632	156
1062	3300033541	Ga0316596_1080408	Ga0316596_10804081	156
1063	3300033541	Ga0316596_1129390	Ga0316596_11293901	156
1064	3300034820	Ga0373959_0053637	Ga0373959_0053637_223_693	156
1065	3300035089	Ga0373944_0112923	Ga0373944_0112923_421_891	156
1066	3300035121	Ga0373960_0174619	Ga0373960_0174619_68_538	156
1067	3300035170	Ga0373943_0004523	Ga0373943_0004523_2654_3124	156
1068	3300035398	Ga0316574_0004698	Ga0316574_0004698_2207_2683	156
1069	3300035398	Ga0316574_0005055	Ga0316574_0005055_4246_4716	156
1070	3300035398	Ga0316574_0035426	Ga0316574_0035426_32_502	156
1071	3300035398	Ga0316574_0099650	Ga0316574_0099650_717_1187	156
1072	3300035398	Ga0316574_0113092	Ga0316574_0113092_178_648	156
1073	3300035398	Ga0316574_0404534	Ga0316574_0404534_214_684	156
1074	3300035691	Ga0373931_0035337	Ga0373931_0035337_2045_2515	156
1075	3300035692	Ga0373935_0037307	Ga0373935_0037307_1394_1864	156
1076	3300035692	Ga0373935_0481351	Ga0373935_0481351_248_718	156
1077	3300035695	Ga0373927_0005943	Ga0373927_0005943_2303_2773	156
1078	3300035724	Ga0373933_0002378	Ga0373933_0002378_7223_7693	156
1079	3300035725	Ga0373947_0024037	Ga0373947_0024037_2119_2589	156
1080	3300035725	Ga0373947_0169732	Ga0373947_0169732_491_961	156
1081	3300036647	Ga0316582_0000085	Ga0316582_0000085_21405_21875	156
1082	3300036647	Ga0316582_0008650	Ga0316582_0008650_4192_4662	156
1083	3300036647	Ga0316582_0010089	Ga0316582_0010089_1950_2420	156
1084	3300036647	Ga0316582_0028334	Ga0316582_0028334_2315_2785	156
1085	3300036647	Ga0316582_0063633	Ga0316582_0063633_461_931	156
1086	3300036647	Ga0316582_0090315	Ga0316582_0090315_858_1328	156
1087	3300036647	Ga0316582_0236355	Ga0316582_0236355_222_692	156
1088	3300036647	Ga0316582_0600187	Ga0316582_0600187_28_498	156
1089	3300036712	Ga0316584_0017383	Ga0316584_0017383_3778_4248	156
1090	3300036712	Ga0316584_0029088	Ga0316584_0029088_1370_1846	156
1091	3300036712	Ga0316584_0030805	Ga0316584_0030805_564_1034	156
1092	3300036712	Ga0316584_0034746	Ga0316584_0034746_2645_3115	156
1093	3300036712	Ga0316584_0157575	Ga0316584_0157575_728_1198	156
1094	3300036712	Ga0316584_0309927	Ga0316584_0309927_578_1048	156
1095	3300036712	Ga0316584_0350466	Ga0316584_0350466_442_954	156
1096	3300037312	Ga0395899_0039776	Ga0395899_0039776_2226_2696	156
1097	3300037312	Ga0395899_0177466	Ga0395899_0177466_915_1385	156
1098	3300037312	Ga0395899_0273327	Ga0395899_0273327_367_837	156
1099	3300037418	Ga0395900_0162645	Ga0395900_0162645_1644_2114	156
1100	3300037418	Ga0395900_0164523	Ga0395900_0164523_1306_1776	156
1101	3300037418	Ga0395900_0175343	Ga0395900_0175343_1584_2054	156
1102	3300037418	Ga0395900_0218794	Ga0395900_0218794_497_967	156
1103	3300037418	Ga0395900_0386359	Ga0395900_0386359_690_1178	156
1104	3300037466	Ga0395898_0500709	Ga0395898_0500709_312_782	156
1105	3300037471	Ga0395905_0152904	Ga0395905_0152904_1614_2084	156
1106	3300037471	Ga0395905_1515849	Ga0395905_1515849_14_484	156
1107	3300037588	Ga0316581_0000617	Ga0316581_0000617_38_508	156
1108	3300037588	Ga0316581_0004473	Ga0316581_0004473_2653_3123	156
1109	3300037588	Ga0316581_0009673	Ga0316581_0009673_737_1213	156
1110	3300037588	Ga0316581_0037795	Ga0316581_0037795_57_527	156
1111	3300037853	Ga0436364_0060535	Ga0436364_0060535_153_623	156
1112	3300038443	Ga0395901_0103182	Ga0395901_0103182_962_1432	156
1113	3300038443	Ga0395901_0178099	Ga0395901_0178099_1428_1898	156
1114	3300038443	Ga0395901_0783169	Ga0395901_0783169_34_504	156
1115	3300039062	Ga0400483_061237	Ga0400483_061237_293_763	156
1116	3300039062	Ga0400483_088473	Ga0400483_088473_832_1302	156
1117	3300039062	Ga0400483_121017	Ga0400483_121017_607_1077	156
1118	3300039062	Ga0400483_152177	Ga0400483_152177_1746_2216	156
1119	3300039062	Ga0400483_191764	Ga0400483_191764_1702_2172	156
1120	3300039062	Ga0400483_240700	Ga0400483_240700_116_586	156
1121	3300039062	Ga0400483_251814	Ga0400483_251814_805_1275	156
1122	3300039093	Ga0400489_24036	Ga0400489_24036_5215_5685	156
1123	3300039437	Ga0436365_0226428	Ga0436365_0226428_355_825	156
1124	3300039437	Ga0436365_0231838	Ga0436365_0231838_1442_1912	156
1125	3300039437	Ga0436365_1553927	Ga0436365_1553927_5068_5571	156
1126	3300039447	Ga0436361_0590615	Ga0436361_0590615_50_538	156
1127	3300039447	Ga0436361_1132730	Ga0436361_1132730_50_538	156
1128	3300039450	Ga0436363_1108103	Ga0436363_1108103_239_709	156
1129	3300039450	Ga0436363_1342110	Ga0436363_1342110_4166_4669	156
1130	3300039450	Ga0436363_1361388	Ga0436363_1361388_27_497	156
1131	3300039453	Ga0436362_0473248	Ga0436362_0473248_1159_1662	156
1132	3300039453	Ga0436362_1186852	Ga0436362_1186852_141_611	156
1133	3300041404	Ga0439436_0017530	Ga0439436_0017530_1226_1696	156
1134	3300041404	Ga0439436_0021212	Ga0439436_0021212_171_641	156
1135	3300041404	Ga0439436_0046399	Ga0439436_0046399_111_581	156
1136	3300041406	Ga0439439_0004984	Ga0439439_0004984_1450_1920	156
1137	3300041413	Ga0439465_0012258	Ga0439465_0012258_1158_1628	156
1138	3300041413	Ga0439465_0046024	Ga0439465_0046024_634_1104	156
1139	3300041444	Ga0451790_01116	Ga0451790_01116_445_915	156
1140	3300041446	Ga0451794_05594	Ga0451794_05594_134_604	156
1141	3300041446	Ga0451794_10939	Ga0451794_10939_66_536	156
1142	3300041452	Ga0451793_1821177	Ga0451793_1821177_102_572	156
1143	3300041456	Ga0451795_1538807	Ga0451795_1538807_147_635	156
1144	3300041461	Ga0451805_003187	Ga0451805_003187_146_616	156
1145	3300041462	Ga0451806_244781	Ga0451806_244781_53_523	156
1146	3300041508	Ga0451852_07416	Ga0451852_07416_213_701	156
1147	3300041512	Ga0451853_0612608	Ga0451853_0612608_174_644	156
1148	3300042007	Ga0439449_0013290	Ga0439449_0013290_953_1423	156
1149	3300042013	Ga0439456_066597	Ga0439456_066597_228_698	156
1150	3300042435	Ga0439434_0008551	Ga0439434_0008551_342_812	156
1151	3300042531	Ga0450918_002152	Ga0450918_002152_1359_1829	156
1152	3300042876	Ga0451577_0105064	Ga0451577_0105064_1302_1772	156
1153	3300044656	Ga0466969_0206734	Ga0466969_0206734_107_577	156
1154	3300044673	Ga0453683_0156349	Ga0453683_0156349_573_1043	156
1155	3300044673	Ga0453683_0226327	Ga0453683_0226327_176_646	156
1156	3300044673	Ga0453683_0320829	Ga0453683_0320829_435_905	156
1157	3300044693	Ga0466961_0292005	Ga0466961_0292005_218_688	156
1158	3300044694	Ga0466963_0801249	Ga0466963_0801249_111_584	156
1159	3300044712	Ga0453684_0074307	Ga0453684_0074307_1452_1922	156
1160	3300044712	Ga0453684_0079481	Ga0453684_0079481_2528_2998	156
1161	3300044712	Ga0453684_0559084	Ga0453684_0559084_469_939	156
1162	3300044712	Ga0453684_0592277	Ga0453684_0592277_118_588	156
1163	3300045051	Ga0451576_0464627	Ga0451576_0464627_59_529	156
1164	3300045051	Ga0451576_0894561	Ga0451576_0894561_298_768	156
1165	3300045051	Ga0451576_0912377	Ga0451576_0912377_154_624	156
1166	3300045976	Ga0466967_1285394	Ga0466967_1285394_183_653	156
1167	3300045976	Ga0466967_1450886	Ga0466967_1450886_50_544	156
1168	3300046459	Ga0495629_0060948	Ga0495629_0060948_382_852	156
1169	3300046460	Ga0495638_0050046	Ga0495638_0050046_1300_1770	156
1170	3300046471	Ga0495650_0092454	Ga0495650_0092454_429_899	156
1171	3300046492	Ga0495585_0576740	Ga0495585_0576740_35_505	156
1172	3300046499	Ga0495594_0212470	Ga0495594_0212470_285_755	156
1173	3300046499	Ga0495594_0319836	Ga0495594_0319836_84_554	156
1174	3300046507	Ga0495606_0314310	Ga0495606_0314310_186_656	156
1175	3300046522	Ga0495643_0289763	Ga0495643_0289763_48_518	156
1176	3300046525	Ga0495663_0100831	Ga0495663_0100831_86_556	156
1177	3300046536	Ga0495587_0039455	Ga0495587_0039455_2010_2480	156
1178	3300046557	Ga0495622_0028313	Ga0495622_0028313_1860_2330	156
1179	3300046558	Ga0495633_0050287	Ga0495633_0050287_1150_1620	156
1180	3300046660	Ga0495625_0080308	Ga0495625_0080308_1524_1994	156
1181	3300046660	Ga0495625_0299231	Ga0495625_0299231_198_668	156
1182	3300046675	Ga0495657_0071484	Ga0495657_0071484_1543_2013	156
1183	3300046809	Ga0495600_0127402	Ga0495600_0127402_514_984	156
1184	3300047317	Ga0495604_0040612	Ga0495604_0040612_2125_2595	156
1185	3300047320	Ga0495672_0077757	Ga0495672_0077757_691_1161	156
1186	3300048905	Ga0496102_1424949	Ga0496102_1424949_36_506	156
1187	3300048912	Ga0496109_0502406	Ga0496109_0502406_187_657	156
1188	3300048913	Ga0496110_0947510	Ga0496110_0947510_177_647	156
1189	3300048914	Ga0496111_0063527	Ga0496111_0063527_2110_2580	156
1190	3300048917	Ga0496114_0400431	Ga0496114_0400431_50_520	156
1191	3300048919	Ga0496116_0004534	Ga0496116_0004534_1694_2164	156
1192	3300048919	Ga0496116_0270306	Ga0496116_0270306_195_665	156
1193	3300048920	Ga0496117_0000002	Ga0496117_0000002_626023_626493	156
1194	3300048920	Ga0496117_0012789	Ga0496117_0012789_2325_2795	156
1195	3300048921	Ga0496118_0123602	Ga0496118_0123602_564_1034	156
1196	3300048921	Ga0496118_0156680	Ga0496118_0156680_208_678	156
1197	3300048921	Ga0496118_0314949	Ga0496118_0314949_365_835	156
1198	3300048922	Ga0496119_0009236	Ga0496119_0009236_2262_2732	156
1199	3300048922	Ga0496119_0019096	Ga0496119_0019096_2184_2654	156
1200	3300048922	Ga0496119_0023071	Ga0496119_0023071_510_980	156
1201	3300048922	Ga0496119_0253986	Ga0496119_0253986_86_556	156
1202	3300048922	Ga0496119_0348092	Ga0496119_0348092_76_546	156
1203	3300048923	Ga0496120_0019172	Ga0496120_0019172_2365_2835	156
1204	3300048923	Ga0496120_0037993	Ga0496120_0037993_1200_1670	156
1205	3300048924	Ga0496121_0000003	Ga0496121_0000003_243557_244027	156
1206	3300048924	Ga0496121_0212935	Ga0496121_0212935_190_660	156
1207	3300048924	Ga0496121_0494991	Ga0496121_0494991_171_641	156
1208	3300048925	Ga0496122_0003789	Ga0496122_0003789_16693_17163	156
1209	3300048925	Ga0496122_0014262	Ga0496122_0014262_1324_1794	156
1210	3300048925	Ga0496122_0020638	Ga0496122_0020638_4427_4897	156
1211	3300048925	Ga0496122_0049715	Ga0496122_0049715_456_926	156
1212	3300048925	Ga0496122_0061884	Ga0496122_0061884_485_955	156
1213	3300048925	Ga0496122_0066560	Ga0496122_0066560_788_1258	156
1214	3300048926	Ga0496123_0003005	Ga0496123_0003005_2328_2798	156
1215	3300048926	Ga0496123_0003186	Ga0496123_0003186_15189_15659	156
1216	3300048926	Ga0496123_0049540	Ga0496123_0049540_792_1262	156
1217	3300048926	Ga0496123_0111314	Ga0496123_0111314_906_1376	156
1218	3300048927	Ga0496124_0040841	Ga0496124_0040841_1653_2123	156
1219	3300048927	Ga0496124_0057067	Ga0496124_0057067_461_931	156
1220	3300048927	Ga0496124_0105511	Ga0496124_0105511_1487_1957	156
1221	3300048928	Ga0496125_0003405	Ga0496125_0003405_16401_16871	156
1222	3300048928	Ga0496125_0090649	Ga0496125_0090649_917_1387	156
1223	3300048929	Ga0496126_0117394	Ga0496126_0117394_24_494	156
1224	3300048929	Ga0496126_0258271	Ga0496126_0258271_791_1261	156
1225	3300049127	Ga0501306_000765	Ga0501306_000765_1529_1999	156
1226	3300049127	Ga0501306_005433	Ga0501306_005433_843_1313	156
1227	3300049127	Ga0501306_031548	Ga0501306_031548_92_562	156
1228	3300049127	Ga0501306_036263	Ga0501306_036263_151_621	156
1229	3300049128	Ga0501308_000661	Ga0501308_000661_238_708	156
1230	3300049128	Ga0501308_003600	Ga0501308_003600_296_766	156
1231	3300049128	Ga0501308_025579	Ga0501308_025579_137_607	156
1232	3300049129	Ga0501309_007963	Ga0501309_007963_176_646	156
1233	3300049129	Ga0501309_009566	Ga0501309_009566_603_1073	156
1234	3300049130	Ga0501310_001201	Ga0501310_001201_1242_1712	156
1235	3300049160	Ga0501304_010964	Ga0501304_010964_106_576	156
1236	3300049160	Ga0501304_015388	Ga0501304_015388_137_607	156
1237	3300049161	Ga0501305_006784	Ga0501305_006784_678_1148	156
1238	3300049161	Ga0501305_034906	Ga0501305_034906_157_627	156
1239	3300049162	Ga0501307_000480	Ga0501307_000480_1460_1930	156
1240	3300049162	Ga0501307_003158	Ga0501307_003158_288_758	156
1241	3300049162	Ga0501307_023361	Ga0501307_023361_243_713	156
1242	3300049527	Ga0501311_003311	Ga0501311_003311_489_959	156
1243	3300049528	Ga0501312_007074	Ga0501312_007074_293_763	156
1244	3300049528	Ga0501312_027840	Ga0501312_027840_209_679	156
1245	3300049528	Ga0501312_032203	Ga0501312_032203_149_619	156
1246	3300049529	Ga0501313_038506	Ga0501313_038506_53_523	156
1247	3300049530	Ga0501314_011966	Ga0501314_011966_193_663	156
1248	3300049531	Ga0501315_002193	Ga0501315_002193_650_1120	156
1249	3300049531	Ga0501315_011177	Ga0501315_011177_549_1019	156
1250	3300049532	Ga0501316_005188	Ga0501316_005188_193_663	156
1251	3300049532	Ga0501316_018868	Ga0501316_018868_222_692	156
1252	3300049533	Ga0501317_004405	Ga0501317_004405_759_1229	156
1253	3300049534	Ga0501318_004431	Ga0501318_004431_709_1179	156
1254	3300049535	Ga0501319_001692	Ga0501319_001692_701_1171	156
1255	3300049536	Ga0501320_053858	Ga0501320_053858_39_509	156
1256	3300049537	Ga0501321_005320	Ga0501321_005320_606_1076	156
1257	3300049540	Ga0501324_008543	Ga0501324_008543_225_695	156
1258	3300049552	Ga0501336_005366	Ga0501336_005366_162_632	156
1259	3300049568	Ga0501031_0066005	Ga0501031_0066005_634_1104	156
1260	3300049568	Ga0501031_0244515	Ga0501031_0244515_478_948	156
1261	3300049569	Ga0501032_0037906	Ga0501032_0037906_1275_1745	156
1262	3300049569	Ga0501032_0041372	Ga0501032_0041372_2358_2828	156
1263	3300049569	Ga0501032_0079518	Ga0501032_0079518_838_1308	156
1264	3300049569	Ga0501032_0868076	Ga0501032_0868076_39_509	156
1265	3300049570	Ga0501033_0210470	Ga0501033_0210470_897_1367	156
1266	3300049571	Ga0501034_0000208	Ga0501034_0000208_46030_46500	156
1267	3300049571	Ga0501034_0000482	Ga0501034_0000482_52003_52473	156
1268	3300049571	Ga0501034_0040379	Ga0501034_0040379_1629_2123	156
1269	3300049571	Ga0501034_0284928	Ga0501034_0284928_153_623	156
1270	3300049572	Ga0501036_0910820	Ga0501036_0910820_169_639	156
1271	3300049573	Ga0501037_0005204	Ga0501037_0005204_2490_2984	156
1272	3300049573	Ga0501037_0046933	Ga0501037_0046933_996_1466	156
1273	3300049574	Ga0501038_0024265	Ga0501038_0024265_1880_2374	156
1274	3300049575	Ga0501039_0241079	Ga0501039_0241079_282_752	156
1275	3300049575	Ga0501039_1144236	Ga0501039_1144236_76_546	156
1276	3300049576	Ga0501040_0986865	Ga0501040_0986865_61_531	156
1277	3300049577	Ga0501041_0951177	Ga0501041_0951177_66_536	156
1278	3300049579	Ga0501043_0042895	Ga0501043_0042895_2650_3120	156
1279	3300049580	Ga0501046_0006019	Ga0501046_0006019_8859_9329	156
1280	3300049580	Ga0501046_0014835	Ga0501046_0014835_3746_4216	156
1281	3300049580	Ga0501046_0160393	Ga0501046_0160393_664_1158	156
1282	3300049580	Ga0501046_0263467	Ga0501046_0263467_785_1255	156
1283	3300049580	Ga0501046_0289747	Ga0501046_0289747_352_822	156
1284	3300049580	Ga0501046_0306963	Ga0501046_0306963_555_1025	156
1285	3300049581	Ga0501047_0001689	Ga0501047_0001689_20478_20948	156
1286	3300049581	Ga0501047_0068881	Ga0501047_0068881_121_615	156
1287	3300049581	Ga0501047_0096167	Ga0501047_0096167_992_1462	156
1288	3300049581	Ga0501047_0229785	Ga0501047_0229785_393_863	156
1289	3300049581	Ga0501047_0247659	Ga0501047_0247659_911_1381	156
1290	3300049582	Ga0501048_0000501	Ga0501048_0000501_22843_23313	156
1291	3300049582	Ga0501048_0068273	Ga0501048_0068273_878_1372	156
1292	3300049582	Ga0501048_0546828	Ga0501048_0546828_72_542	156
1293	3300049582	Ga0501048_0684347	Ga0501048_0684347_32_502	156
1294	3300049583	Ga0501067_0001590	Ga0501067_0001590_11235_11705	156
1295	3300049583	Ga0501067_0031556	Ga0501067_0031556_2180_2650	156
1296	3300049584	Ga0501068_0080479	Ga0501068_0080479_1218_1688	156
1297	3300049586	Ga0501070_0004020	Ga0501070_0004020_7127_7597	156
1298	3300049586	Ga0501070_0357839	Ga0501070_0357839_246_716	156
1299	3300049586	Ga0501070_0414653	Ga0501070_0414653_315_785	156
1300	3300049586	Ga0501070_0885596	Ga0501070_0885596_146_616	156
1301	3300049587	Ga0501071_0244017	Ga0501071_0244017_441_911	156
1302	3300049588	Ga0501072_0634874	Ga0501072_0634874_28_498	156
1303	3300049589	Ga0501073_0091330	Ga0501073_0091330_1229_1699	156
1304	3300049589	Ga0501073_0146311	Ga0501073_0146311_220_690	156
1305	3300049589	Ga0501073_0693345	Ga0501073_0693345_147_617	156
1306	3300049590	Ga0501074_0947637	Ga0501074_0947637_100_570	156
1307	3300049591	Ga0501075_0293040	Ga0501075_0293040_49_519	156
1308	3300049592	Ga0501076_1191751	Ga0501076_1191751_29_499	156
1309	3300049686	Ga0501257_000906	Ga0501257_000906_3837_4307	156
1310	3300049742	Ga0501080_0000005	Ga0501080_0000005_170354_170824	156
1311	3300049742	Ga0501080_0390309	Ga0501080_0390309_293_787	156
1312	3300049776	Ga0501280_005781	Ga0501280_005781_1008_1478	156
1313	3300049822	Ga0501035_0000049	Ga0501035_0000049_49498_49968	156
1314	3300049822	Ga0501035_0190330	Ga0501035_0190330_545_1015	156
1315	3300049822	Ga0501035_0389049	Ga0501035_0389049_621_1091	156
1316	3300049823	Ga0501044_0000030	Ga0501044_0000030_77258_77728	156
1317	3300049823	Ga0501044_0012139	Ga0501044_0012139_5330_5824	156
1318	3300049823	Ga0501044_0323069	Ga0501044_0323069_802_1272	156
1319	3300049823	Ga0501044_0486396	Ga0501044_0486396_167_637	156
1320	3300049823	Ga0501044_0804969	Ga0501044_0804969_338_808	156
1321	3300049824	Ga0501045_0090802	Ga0501045_0090802_1054_1524	156
1322	3300050489	nmdc:mga03683_11969_c1	nmdc:mga03683_11969_c1_740_1210	156
1323	3300050489	nmdc:mga03683_12524_c1	nmdc:mga03683_12524_c1_790_1260	156
1324	3300050489	nmdc:mga03683_299498_c1	nmdc:mga03683_299498_c1_92_562	156
1325	3300050489	nmdc:mga03683_94557_c1	nmdc:mga03683_94557_c1_52_522	156
1326	3300050490	nmdc:mga03n38_83581_c1	nmdc:mga03n38_83581_c1_83_553	156
1327	3300050491	nmdc:mga00v17_21458_c1	nmdc:mga00v17_21458_c1_3118_3588	156
1328	3300050491	nmdc:mga00v17_376_c1	nmdc:mga00v17_376_c1_8070_8540	156
1329	3300050492	nmdc:mga0yw44_20733_c1	nmdc:mga0yw44_20733_c1_659_1129	156
1330	3300050492	nmdc:mga0yw44_28579_c1	nmdc:mga0yw44_28579_c1_2328_2798	156
1331	3300050492	nmdc:mga0yw44_72164_c1	nmdc:mga0yw44_72164_c1_1390_1860	156
1332	3300050493	nmdc:mga0k408_241538_c1	nmdc:mga0k408_241538_c1_84_554	156
1333	3300050493	nmdc:mga0k408_37180_c1	nmdc:mga0k408_37180_c1_1035_1505	156
1334	3300050494	nmdc:mga06z11_110847_c1	nmdc:mga06z11_110847_c1_914_1384	156
1335	3300050494	nmdc:mga06z11_58196_c1	nmdc:mga06z11_58196_c1_135_605	156
1336	3300050495	nmdc:mga04h51_50241_c1	nmdc:mga04h51_50241_c1_714_1184	156
1337	3300050495	nmdc:mga04h51_56055_c1	nmdc:mga04h51_56055_c1_633_1103	156
1338	3300050496	nmdc:mga07m45_505360_c1	nmdc:mga07m45_505360_c1_98_568	156
1339	3300050507	nmdc:mga05p37_112879_c1	nmdc:mga05p37_112879_c1_461_931	156
1340	3300050507	nmdc:mga05p37_122660_c1	nmdc:mga05p37_122660_c1_2081_2551	156
1341	3300050507	nmdc:mga05p37_218708_c1	nmdc:mga05p37_218708_c1_438_908	156
1342	3300050507	nmdc:mga05p37_221730_c1	nmdc:mga05p37_221730_c1_1596_2066	156
1343	3300050507	nmdc:mga05p37_381417_c1	nmdc:mga05p37_381417_c1_819_1289	156
1344	3300050508	nmdc:mga09592_28886_c1	nmdc:mga09592_28886_c1_1831_2301	156
1345	3300050510	nmdc:mga06r32_15477_c1	nmdc:mga06r32_15477_c1_4229_4699	156
1346	3300050512	nmdc:mga0n895_168729_c1	nmdc:mga0n895_168729_c1_145_615	156
1347	3300050512	nmdc:mga0n895_1967678_c1	nmdc:mga0n895_1967678_c1_55_525	156
1348	3300050512	nmdc:mga0n895_241636_c1	nmdc:mga0n895_241636_c1_842_1312	156
1349	3300050512	nmdc:mga0n895_447339_c1	nmdc:mga0n895_447339_c1_647_1117	156
1350	3300050512	nmdc:mga0n895_482310_c1	nmdc:mga0n895_482310_c1_415_885	156
1351	3300050512	nmdc:mga0n895_804228_c1	nmdc:mga0n895_804228_c1_350_820	156
1352	3300050512	nmdc:mga0n895_814742_c1	nmdc:mga0n895_814742_c1_185_655	156
1353	3300050512	nmdc:mga0n895_896766_c1	nmdc:mga0n895_896766_c1_180_650	156
1354	3300050513	nmdc:mga0rr50_17999_c1	nmdc:mga0rr50_17999_c1_4197_4667	156
1355	3300050513	nmdc:mga0rr50_218642_c1	nmdc:mga0rr50_218642_c1_767_1237	156
1356	3300050514	nmdc:mga08x19_158742_c1	nmdc:mga08x19_158742_c1_809_1279	156
1357	3300050514	nmdc:mga08x19_2020_c1	nmdc:mga08x19_2020_c1_6940_7410	156
1358	3300050514	nmdc:mga08x19_225775_c1	nmdc:mga08x19_225775_c1_613_1083	156
1359	3300050514	nmdc:mga08x19_336369_c1	nmdc:mga08x19_336369_c1_536_1006	156
1360	3300050514	nmdc:mga08x19_579543_c1	nmdc:mga08x19_579543_c1_92_562	156
1361	3300050514	nmdc:mga08x19_665064_c1	nmdc:mga08x19_665064_c1_112_582	156
1362	3300050514	nmdc:mga08x19_77818_c1	nmdc:mga08x19_77818_c1_520_990	156
1363	3300050514	nmdc:mga08x19_80747_c1	nmdc:mga08x19_80747_c1_1597_2067	156
1364	3300050514	nmdc:mga08x19_84200_c1	nmdc:mga08x19_84200_c1_674_1144	156
1365	3300050514	nmdc:mga08x19_95215_c1	nmdc:mga08x19_95215_c1_945_1415	156
1366	3300050515	nmdc:mga0a205_172159_c1	nmdc:mga0a205_172159_c1_861_1331	156
1367	3300050515	nmdc:mga0a205_383906_c1	nmdc:mga0a205_383906_c1_427_897	156
1368	3300050515	nmdc:mga0a205_42329_c1	nmdc:mga0a205_42329_c1_672_1142	156
1369	3300050515	nmdc:mga0a205_42573_c1	nmdc:mga0a205_42573_c1_1233_1703	156
1370	3300050516	nmdc:mga0sz30_15822_c1	nmdc:mga0sz30_15822_c1_2328_2798	156
1371	3300050516	nmdc:mga0sz30_321519_c1	nmdc:mga0sz30_321519_c1_136_606	156
1372	3300053104	Ga0500556_0000009	Ga0500556_0000009_156728_157198	156
1373	3300053111	Ga0500572_005244	Ga0500572_005244_2315_2785	156
1374	3300053119	Ga0500595_045681	Ga0500595_045681_424_894	156
1375	3300053119	Ga0500595_063539	Ga0500595_063539_531_1001	156
1376	3300053122	Ga0500608_208743	Ga0500608_208743_163_633	156
1377	3300053125	Ga0500618_002093	Ga0500618_002093_5630_6100	156
1378	3300053130	Ga0500642_0231576	Ga0500642_0231576_14_484	156
1379	3300053131	Ga0500652_056846	Ga0500652_056846_190_660	156
1380	3300053133	Ga0500655_026884	Ga0500655_026884_416_886	156
1381	3300053137	Ga0500561_0022003	Ga0500561_0022003_92_562	156
1382	3300053140	Ga0500573_0014889	Ga0500573_0014889_1555_2025	156
1383	3300053153	Ga0500616_0022997	Ga0500616_0022997_1764_2234	156
1384	3300053155	Ga0500620_140356	Ga0500620_140356_205_675	156
1385	3300053157	Ga0500624_001960	Ga0500624_001960_2328_2798	156
1386	3300053161	Ga0500634_0006894	Ga0500634_0006894_2300_2770	156
1387	3300053178	Ga0500637_0366250	Ga0500637_0366250_104_574	156
1388	3300053730	Ga0500645_031832	Ga0500645_031832_976_1446	156
1389	3300053733	Ga0500552_000131	Ga0500552_000131_5839_6309	156
1390	3300054114	Ga0501084_0685166	Ga0501084_0685166_258_728	156
1391	3300054114	Ga0501084_1328454	Ga0501084_1328454_62_532	156
1392	3300059477	Ga0587084_000194	Ga0587084_000194_2773_3243	156
1393	3300059477	Ga0587084_014509	Ga0587084_014509_134_604	156
1394	3300059477	Ga0587084_018196	Ga0587084_018196_511_981	156
1395	3300059477	Ga0587084_020842	Ga0587084_020842_42_512	156
1396	3300059477	Ga0587084_042169	Ga0587084_042169_152_622	156
1397	3300059477	Ga0587084_051507	Ga0587084_051507_131_601	156
1398	3300059490	Ga0587066_000828	Ga0587066_000828_2212_2682	156
1399	3300059491	Ga0587070_027591	Ga0587070_027591_380_850	156
1400	3300059491	Ga0587070_027933	Ga0587070_027933_156_626	156
1401	3300059491	Ga0587070_032456	Ga0587070_032456_97_567	156
1402	3300059491	Ga0587070_038524	Ga0587070_038524_310_780	156
1403	3300059492	Ga0587073_0007397	Ga0587073_0007397_699_1169	156
1404	3300059493	Ga0587077_000467	Ga0587077_000467_685_1155	156
1405	3300059493	Ga0587077_013755	Ga0587077_013755_684_1154	156
1406	3300059493	Ga0587077_026811	Ga0587077_026811_24_494	156
1407	3300059503	Ga0587080_002394	Ga0587080_002394_902_1372	156
1408	3300059503	Ga0587080_032482	Ga0587080_032482_233_703	156
1409	3300059503	Ga0587080_055284	Ga0587080_055284_158_628	156
1410	3300059504	Ga0587082_002565	Ga0587082_002565_904_1374	156
1411	3300059505	Ga0587083_0009865	Ga0587083_0009865_823_1293	156
1412	3300059505	Ga0587083_0011635	Ga0587083_0011635_291_761	156
1413	3300059505	Ga0587083_0014299	Ga0587083_0014299_108_578	156
1414	3300059505	Ga0587083_0130623	Ga0587083_0130623_114_584	156
1415	3300059506	Ga0587085_006661	Ga0587085_006661_159_629	156
1416	3300059507	Ga0587086_026145	Ga0587086_026145_284_754	156
1417	3300059508	Ga0587088_002354	Ga0587088_002354_30_500	156
1418	3300059508	Ga0587088_010530	Ga0587088_010530_99_569	156
1419	3300059509	Ga0587089_002184	Ga0587089_002184_226_696	156
1420	3300059510	Ga0587090_000116	Ga0587090_000116_3863_4333	156
1421	3300059510	Ga0587090_000346	Ga0587090_000346_2522_2992	156
1422	3300059510	Ga0587090_003870	Ga0587090_003870_751_1221	156
1423	3300059510	Ga0587090_008630	Ga0587090_008630_112_582	156
1424	3300059511	Ga0587091_000076	Ga0587091_000076_4124_4594	156
1425	3300059511	Ga0587091_046513	Ga0587091_046513_101_571	156
1426	3300059512	Ga0587092_009456	Ga0587092_009456_177_647	156
1427	3300059512	Ga0587092_015815	Ga0587092_015815_29_499	156
1428	3300059512	Ga0587092_045784	Ga0587092_045784_40_510	156
1429	3300059513	Ga0587094_028213	Ga0587094_028213_277_747	156
1430	3300059513	Ga0587094_043974	Ga0587094_043974_112_582	156
1431	3300059604	Ga0587098_004005	Ga0587098_004005_198_668	156
1432	3300059604	Ga0587098_026329	Ga0587098_026329_168_638	156
1433	3300059605	Ga0587106_088143	Ga0587106_088143_36_506	156
1434	3300059607	Ga0587125_015386	Ga0587125_015386_230_700	156
1435	3300059609	Ga0587131_003797	Ga0587131_003797_289_759	156
1436	3300059623	Ga0587101_006834	Ga0587101_006834_698_1168	156
1437	3300059623	Ga0587101_018940	Ga0587101_018940_286_756	156
1438	3300059623	Ga0587101_036287	Ga0587101_036287_135_605	156
1439	3300059624	Ga0587109_003459	Ga0587109_003459_934_1404	156
1440	3300059624	Ga0587109_075956	Ga0587109_075956_154_624	156
1441	3300059624	Ga0587109_143283	Ga0587109_143283_75_545	156
1442	3300059626	Ga0587115_005210	Ga0587115_005210_834_1304	156
1443	3300059629	Ga0587127_010510	Ga0587127_010510_222_692	156
1444	3300059630	Ga0587128_000318	Ga0587128_000318_698_1168	156
1445	3300059631	Ga0587130_004418	Ga0587130_004418_85_555	156
1446	3300059639	Ga0587062_000535	Ga0587062_000535_733_1203	156
1447	3300059639	Ga0587062_003834	Ga0587062_003834_105_575	156
1448	3300059639	Ga0587062_006275	Ga0587062_006275_51_521	156
1449	3300059639	Ga0587062_030972	Ga0587062_030972_114_584	156
1450	3300059639	Ga0587062_040103	Ga0587062_040103_197_667	156
1451	3300059640	Ga0587067_000490	Ga0587067_000490_698_1168	156
1452	3300059641	Ga0587068_001964	Ga0587068_001964_826_1296	156
1453	3300059641	Ga0587068_004823	Ga0587068_004823_644_1114	156
1454	3300059641	Ga0587068_013373	Ga0587068_013373_683_1153	156
1455	3300059641	Ga0587068_094306	Ga0587068_094306_114_584	156
1456	3300059642	Ga0587069_002445	Ga0587069_002445_1240_1710	156
1457	3300059643	Ga0587072_000652	Ga0587072_000652_2479_2949	156
1458	3300059643	Ga0587072_016387	Ga0587072_016387_687_1157	156
1459	3300059643	Ga0587072_070419	Ga0587072_070419_106_576	156
1460	3300059644	Ga0587075_009312	Ga0587075_009312_109_579	156
1461	3300059644	Ga0587075_076083	Ga0587075_076083_84_554	156
1462	3300059644	Ga0587075_076138	Ga0587075_076138_59_529	156
1463	3300059645	Ga0587076_005208	Ga0587076_005208_503_973	156
1464	3300059645	Ga0587076_011834	Ga0587076_011834_684_1154	156
1465	3300059645	Ga0587076_023079	Ga0587076_023079_109_579	156
1466	3300059646	Ga0587078_003436	Ga0587078_003436_439_909	156
1467	3300059647	Ga0587079_014685	Ga0587079_014685_167_637	156
1468	3300059647	Ga0587079_034148	Ga0587079_034148_467_937	156
1469	3300059647	Ga0587079_034352	Ga0587079_034352_465_935	156
1470	3300059647	Ga0587079_097372	Ga0587079_097372_170_640	156
1471	3300059648	Ga0587100_000626	Ga0587100_000626_1004_1474	156
1472	3300059649	Ga0587102_003779	Ga0587102_003779_157_627	156
1473	3300059649	Ga0587102_016951	Ga0587102_016951_257_727	156
1474	3300059651	Ga0587105_003380	Ga0587105_003380_404_874	156
1475	3300059651	Ga0587105_009059	Ga0587105_009059_100_570	156
1476	3300059652	Ga0587107_039252	Ga0587107_039252_124_594	156
1477	3300059653	Ga0587108_000493	Ga0587108_000493_877_1347	156
1478	3300059654	Ga0587110_010841	Ga0587110_010841_293_763	156
1479	3300059654	Ga0587110_032839	Ga0587110_032839_32_502	156
1480	3300059655	Ga0587114_004381	Ga0587114_004381_425_895	156
1481	3300059658	Ga0587119_002635	Ga0587119_002635_193_663	156
1482	3300059660	Ga0587124_000696	Ga0587124_000696_690_1160	156
1483	3300060247	Ga0587096_01945	Ga0587096_01945_152_622	156
1484	3300060344	Ga0587071_025568	Ga0587071_025568_37_507	156
1485	3300060344	Ga0587071_029070	Ga0587071_029070_119_589	156
1486	3300060344	Ga0587071_032689	Ga0587071_032689_264_734	156
1487	3300060344	Ga0587071_071530	Ga0587071_071530_228_698	156
1488	3300060344	Ga0587071_123172	Ga0587071_123172_65_535	156
1489	3300060346	Ga0587111_0006620	Ga0587111_0006620_507_977	156
1490	3300060346	Ga0587111_0018754	Ga0587111_0018754_138_608	156
1491	3300060346	Ga0587111_0035607	Ga0587111_0035607_368_838	156
1492	3300060346	Ga0587111_0050132	Ga0587111_0050132_436_906	156
1493	3300060346	Ga0587111_0070214	Ga0587111_0070214_135_605	156
1494	3300060346	Ga0587111_0110532	Ga0587111_0110532_148_618	156
1495	3300060353	Ga0501082_0150048	Ga0501082_0150048_917_1387	156
1496	3300060353	Ga0501082_0381877	Ga0501082_0381877_195_665	156
1497	3300061734	Ga0530510_1207959	Ga0530510_1207959_39_509	156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00177

Ribosomal_S7

Ribosomal protein S7p/S5e

2

155

0.96 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7nhn-assembly1.cif.gz_h	vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes	0.9732	12	152
7nhl-assembly1.cif.gz_h	vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus	0.9715	12	152
8cdv-assembly1.cif.gz_H	rnase r bound to a 30s degradation intermediate (state ii)	0.9696	22	127
8ca7-assembly1.cif.gz_G	omadacycline and spectinomycin bound to the 30s ribosomal subunit head	0.9681	14	125
7nhn-assembly1.cif.gz_h	vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes	0.9665	12	152

ID	Description	Score	Start	End	Superfamily
af_P48940_2_156_1.10.455.10	Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5	0.9595	2	156	1.10.455.10
af_P48940_2_156_1.10.455.10	Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5	0.9535	2	156	1.10.455.10
4qcoG00	Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5	0.9451	3	156	1.10.455.10
5mmjg00	Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5	0.9439	3	155	1.10.455.10
5x8rg00	Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5	0.9361	4	152	1.10.455.10

ID	Description	Score	Start	End	GO Terms
AF-A0A7C6DLZ9-F1-model_v4	30S ribosomal protein S7	0.9935	61	156	GO:0003735 GO:0006412 GO:0015935 GO:0019843
AF-A0A2D9J9P7-F1-model_v4	30S ribosomal protein S7	0.9909	56	156	GO:0000049 GO:0003735 GO:0006412 GO:0015935 GO:0019843
AF-G0YD96-F1-model_v4	Ribosomal protein S7	0.9901	57	155	GO:0003735 GO:0006412 GO:0009536 GO:0015935 GO:0019843
AF-A0A2N3AVB6-F1-model_v4	30S ribosomal protein S7	0.9901	62	156	GO:0000049 GO:0003735 GO:0006412 GO:0015935 GO:0019843
AF-K1U2L4-F1-model_v4	30S ribosomal protein S7	0.9898	66	156	GO:0003735 GO:0006412 GO:0015935 GO:0019843

Feature Viewer

pLDDT	pTM	Quality
92.51	0.82	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F494377

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00177

Ribosomal_S7

Ribosomal protein S7p/S5e

2

155

0.96

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map