F494398

General Info

Members Datasets Scaffolds Average Seq Length
1499 393 1496 197

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0451293|Ga0466961_0451293_158_727
Length 189
Sequence MAIKKFVVACFDDEAVLFPAVKQVRKTGYKIHDVYTPMPIHGLDAAMGLRDTSLHTAGFFYGLAGTCTALGFITWALTYDWPLNFGGKPFFALPAWTVLFSAVGMVLTFCYLCQMAPFVKKDHFHLRSTDDLFVMAIECTDKTNEGEVTQFLNDLGAVEVTTKMKETGWWIGNYADDRKPFEKSVEAVS

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2914759650 Rhizosphaericola mali Isolate Rhizosphere
3 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
120 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
121 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
191 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
197 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
206 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
219 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
220 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
221 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
222 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
223 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
224 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
225 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
226 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
227 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
228 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
229 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
230 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
231 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
232 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
233 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
234 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
235 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
236 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
237 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
238 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
239 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
240 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
241 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
242 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
243 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
247 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
248 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
249 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
260 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
261 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
267 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
270 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
284 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
285 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
286 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
287 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
298 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
310 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
311 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
312 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
325 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
333 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
334 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
335 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
336 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
337 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
338 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
339 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
340 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
341 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
342 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
343 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
344 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
345 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
346 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
347 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
348 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
349 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
350 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
351 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
352 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
358 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
359 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
360 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
364 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
365 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
366 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
367 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
368 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
369 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
370 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
371 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
372 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
373 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
374 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
375 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
376 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
377 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
378 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
379 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
380 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
381 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
382 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
383 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
384 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
385 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
386 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
387 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
393 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.27
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.6
Nodule 0
Rhizoplane 1
Rhizosphere 93.8
Stem 0
Stem Tuber 0
Unclassified 2.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10016281 3300003203 Bacteria 3104
2 rootH2_10016807 3300003320 Bacteria 3219
3 rootH2_10031796 3300003320 Bacteria 4047
4 rootH2_10192773 3300003320 Bacteria 1742
5 rootL2_10079796 3300003322 Bacteria 4159
6 rootL2_10152750 3300003322 Bacteria 2664
7 rootL2_10245767 3300003322 Bacteria 1018
8 rootL2_10250232 3300003322 Bacteria 1540
9 rootH1_10011024 3300003323 Bacteria 3451
10 rootH1_10255312 3300003323 Unclassified 2116
11 JGI25160J50197_1001012 3300003354 Bacteria 14593
12 Ga0065714_10065508 3300005288 Bacteria 9697
13 Ga0065714_10169546 3300005288 Bacteria 1011
14 Ga0065704_10094776 3300005289 Bacteria 2486
15 Ga0065704_10136476 3300005289 Bacteria 1550
16 Ga0065704_10436151 3300005289 Bacteria 693
17 Ga0065712_10001960 3300005290 Bacteria 13513
18 Ga0065712_10086063 3300005290 Bacteria 2658
19 Ga0065712_10095536 3300005290 Bacteria 2212
20 Ga0065712_10119581 3300005290 Bacteria 1690
21 Ga0065712_10236480 3300005290 Bacteria 996
22 Ga0065712_10361682 3300005290 Bacteria 753
23 Ga0065715_10107733 3300005293 Bacteria 2751
24 Ga0065715_10236555 3300005293 Bacteria 1214
25 Ga0065707_10145885 3300005295 Bacteria 1715
26 Ga0065707_10342951 3300005295 Bacteria 930
27 Ga0070658_10049636 3300005327 Bacteria 3400
28 Ga0070658_10249989 3300005327 Bacteria 1504
29 Ga0070658_10593017 3300005327 Bacteria 960
30 Ga0070658_10778001 3300005327 Unclassified 831
31 Ga0070658_10911935 3300005327 Unclassified 764
32 Ga0070658_10997371 3300005327 Bacteria 728
33 Ga0070676_10006527 3300005328 Bacteria 6234
34 Ga0070676_10007632 3300005328 Bacteria 5812
35 Ga0070676_10040274 3300005328 Bacteria 2705
36 Ga0070676_10043239 3300005328 Bacteria 2618
37 Ga0070676_10058043 3300005328 Bacteria 2292
38 Ga0070676_10174376 3300005328 Bacteria 1393
39 Ga0070676_10738387 3300005328 Bacteria 722
40 Ga0070676_10863705 3300005328 Unclassified 671
41 Ga0070683_100001729 3300005329 Bacteria 16990
42 Ga0070683_100005726 3300005329 Bacteria 10387
43 Ga0070683_100034714 3300005329 Bacteria 4609
44 Ga0070683_100140256 3300005329 Bacteria 2290
45 Ga0070683_100183378 3300005329 Bacteria 1987
46 Ga0070683_100331861 3300005329 Bacteria 1448
47 Ga0070683_100385555 3300005329 Bacteria 1335
48 Ga0070683_100466220 3300005329 Bacteria 1206
49 Ga0070683_100715065 3300005329 Unclassified 959
50 Ga0070690_100009060 3300005330 Bacteria 5755
51 Ga0070690_100026759 3300005330 Bacteria 3561
52 Ga0070690_100082154 3300005330 Bacteria 2109
53 Ga0070690_100120722 3300005330 Bacteria 1759
54 Ga0070690_100923722 3300005330 Bacteria 684
55 Ga0070670_100031852 3300005331 Bacteria 4541
56 Ga0070670_100037193 3300005331 Bacteria 4187
57 Ga0070670_100053977 3300005331 Bacteria 3450
58 Ga0070670_100069756 3300005331 Bacteria 3018
59 Ga0070670_100071480 3300005331 Bacteria 2979
60 Ga0070670_100072664 3300005331 Bacteria 2954
61 Ga0070670_100097159 3300005331 Bacteria 2534
62 Ga0070670_100097553 3300005331 Bacteria 2528
63 Ga0070670_100265726 3300005331 Bacteria 1496
64 Ga0070670_100430194 3300005331 Bacteria 1168
65 Ga0070670_100462322 3300005331 Bacteria 1125
66 Ga0070670_100552685 3300005331 Bacteria 1027
67 Ga0070670_100784650 3300005331 Bacteria 860
68 Ga0070670_101311930 3300005331 Bacteria 663
69 Ga0070677_10017638 3300005333 Bacteria 2559
70 Ga0070677_10221508 3300005333 Bacteria 924
71 Ga0068869_100007572 3300005334 Bacteria 6948
72 Ga0068869_100008253 3300005334 Bacteria 6707
73 Ga0068869_100036552 3300005334 Bacteria 3488
74 Ga0068869_100114641 3300005334 Bacteria 2054
75 Ga0068869_100123511 3300005334 Bacteria 1983
76 Ga0068869_100135759 3300005334 Bacteria 1895
77 Ga0068869_100317584 3300005334 Bacteria 1262
78 Ga0068869_100354490 3300005334 Bacteria 1197
79 Ga0068869_100665132 3300005334 Bacteria 885
80 Ga0068869_100836153 3300005334 Bacteria 793
81 Ga0070666_10000126 3300005335 Bacteria 53667
82 Ga0070666_10007097 3300005335 Bacteria 6907
83 Ga0070666_10018579 3300005335 Bacteria 4474
84 Ga0070666_10028450 3300005335 Bacteria 3668
85 Ga0070666_10051525 3300005335 Bacteria 2772
86 Ga0070666_10096508 3300005335 Bacteria 2035
87 Ga0070680_100358167 3300005336 Bacteria 1241
88 Ga0070682_100000012 3300005337 Bacteria 265658
89 Ga0070682_100000817 3300005337 Bacteria 18185
90 Ga0070682_100003764 3300005337 Bacteria 8430
91 Ga0070682_100279466 3300005337 Bacteria 1216
92 Ga0070682_100359106 3300005337 Bacteria 1089
93 Ga0070682_100615412 3300005337 Bacteria 860
94 Ga0068868_100003574 3300005338 Bacteria 10828
95 Ga0068868_100013019 3300005338 Bacteria 6088
96 Ga0068868_100013615 3300005338 Bacteria 5972
97 Ga0068868_100044829 3300005338 Bacteria 3459
98 Ga0068868_100061691 3300005338 Bacteria 2970
99 Ga0068868_100174986 3300005338 Bacteria 1778
100 Ga0068868_100480293 3300005338 Bacteria 1085
101 Ga0068868_100599286 3300005338 Bacteria 976
102 Ga0068868_100684985 3300005338 Bacteria 916
103 Ga0068868_100896175 3300005338 Bacteria 806
104 Ga0068868_101143729 3300005338 Bacteria 718
105 Ga0070660_100014833 3300005339 Bacteria 5624
106 Ga0070660_100020166 3300005339 Bacteria 4895
107 Ga0070660_100033447 3300005339 Bacteria 3876
108 Ga0070660_100211118 3300005339 Bacteria 1576
109 Ga0070689_100033788 3300005340 Bacteria 3899
110 Ga0070689_100058834 3300005340 Bacteria 2985
111 Ga0070689_100067386 3300005340 Bacteria 2790
112 Ga0070689_100074702 3300005340 Bacteria 2652
113 Ga0070689_100200815 3300005340 Unclassified 1628
114 Ga0070691_10016505 3300005341 Bacteria 3393
115 Ga0070687_100036744 3300005343 Bacteria 2443
116 Ga0070687_100153100 3300005343 Bacteria 1355
117 Ga0070687_100184060 3300005343 Unclassified 1253
118 Ga0070661_100010038 3300005344 Bacteria 6572
119 Ga0070661_100010545 3300005344 Bacteria 6424
120 Ga0070661_100051650 3300005344 Bacteria 3009
121 Ga0070661_100109997 3300005344 Bacteria 2057
122 Ga0070661_100182750 3300005344 Bacteria 1596
123 Ga0070668_100001487 3300005347 Bacteria 16922
124 Ga0070668_100069574 3300005347 Bacteria 2738
125 Ga0070668_100122169 3300005347 Bacteria 2083
126 Ga0070668_100325283 3300005347 Bacteria 1295
127 Ga0070668_100503193 3300005347 Bacteria 1049
128 Ga0070668_100851800 3300005347 Bacteria 812
129 Ga0070669_100056897 3300005353 Bacteria 2867
130 Ga0070669_100131583 3300005353 Bacteria 1920
131 Ga0070669_100258177 3300005353 Bacteria 1390
132 Ga0070669_100409515 3300005353 Unclassified 1111
133 Ga0070669_100964228 3300005353 Bacteria 730
134 Ga0070675_100010438 3300005354 Bacteria 7257
135 Ga0070675_100017849 3300005354 Bacteria 5644
136 Ga0070675_100024040 3300005354 Bacteria 4877
137 Ga0070675_100033737 3300005354 Bacteria 4151
138 Ga0070675_100046116 3300005354 Bacteria 3568
139 Ga0070675_100046198 3300005354 Bacteria 3565
140 Ga0070675_100078220 3300005354 Bacteria 2754
141 Ga0070675_100157354 3300005354 Bacteria 1952
142 Ga0070675_100234729 3300005354 Unclassified 1601
143 Ga0070675_100308255 3300005354 Bacteria 1396
144 Ga0070675_100556990 3300005354 Bacteria 1037
145 Ga0070671_100019120 3300005355 Bacteria 5572
146 Ga0070671_100028345 3300005355 Bacteria 4610
147 Ga0070671_100095574 3300005355 Bacteria 2491
148 Ga0070671_100109533 3300005355 Bacteria 2319
149 Ga0070671_100148548 3300005355 Bacteria 1979
150 Ga0070671_100368012 3300005355 Bacteria 1228
151 Ga0070671_100373478 3300005355 Bacteria 1218
152 Ga0070671_100728414 3300005355 Bacteria 861
153 Ga0070674_100113541 3300005356 Bacteria 1993
154 Ga0070673_100002504 3300005364 Bacteria 11202
155 Ga0070673_100004569 3300005364 Bacteria 8773
156 Ga0070673_100016121 3300005364 Bacteria 5273
157 Ga0070673_100016743 3300005364 Bacteria 5193
158 Ga0070673_100032074 3300005364 Bacteria 3950
159 Ga0070673_100105384 3300005364 Bacteria 2329
160 Ga0070673_100106412 3300005364 Bacteria 2319
161 Ga0070673_100190648 3300005364 Bacteria 1761
162 Ga0070673_100267680 3300005364 Bacteria 1495
163 Ga0070673_100273980 3300005364 Bacteria 1478
164 Ga0070673_100288621 3300005364 Bacteria 1441
165 Ga0070673_100317478 3300005364 Bacteria 1375
166 Ga0070673_100377573 3300005364 Bacteria 1263
167 Ga0070673_100468277 3300005364 Bacteria 1136
168 Ga0070688_100016155 3300005365 Bacteria 4262
169 Ga0070688_100026151 3300005365 Bacteria 3464
170 Ga0070688_100052885 3300005365 Bacteria 2539
171 Ga0070688_100078000 3300005365 Bacteria 2136
172 Ga0070688_100155687 3300005365 Bacteria 1565
173 Ga0070688_100571160 3300005365 Unclassified 862
174 Ga0070688_101081153 3300005365 Bacteria 640
175 Ga0070659_100003202 3300005366 Bacteria 11649
176 Ga0070659_100005752 3300005366 Bacteria 8921
177 Ga0070659_100016628 3300005366 Bacteria 5526
178 Ga0070659_100178968 3300005366 Bacteria 1739
179 Ga0070659_100398038 3300005366 Bacteria 1162
180 Ga0070659_100725505 3300005366 Bacteria 861
181 Ga0070659_101053711 3300005366 Bacteria 715
182 Ga0070667_100001797 3300005367 Bacteria 19092
183 Ga0070667_100043443 3300005367 Bacteria 3772
184 Ga0070667_100126310 3300005367 Bacteria 2229
185 Ga0070667_100204158 3300005367 Bacteria 1754
186 Ga0070667_100301412 3300005367 Bacteria 1443
187 Ga0070667_100365129 3300005367 Unclassified 1309
188 Ga0070667_100566592 3300005367 Bacteria 1045
189 Ga0070713_100327529 3300005436 Bacteria 1416
190 Ga0070701_10348206 3300005438 Bacteria 925
191 Ga0070705_100395779 3300005440 Bacteria 1021
192 Ga0070700_100036455 3300005441 Bacteria 2983
193 Ga0070700_100065633 3300005441 Bacteria 2302
194 Ga0070700_100133651 3300005441 Bacteria 1677
195 Ga0070663_100759600 3300005455 Bacteria 828
196 Ga0070678_100168186 3300005456 Bacteria 1783
197 Ga0070678_100225959 3300005456 Bacteria 1558
198 Ga0070678_100319453 3300005456 Bacteria 1325
199 Ga0070678_100754155 3300005456 Bacteria 881
200 Ga0070678_101013164 3300005456 Unclassified 764
201 Ga0070678_101387950 3300005456 Bacteria 656
202 Ga0070662_100001127 3300005457 Bacteria 16320
203 Ga0070662_100034909 3300005457 Bacteria 3548
204 Ga0070662_100052494 3300005457 Bacteria 2947
205 Ga0070662_100058143 3300005457 Bacteria 2813
206 Ga0070662_100138333 3300005457 Bacteria 1885
207 Ga0070662_100623006 3300005457 Bacteria 909
208 Ga0070681_10046317 3300005458 Bacteria 4348
209 Ga0068867_100002814 3300005459 Bacteria 12228
210 Ga0068867_100014495 3300005459 Bacteria 5587
211 Ga0068867_100023810 3300005459 Bacteria 4386
212 Ga0068867_100214225 3300005459 Bacteria 1549
213 Ga0068867_100260334 3300005459 Bacteria 1414
214 Ga0068867_100316524 3300005459 Bacteria 1291
215 Ga0070685_10008238 3300005466 Bacteria 5346
216 Ga0070685_10042349 3300005466 Bacteria 2598
217 Ga0070685_10053848 3300005466 Bacteria 2333
218 Ga0070685_10080204 3300005466 Bacteria 1955
219 Ga0070685_10105755 3300005466 Bacteria 1725
220 Ga0070698_100001240 3300005471 Bacteria 28441
221 Ga0070698_100001314 3300005471 Bacteria 27660
222 Ga0070698_100609134 3300005471 Bacteria 1032
223 Ga0070679_100451339 3300005530 Bacteria 1230
224 Ga0070684_100002074 3300005535 Bacteria 14766
225 Ga0070684_100024750 3300005535 Bacteria 5039
226 Ga0070684_100030335 3300005535 Bacteria 4592
227 Ga0070684_100086910 3300005535 Bacteria 2776
228 Ga0070684_100221284 3300005535 Bacteria 1727
229 Ga0070684_100560073 3300005535 Bacteria 1061
230 Ga0068853_100005120 3300005539 Bacteria 10244
231 Ga0068853_100029396 3300005539 Bacteria 4633
232 Ga0068853_100029550 3300005539 Bacteria 4622
233 Ga0068853_100030082 3300005539 Bacteria 4584
234 Ga0068853_100032498 3300005539 Bacteria 4421
235 Ga0068853_100047124 3300005539 Bacteria 3699
236 Ga0068853_100171519 3300005539 Bacteria 1963
237 Ga0068853_100202351 3300005539 Bacteria 1807
238 Ga0068853_100261478 3300005539 Bacteria 1591
239 Ga0068853_100403098 3300005539 Bacteria 1280
240 Ga0068853_100437191 3300005539 Bacteria 1229
241 Ga0068853_100768438 3300005539 Unclassified 921
242 Ga0068853_100944551 3300005539 Unclassified 829
243 Ga0070672_100003343 3300005543 Bacteria 10394
244 Ga0070672_100005202 3300005543 Bacteria 8607
245 Ga0070672_100039156 3300005543 Bacteria 3629
246 Ga0070672_100103388 3300005543 Bacteria 2313
247 Ga0070672_100111521 3300005543 Bacteria 2230
248 Ga0070672_100130133 3300005543 Bacteria 2067
249 Ga0070672_100227828 3300005543 Bacteria 1565
250 Ga0070672_100434217 3300005543 Bacteria 1129
251 Ga0070672_100442106 3300005543 Bacteria 1119
252 Ga0070672_100481353 3300005543 Bacteria 1072
253 Ga0070672_100729964 3300005543 Bacteria 868
254 Ga0070672_100864193 3300005543 Bacteria 798
255 Ga0070686_100034839 3300005544 Bacteria 3105
256 Ga0070686_100178701 3300005544 Bacteria 1506
257 Ga0070686_100377076 3300005544 Bacteria 1073
258 Ga0070686_100836990 3300005544 Unclassified 744
259 Ga0070695_100752513 3300005545 Bacteria 777
260 Ga0070665_100000014 3300005548 Bacteria 484881
261 Ga0070665_100002963 3300005548 Bacteria 18336
262 Ga0070665_100013506 3300005548 Bacteria 8215
263 Ga0070665_100020821 3300005548 Bacteria 6591
264 Ga0070665_100135709 3300005548 Bacteria 2463
265 Ga0070665_100578069 3300005548 Bacteria 1136
266 Ga0070665_100705442 3300005548 Bacteria 1022
267 Ga0070665_101025363 3300005548 Bacteria 837
268 Ga0070704_100364160 3300005549 Bacteria 1224
269 Ga0070704_100560980 3300005549 Bacteria 999
270 Ga0068855_100000081 3300005563 Bacteria 115707
271 Ga0068855_100028314 3300005563 Bacteria 6701
272 Ga0068855_100030002 3300005563 Bacteria 6504
273 Ga0068855_100047256 3300005563 Bacteria 5085
274 Ga0068855_100068195 3300005563 Bacteria 4141
275 Ga0068855_100299226 3300005563 Bacteria 1782
276 Ga0068855_100533310 3300005563 Bacteria 1272
277 Ga0070664_100002665 3300005564 Bacteria 14400
278 Ga0070664_100011068 3300005564 Bacteria 7316
279 Ga0070664_100012746 3300005564 Bacteria 6840
280 Ga0070664_100023902 3300005564 Bacteria 5049
281 Ga0070664_100024151 3300005564 Bacteria 5027
282 Ga0070664_100059556 3300005564 Bacteria 3249
283 Ga0070664_100126536 3300005564 Bacteria 2242
284 Ga0070664_100130960 3300005564 Bacteria 2203
285 Ga0070664_100269721 3300005564 Unclassified 1533
286 Ga0070664_100276635 3300005564 Bacteria 1513
287 Ga0070664_100365503 3300005564 Bacteria 1315
288 Ga0068857_100002147 3300005577 Bacteria 16027
289 Ga0068857_100003490 3300005577 Bacteria 13120
290 Ga0068857_100021702 3300005577 Bacteria 5650
291 Ga0068857_100040038 3300005577 Bacteria 4155
292 Ga0068857_100042481 3300005577 Bacteria 4034
293 Ga0068857_100048707 3300005577 Bacteria 3761
294 Ga0068857_100120144 3300005577 Bacteria 2365
295 Ga0068857_100239651 3300005577 Bacteria 1660
296 Ga0068857_101160176 3300005577 Bacteria 747
297 Ga0068854_100014542 3300005578 Bacteria 5192
298 Ga0068854_100033534 3300005578 Bacteria 3580
299 Ga0068854_100045630 3300005578 Bacteria 3117
300 Ga0068854_100057512 3300005578 Bacteria 2806
301 Ga0068854_100147519 3300005578 Bacteria 1811
302 Ga0068854_100418824 3300005578 Bacteria 1112
303 Ga0068854_100454171 3300005578 Bacteria 1071
304 Ga0068854_100486972 3300005578 Bacteria 1036
305 Ga0068854_100917904 3300005578 Bacteria 770
306 Ga0068856_100013213 3300005614 Bacteria 7996
307 Ga0068856_100077714 3300005614 Bacteria 3289
308 Ga0068856_100117174 3300005614 Unclassified 2664
309 Ga0068856_100165278 3300005614 Bacteria 2224
310 Ga0070702_100138828 3300005615 Bacteria 1546
311 Ga0068852_100001315 3300005616 Bacteria 16622
312 Ga0068852_100021556 3300005616 Bacteria 5148
313 Ga0068852_100022444 3300005616 Bacteria 5062
314 Ga0068852_100034271 3300005616 Bacteria 4222
315 Ga0068852_100126566 3300005616 Bacteria 2347
316 Ga0068852_100144464 3300005616 Bacteria 2205
317 Ga0068852_100280118 3300005616 Bacteria 1607
318 Ga0068852_100549364 3300005616 Bacteria 1155
319 Ga0068852_101452846 3300005616 Bacteria 708
320 Ga0068859_100000003 3300005617 Bacteria 479218
321 Ga0068859_100000592 3300005617 Bacteria 36168
322 Ga0068859_100002273 3300005617 Bacteria 19500
323 Ga0068859_100037372 3300005617 Bacteria 4873
324 Ga0068859_100059461 3300005617 Bacteria 3850
325 Ga0068859_100070283 3300005617 Bacteria 3536
326 Ga0068859_100079802 3300005617 Bacteria 3313
327 Ga0068859_100081735 3300005617 Bacteria 3273
328 Ga0068859_100085967 3300005617 Bacteria 3191
329 Ga0068859_100137328 3300005617 Bacteria 2518
330 Ga0068859_100167827 3300005617 Bacteria 2275
331 Ga0068859_100178034 3300005617 Bacteria 2209
332 Ga0068859_100283057 3300005617 Bacteria 1751
333 Ga0068859_100293379 3300005617 Bacteria 1719
334 Ga0068859_100427170 3300005617 Bacteria 1421
335 Ga0068859_100449886 3300005617 Bacteria 1384
336 Ga0068859_100450640 3300005617 Bacteria 1383
337 Ga0068859_100635313 3300005617 Bacteria 1160
338 Ga0068859_100860221 3300005617 Bacteria 992
339 Ga0068859_101251622 3300005617 Bacteria 817
340 Ga0068864_100007084 3300005618 Bacteria 9205
341 Ga0068864_100021165 3300005618 Bacteria 5446
342 Ga0068864_100037255 3300005618 Bacteria 4150
343 Ga0068864_100048883 3300005618 Bacteria 3637
344 Ga0068864_100119680 3300005618 Bacteria 2353
345 Ga0068864_100133853 3300005618 Bacteria 2230
346 Ga0068864_100192449 3300005618 Bacteria 1870
347 Ga0068864_100267086 3300005618 Bacteria 1593
348 Ga0068864_100453334 3300005618 Bacteria 1227
349 Ga0068866_10120882 3300005718 Bacteria 1476
350 Ga0068866_10302902 3300005718 Unclassified 999
351 Ga0068866_10708184 3300005718 Bacteria 691
352 Ga0068861_100007006 3300005719 Bacteria 7703
353 Ga0068861_100033569 3300005719 Bacteria 3787
354 Ga0068861_100060066 3300005719 Bacteria 2913
355 Ga0068861_100155625 3300005719 Bacteria 1880
356 Ga0068861_100197822 3300005719 Bacteria 1685
357 Ga0068861_100375589 3300005719 Bacteria 1254
358 Ga0068861_100503220 3300005719 Unclassified 1096
359 Ga0068861_100659867 3300005719 Bacteria 967
360 Ga0068851_10013732 3300005834 Bacteria 3834
361 Ga0068851_10024275 3300005834 Bacteria 2968
362 Ga0068851_10037373 3300005834 Bacteria 2434
363 Ga0068851_10088305 3300005834 Bacteria 1629
364 Ga0068851_10145542 3300005834 Bacteria 1292
365 Ga0068851_10190935 3300005834 Bacteria 1139
366 Ga0068851_10332468 3300005834 Bacteria 880
367 Ga0068851_10359654 3300005834 Bacteria 849
368 Ga0068870_10178511 3300005840 Bacteria 1273
369 Ga0068870_10323816 3300005840 Bacteria 980
370 Ga0068870_10475645 3300005840 Bacteria 828
371 Ga0068863_100005185 3300005841 Bacteria 12851
372 Ga0068863_100029845 3300005841 Bacteria 5207
373 Ga0068863_100087712 3300005841 Bacteria 2949
374 Ga0068863_100214931 3300005841 Bacteria 1852
375 Ga0068863_100232817 3300005841 Bacteria 1777
376 Ga0068863_100241104 3300005841 Bacteria 1745
377 Ga0068863_100890110 3300005841 Unclassified 890
378 Ga0068863_100908067 3300005841 Bacteria 881
379 Ga0068863_101147087 3300005841 Unclassified 782
380 Ga0068863_101338441 3300005841 Bacteria 723
381 Ga0068858_100002187 3300005842 Bacteria 19799
382 Ga0068858_100003985 3300005842 Bacteria 14573
383 Ga0068858_100263131 3300005842 Bacteria 1640
384 Ga0068858_100265482 3300005842 Unclassified 1633
385 Ga0068858_100289694 3300005842 Bacteria 1560
386 Ga0068858_101055710 3300005842 Bacteria 797
387 Ga0068858_101089674 3300005842 Bacteria 784
388 Ga0068860_100000024 3300005843 Bacteria 271902
389 Ga0068860_100000691 3300005843 Bacteria 38802
390 Ga0068860_100001083 3300005843 Bacteria 30039
391 Ga0068860_100001337 3300005843 Bacteria 26812
392 Ga0068860_100003814 3300005843 Bacteria 15504
393 Ga0068860_100022366 3300005843 Bacteria 6118
394 Ga0068860_100027314 3300005843 Bacteria 5499
395 Ga0068860_100067529 3300005843 Bacteria 3397
396 Ga0068860_100081884 3300005843 Bacteria 3069
397 Ga0068860_100116746 3300005843 Bacteria 2553
398 Ga0068860_100258424 3300005843 Bacteria 1697
399 Ga0068860_100348704 3300005843 Bacteria 1456
400 Ga0068860_100757042 3300005843 Unclassified 983
401 Ga0068862_100002954 3300005844 Bacteria 14850
402 Ga0068862_100311248 3300005844 Bacteria 1451
403 Ga0068862_100315219 3300005844 Bacteria 1442
404 Ga0068862_100363185 3300005844 Unclassified 1346
405 Ga0068862_100898461 3300005844 Bacteria 871
406 Ga0068862_100915649 3300005844 Bacteria 863
407 Ga0081455_10354328 3300005937 Bacteria 1034
408 Ga0081540_1039715 3300005983 Bacteria 2464
409 Ga0081539_10001587 3300005985 Bacteria 37564
410 Ga0081539_10002627 3300005985 Bacteria 24558
411 Ga0081539_10025751 3300005985 Bacteria 3775
412 Ga0081539_10145320 3300005985 Bacteria 1147
413 Ga0070715_10127650 3300006163 Bacteria 1220
414 Ga0075366_10006323 3300006195 Bacteria 6481
415 Ga0075366_10018684 3300006195 Bacteria 4003
416 Ga0075366_10030752 3300006195 Bacteria 3157
417 Ga0075366_10163167 3300006195 Bacteria 1350
418 Ga0075366_10166302 3300006195 Bacteria 1337
419 Ga0075366_10189815 3300006195 Bacteria 1249
420 Ga0097621_100000092 3300006237 Bacteria 49439
421 Ga0097621_100015927 3300006237 Bacteria 5670
422 Ga0097621_100030459 3300006237 Bacteria 4272
423 Ga0097621_100037414 3300006237 Bacteria 3888
424 Ga0097621_100043006 3300006237 Bacteria 3641
425 Ga0097621_100190780 3300006237 Bacteria 1775
426 Ga0097621_100579534 3300006237 Bacteria 1024
427 Ga0097621_100601330 3300006237 Bacteria 1005
428 Ga0075370_10271716 3300006353 Bacteria 1006
429 Ga0068871_100000032 3300006358 Bacteria 73078
430 Ga0068871_100002355 3300006358 Bacteria 12882
431 Ga0068871_100008522 3300006358 Bacteria 7372
432 Ga0068871_100058677 3300006358 Bacteria 3134
433 Ga0068871_100083838 3300006358 Bacteria 2644
434 Ga0068871_100143671 3300006358 Bacteria 2030
435 Ga0068871_100365015 3300006358 Unclassified 1280
436 Ga0068871_100455589 3300006358 Bacteria 1147
437 Ga0068871_100465880 3300006358 Bacteria 1135
438 Ga0068871_100541812 3300006358 Bacteria 1053
439 Ga0068871_100562364 3300006358 Bacteria 1034
440 Ga0068871_100636641 3300006358 Unclassified 972
441 Ga0068871_100712950 3300006358 Unclassified 920
442 Ga0075428_100019658 3300006844 Bacteria 7472
443 Ga0075428_100381527 3300006844 Bacteria 1511
444 Ga0075430_100036022 3300006846 Bacteria 4196
445 Ga0075430_100582140 3300006846 Bacteria 923
446 Ga0075431_100001819 3300006847 Bacteria 20141
447 Ga0075431_100064340 3300006847 Bacteria 3787
448 Ga0075429_100007759 3300006880 Bacteria 9319
449 Ga0075429_100255440 3300006880 Bacteria 1535
450 Ga0068865_100028398 3300006881 Bacteria 3703
451 Ga0068865_100161276 3300006881 Bacteria 1711
452 Ga0068865_100187003 3300006881 Bacteria 1599
453 Ga0068865_100289257 3300006881 Bacteria 1307
454 Ga0068865_100378704 3300006881 Bacteria 1154
455 Ga0068865_100579970 3300006881 Bacteria 945
456 Ga0068865_100661863 3300006881 Bacteria 888
457 Ga0097620_100000003 3300006931 Bacteria 479218
458 Ga0097620_100000592 3300006931 Bacteria 36168
459 Ga0097620_100002273 3300006931 Bacteria 19500
460 Ga0097620_100008633 3300006931 Bacteria 10295
461 Ga0097620_100037373 3300006931 Bacteria 4873
462 Ga0097620_100059455 3300006931 Bacteria 3850
463 Ga0097620_100070282 3300006931 Bacteria 3536
464 Ga0097620_100079806 3300006931 Bacteria 3313
465 Ga0097620_100081732 3300006931 Bacteria 3273
466 Ga0097620_100085964 3300006931 Bacteria 3191
467 Ga0097620_100137326 3300006931 Bacteria 2518
468 Ga0097620_100167823 3300006931 Bacteria 2275
469 Ga0097620_100178027 3300006931 Bacteria 2209
470 Ga0097620_100283061 3300006931 Bacteria 1751
471 Ga0097620_100293381 3300006931 Bacteria 1719
472 Ga0097620_100427189 3300006931 Bacteria 1421
473 Ga0097620_100449875 3300006931 Bacteria 1384
474 Ga0097620_100450647 3300006931 Bacteria 1383
475 Ga0097620_100635384 3300006931 Bacteria 1160
476 Ga0097620_100860213 3300006931 Bacteria 992
477 Ga0097620_101251575 3300006931 Bacteria 817
478 Ga0105251_10109748 3300009011 Bacteria 1257
479 Ga0105240_10000106 3300009093 Bacteria 171825
480 Ga0105240_10010519 3300009093 Bacteria 12997
481 Ga0105240_10016577 3300009093 Bacteria 9968
482 Ga0105240_10023738 3300009093 Bacteria 8101
483 Ga0105240_10053361 3300009093 Bacteria 5074
484 Ga0105240_10054237 3300009093 Bacteria 5024
485 Ga0105240_10074110 3300009093 Bacteria 4202
486 Ga0105240_10085023 3300009093 Bacteria 3877
487 Ga0105240_10092597 3300009093 Bacteria 3690
488 Ga0105240_10108372 3300009093 Bacteria 3365
489 Ga0105240_10109200 3300009093 Bacteria 3351
490 Ga0105240_10154725 3300009093 Bacteria 2728
491 Ga0111539_10023215 3300009094 Bacteria 7619
492 Ga0111539_10046769 3300009094 Bacteria 5175
493 Ga0111539_10095880 3300009094 Bacteria 3484
494 Ga0111539_10177876 3300009094 Bacteria 2485
495 Ga0111539_10500579 3300009094 Bacteria 1415
496 Ga0111539_10958025 3300009094 Bacteria 995
497 Ga0111539_11166593 3300009094 Unclassified 895
498 Ga0105245_10213785 3300009098 Bacteria 1857
499 Ga0105245_10635030 3300009098 Bacteria 1097
500 Ga0105245_10666128 3300009098 Bacteria 1072
501 Ga0105247_10004291 3300009101 Bacteria 9120
502 Ga0105247_10019940 3300009101 Bacteria 4028
503 Ga0105247_10091168 3300009101 Unclassified 1935
504 Ga0105247_10222600 3300009101 Bacteria 1278
505 Ga0105247_10324077 3300009101 Bacteria 1076
506 Ga0114129_10004788 3300009147 Bacteria 19131
507 Ga0114129_10097256 3300009147 Bacteria 4075
508 Ga0114129_10103533 3300009147 Bacteria 3936
509 Ga0114129_10654684 3300009147 Bacteria 1355
510 Ga0105243_10886064 3300009148 Unclassified 887
511 Ga0105241_10001001 3300009174 Bacteria 21430
512 Ga0105241_10001117 3300009174 Bacteria 20448
513 Ga0105241_10026175 3300009174 Bacteria 4338
514 Ga0105241_10134161 3300009174 Bacteria 2008
515 Ga0105241_10164060 3300009174 Bacteria 1829
516 Ga0105241_10168883 3300009174 Bacteria 1805
517 Ga0105241_10172154 3300009174 Bacteria 1789
518 Ga0105241_10206365 3300009174 Bacteria 1644
519 Ga0105241_10557038 3300009174 Bacteria 1030
520 Ga0105241_10585782 3300009174 Bacteria 1006
521 Ga0105241_10696428 3300009174 Bacteria 927
522 Ga0105242_10023752 3300009176 Bacteria 4835
523 Ga0105242_10034030 3300009176 Bacteria 4083
524 Ga0105242_10078908 3300009176 Bacteria 2749
525 Ga0105242_10234417 3300009176 Bacteria 1646
526 Ga0105242_10331489 3300009176 Unclassified 1399
527 Ga0105242_10540892 3300009176 Bacteria 1115
528 Ga0105242_10857753 3300009176 Bacteria 904
529 Ga0105242_10951734 3300009176 Bacteria 863
530 Ga0105248_10018548 3300009177 Bacteria 7691
531 Ga0105248_10027463 3300009177 Bacteria 6337
532 Ga0105248_10048854 3300009177 Bacteria 4746
533 Ga0105248_10170656 3300009177 Bacteria 2452
534 Ga0105248_10364674 3300009177 Bacteria 1626
535 Ga0105237_10000561 3300009545 Bacteria 51951
536 Ga0105237_10002380 3300009545 Bacteria 23342
537 Ga0105237_10004291 3300009545 Bacteria 16528
538 Ga0105237_10009011 3300009545 Bacteria 10729
539 Ga0105237_10014958 3300009545 Bacteria 8089
540 Ga0105237_10027964 3300009545 Bacteria 5746
541 Ga0105237_10046256 3300009545 Bacteria 4377
542 Ga0105237_10163203 3300009545 Bacteria 2227
543 Ga0105237_10181753 3300009545 Unclassified 2103
544 Ga0105237_10267031 3300009545 Bacteria 1714
545 Ga0105237_10282510 3300009545 Bacteria 1662
546 Ga0105237_10914406 3300009545 Bacteria 884
547 Ga0105238_10031474 3300009551 Bacteria 5401
548 Ga0105238_10069229 3300009551 Bacteria 3529
549 Ga0105249_10001813 3300009553 Bacteria 18581
550 Ga0105249_10004472 3300009553 Bacteria 12086
551 Ga0105249_10005427 3300009553 Bacteria 11006
552 Ga0105249_10014006 3300009553 Bacteria 7089
553 Ga0105249_10033642 3300009553 Bacteria 4642
554 Ga0105249_10056505 3300009553 Bacteria 3593
555 Ga0105249_10113817 3300009553 Bacteria 2561
556 Ga0105249_10160717 3300009553 Unclassified 2171
557 Ga0105249_10161804 3300009553 Bacteria 2164
558 Ga0105249_10199526 3300009553 Bacteria 1957
559 Ga0105249_10246578 3300009553 Bacteria 1769
560 Ga0105249_11167002 3300009553 Bacteria 841
561 Ga0105249_11265211 3300009553 Bacteria 809
562 Ga0105249_11324343 3300009553 Bacteria 792
563 Ga0105249_11377412 3300009553 Unclassified 777
564 Ga0105249_11642142 3300009553 Bacteria 715
565 Ga0105239_10000580 3300010375 Bacteria 52245
566 Ga0105239_10014827 3300010375 Bacteria 8644
567 Ga0105239_10015390 3300010375 Bacteria 8475
568 Ga0105239_10018651 3300010375 Bacteria 7664
569 Ga0105239_10025967 3300010375 Bacteria 6449
570 Ga0105239_10272507 3300010375 Unclassified 1904
571 Ga0105239_10437167 3300010375 Bacteria 1483
572 Ga0105239_10642505 3300010375 Bacteria 1212
573 Ga0105239_11125727 3300010375 Bacteria 904
574 Ga0105239_11206934 3300010375 Bacteria 872
575 Ga0105239_11318998 3300010375 Bacteria 833
576 Ga0105246_10001264 3300011119 Bacteria 14839
577 Ga0105246_10110700 3300011119 Bacteria 2017
578 Ga0105246_10110814 3300011119 Bacteria 2016
579 Ga0105246_10112608 3300011119 Unclassified 2002
580 Ga0105246_10223331 3300011119 Bacteria 1478
581 Ga0105246_10343862 3300011119 Bacteria 1220
582 Ga0105246_10456187 3300011119 Bacteria 1075
583 Ga0105246_10703034 3300011119 Bacteria 886
584 Ga0105246_11011060 3300011119 Bacteria 753
585 Ga0157373_10002876 3300013100 Bacteria 13026
586 Ga0157373_10038665 3300013100 Bacteria 3419
587 Ga0157373_10072067 3300013100 Bacteria 2439
588 Ga0157373_10104215 3300013100 Bacteria 1995
589 Ga0157373_10128381 3300013100 Bacteria 1783
590 Ga0157373_10132980 3300013100 Bacteria 1749
591 Ga0157373_10181167 3300013100 Bacteria 1483
592 Ga0157373_10204234 3300013100 Bacteria 1393
593 Ga0157373_10448322 3300013100 Unclassified 928
594 Ga0157371_10009545 3300013102 Bacteria 7632
595 Ga0157371_10012610 3300013102 Bacteria 6450
596 Ga0157371_10016310 3300013102 Bacteria 5549
597 Ga0157371_10020936 3300013102 Bacteria 4808
598 Ga0157371_10097065 3300013102 Bacteria 2089
599 Ga0157371_10179682 3300013102 Bacteria 1513
600 Ga0157371_10307673 3300013102 Bacteria 1148
601 Ga0157371_10333941 3300013102 Bacteria 1101
602 Ga0157371_10372098 3300013102 Bacteria 1042
603 Ga0157371_10402923 3300013102 Bacteria 1001
604 Ga0157370_10001381 3300013104 Bacteria 30032
605 Ga0157370_10004229 3300013104 Bacteria 16610
606 Ga0157370_10004529 3300013104 Bacteria 15925
607 Ga0157370_10017392 3300013104 Bacteria 7257
608 Ga0157370_10069720 3300013104 Bacteria 3320
609 Ga0157370_10235369 3300013104 Bacteria 1695
610 Ga0157370_10491839 3300013104 Bacteria 1127
611 Ga0157370_10747382 3300013104 Bacteria 891
612 Ga0157369_10019874 3300013105 Bacteria 7514
613 Ga0157369_10044560 3300013105 Bacteria 4827
614 Ga0157369_10050980 3300013105 Bacteria 4480
615 Ga0157369_10077516 3300013105 Bacteria 3562
616 Ga0157369_10104510 3300013105 Bacteria 3015
617 Ga0157369_10214797 3300013105 Bacteria 2015
618 Ga0157369_10455425 3300013105 Bacteria 1325
619 Ga0157369_10575030 3300013105 Bacteria 1164
620 Ga0157374_10000011 3300013296 Bacteria 466749
621 Ga0157374_10002056 3300013296 Bacteria 16922
622 Ga0157374_10002752 3300013296 Bacteria 14766
623 Ga0157374_10007445 3300013296 Bacteria 9338
624 Ga0157374_10049099 3300013296 Bacteria 3919
625 Ga0157374_10058501 3300013296 Bacteria 3602
626 Ga0157374_10128677 3300013296 Bacteria 2449
627 Ga0157374_10327134 3300013296 Bacteria 1520
628 Ga0157374_11102403 3300013296 Bacteria 814
629 Ga0157374_11583648 3300013296 Bacteria 679
630 Ga0157378_10003885 3300013297 Bacteria 13232
631 Ga0157378_10004715 3300013297 Bacteria 11954
632 Ga0157378_10005169 3300013297 Bacteria 11457
633 Ga0157378_10007179 3300013297 Bacteria 9729
634 Ga0157378_10022460 3300013297 Bacteria 5553
635 Ga0157378_10023168 3300013297 Bacteria 5465
636 Ga0157378_10122033 3300013297 Bacteria 2403
637 Ga0157378_10124362 3300013297 Bacteria 2381
638 Ga0157378_10137561 3300013297 Bacteria 2265
639 Ga0157378_10145037 3300013297 Bacteria 2207
640 Ga0157378_10146238 3300013297 Bacteria 2199
641 Ga0163162_10001786 3300013306 Bacteria 20177
642 Ga0163162_10003305 3300013306 Bacteria 15432
643 Ga0163162_10010207 3300013306 Bacteria 9123
644 Ga0163162_10011455 3300013306 Bacteria 8648
645 Ga0163162_10014954 3300013306 Bacteria 7579
646 Ga0163162_10023728 3300013306 Bacteria 6053
647 Ga0163162_10040579 3300013306 Bacteria 4655
648 Ga0163162_10256815 3300013306 Bacteria 1879
649 Ga0163162_10283918 3300013306 Bacteria 1787
650 Ga0163162_10307954 3300013306 Bacteria 1716
651 Ga0163162_10353192 3300013306 Unclassified 1603
652 Ga0163162_10938397 3300013306 Unclassified 977
653 Ga0163162_11182232 3300013306 Bacteria 868
654 Ga0163162_11628418 3300013306 Bacteria 737
655 Ga0157372_10000171 3300013307 Bacteria 71956
656 Ga0157372_10000463 3300013307 Bacteria 44664
657 Ga0157372_10002594 3300013307 Bacteria 19562
658 Ga0157372_10011230 3300013307 Bacteria 9527
659 Ga0157372_10020732 3300013307 Bacteria 7096
660 Ga0157372_10059624 3300013307 Bacteria 4269
661 Ga0157372_10066128 3300013307 Bacteria 4061
662 Ga0157372_10097927 3300013307 Bacteria 3346
663 Ga0157372_10098970 3300013307 Bacteria 3326
664 Ga0157372_10144671 3300013307 Bacteria 2741
665 Ga0157372_10216361 3300013307 Bacteria 2221
666 Ga0157372_10231196 3300013307 Bacteria 2144
667 Ga0157372_10288029 3300013307 Bacteria 1910
668 Ga0157372_10296905 3300013307 Bacteria 1879
669 Ga0157372_10398778 3300013307 Bacteria 1603
670 Ga0157372_10414282 3300013307 Bacteria 1570
671 Ga0157372_10460271 3300013307 Bacteria 1482
672 Ga0157372_10505780 3300013307 Bacteria 1409
673 Ga0157372_10622885 3300013307 Bacteria 1257
674 Ga0157372_11628241 3300013307 Unclassified 743
675 Ga0157372_11657526 3300013307 Bacteria 736
676 Ga0157372_12096753 3300013307 Bacteria 650
677 Ga0157375_10000253 3300013308 Bacteria 48558
678 Ga0157375_10006781 3300013308 Bacteria 9977
679 Ga0157375_10018468 3300013308 Bacteria 6325
680 Ga0157375_10039295 3300013308 Bacteria 4554
681 Ga0157375_10061193 3300013308 Bacteria 3737
682 Ga0157375_10079386 3300013308 Bacteria 3317
683 Ga0157375_10093329 3300013308 Bacteria 3076
684 Ga0157375_10209713 3300013308 Bacteria 2105
685 Ga0157375_10219966 3300013308 Bacteria 2057
686 Ga0157375_10223380 3300013308 Bacteria 2042
687 Ga0157375_10229514 3300013308 Bacteria 2015
688 Ga0157375_10503629 3300013308 Bacteria 1375
689 Ga0157375_10518608 3300013308 Bacteria 1355
690 Ga0157375_10680661 3300013308 Bacteria 1183
691 Ga0157375_11015244 3300013308 Bacteria 969
692 Ga0157375_11147721 3300013308 Bacteria 910
693 Ga0157375_11238351 3300013308 Bacteria 876
694 Ga0157375_12128856 3300013308 Bacteria 668
695 Ga0157375_12268388 3300013308 Bacteria 647
696 Ga0163163_10001998 3300014325 Bacteria 17228
697 Ga0163163_10005703 3300014325 Bacteria 10797
698 Ga0163163_10014364 3300014325 Bacteria 7280
699 Ga0163163_10067307 3300014325 Bacteria 3561
700 Ga0163163_10079366 3300014325 Bacteria 3280
701 Ga0163163_10209682 3300014325 Unclassified 1997
702 Ga0163163_10357042 3300014325 Bacteria 1518
703 Ga0163163_10384193 3300014325 Bacteria 1462
704 Ga0163163_10396739 3300014325 Bacteria 1438
705 Ga0163163_10557891 3300014325 Bacteria 1208
706 Ga0163163_10962002 3300014325 Bacteria 917
707 Ga0163163_11071721 3300014325 Bacteria 869
708 Ga0163163_11868658 3300014325 Bacteria 661
709 Ga0157380_10000255 3300014326 Bacteria 31852
710 Ga0157380_10026726 3300014326 Bacteria 4385
711 Ga0157380_10033800 3300014326 Bacteria 3940
712 Ga0157380_10104836 3300014326 Bacteria 2363
713 Ga0157380_10191094 3300014326 Bacteria 1808
714 Ga0157380_10244711 3300014326 Bacteria 1619
715 Ga0157380_10684609 3300014326 Bacteria 1028
716 Ga0157380_10707913 3300014326 Bacteria 1013
717 Ga0157380_10998365 3300014326 Bacteria 870
718 Ga0157377_10000877 3300014745 Bacteria 12514
719 Ga0157377_10033346 3300014745 Bacteria 2810
720 Ga0157377_10053008 3300014745 Bacteria 2292
721 Ga0157377_10053201 3300014745 Bacteria 2288
722 Ga0157377_10104769 3300014745 Bacteria 1692
723 Ga0157377_10119224 3300014745 Bacteria 1597
724 Ga0157377_10168175 3300014745 Bacteria 1369
725 Ga0157377_10245015 3300014745 Bacteria 1159
726 Ga0157379_10003755 3300014968 Bacteria 12918
727 Ga0157379_10010237 3300014968 Bacteria 8166
728 Ga0157379_10012296 3300014968 Bacteria 7476
729 Ga0157379_10072358 3300014968 Bacteria 3084
730 Ga0157379_10102352 3300014968 Bacteria 2571
731 Ga0157379_10110228 3300014968 Bacteria 2472
732 Ga0157379_10164121 3300014968 Bacteria 2005
733 Ga0157379_10239159 3300014968 Bacteria 1647
734 Ga0157379_10416341 3300014968 Unclassified 1237
735 Ga0157379_10974267 3300014968 Unclassified 807
736 Ga0157379_11319200 3300014968 Unclassified 697
737 Ga0157376_10000714 3300014969 Bacteria 21474
738 Ga0157376_10000961 3300014969 Bacteria 18769
739 Ga0157376_10013649 3300014969 Bacteria 6070
740 Ga0157376_10020493 3300014969 Bacteria 5115
741 Ga0157376_10037704 3300014969 Bacteria 3927
742 Ga0157376_10042263 3300014969 Bacteria 3736
743 Ga0157376_10128050 3300014969 Bacteria 2261
744 Ga0157376_10207857 3300014969 Bacteria 1805
745 Ga0157376_10392783 3300014969 Bacteria 1339
746 Ga0157376_10454081 3300014969 Unclassified 1251
747 Ga0157376_10610114 3300014969 Bacteria 1087
748 Ga0163161_10006391 3300017792 Bacteria 8158
749 Ga0163161_10010207 3300017792 Bacteria 6502
750 Ga0163161_10057828 3300017792 Bacteria 2818
751 Ga0163161_10063298 3300017792 Bacteria 2696
752 Ga0163161_10071446 3300017792 Bacteria 2540
753 Ga0163161_10072000 3300017792 Bacteria 2530
754 Ga0163161_10194095 3300017792 Bacteria 1562
755 Ga0163161_10208107 3300017792 Bacteria 1510
756 Ga0163161_10365380 3300017792 Unclassified 1150
757 Ga0163161_10450629 3300017792 Bacteria 1040
758 Ga0163161_10884223 3300017792 Unclassified 756
759 Ga0224572_1030126 3300024225 Unclassified 1037
760 Ga0209646_1001266 3300025246 Bacteria 7139
761 Ga0207666_1006968 3300025271 Bacteria 1477
762 Ga0207666_1036659 3300025271 Bacteria 762
763 Ga0207426_1000040 3300025302 Bacteria 433920
764 Ga0207697_10011629 3300025315 Bacteria 3717
765 Ga0207697_10011691 3300025315 Bacteria 3705
766 Ga0207697_10022813 3300025315 Bacteria 2563
767 Ga0207697_10124080 3300025315 Unclassified 1113
768 Ga0207656_10002582 3300025321 Bacteria 6124
769 Ga0207656_10016933 3300025321 Bacteria 2846
770 Ga0207656_10047246 3300025321 Bacteria 1850
771 Ga0207656_10059474 3300025321 Bacteria 1672
772 Ga0207656_10080318 3300025321 Unclassified 1464
773 Ga0207656_10172435 3300025321 Unclassified 1035
774 Ga0207656_10329934 3300025321 Unclassified 759
775 Ga0207682_10103487 3300025893 Bacteria 1247
776 Ga0207682_10155406 3300025893 Bacteria 1034
777 Ga0207642_10039087 3300025899 Bacteria 2058
778 Ga0207710_10007034 3300025900 Bacteria 4780
779 Ga0207710_10007383 3300025900 Bacteria 4656
780 Ga0207710_10012704 3300025900 Bacteria 3544
781 Ga0207688_10007452 3300025901 Bacteria 5950
782 Ga0207688_10021310 3300025901 Bacteria 3540
783 Ga0207688_10401068 3300025901 Bacteria 850
784 Ga0207688_10434620 3300025901 Bacteria 817
785 Ga0207680_10000385 3300025903 Bacteria 21073
786 Ga0207680_10093805 3300025903 Bacteria 1915
787 Ga0207680_10112408 3300025903 Bacteria 1769
788 Ga0207680_10162269 3300025903 Bacteria 1500
789 Ga0207680_10572309 3300025903 Bacteria 807
790 Ga0207647_10000267 3300025904 Bacteria 42865
791 Ga0207647_10020554 3300025904 Bacteria 4425
792 Ga0207647_10021116 3300025904 Bacteria 4351
793 Ga0207647_10032255 3300025904 Bacteria 3368
794 Ga0207647_10102979 3300025904 Bacteria 1693
795 Ga0207647_10106706 3300025904 Bacteria 1658
796 Ga0207685_10181909 3300025905 Bacteria 975
797 Ga0207645_10010860 3300025907 Bacteria 6240
798 Ga0207645_10011072 3300025907 Bacteria 6172
799 Ga0207645_10026728 3300025907 Bacteria 3729
800 Ga0207645_10084323 3300025907 Bacteria 2039
801 Ga0207645_10113964 3300025907 Unclassified 1752
802 Ga0207645_10124444 3300025907 Bacteria 1675
803 Ga0207643_10009151 3300025908 Bacteria 5321
804 Ga0207643_10023749 3300025908 Bacteria 3382
805 Ga0207643_10373191 3300025908 Unclassified 898
806 Ga0207705_10010189 3300025909 Bacteria 6837
807 Ga0207705_10425060 3300025909 Bacteria 1029
808 Ga0207705_10448394 3300025909 Bacteria 1000
809 Ga0207654_10000620 3300025911 Bacteria 20025
810 Ga0207654_10005079 3300025911 Bacteria 6638
811 Ga0207654_10017618 3300025911 Bacteria 3738
812 Ga0207654_10029309 3300025911 Bacteria 3011
813 Ga0207654_10074892 3300025911 Bacteria 2021
814 Ga0207654_10143024 3300025911 Bacteria 1527
815 Ga0207654_10157829 3300025911 Bacteria 1462
816 Ga0207654_10419371 3300025911 Unclassified 934
817 Ga0207707_10006526 3300025912 Bacteria 10186
818 Ga0207707_10128314 3300025912 Bacteria 2217
819 Ga0207695_10000087 3300025913 Bacteria 276412
820 Ga0207695_10001064 3300025913 Bacteria 48020
821 Ga0207695_10003167 3300025913 Bacteria 23458
822 Ga0207695_10005226 3300025913 Bacteria 17356
823 Ga0207695_10010725 3300025913 Bacteria 11182
824 Ga0207695_10013294 3300025913 Bacteria 9821
825 Ga0207695_10026607 3300025913 Bacteria 6456
826 Ga0207695_10035111 3300025913 Bacteria 5442
827 Ga0207695_10043256 3300025913 Bacteria 4801
828 Ga0207671_10001454 3300025914 Bacteria 27338
829 Ga0207671_10001564 3300025914 Bacteria 26154
830 Ga0207671_10002275 3300025914 Bacteria 20777
831 Ga0207671_10002324 3300025914 Bacteria 20513
832 Ga0207671_10002511 3300025914 Bacteria 19577
833 Ga0207671_10012471 3300025914 Bacteria 6829
834 Ga0207671_10119196 3300025914 Bacteria 2016
835 Ga0207671_10151250 3300025914 Bacteria 1793
836 Ga0207671_10250176 3300025914 Bacteria 1393
837 Ga0207671_10453712 3300025914 Bacteria 1021
838 Ga0207660_10010532 3300025917 Bacteria 6004
839 Ga0207660_10076527 3300025917 Unclassified 2447
840 Ga0207662_10007595 3300025918 Bacteria 5909
841 Ga0207662_10057432 3300025918 Bacteria 2326
842 Ga0207657_10008173 3300025919 Bacteria 10659
843 Ga0207657_10035191 3300025919 Bacteria 4494
844 Ga0207657_10177169 3300025919 Bacteria 1725
845 Ga0207657_10248567 3300025919 Unclassified 1418
846 Ga0207649_10004322 3300025920 Bacteria 7721
847 Ga0207649_10010183 3300025920 Bacteria 5163
848 Ga0207649_10281232 3300025920 Bacteria 1210
849 Ga0207649_10288048 3300025920 Bacteria 1197
850 Ga0207649_10653167 3300025920 Bacteria 813
851 Ga0207652_10001428 3300025921 Bacteria 21177
852 Ga0207652_10174526 3300025921 Bacteria 1930
853 Ga0207652_10963259 3300025921 Bacteria 751
854 Ga0207681_10006442 3300025923 Bacteria 7206
855 Ga0207681_10050522 3300025923 Bacteria 2814
856 Ga0207681_10140802 3300025923 Bacteria 1796
857 Ga0207681_10289267 3300025923 Bacteria 1293
858 Ga0207694_10032409 3300025924 Bacteria 4000
859 Ga0207694_10037716 3300025924 Unclassified 3713
860 Ga0207694_10266312 3300025924 Bacteria 1405
861 Ga0207650_10000886 3300025925 Bacteria 22639
862 Ga0207650_10016333 3300025925 Bacteria 5188
863 Ga0207650_10038753 3300025925 Bacteria 3482
864 Ga0207650_10094335 3300025925 Bacteria 2292
865 Ga0207650_10165996 3300025925 Bacteria 1752
866 Ga0207650_10217609 3300025925 Bacteria 1536
867 Ga0207650_10255577 3300025925 Bacteria 1420
868 Ga0207650_10261414 3300025925 Bacteria 1404
869 Ga0207650_10287529 3300025925 Bacteria 1340
870 Ga0207650_10302399 3300025925 Bacteria 1307
871 Ga0207650_10523453 3300025925 Bacteria 992
872 Ga0207650_10571944 3300025925 Unclassified 948
873 Ga0207650_10636961 3300025925 Bacteria 898
874 Ga0207659_10009499 3300025926 Bacteria 6081
875 Ga0207659_10024016 3300025926 Bacteria 4079
876 Ga0207659_10025149 3300025926 Bacteria 3997
877 Ga0207659_10082611 3300025926 Bacteria 2379
878 Ga0207659_10133875 3300025926 Bacteria 1917
879 Ga0207659_10176810 3300025926 Bacteria 1688
880 Ga0207659_10185656 3300025926 Unclassified 1651
881 Ga0207659_10289288 3300025926 Bacteria 1342
882 Ga0207659_10320533 3300025926 Unclassified 1279
883 Ga0207659_10385180 3300025926 Bacteria 1170
884 Ga0207659_10421993 3300025926 Bacteria 1119
885 Ga0207659_10631973 3300025926 Unclassified 914
886 Ga0207700_10151666 3300025928 Bacteria 1916
887 Ga0207644_10039742 3300025931 Bacteria 3322
888 Ga0207644_10211405 3300025931 Bacteria 1534
889 Ga0207644_10553664 3300025931 Bacteria 952
890 Ga0207690_10323216 3300025932 Bacteria 1213
891 Ga0207690_10341321 3300025932 Bacteria 1182
892 Ga0207690_10588220 3300025932 Bacteria 907
893 Ga0207690_10642972 3300025932 Bacteria 869
894 Ga0207706_10003305 3300025933 Bacteria 15441
895 Ga0207706_10006233 3300025933 Bacteria 11084
896 Ga0207706_10024736 3300025933 Bacteria 5382
897 Ga0207706_10098351 3300025933 Bacteria 2574
898 Ga0207706_10161317 3300025933 Bacteria 1971
899 Ga0207706_10339753 3300025933 Bacteria 1306
900 Ga0207686_10002365 3300025934 Bacteria 10310
901 Ga0207686_10172081 3300025934 Bacteria 1528
902 Ga0207686_10431623 3300025934 Bacteria 1010
903 Ga0207670_10002414 3300025936 Bacteria 9794
904 Ga0207670_10013041 3300025936 Bacteria 4887
905 Ga0207670_10036422 3300025936 Bacteria 3199
906 Ga0207670_10046304 3300025936 Bacteria 2889
907 Ga0207669_10008719 3300025937 Bacteria 4779
908 Ga0207669_10044594 3300025937 Bacteria 2607
909 Ga0207669_10046466 3300025937 Bacteria 2566
910 Ga0207669_10079120 3300025937 Bacteria 2097
911 Ga0207669_10337155 3300025937 Bacteria 1160
912 Ga0207704_10238108 3300025938 Bacteria 1358
913 Ga0207704_10272286 3300025938 Unclassified 1283
914 Ga0207704_10348124 3300025938 Bacteria 1153
915 Ga0207704_10416621 3300025938 Bacteria 1064
916 Ga0207704_10672833 3300025938 Unclassified 854
917 Ga0207704_10911796 3300025938 Bacteria 739
918 Ga0207704_11191151 3300025938 Unclassified 649
919 Ga0207704_11235418 3300025938 Bacteria 638
920 Ga0207691_10001280 3300025940 Bacteria 25134
921 Ga0207691_10021484 3300025940 Bacteria 6094
922 Ga0207691_10028411 3300025940 Bacteria 5237
923 Ga0207691_10041189 3300025940 Bacteria 4266
924 Ga0207691_10122221 3300025940 Bacteria 2306
925 Ga0207691_10154086 3300025940 Bacteria 2019
926 Ga0207691_10183594 3300025940 Bacteria 1827
927 Ga0207691_10193029 3300025940 Bacteria 1775
928 Ga0207691_10201431 3300025940 Bacteria 1732
929 Ga0207691_10425589 3300025940 Bacteria 1131
930 Ga0207691_10514004 3300025940 Bacteria 1017
931 Ga0207691_10640672 3300025940 Bacteria 898
932 Ga0207691_10744946 3300025940 Unclassified 825
933 Ga0207711_10107418 3300025941 Bacteria 2478
934 Ga0207711_10166409 3300025941 Bacteria 1999
935 Ga0207711_10455502 3300025941 Bacteria 1191
936 Ga0207689_10001049 3300025942 Bacteria 26546
937 Ga0207689_10001807 3300025942 Bacteria 20189
938 Ga0207689_10002381 3300025942 Bacteria 17551
939 Ga0207689_10009409 3300025942 Bacteria 8441
940 Ga0207689_10030982 3300025942 Bacteria 4456
941 Ga0207689_10033659 3300025942 Bacteria 4257
942 Ga0207689_10064394 3300025942 Bacteria 3016
943 Ga0207689_10127606 3300025942 Bacteria 2092
944 Ga0207689_10230627 3300025942 Bacteria 1530
945 Ga0207689_10251925 3300025942 Bacteria 1460
946 Ga0207689_10297712 3300025942 Bacteria 1337
947 Ga0207661_10004547 3300025944 Bacteria 9722
948 Ga0207661_10066686 3300025944 Bacteria 2924
949 Ga0207661_10107524 3300025944 Bacteria 2353
950 Ga0207661_10366673 3300025944 Unclassified 1302
951 Ga0207661_10504259 3300025944 Unclassified 1106
952 Ga0207661_10617403 3300025944 Bacteria 996
953 Ga0207661_10926512 3300025944 Bacteria 802
954 Ga0207679_10001622 3300025945 Bacteria 14023
955 Ga0207679_10001896 3300025945 Bacteria 12987
956 Ga0207679_10013487 3300025945 Bacteria 5359
957 Ga0207679_10045820 3300025945 Bacteria 3165
958 Ga0207679_10048432 3300025945 Bacteria 3094
959 Ga0207679_10372822 3300025945 Bacteria 1249
960 Ga0207679_10828352 3300025945 Bacteria 844
961 Ga0207667_10000584 3300025949 Bacteria 47412
962 Ga0207667_10001242 3300025949 Bacteria 31953
963 Ga0207667_10052749 3300025949 Bacteria 4281
964 Ga0207667_10112572 3300025949 Bacteria 2806
965 Ga0207667_10437896 3300025949 Bacteria 1329
966 Ga0207651_10009144 3300025960 Bacteria 5398
967 Ga0207651_10024767 3300025960 Bacteria 3718
968 Ga0207651_10038166 3300025960 Bacteria 3154
969 Ga0207651_10060146 3300025960 Bacteria 2636
970 Ga0207651_10118387 3300025960 Bacteria 2003
971 Ga0207651_10187003 3300025960 Bacteria 1649
972 Ga0207651_10202383 3300025960 Unclassified 1592
973 Ga0207651_10264086 3300025960 Bacteria 1415
974 Ga0207651_10307609 3300025960 Bacteria 1320
975 Ga0207651_10423199 3300025960 Bacteria 1137
976 Ga0207651_10465509 3300025960 Unclassified 1087
977 Ga0207651_10806072 3300025960 Unclassified 833
978 Ga0207712_10001674 3300025961 Bacteria 14881
979 Ga0207712_10002942 3300025961 Bacteria 10882
980 Ga0207712_10024390 3300025961 Bacteria 4004
981 Ga0207712_10033174 3300025961 Bacteria 3489
982 Ga0207712_10088473 3300025961 Bacteria 2274
983 Ga0207712_10147361 3300025961 Bacteria 1814
984 Ga0207712_10148194 3300025961 Bacteria 1809
985 Ga0207712_10212567 3300025961 Bacteria 1541
986 Ga0207712_10274813 3300025961 Unclassified 1372
987 Ga0207712_10466706 3300025961 Bacteria 1073
988 Ga0207712_10820779 3300025961 Bacteria 818
989 Ga0207712_11001492 3300025961 Bacteria 741
990 Ga0207668_10000514 3300025972 Bacteria 24251
991 Ga0207668_10093747 3300025972 Bacteria 2213
992 Ga0207668_10218419 3300025972 Unclassified 1529
993 Ga0207668_10390789 3300025972 Bacteria 1173
994 Ga0207668_10485411 3300025972 Bacteria 1060
995 Ga0207640_10027405 3300025981 Bacteria 3470
996 Ga0207640_10060803 3300025981 Bacteria 2499
997 Ga0207640_10177489 3300025981 Unclassified 1594
998 Ga0207640_10184743 3300025981 Bacteria 1566
999 Ga0207640_10198817 3300025981 Bacteria 1517
1000 Ga0207640_10244172 3300025981 Bacteria 1389
1001 Ga0207640_10566953 3300025981 Unclassified 956
1002 Ga0207640_10613757 3300025981 Bacteria 922
1003 Ga0207640_10645381 3300025981 Bacteria 901
1004 Ga0207640_10673307 3300025981 Unclassified 884
1005 Ga0207658_10073650 3300025986 Bacteria 2593
1006 Ga0207658_10153400 3300025986 Bacteria 1879
1007 Ga0207658_10242920 3300025986 Bacteria 1526
1008 Ga0207658_10311895 3300025986 Bacteria 1359
1009 Ga0207658_10421457 3300025986 Bacteria 1177
1010 Ga0207658_10652137 3300025986 Bacteria 949
1011 Ga0207658_10749464 3300025986 Bacteria 884
1012 Ga0207658_11091660 3300025986 Bacteria 729
1013 Ga0207658_11169461 3300025986 Bacteria 703
1014 Ga0207677_10002620 3300026023 Bacteria 9469
1015 Ga0207677_10018792 3300026023 Bacteria 4156
1016 Ga0207677_10081224 3300026023 Bacteria 2325
1017 Ga0207677_10095568 3300026023 Bacteria 2172
1018 Ga0207677_10122307 3300026023 Bacteria 1960
1019 Ga0207677_10253139 3300026023 Bacteria 1431
1020 Ga0207677_10262122 3300026023 Bacteria 1409
1021 Ga0207677_10465788 3300026023 Bacteria 1086
1022 Ga0207677_10690272 3300026023 Bacteria 905
1023 Ga0207677_11226368 3300026023 Unclassified 687
1024 Ga0207703_10005569 3300026035 Bacteria 10103
1025 Ga0207703_10063864 3300026035 Bacteria 3020
1026 Ga0207703_10312904 3300026035 Bacteria 1436
1027 Ga0207703_10546020 3300026035 Bacteria 1092
1028 Ga0207639_10026879 3300026041 Bacteria 4185
1029 Ga0207639_10030308 3300026041 Bacteria 3967
1030 Ga0207639_10112441 3300026041 Unclassified 2222
1031 Ga0207639_10227832 3300026041 Bacteria 1613
1032 Ga0207678_10105489 3300026067 Bacteria 2405
1033 Ga0207678_10716740 3300026067 Bacteria 881
1034 Ga0207708_10020850 3300026075 Bacteria 4944
1035 Ga0207708_10321977 3300026075 Bacteria 1262
1036 Ga0207708_10443910 3300026075 Bacteria 1079
1037 Ga0207702_10016802 3300026078 Bacteria 6057
1038 Ga0207702_10031126 3300026078 Bacteria 4447
1039 Ga0207702_10091198 3300026078 Unclassified 2668
1040 Ga0207702_11436960 3300026078 Unclassified 683
1041 Ga0207641_10000026 3300026088 Bacteria 245091
1042 Ga0207641_10000318 3300026088 Bacteria 59432
1043 Ga0207641_10042011 3300026088 Bacteria 3834
1044 Ga0207641_10056334 3300026088 Bacteria 3340
1045 Ga0207641_10121208 3300026088 Bacteria 2334
1046 Ga0207641_10136282 3300026088 Unclassified 2210
1047 Ga0207641_10217216 3300026088 Bacteria 1771
1048 Ga0207641_10404144 3300026088 Bacteria 1312
1049 Ga0207641_10851819 3300026088 Unclassified 903
1050 Ga0207641_11079495 3300026088 Unclassified 801
1051 Ga0207648_10001180 3300026089 Bacteria 29255
1052 Ga0207648_10001955 3300026089 Bacteria 22528
1053 Ga0207648_10005292 3300026089 Bacteria 13021
1054 Ga0207648_10006356 3300026089 Bacteria 11747
1055 Ga0207648_10009551 3300026089 Bacteria 9278
1056 Ga0207648_10025583 3300026089 Bacteria 5256
1057 Ga0207648_10039078 3300026089 Bacteria 4172
1058 Ga0207648_10224594 3300026089 Unclassified 1670
1059 Ga0207648_10236245 3300026089 Bacteria 1627
1060 Ga0207648_10345188 3300026089 Bacteria 1341
1061 Ga0207648_10565590 3300026089 Bacteria 1045
1062 Ga0207648_11245666 3300026089 Unclassified 699
1063 Ga0207676_10003469 3300026095 Bacteria 11157
1064 Ga0207676_10007891 3300026095 Bacteria 7571
1065 Ga0207676_10014215 3300026095 Bacteria 5720
1066 Ga0207676_10079691 3300026095 Bacteria 2656
1067 Ga0207676_10157415 3300026095 Bacteria 1964
1068 Ga0207674_10000453 3300026116 Bacteria 53589
1069 Ga0207674_10002491 3300026116 Bacteria 23220
1070 Ga0207674_10007475 3300026116 Bacteria 12733
1071 Ga0207674_10016488 3300026116 Bacteria 8086
1072 Ga0207674_10063666 3300026116 Bacteria 3722
1073 Ga0207674_10067638 3300026116 Bacteria 3596
1074 Ga0207674_10182973 3300026116 Bacteria 2047
1075 Ga0207674_10802884 3300026116 Bacteria 908
1076 Ga0207675_100000282 3300026118 Bacteria 48883
1077 Ga0207675_100012049 3300026118 Bacteria 8077
1078 Ga0207675_100041723 3300026118 Bacteria 4284
1079 Ga0207675_100057527 3300026118 Bacteria 3628
1080 Ga0207675_100083719 3300026118 Bacteria 2992
1081 Ga0207675_100098932 3300026118 Bacteria 2747
1082 Ga0207675_100153102 3300026118 Bacteria 2196
1083 Ga0207675_100176621 3300026118 Bacteria 2043
1084 Ga0207675_100179080 3300026118 Bacteria 2029
1085 Ga0207675_100181799 3300026118 Unclassified 2014
1086 Ga0207675_100647095 3300026118 Bacteria 1063
1087 Ga0207675_100692954 3300026118 Unclassified 1027
1088 Ga0207675_100794204 3300026118 Bacteria 959
1089 Ga0207675_100947003 3300026118 Bacteria 878
1090 Ga0207683_10000957 3300026121 Bacteria 26469
1091 Ga0207683_10046934 3300026121 Bacteria 3782
1092 Ga0207683_10091671 3300026121 Bacteria 2707
1093 Ga0207683_10132622 3300026121 Bacteria 2241
1094 Ga0207683_10188197 3300026121 Bacteria 1873
1095 Ga0207683_10582529 3300026121 Bacteria 1035
1096 Ga0207683_10633094 3300026121 Bacteria 991
1097 Ga0207683_10738336 3300026121 Bacteria 913
1098 Ga0207683_11034915 3300026121 Unclassified 762
1099 Ga0207698_10017582 3300026142 Bacteria 4857
1100 Ga0207698_10049284 3300026142 Bacteria 3205
1101 Ga0207698_10085367 3300026142 Bacteria 2563
1102 Ga0207698_10137644 3300026142 Bacteria 2098
1103 Ga0207698_10172445 3300026142 Unclassified 1906
1104 Ga0207698_10694142 3300026142 Bacteria 1012
1105 Ga0207698_10853527 3300026142 Bacteria 916
1106 Ga0210000_1021596 3300027462 Bacteria 985
1107 Ga0209968_1013041 3300027526 Bacteria 1300
1108 Ga0209966_1016341 3300027695 Unclassified 1403
1109 Ga0209974_10082155 3300027876 Bacteria 1110
1110 Ga0207428_10149611 3300027907 Bacteria 1777
1111 Ga0207428_10183867 3300027907 Bacteria 1578
1112 Ga0207428_10242204 3300027907 Bacteria 1347
1113 Ga0207428_10566450 3300027907 Bacteria 820
1114 Ga0268266_10000048 3300028379 Bacteria 310336
1115 Ga0268266_10004133 3300028379 Bacteria 14019
1116 Ga0268266_10076201 3300028379 Bacteria 2914
1117 Ga0268266_10107224 3300028379 Bacteria 2470
1118 Ga0268266_10151973 3300028379 Bacteria 2087
1119 Ga0268266_10499561 3300028379 Bacteria 1161
1120 Ga0268265_10023908 3300028380 Bacteria 4315
1121 Ga0268265_10025977 3300028380 Bacteria 4163
1122 Ga0268265_10237047 3300028380 Bacteria 1607
1123 Ga0268265_11189766 3300028380 Unclassified 759
1124 Ga0268264_10000028 3300028381 Bacteria 426662
1125 Ga0268264_10001799 3300028381 Bacteria 19596
1126 Ga0268264_10004316 3300028381 Bacteria 12131
1127 Ga0268264_10020347 3300028381 Bacteria 5424
1128 Ga0268264_10027091 3300028381 Bacteria 4682
1129 Ga0268264_10042588 3300028381 Bacteria 3759
1130 Ga0268264_10075954 3300028381 Bacteria 2858
1131 Ga0268264_10089071 3300028381 Bacteria 2657
1132 Ga0268264_10467224 3300028381 Bacteria 1225
1133 Ga0268264_10505685 3300028381 Bacteria 1179
1134 Ga0268264_10587846 3300028381 Bacteria 1096
1135 Ga0268264_10973482 3300028381 Bacteria 854
1136 Ga0268264_11565799 3300028381 Unclassified 670
1137 Ga0307517_10000268 3300028786 Bacteria 89531
1138 Ga0307517_10306715 3300028786 Unclassified 887
1139 Ga0307515_10000001 3300028794 Bacteria 4259510
1140 Ga0307515_10004954 3300028794 Bacteria 27162
1141 Ga0265324_10010359 3300029957 Bacteria 3598
1142 Ga0265324_10078656 3300029957 Bacteria 1122
1143 Ga0307511_10001580 3300030521 Bacteria 24156
1144 Ga0265327_10000013 3300031251 Bacteria 519549
1145 Ga0265327_10000759 3300031251 Bacteria 50085
1146 Ga0265327_10017464 3300031251 Bacteria 4499
1147 Ga0265327_10022312 3300031251 Bacteria 3790
1148 Ga0265327_10235397 3300031251 Bacteria 820
1149 Ga0307513_10035906 3300031456 Bacteria 5540
1150 Ga0307513_10074827 3300031456 Bacteria 3520
1151 Ga0307513_10225954 3300031456 Bacteria 1689
1152 Ga0307513_10236821 3300031456 Bacteria 1634
1153 Ga0307513_10641763 3300031456 Unclassified 769
1154 Ga0307509_10262921 3300031507 Bacteria 1499
1155 Ga0307509_10297295 3300031507 Bacteria 1365
1156 Ga0307408_100023915 3300031548 Bacteria 4166
1157 Ga0265313_10015704 3300031595 Bacteria 4392
1158 Ga0307508_10000111 3300031616 Bacteria 96733
1159 Ga0307508_10035501 3300031616 Bacteria 4493
1160 Ga0265314_10371988 3300031711 Bacteria 780
1161 Ga0307516_10000159 3300031730 Bacteria 84553
1162 Ga0307516_10057074 3300031730 Bacteria 3805
1163 Ga0307516_10134390 3300031730 Bacteria 2250
1164 Ga0307410_10089608 3300031852 Bacteria 2180
1165 Ga0307410_10385299 3300031852 Bacteria 1129
1166 Ga0307412_10197586 3300031911 Bacteria 1525
1167 Ga0307412_10548828 3300031911 Bacteria 970
1168 Ga0307416_100051791 3300032002 Bacteria 3282
1169 Ga0307416_100682625 3300032002 Bacteria 1115
1170 Ga0307416_101177986 3300032002 Bacteria 872
1171 Ga0307414_10712914 3300032004 Bacteria 909
1172 Ga0307414_11077908 3300032004 Bacteria 741
1173 Ga0307411_10299513 3300032005 Bacteria 1289
1174 Ga0307507_10166854 3300033179 Bacteria 1611
1175 Ga0373957_0256809 3300035120 Bacteria 736
1176 Ga0373943_0055211 3300035170 Bacteria 1967
1177 Ga0373946_0102333 3300035171 Bacteria 1286
1178 Ga0373946_0153596 3300035171 Unclassified 1076
1179 Ga0373924_0019466 3300035410 Bacteria 2630
1180 Ga0373935_0164141 3300035692 Bacteria 1516
1181 Ga0373935_0280593 3300035692 Unclassified 1173
1182 Ga0373933_0018459 3300035724 Bacteria 3923
1183 Ga0373947_0280338 3300035725 Bacteria 1108
1184 Ga0373937_0042138 3300036401 Bacteria 4165
1185 Ga0373937_0046915 3300036401 Bacteria 3952
1186 Ga0373937_0395816 3300036401 Bacteria 1310
1187 Ga0373937_0554403 3300036401 Bacteria 1092
1188 Ga0373925_0112422 3300037068 Bacteria 2106
1189 Ga0395900_0352654 3300037418 Unclassified 1445
1190 Ga0395905_0002097 3300037471 Bacteria 22664
1191 Ga0395905_0594250 3300037471 Bacteria 1009
1192 Ga0395905_0661318 3300037471 Bacteria 947
1193 Ga0436365_0083240 3300039437 Bacteria 1038
1194 Ga0436365_1414100 3300039437 Bacteria 1537
1195 Ga0436365_1428787 3300039437 Bacteria 2686
1196 Ga0439436_0000372 3300041404 Bacteria 11185
1197 Ga0439439_0000478 3300041406 Bacteria 6854
1198 Ga0439453_0032084 3300041408 Bacteria 999
1199 Ga0451797_1009180 3300041453 Bacteria 1043
1200 Ga0451802_1934870 3300041460 Bacteria 1647
1201 Ga0451807_2257105 3300041486 Bacteria 871
1202 Ga0451833_1492660 3300041491 Bacteria 1040
1203 Ga0451835_0070461 3300041492 Bacteria 757
1204 Ga0451837_1728540 3300041494 Bacteria 974
1205 Ga0451851_1208939 3300041507 Bacteria 1116
1206 Ga0451853_1906516 3300041512 Bacteria 1487
1207 Ga0451853_2243536 3300041512 Bacteria 758
1208 Ga0439431_0005168 3300041997 Bacteria 2878
1209 Ga0439442_004892 3300042002 Bacteria 2669
1210 Ga0439445_0015475 3300042004 Unclassified 1868
1211 Ga0439445_0120035 3300042004 Unclassified 754
1212 Ga0439449_0002319 3300042007 Bacteria 7458
1213 Ga0439449_0017143 3300042007 Bacteria 2719
1214 Ga0439449_0111914 3300042007 Bacteria 1011
1215 Ga0439454_014142 3300042011 Bacteria 1103
1216 Ga0439457_000079 3300042014 Bacteria 21395
1217 Ga0439462_0066515 3300042015 Bacteria 977
1218 Ga0450920_015921 3300042122 Bacteria 1432
1219 Ga0439434_0039899 3300042435 Bacteria 1441
1220 Ga0439434_0072370 3300042435 Bacteria 1086
1221 Ga0439444_0040570 3300042437 Unclassified 912
1222 Ga0451577_0028037 3300042876 Bacteria 5095
1223 Ga0451577_0056755 3300042876 Bacteria 3493
1224 Ga0466969_0017220 3300044656 Bacteria 3775
1225 Ga0466972_0000080 3300044658 Bacteria 89226
1226 Ga0466972_0036207 3300044658 Bacteria 2415
1227 Ga0466972_0182716 3300044658 Bacteria 983
1228 Ga0453683_0128832 3300044673 Bacteria 1594
1229 Ga0466965_0102697 3300044683 Bacteria 1463
1230 Ga0466966_0000096 3300044684 Bacteria 54307
1231 Ga0466961_0007019 3300044693 Bacteria 7165
1232 Ga0466961_0042205 3300044693 Bacteria 2924
1233 Ga0466961_0451293 3300044693 Bacteria 778
1234 Ga0466964_0086320 3300044706 Bacteria 1357
1235 Ga0453684_0021992 3300044712 Bacteria 9490
1236 Ga0453684_0050332 3300044712 Bacteria 5483
1237 Ga0453684_0114590 3300044712 Bacteria 3267
1238 Ga0453684_0655220 3300044712 Bacteria 1145
1239 Ga0466971_0007115 3300044719 Bacteria 4870
1240 Ga0466968_0097385 3300044735 Bacteria 1310
1241 Ga0466968_0121709 3300044735 Bacteria 1181
1242 Ga0466970_0003085 3300044765 Bacteria 8089
1243 Ga0466970_0277576 3300044765 Bacteria 942
1244 Ga0466957_0002754 3300044842 Bacteria 9515
1245 Ga0466957_0050097 3300044842 Bacteria 2541
1246 Ga0466960_0110459 3300044901 Bacteria 1428
1247 Ga0466959_0000014 3300045049 Bacteria 150962
1248 Ga0466959_0001773 3300045049 Bacteria 13455
1249 Ga0466959_0080190 3300045049 Bacteria 2353
1250 Ga0451576_0667996 3300045051 Unclassified 1092
1251 Ga0466958_0039672 3300045836 Bacteria 2830
1252 Ga0466967_0315986 3300045976 Bacteria 1506
1253 Ga0495592_0162911 3300046454 Bacteria 1533
1254 Ga0495638_0182403 3300046460 Bacteria 1197
1255 Ga0495638_0419742 3300046460 Bacteria 690
1256 Ga0495651_0366710 3300046462 Bacteria 948
1257 Ga0495653_0096922 3300046463 Bacteria 2144
1258 Ga0495650_0011951 3300046471 Bacteria 4704
1259 Ga0495580_0107068 3300046472 Bacteria 1942
1260 Ga0495582_0040506 3300046473 Bacteria 2566
1261 Ga0495582_0122516 3300046473 Bacteria 1466
1262 Ga0495639_0287509 3300046475 Unclassified 818
1263 Ga0495594_0344219 3300046499 Bacteria 849
1264 Ga0495606_0016536 3300046507 Bacteria 5617
1265 Ga0495608_0035015 3300046511 Bacteria 3389
1266 Ga0495618_0016822 3300046514 Bacteria 4479
1267 Ga0495628_0032692 3300046516 Bacteria 4198
1268 Ga0495630_0015882 3300046517 Bacteria 5502
1269 Ga0495630_0082016 3300046517 Bacteria 2434
1270 Ga0495630_0377092 3300046517 Unclassified 1086
1271 Ga0495644_0153692 3300046523 Bacteria 881
1272 Ga0495648_0088516 3300046524 Bacteria 1740
1273 Ga0495586_0175148 3300046535 Bacteria 1213
1274 Ga0495587_0165009 3300046536 Unclassified 1260
1275 Ga0495633_0055039 3300046558 Unclassified 1871
1276 Ga0495633_0058929 3300046558 Bacteria 1802
1277 Ga0495667_0225366 3300046559 Bacteria 1196
1278 Ga0495668_0000384 3300046616 Bacteria 58265
1279 Ga0495668_0097292 3300046616 Bacteria 1611
1280 Ga0495668_0332085 3300046616 Bacteria 834
1281 Ga0495634_0089355 3300046642 Bacteria 2003
1282 Ga0495611_0000677 3300046648 Bacteria 19441
1283 Ga0495611_0119513 3300046648 Unclassified 1228
1284 Ga0495635_0108803 3300046663 Bacteria 1893
1285 Ga0495635_0121894 3300046663 Bacteria 1778
1286 Ga0495657_0185221 3300046675 Bacteria 1275
1287 Ga0495599_0106619 3300046678 Bacteria 1746
1288 Ga0495647_0016078 3300046681 Bacteria 2631
1289 Ga0495613_0055863 3300046689 Bacteria 2900
1290 Ga0495624_0145290 3300046690 Bacteria 1452
1291 Ga0495670_0462249 3300046691 Unclassified 688
1292 Ga0495649_0042810 3300046694 Bacteria 2473
1293 Ga0495649_0257556 3300046694 Unclassified 895
1294 Ga0495600_0139636 3300046809 Bacteria 1573
1295 Ga0495604_0376077 3300047317 Bacteria 939
1296 Ga0495636_0000116 3300047318 Bacteria 33107
1297 Ga0495674_0295972 3300047319 Bacteria 1323
1298 Ga0495672_0013727 3300047320 Bacteria 5574
1299 Ga0495672_0094785 3300047320 Bacteria 1631
1300 Ga0495676_0248730 3300047321 Bacteria 1214
1301 Ga0495680_0106125 3300047322 Bacteria 2088
1302 Ga0495687_002362 3300047443 Bacteria 15287
1303 Ga0495675_0120776 3300047444 Bacteria 1632
1304 Ga0495684_0025148 3300047471 Bacteria 4579
1305 Ga0495686_0000005 3300047472 Bacteria 827143
1306 Ga0495686_0037709 3300047472 Bacteria 3094
1307 Ga0496100_0055860 3300048903 Bacteria 2581
1308 Ga0496101_1012481 3300048904 Bacteria 653
1309 Ga0496104_0401033 3300048907 Bacteria 1284
1310 Ga0496104_0559961 3300048907 Bacteria 1054
1311 Ga0496104_0930327 3300048907 Unclassified 774
1312 Ga0496105_0252689 3300048908 Bacteria 1428
1313 Ga0496107_0292228 3300048910 Bacteria 1213
1314 Ga0496109_0758194 3300048912 Bacteria 908
1315 Ga0496113_0189880 3300048916 Bacteria 1631
1316 Ga0496114_0091779 3300048917 Bacteria 2580
1317 Ga0496115_0082594 3300048918 Bacteria 2618
1318 Ga0496115_0886380 3300048918 Unclassified 689
1319 Ga0501305_018559 3300049161 Unclassified 1008
1320 Ga0501297_003185 3300049520 Bacteria 1621
1321 Ga0501299_002784 3300049522 Bacteria 2462
1322 Ga0501299_013103 3300049522 Bacteria 1426
1323 Ga0501300_030134 3300049523 Bacteria 800
1324 Ga0501031_0008289 3300049568 Bacteria 6759
1325 Ga0501032_0011586 3300049569 Bacteria 6325
1326 Ga0501032_0021587 3300049569 Bacteria 4475
1327 Ga0501032_0260275 3300049569 Bacteria 1125
1328 Ga0501033_0079079 3300049570 Bacteria 2413
1329 Ga0501033_0259583 3300049570 Bacteria 1230
1330 Ga0501033_0376671 3300049570 Bacteria 992
1331 Ga0501033_0641110 3300049570 Bacteria 726
1332 Ga0501034_0000152 3300049571 Bacteria 130576
1333 Ga0501034_0006265 3300049571 Bacteria 12798
1334 Ga0501034_0032963 3300049571 Bacteria 5259
1335 Ga0501034_0066290 3300049571 Bacteria 3623
1336 Ga0501034_0119453 3300049571 Bacteria 2622
1337 Ga0501034_0542463 3300049571 Bacteria 1073
1338 Ga0501036_0012018 3300049572 Bacteria 7177
1339 Ga0501036_0015822 3300049572 Bacteria 6299
1340 Ga0501036_0030300 3300049572 Bacteria 4572
1341 Ga0501036_0237401 3300049572 Bacteria 1529
1342 Ga0501037_0057174 3300049573 Bacteria 2848
1343 Ga0501038_0002256 3300049574 Bacteria 17927
1344 Ga0501038_0003120 3300049574 Bacteria 15461
1345 Ga0501038_0031747 3300049574 Bacteria 4666
1346 Ga0501039_0012093 3300049575 Bacteria 6582
1347 Ga0501039_0064805 3300049575 Bacteria 2833
1348 Ga0501043_0002067 3300049579 Bacteria 17117
1349 Ga0501043_0032076 3300049579 Bacteria 4130
1350 Ga0501043_0056098 3300049579 Bacteria 3094
1351 Ga0501043_0075075 3300049579 Bacteria 2656
1352 Ga0501043_0104821 3300049579 Bacteria 2222
1353 Ga0501043_0177536 3300049579 Bacteria 1660
1354 Ga0501043_0183914 3300049579 Bacteria 1628
1355 Ga0501046_0015920 3300049580 Bacteria 6306
1356 Ga0501046_0036697 3300049580 Bacteria 3943
1357 Ga0501046_0422323 3300049580 Bacteria 961
1358 Ga0501046_0671350 3300049580 Bacteria 732
1359 Ga0501047_0008193 3300049581 Bacteria 9873
1360 Ga0501047_0044588 3300049581 Bacteria 4286
1361 Ga0501047_0053122 3300049581 Bacteria 3917
1362 Ga0501047_0066583 3300049581 Bacteria 3472
1363 Ga0501047_0092528 3300049581 Bacteria 2902
1364 Ga0501047_0299797 3300049581 Bacteria 1450
1365 Ga0501048_0002001 3300049582 Bacteria 15480
1366 Ga0501048_0049627 3300049582 Bacteria 2991
1367 Ga0501048_0067589 3300049582 Bacteria 2526
1368 Ga0501067_0007424 3300049583 Bacteria 6092
1369 Ga0501067_0019596 3300049583 Bacteria 3745
1370 Ga0501068_0059805 3300049584 Bacteria 2313
1371 Ga0501070_0007289 3300049586 Bacteria 9390
1372 Ga0501071_0031907 3300049587 Bacteria 3738
1373 Ga0501072_0065071 3300049588 Bacteria 2875
1374 Ga0501073_0007586 3300049589 Bacteria 8060
1375 Ga0501074_0001847 3300049590 Bacteria 14526
1376 Ga0501074_0070946 3300049590 Bacteria 2504
1377 Ga0501077_0133495 3300049593 Unclassified 1574
1378 Ga0501198_000269 3300049649 Bacteria 6539
1379 Ga0501198_047065 3300049649 Bacteria 760
1380 Ga0501202_000030 3300049652 Bacteria 14265
1381 Ga0501202_000214 3300049652 Bacteria 7520
1382 Ga0501207_001734 3300049654 Bacteria 2759
1383 Ga0501207_003556 3300049654 Bacteria 2083
1384 Ga0501209_125765 3300049656 Bacteria 763
1385 Ga0501209_147441 3300049656 Bacteria 707
1386 Ga0501217_000139 3300049661 Bacteria 9804
1387 Ga0501217_028927 3300049661 Bacteria 1352
1388 Ga0501223_003995 3300049663 Bacteria 3176
1389 Ga0501224_000603 3300049664 Bacteria 4430
1390 Ga0501224_013114 3300049664 Bacteria 1224
1391 Ga0501228_000139 3300049666 Bacteria 3962
1392 Ga0501233_000454 3300049668 Bacteria 6491
1393 Ga0501233_115446 3300049668 Bacteria 721
1394 Ga0501235_053576 3300049669 Bacteria 937
1395 Ga0501240_002632 3300049673 Bacteria 1926
1396 Ga0501243_002188 3300049675 Bacteria 2846
1397 Ga0501250_004296 3300049680 Bacteria 1411
1398 Ga0501252_001474 3300049682 Bacteria 2177
1399 Ga0501252_005402 3300049682 Bacteria 1388
1400 Ga0501257_001328 3300049686 Bacteria 5105
1401 Ga0501257_019120 3300049686 Bacteria 1601
1402 Ga0501257_039175 3300049686 Bacteria 1160
1403 Ga0501259_000179 3300049688 Bacteria 9653
1404 Ga0501259_000389 3300049688 Bacteria 6955
1405 Ga0501261_002945 3300049690 Bacteria 2093
1406 Ga0501221_056007 3300049704 Bacteria 900
1407 Ga0501221_063085 3300049704 Bacteria 860
1408 Ga0501225_0000262 3300049705 Bacteria 16611
1409 Ga0501225_0011993 3300049705 Bacteria 2436
1410 Ga0501225_0015699 3300049705 Bacteria 2107
1411 Ga0501225_0017737 3300049705 Bacteria 1975
1412 Ga0501225_0095969 3300049705 Bacteria 862
1413 Ga0501234_001261 3300049707 Bacteria 3978
1414 Ga0501245_000212 3300049708 Bacteria 6499
1415 Ga0501245_001131 3300049708 Bacteria 3442
1416 Ga0501079_0074098 3300049741 Bacteria 2631
1417 Ga0501079_0101168 3300049741 Bacteria 2235
1418 Ga0501080_0048628 3300049742 Bacteria 3947
1419 Ga0501080_0060710 3300049742 Bacteria 3519
1420 Ga0501080_0074092 3300049742 Bacteria 3167
1421 Ga0501080_0186185 3300049742 Unclassified 1909
1422 Ga0501081_0287945 3300049743 Bacteria 1204
1423 Ga0501083_0007969 3300049744 Bacteria 7500
1424 Ga0501083_0166701 3300049744 Bacteria 1440
1425 Ga0501232_003982 3300049757 Bacteria 1384
1426 Ga0501266_005869 3300049763 Bacteria 1526
1427 Ga0501271_001023 3300049768 Bacteria 2359
1428 Ga0501279_019117 3300049775 Bacteria 968
1429 Ga0501035_0000916 3300049822 Bacteria 31216
1430 Ga0501035_0001762 3300049822 Bacteria 21856
1431 Ga0501035_0028811 3300049822 Bacteria 5067
1432 Ga0501035_0549927 3300049822 Bacteria 946
1433 Ga0501044_0001096 3300049823 Bacteria 32262
1434 Ga0501044_0003029 3300049823 Bacteria 19020
1435 Ga0501044_0004698 3300049823 Bacteria 15272
1436 Ga0501044_0054728 3300049823 Bacteria 4100
1437 Ga0501044_0058717 3300049823 Bacteria 3944
1438 Ga0501044_0128478 3300049823 Bacteria 2530
1439 Ga0501044_0346107 3300049823 Bacteria 1407
1440 Ga0501212_001669 3300049851 Bacteria 2544
1441 nmdc:mga0k408_35768_c1 3300050493 Bacteria 2848
1442 nmdc:mga0k408_6574_c1 3300050493 Bacteria 6194
1443 nmdc:mga0k408_9259_c1 3300050493 Bacteria 5307
1444 nmdc:mga07m45_86419_c1 3300050496 Unclassified 1794
1445 nmdc:mga09592_223729_c1 3300050508 Bacteria 1630
1446 nmdc:mga09592_24225_c1 3300050508 Bacteria 5018
1447 nmdc:mga09592_298986_c1 3300050508 Bacteria 1395
1448 nmdc:mga09592_40106_c1 3300050508 Bacteria 3934
1449 nmdc:mga09592_490921_c1 3300050508 Bacteria 1058
1450 nmdc:mga09592_774025_c1 3300050508 Bacteria 813
1451 nmdc:mga0qj67_546481_c1 3300050509 Bacteria 929
1452 nmdc:mga0qj67_96858_c1 3300050509 Bacteria 2375
1453 nmdc:mga06r32_529343_c1 3300050510 Bacteria 1154
1454 nmdc:mga08y16_1038383_c1 3300050511 Bacteria 798
1455 nmdc:mga08y16_1151308_c1 3300050511 Bacteria 748
1456 nmdc:mga08y16_116284_c1 3300050511 Bacteria 2784
1457 nmdc:mga08y16_136114_c1 3300050511 Bacteria 2553
1458 nmdc:mga08y16_34132_c1 3300050511 Bacteria 5344
1459 nmdc:mga08y16_437140_c1 3300050511 Unclassified 1336
1460 nmdc:mga08y16_85070_c1 3300050511 Bacteria 3296
1461 Ga0495619_0036042 3300053085 Bacteria 3220
1462 Ga0495619_0114423 3300053085 Bacteria 1846
1463 Ga0500578_0000325 3300053086 Bacteria 58251
1464 Ga0500646_0009752 3300053090 Bacteria 2457
1465 Ga0500646_0019574 3300053090 Bacteria 1791
1466 Ga0500646_0040761 3300053090 Bacteria 1307
1467 Ga0500646_0051234 3300053090 Bacteria 1192
1468 Ga0500583_0000001 3300053092 Bacteria 241642
1469 Ga0500583_0001322 3300053092 Bacteria 7082
1470 Ga0500651_0261243 3300053093 Bacteria 1004
1471 Ga0500650_0117937 3300053098 Bacteria 1238
1472 Ga0500562_000070 3300053108 Bacteria 49835
1473 Ga0500594_0035308 3300053118 Bacteria 1340
1474 Ga0500568_0000380 3300053139 Bacteria 33995
1475 Ga0500568_0079914 3300053139 Bacteria 1242
1476 Ga0500588_0087389 3300053146 Unclassified 1054
1477 Ga0500604_0001178 3300053151 Bacteria 7281
1478 Ga0500604_0061301 3300053151 Bacteria 1182
1479 Ga0500616_0067871 3300053153 Bacteria 1827
1480 Ga0500616_0068964 3300053153 Bacteria 1809
1481 Ga0500619_107222 3300053154 Bacteria 950
1482 Ga0500622_0000462 3300053156 Bacteria 38552
1483 Ga0500622_0003299 3300053156 Bacteria 10917
1484 Ga0500639_250104 3300053163 Unclassified 711
1485 Ga0500636_0308496 3300053177 Bacteria 775
1486 Ga0500637_0134446 3300053178 Bacteria 1433
1487 Ga0500611_000003 3300053727 Bacteria 333431
1488 Ga0500611_004824 3300053727 Bacteria 1850
1489 Ga0501084_0034892 3300054114 Bacteria 4207
1490 Ga0501084_0134229 3300054114 Bacteria 2083
1491 Ga0587106_024026 3300059605 Bacteria 929
1492 Ga0587109_011159 3300059624 Bacteria 1447
1493 Ga0587079_057938 3300059647 Bacteria 832
1494 Ga0501082_0246325 3300060353 Unclassified 1555
1495 Ga0466962_0171049 3300061719 Bacteria 1058
1496 Ga0466962_0263084 3300061719 Bacteria 849

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009101 Ga0105247_10222600 Ga0105247_102226002 187
2 3300005327 Ga0070658_10997371 Ga0070658_109973711 188
3 3300005548 Ga0070665_100002963 Ga0070665_10000296310 188
4 3300005563 Ga0068855_100299226 Ga0068855_1002992262 188
5 3300005578 Ga0068854_100486972 Ga0068854_1004869722 188
6 3300009093 Ga0105240_10016577 Ga0105240_100165773 188
7 3300009545 Ga0105237_10004291 Ga0105237_1000429111 188
8 3300025904 Ga0207647_10020554 Ga0207647_100205542 188
9 3300025913 Ga0207695_10005226 Ga0207695_1000522613 188
10 3300025914 Ga0207671_10001564 Ga0207671_1000156419 188
11 3300025981 Ga0207640_10244172 Ga0207640_102441722 188
12 3300028379 Ga0268266_10004133 Ga0268266_100041336 188
13 3300044693 Ga0466961_0451293 Ga0466961_0451293_158_727 188
14 3300009094 Ga0111539_10500579 Ga0111539_105005792 189
15 3300049569 Ga0501032_0011586 Ga0501032_0011586_5593_6162 189
16 3300049570 Ga0501033_0079079 Ga0501033_0079079_43_612 189
17 3300049571 Ga0501034_0032963 Ga0501034_0032963_3864_4433 189
18 3300049571 Ga0501034_0542463 Ga0501034_0542463_435_1004 189
19 3300049572 Ga0501036_0015822 Ga0501036_0015822_2475_3044 189
20 3300049573 Ga0501037_0057174 Ga0501037_0057174_1541_2110 189
21 3300049574 Ga0501038_0031747 Ga0501038_0031747_2310_2879 189
22 3300049575 Ga0501039_0064805 Ga0501039_0064805_926_1495 189
23 3300049579 Ga0501043_0056098 Ga0501043_0056098_145_714 189
24 3300049581 Ga0501047_0066583 Ga0501047_0066583_1858_2427 189
25 3300049822 Ga0501035_0000916 Ga0501035_0000916_27231_27800 189
26 3300049823 Ga0501044_0001096 Ga0501044_0001096_26297_26866 189
27 3300005331 Ga0070670_100072664 Ga0070670_1000726643 190
28 3300005577 Ga0068857_101160176 Ga0068857_1011601762 190
29 3300005616 Ga0068852_101452846 Ga0068852_1014528461 190
30 3300005617 Ga0068859_100167827 Ga0068859_1001678273 190
31 3300005618 Ga0068864_100048883 Ga0068864_1000488834 190
32 3300005843 Ga0068860_100258424 Ga0068860_1002584242 190
33 3300006931 Ga0097620_100167823 Ga0097620_1001678233 190
34 3300009553 Ga0105249_10004472 Ga0105249_100044725 190
35 3300025925 Ga0207650_10016333 Ga0207650_100163333 190
36 3300025925 Ga0207650_10523453 Ga0207650_105234531 190
37 3300026095 Ga0207676_10014215 Ga0207676_100142152 190
38 3300026142 Ga0207698_10853527 Ga0207698_108535271 190
39 3300028381 Ga0268264_10587846 Ga0268264_105878462 190
40 3300029957 Ga0265324_10010359 Ga0265324_100103592 190
41 3300031711 Ga0265314_10371988 Ga0265314_103719881 190
42 3300041492 Ga0451835_0070461 Ga0451835_0070461_133_705 190
43 3300053154 Ga0500619_107222 Ga0500619_107222_174_746 190
44 3300053163 Ga0500639_250104 Ga0500639_250104_76_648 190
45 3300005331 Ga0070670_100071480 Ga0070670_1000714802 191
46 3300005544 Ga0070686_100178701 Ga0070686_1001787012 191
47 3300006195 Ga0075366_10006323 Ga0075366_100063233 191
48 3300006195 Ga0075366_10018684 Ga0075366_100186843 191
49 3300009553 Ga0105249_11265211 Ga0105249_112652112 191
50 3300014325 Ga0163163_10384193 Ga0163163_103841932 191
51 3300017792 Ga0163161_10365380 Ga0163161_103653802 191
52 3300046460 Ga0495638_0419742 Ga0495638_0419742_64_642 191
53 3300047320 Ga0495672_0013727 Ga0495672_0013727_4659_5237 191
54 3300047472 Ga0495686_0037709 Ga0495686_0037709_1430_2008 191
55 3300049570 Ga0501033_0259583 Ga0501033_0259583_620_1198 191
56 3300049579 Ga0501043_0183914 Ga0501043_0183914_874_1452 191
57 3300049822 Ga0501035_0549927 Ga0501035_0549927_184_762 191
58 3300050493 nmdc:mga0k408_6574_c1 nmdc:mga0k408_6574_c1_1797_2375 191
59 iso_pu_bacteria 2929154850 2929159460 191
60 iso_pu_bacteria 2738541278 2738725478 192
61 iso_pu_bacteria 2914759650 2914763376 192
62 3300005548 Ga0070665_100000014 Ga0070665_10000001481 193
63 3300013297 Ga0157378_10004715 Ga0157378_1000471511 193
64 3300026118 Ga0207675_100176621 Ga0207675_1001766213 193
65 3300028379 Ga0268266_10000048 Ga0268266_10000048160 193
66 3300033179 Ga0307507_10166854 Ga0307507_101668543 193
67 3300046524 Ga0495648_0088516 Ga0495648_0088516_16_597 193
68 3300046558 Ga0495633_0058929 Ga0495633_0058929_80_670 193
69 3300046616 Ga0495668_0000384 Ga0495668_0000384_15356_15943 193
70 3300046691 Ga0495670_0462249 Ga0495670_0462249_85_675 193
71 3300047318 Ga0495636_0000116 Ga0495636_0000116_5713_6303 193
72 3300053090 Ga0500646_0040761 Ga0500646_0040761_510_1091 193
73 3300053139 Ga0500568_0079914 Ga0500568_0079914_485_1066 193
74 3300053156 Ga0500622_0003299 Ga0500622_0003299_7408_7989 193
75 3300005289 Ga0065704_10094776 Ga0065704_100947762 194
76 3300005290 Ga0065712_10119581 Ga0065712_101195812 194
77 3300005330 Ga0070690_100026759 Ga0070690_1000267591 194
78 3300005331 Ga0070670_100037193 Ga0070670_1000371932 194
79 3300005331 Ga0070670_100069756 Ga0070670_1000697563 194
80 3300005331 Ga0070670_100552685 Ga0070670_1005526852 194
81 3300005333 Ga0070677_10221508 Ga0070677_102215081 194
82 3300005334 Ga0068869_100665132 Ga0068869_1006651322 194
83 3300005334 Ga0068869_100836153 Ga0068869_1008361532 194
84 3300005337 Ga0070682_100000012 Ga0070682_1000000125 194
85 3300005337 Ga0070682_100279466 Ga0070682_1002794662 194
86 3300005338 Ga0068868_100599286 Ga0068868_1005992862 194
87 3300005338 Ga0068868_100684985 Ga0068868_1006849851 194
88 3300005338 Ga0068868_100896175 Ga0068868_1008961751 194
89 3300005343 Ga0070687_100184060 Ga0070687_1001840602 194
90 3300005347 Ga0070668_100851800 Ga0070668_1008518001 194
91 3300005353 Ga0070669_100056897 Ga0070669_1000568972 194
92 3300005354 Ga0070675_100046116 Ga0070675_1000461163 194
93 3300005354 Ga0070675_100157354 Ga0070675_1001573542 194
94 3300005364 Ga0070673_100273980 Ga0070673_1002739802 194
95 3300005365 Ga0070688_100078000 Ga0070688_1000780002 194
96 3300005365 Ga0070688_101081153 Ga0070688_1010811531 194
97 3300005367 Ga0070667_100566592 Ga0070667_1005665922 194
98 3300005539 Ga0068853_100032498 Ga0068853_1000324982 194
99 3300005548 Ga0070665_101025363 Ga0070665_1010253631 194
100 3300005564 Ga0070664_100365503 Ga0070664_1003655032 194
101 3300005578 Ga0068854_100147519 Ga0068854_1001475192 194
102 3300005617 Ga0068859_100000592 Ga0068859_10000059217 194
103 3300005618 Ga0068864_100119680 Ga0068864_1001196803 194
104 3300005841 Ga0068863_100908067 Ga0068863_1009080671 194
105 3300005843 Ga0068860_100757042 Ga0068860_1007570422 194
106 3300005844 Ga0068862_100915649 Ga0068862_1009156492 194
107 3300006844 Ga0075428_100381527 Ga0075428_1003815272 194
108 3300006846 Ga0075430_100582140 Ga0075430_1005821402 194
109 3300006847 Ga0075431_100001819 Ga0075431_1000018193 194
110 3300006880 Ga0075429_100007759 Ga0075429_1000077593 194
111 3300006931 Ga0097620_100000592 Ga0097620_10000059217 194
112 3300009094 Ga0111539_10177876 Ga0111539_101778762 194
113 3300009147 Ga0114129_10004788 Ga0114129_100047887 194
114 3300009147 Ga0114129_10103533 Ga0114129_101035333 194
115 3300013308 Ga0157375_10518608 Ga0157375_105186082 194
116 3300014325 Ga0163163_10357042 Ga0163163_103570422 194
117 3300014326 Ga0157380_10026726 Ga0157380_100267264 194
118 3300014326 Ga0157380_10684609 Ga0157380_106846092 194
119 3300014745 Ga0157377_10053201 Ga0157377_100532012 194
120 3300025908 Ga0207643_10373191 Ga0207643_103731911 194
121 3300025909 Ga0207705_10448394 Ga0207705_104483943 194
122 3300025923 Ga0207681_10289267 Ga0207681_102892672 194
123 3300025925 Ga0207650_10302399 Ga0207650_103023992 194
124 3300025925 Ga0207650_10636961 Ga0207650_106369611 194
125 3300025926 Ga0207659_10009499 Ga0207659_100094993 194
126 3300025926 Ga0207659_10289288 Ga0207659_102892882 194
127 3300025940 Ga0207691_10744946 Ga0207691_107449461 194
128 3300025945 Ga0207679_10372822 Ga0207679_103728221 194
129 3300025960 Ga0207651_10264086 Ga0207651_102640862 194
130 3300025981 Ga0207640_10198817 Ga0207640_101988172 194
131 3300025986 Ga0207658_11169461 Ga0207658_111694611 194
132 3300026023 Ga0207677_10253139 Ga0207677_102531392 194
133 3300026023 Ga0207677_11226368 Ga0207677_112263681 194
134 3300026088 Ga0207641_10056334 Ga0207641_100563343 194
135 3300026088 Ga0207641_10404144 Ga0207641_104041442 194
136 3300026089 Ga0207648_10236245 Ga0207648_102362452 194
137 3300026116 Ga0207674_10802884 Ga0207674_108028842 194
138 3300027907 Ga0207428_10149611 Ga0207428_101496112 194
139 3300028380 Ga0268265_10025977 Ga0268265_100259773 194
140 3300028381 Ga0268264_10020347 Ga0268264_100203473 194
141 3300028794 Ga0307515_10000001 Ga0307515_100000012552 194
142 3300031251 Ga0265327_10000013 Ga0265327_10000013406 194
143 3300031852 Ga0307410_10385299 Ga0307410_103852992 194
144 3300031911 Ga0307412_10548828 Ga0307412_105488282 194
145 3300032002 Ga0307416_101177986 Ga0307416_1011779861 194
146 3300032004 Ga0307414_10712914 Ga0307414_107129142 194
147 3300032005 Ga0307411_10299513 Ga0307411_102995132 194
148 3300039437 Ga0436365_1414100 Ga0436365_1414100_931_1515 194
149 3300041507 Ga0451851_1208939 Ga0451851_1208939_281_868 194
150 3300041512 Ga0451853_2243536 Ga0451853_2243536_26_616 194
151 3300042004 Ga0439445_0120035 Ga0439445_0120035_79_666 194
152 3300044712 Ga0453684_0021992 Ga0453684_0021992_5775_6359 194
153 3300049520 Ga0501297_003185 Ga0501297_003185_711_1313 194
154 3300049522 Ga0501299_002784 Ga0501299_002784_274_876 194
155 3300049522 Ga0501299_013103 Ga0501299_013103_699_1298 194
156 3300049523 Ga0501300_030134 Ga0501300_030134_51_650 194
157 3300049571 Ga0501034_0000152 Ga0501034_0000152_95420_96010 194
158 3300049649 Ga0501198_000269 Ga0501198_000269_5839_6441 194
159 3300049649 Ga0501198_047065 Ga0501198_047065_28_627 194
160 3300049652 Ga0501202_000030 Ga0501202_000030_12145_12747 194
161 3300049654 Ga0501207_003556 Ga0501207_003556_1410_2012 194
162 3300049656 Ga0501209_125765 Ga0501209_125765_101_700 194
163 3300049661 Ga0501217_000139 Ga0501217_000139_5149_5751 194
164 3300049661 Ga0501217_028927 Ga0501217_028927_464_1063 194
165 3300049663 Ga0501223_003995 Ga0501223_003995_2382_2984 194
166 3300049664 Ga0501224_000603 Ga0501224_000603_2105_2707 194
167 3300049666 Ga0501228_000139 Ga0501228_000139_2936_3535 194
168 3300049668 Ga0501233_000454 Ga0501233_000454_884_1486 194
169 3300049668 Ga0501233_115446 Ga0501233_115446_76_675 194
170 3300049669 Ga0501235_053576 Ga0501235_053576_304_903 194
171 3300049673 Ga0501240_002632 Ga0501240_002632_767_1369 194
172 3300049675 Ga0501243_002188 Ga0501243_002188_2224_2826 194
173 3300049680 Ga0501250_004296 Ga0501250_004296_653_1252 194
174 3300049682 Ga0501252_001474 Ga0501252_001474_803_1405 194
175 3300049686 Ga0501257_039175 Ga0501257_039175_526_1125 194
176 3300049688 Ga0501259_000179 Ga0501259_000179_288_890 194
177 3300049690 Ga0501261_002945 Ga0501261_002945_1314_1916 194
178 3300049704 Ga0501221_063085 Ga0501221_063085_233_832 194
179 3300049705 Ga0501225_0011993 Ga0501225_0011993_1625_2227 194
180 3300049705 Ga0501225_0095969 Ga0501225_0095969_192_791 194
181 3300049707 Ga0501234_001261 Ga0501234_001261_1302_1904 194
182 3300049708 Ga0501245_000212 Ga0501245_000212_1982_2584 194
183 3300049768 Ga0501271_001023 Ga0501271_001023_1398_2000 194
184 3300049775 Ga0501279_019117 Ga0501279_019117_11_598 194
185 3300049851 Ga0501212_001669 Ga0501212_001669_193_795 194
186 3300050508 nmdc:mga09592_24225_c1 nmdc:mga09592_24225_c1_3184_3771 194
187 3300050509 nmdc:mga0qj67_546481_c1 nmdc:mga0qj67_546481_c1_25_612 194
188 3300050511 nmdc:mga08y16_136114_c1 nmdc:mga08y16_136114_c1_1313_1900 194
189 3300003320 rootH2_10016807 rootH2_100168072 195
190 3300003320 rootH2_10192773 rootH2_101927733 195
191 3300003322 rootL2_10250232 rootL2_102502322 195
192 3300003354 JGI25160J50197_1001012 JGI25160J50197_10010127 195
193 3300005288 Ga0065714_10065508 Ga0065714_100655083 195
194 3300005288 Ga0065714_10169546 Ga0065714_101695461 195
195 3300005290 Ga0065712_10001960 Ga0065712_100019602 195
196 3300005290 Ga0065712_10086063 Ga0065712_100860632 195
197 3300005290 Ga0065712_10095536 Ga0065712_100955362 195
198 3300005290 Ga0065712_10236480 Ga0065712_102364801 195
199 3300005293 Ga0065715_10107733 Ga0065715_101077333 195
200 3300005293 Ga0065715_10236555 Ga0065715_102365552 195
201 3300005295 Ga0065707_10342951 Ga0065707_103429512 195
202 3300005327 Ga0070658_10593017 Ga0070658_105930172 195
203 3300005327 Ga0070658_10778001 Ga0070658_107780011 195
204 3300005327 Ga0070658_10911935 Ga0070658_109119351 195
205 3300005328 Ga0070676_10040274 Ga0070676_100402741 195
206 3300005328 Ga0070676_10043239 Ga0070676_100432393 195
207 3300005328 Ga0070676_10058043 Ga0070676_100580432 195
208 3300005328 Ga0070676_10174376 Ga0070676_101743762 195
209 3300005328 Ga0070676_10738387 Ga0070676_107383871 195
210 3300005328 Ga0070676_10863705 Ga0070676_108637051 195
211 3300005329 Ga0070683_100140256 Ga0070683_1001402562 195
212 3300005329 Ga0070683_100183378 Ga0070683_1001833782 195
213 3300005329 Ga0070683_100385555 Ga0070683_1003855552 195
214 3300005329 Ga0070683_100715065 Ga0070683_1007150652 195
215 3300005330 Ga0070690_100120722 Ga0070690_1001207222 195
216 3300005331 Ga0070670_100031852 Ga0070670_1000318525 195
217 3300005331 Ga0070670_100053977 Ga0070670_1000539772 195
218 3300005331 Ga0070670_100097159 Ga0070670_1000971593 195
219 3300005331 Ga0070670_100097553 Ga0070670_1000975533 195
220 3300005331 Ga0070670_100430194 Ga0070670_1004301942 195
221 3300005331 Ga0070670_100462322 Ga0070670_1004623222 195
222 3300005331 Ga0070670_101311930 Ga0070670_1013119301 195
223 3300005333 Ga0070677_10017638 Ga0070677_100176383 195
224 3300005334 Ga0068869_100007572 Ga0068869_1000075724 195
225 3300005334 Ga0068869_100036552 Ga0068869_1000365521 195
226 3300005334 Ga0068869_100114641 Ga0068869_1001146412 195
227 3300005334 Ga0068869_100123511 Ga0068869_1001235112 195
228 3300005334 Ga0068869_100135759 Ga0068869_1001357592 195
229 3300005334 Ga0068869_100354490 Ga0068869_1003544902 195
230 3300005335 Ga0070666_10000126 Ga0070666_1000012631 195
231 3300005335 Ga0070666_10028450 Ga0070666_100284502 195
232 3300005335 Ga0070666_10051525 Ga0070666_100515253 195
233 3300005338 Ga0068868_100061691 Ga0068868_1000616911 195
234 3300005338 Ga0068868_100174986 Ga0068868_1001749862 195
235 3300005338 Ga0068868_100480293 Ga0068868_1004802931 195
236 3300005338 Ga0068868_101143729 Ga0068868_1011437291 195
237 3300005339 Ga0070660_100014833 Ga0070660_1000148333 195
238 3300005339 Ga0070660_100033447 Ga0070660_1000334472 195
239 3300005340 Ga0070689_100033788 Ga0070689_1000337883 195
240 3300005340 Ga0070689_100058834 Ga0070689_1000588343 195
241 3300005340 Ga0070689_100067386 Ga0070689_1000673863 195
242 3300005340 Ga0070689_100074702 Ga0070689_1000747023 195
243 3300005343 Ga0070687_100153100 Ga0070687_1001531002 195
244 3300005344 Ga0070661_100109997 Ga0070661_1001099972 195
245 3300005344 Ga0070661_100182750 Ga0070661_1001827502 195
246 3300005347 Ga0070668_100069574 Ga0070668_1000695742 195
247 3300005347 Ga0070668_100122169 Ga0070668_1001221692 195
248 3300005347 Ga0070668_100325283 Ga0070668_1003252832 195
249 3300005347 Ga0070668_100503193 Ga0070668_1005031932 195
250 3300005353 Ga0070669_100131583 Ga0070669_1001315832 195
251 3300005353 Ga0070669_100258177 Ga0070669_1002581771 195
252 3300005354 Ga0070675_100010438 Ga0070675_1000104384 195
253 3300005354 Ga0070675_100024040 Ga0070675_1000240403 195
254 3300005354 Ga0070675_100046198 Ga0070675_1000461983 195
255 3300005354 Ga0070675_100556990 Ga0070675_1005569902 195
256 3300005355 Ga0070671_100019120 Ga0070671_1000191203 195
257 3300005355 Ga0070671_100028345 Ga0070671_1000283452 195
258 3300005355 Ga0070671_100095574 Ga0070671_1000955742 195
259 3300005355 Ga0070671_100109533 Ga0070671_1001095332 195
260 3300005355 Ga0070671_100148548 Ga0070671_1001485481 195
261 3300005356 Ga0070674_100113541 Ga0070674_1001135412 195
262 3300005364 Ga0070673_100004569 Ga0070673_1000045692 195
263 3300005364 Ga0070673_100016121 Ga0070673_1000161213 195
264 3300005364 Ga0070673_100105384 Ga0070673_1001053843 195
265 3300005364 Ga0070673_100106412 Ga0070673_1001064122 195
266 3300005364 Ga0070673_100190648 Ga0070673_1001906482 195
267 3300005364 Ga0070673_100267680 Ga0070673_1002676802 195
268 3300005364 Ga0070673_100288621 Ga0070673_1002886211 195
269 3300005364 Ga0070673_100377573 Ga0070673_1003775732 195
270 3300005365 Ga0070688_100016155 Ga0070688_1000161555 195
271 3300005365 Ga0070688_100026151 Ga0070688_1000261512 195
272 3300005365 Ga0070688_100155687 Ga0070688_1001556871 195
273 3300005366 Ga0070659_100005752 Ga0070659_1000057523 195
274 3300005366 Ga0070659_100725505 Ga0070659_1007255051 195
275 3300005366 Ga0070659_101053711 Ga0070659_1010537111 195
276 3300005367 Ga0070667_100001797 Ga0070667_10000179716 195
277 3300005367 Ga0070667_100043443 Ga0070667_1000434433 195
278 3300005367 Ga0070667_100204158 Ga0070667_1002041582 195
279 3300005367 Ga0070667_100301412 Ga0070667_1003014122 195
280 3300005367 Ga0070667_100365129 Ga0070667_1003651292 195
281 3300005438 Ga0070701_10348206 Ga0070701_103482062 195
282 3300005440 Ga0070705_100395779 Ga0070705_1003957792 195
283 3300005441 Ga0070700_100065633 Ga0070700_1000656332 195
284 3300005456 Ga0070678_100225959 Ga0070678_1002259592 195
285 3300005456 Ga0070678_100319453 Ga0070678_1003194531 195
286 3300005456 Ga0070678_101013164 Ga0070678_1010131641 195
287 3300005456 Ga0070678_101387950 Ga0070678_1013879501 195
288 3300005457 Ga0070662_100058143 Ga0070662_1000581432 195
289 3300005457 Ga0070662_100138333 Ga0070662_1001383333 195
290 3300005457 Ga0070662_100623006 Ga0070662_1006230061 195
291 3300005459 Ga0068867_100023810 Ga0068867_1000238104 195
292 3300005459 Ga0068867_100214225 Ga0068867_1002142252 195
293 3300005459 Ga0068867_100260334 Ga0068867_1002603342 195
294 3300005466 Ga0070685_10008238 Ga0070685_100082382 195
295 3300005466 Ga0070685_10042349 Ga0070685_100423491 195
296 3300005466 Ga0070685_10053848 Ga0070685_100538483 195
297 3300005466 Ga0070685_10105755 Ga0070685_101057552 195
298 3300005471 Ga0070698_100001314 Ga0070698_10000131413 195
299 3300005535 Ga0070684_100002074 Ga0070684_10000207413 195
300 3300005535 Ga0070684_100030335 Ga0070684_1000303352 195
301 3300005535 Ga0070684_100086910 Ga0070684_1000869103 195
302 3300005535 Ga0070684_100560073 Ga0070684_1005600732 195
303 3300005539 Ga0068853_100005120 Ga0068853_1000051203 195
304 3300005539 Ga0068853_100047124 Ga0068853_1000471243 195
305 3300005539 Ga0068853_100171519 Ga0068853_1001715192 195
306 3300005539 Ga0068853_100403098 Ga0068853_1004030982 195
307 3300005539 Ga0068853_100944551 Ga0068853_1009445512 195
308 3300005543 Ga0070672_100005202 Ga0070672_1000052022 195
309 3300005543 Ga0070672_100039156 Ga0070672_1000391563 195
310 3300005543 Ga0070672_100103388 Ga0070672_1001033883 195
311 3300005543 Ga0070672_100130133 Ga0070672_1001301332 195
312 3300005543 Ga0070672_100442106 Ga0070672_1004421062 195
313 3300005543 Ga0070672_100481353 Ga0070672_1004813531 195
314 3300005543 Ga0070672_100729964 Ga0070672_1007299641 195
315 3300005543 Ga0070672_100864193 Ga0070672_1008641932 195
316 3300005544 Ga0070686_100377076 Ga0070686_1003770762 195
317 3300005544 Ga0070686_100836990 Ga0070686_1008369901 195
318 3300005545 Ga0070695_100752513 Ga0070695_1007525132 195
319 3300005548 Ga0070665_100020821 Ga0070665_1000208212 195
320 3300005548 Ga0070665_100705442 Ga0070665_1007054422 195
321 3300005549 Ga0070704_100364160 Ga0070704_1003641602 195
322 3300005549 Ga0070704_100560980 Ga0070704_1005609802 195
323 3300005563 Ga0068855_100000081 Ga0068855_10000008193 195
324 3300005563 Ga0068855_100030002 Ga0068855_1000300025 195
325 3300005563 Ga0068855_100533310 Ga0068855_1005333101 195
326 3300005564 Ga0070664_100024151 Ga0070664_1000241515 195
327 3300005564 Ga0070664_100126536 Ga0070664_1001265363 195
328 3300005564 Ga0070664_100130960 Ga0070664_1001309603 195
329 3300005564 Ga0070664_100269721 Ga0070664_1002697212 195
330 3300005564 Ga0070664_100276635 Ga0070664_1002766352 195
331 3300005577 Ga0068857_100003490 Ga0068857_1000034904 195
332 3300005577 Ga0068857_100120144 Ga0068857_1001201442 195
333 3300005577 Ga0068857_100239651 Ga0068857_1002396512 195
334 3300005578 Ga0068854_100033534 Ga0068854_1000335343 195
335 3300005578 Ga0068854_100045630 Ga0068854_1000456302 195
336 3300005578 Ga0068854_100418824 Ga0068854_1004188241 195
337 3300005578 Ga0068854_100917904 Ga0068854_1009179041 195
338 3300005614 Ga0068856_100117174 Ga0068856_1001171743 195
339 3300005616 Ga0068852_100144464 Ga0068852_1001444642 195
340 3300005616 Ga0068852_100280118 Ga0068852_1002801182 195
341 3300005616 Ga0068852_100549364 Ga0068852_1005493642 195
342 3300005617 Ga0068859_100000003 Ga0068859_10000000351 195
343 3300005617 Ga0068859_100002273 Ga0068859_10000227315 195
344 3300005617 Ga0068859_100037372 Ga0068859_1000373722 195
345 3300005617 Ga0068859_100059461 Ga0068859_1000594613 195
346 3300005617 Ga0068859_100070283 Ga0068859_1000702833 195
347 3300005617 Ga0068859_100079802 Ga0068859_1000798022 195
348 3300005617 Ga0068859_100081735 Ga0068859_1000817352 195
349 3300005617 Ga0068859_100085967 Ga0068859_1000859673 195
350 3300005617 Ga0068859_100283057 Ga0068859_1002830572 195
351 3300005617 Ga0068859_100293379 Ga0068859_1002933792 195
352 3300005617 Ga0068859_100860221 Ga0068859_1008602212 195
353 3300005617 Ga0068859_101251622 Ga0068859_1012516222 195
354 3300005618 Ga0068864_100021165 Ga0068864_1000211652 195
355 3300005618 Ga0068864_100133853 Ga0068864_1001338532 195
356 3300005618 Ga0068864_100192449 Ga0068864_1001924492 195
357 3300005718 Ga0068866_10120882 Ga0068866_101208822 195
358 3300005719 Ga0068861_100007006 Ga0068861_1000070064 195
359 3300005719 Ga0068861_100033569 Ga0068861_1000335693 195
360 3300005719 Ga0068861_100197822 Ga0068861_1001978222 195
361 3300005719 Ga0068861_100503220 Ga0068861_1005032202 195
362 3300005834 Ga0068851_10024275 Ga0068851_100242753 195
363 3300005834 Ga0068851_10088305 Ga0068851_100883052 195
364 3300005834 Ga0068851_10145542 Ga0068851_101455421 195
365 3300005834 Ga0068851_10190935 Ga0068851_101909352 195
366 3300005834 Ga0068851_10332468 Ga0068851_103324682 195
367 3300005840 Ga0068870_10323816 Ga0068870_103238162 195
368 3300005840 Ga0068870_10475645 Ga0068870_104756451 195
369 3300005841 Ga0068863_100029845 Ga0068863_1000298452 195
370 3300005841 Ga0068863_100232817 Ga0068863_1002328172 195
371 3300005841 Ga0068863_100241104 Ga0068863_1002411042 195
372 3300005841 Ga0068863_101147087 Ga0068863_1011470871 195
373 3300005841 Ga0068863_101338441 Ga0068863_1013384411 195
374 3300005842 Ga0068858_100003985 Ga0068858_1000039859 195
375 3300005842 Ga0068858_100265482 Ga0068858_1002654823 195
376 3300005842 Ga0068858_100289694 Ga0068858_1002896942 195
377 3300005842 Ga0068858_101055710 Ga0068858_1010557102 195
378 3300005842 Ga0068858_101089674 Ga0068858_1010896741 195
379 3300005843 Ga0068860_100000024 Ga0068860_100000024135 195
380 3300005843 Ga0068860_100001083 Ga0068860_1000010833 195
381 3300005843 Ga0068860_100001337 Ga0068860_10000133717 195
382 3300005843 Ga0068860_100022366 Ga0068860_1000223662 195
383 3300005843 Ga0068860_100027314 Ga0068860_1000273141 195
384 3300005843 Ga0068860_100081884 Ga0068860_1000818841 195
385 3300005843 Ga0068860_100116746 Ga0068860_1001167462 195
386 3300005843 Ga0068860_100348704 Ga0068860_1003487042 195
387 3300005844 Ga0068862_100002954 Ga0068862_1000029544 195
388 3300005844 Ga0068862_100311248 Ga0068862_1003112482 195
389 3300005844 Ga0068862_100315219 Ga0068862_1003152192 195
390 3300005844 Ga0068862_100898461 Ga0068862_1008984611 195
391 3300005937 Ga0081455_10354328 Ga0081455_103543281 195
392 3300005983 Ga0081540_1039715 Ga0081540_10397152 195
393 3300005985 Ga0081539_10145320 Ga0081539_101453202 195
394 3300006163 Ga0070715_10127650 Ga0070715_101276501 195
395 3300006195 Ga0075366_10030752 Ga0075366_100307522 195
396 3300006195 Ga0075366_10166302 Ga0075366_101663021 195
397 3300006237 Ga0097621_100000092 Ga0097621_1000000926 195
398 3300006237 Ga0097621_100030459 Ga0097621_1000304594 195
399 3300006237 Ga0097621_100037414 Ga0097621_1000374143 195
400 3300006237 Ga0097621_100043006 Ga0097621_1000430062 195
401 3300006237 Ga0097621_100190780 Ga0097621_1001907802 195
402 3300006237 Ga0097621_100579534 Ga0097621_1005795341 195
403 3300006353 Ga0075370_10271716 Ga0075370_102717162 195
404 3300006358 Ga0068871_100000032 Ga0068871_10000003250 195
405 3300006358 Ga0068871_100058677 Ga0068871_1000586771 195
406 3300006358 Ga0068871_100083838 Ga0068871_1000838382 195
407 3300006358 Ga0068871_100455589 Ga0068871_1004555892 195
408 3300006358 Ga0068871_100562364 Ga0068871_1005623642 195
409 3300006358 Ga0068871_100636641 Ga0068871_1006366412 195
410 3300006358 Ga0068871_100712950 Ga0068871_1007129501 195
411 3300006880 Ga0075429_100255440 Ga0075429_1002554401 195
412 3300006881 Ga0068865_100187003 Ga0068865_1001870032 195
413 3300006881 Ga0068865_100378704 Ga0068865_1003787041 195
414 3300006881 Ga0068865_100579970 Ga0068865_1005799701 195
415 3300006931 Ga0097620_100000003 Ga0097620_10000000351 195
416 3300006931 Ga0097620_100002273 Ga0097620_10000227315 195
417 3300006931 Ga0097620_100008633 Ga0097620_1000086338 195
418 3300006931 Ga0097620_100037373 Ga0097620_1000373733 195
419 3300006931 Ga0097620_100059455 Ga0097620_1000594553 195
420 3300006931 Ga0097620_100070282 Ga0097620_1000702823 195
421 3300006931 Ga0097620_100079806 Ga0097620_1000798062 195
422 3300006931 Ga0097620_100081732 Ga0097620_1000817323 195
423 3300006931 Ga0097620_100085964 Ga0097620_1000859643 195
424 3300006931 Ga0097620_100283061 Ga0097620_1002830612 195
425 3300006931 Ga0097620_100293381 Ga0097620_1002933812 195
426 3300006931 Ga0097620_100860213 Ga0097620_1008602132 195
427 3300006931 Ga0097620_101251575 Ga0097620_1012515751 195
428 3300009093 Ga0105240_10023738 Ga0105240_100237383 195
429 3300009093 Ga0105240_10053361 Ga0105240_100533614 195
430 3300009093 Ga0105240_10054237 Ga0105240_100542374 195
431 3300009093 Ga0105240_10108372 Ga0105240_101083723 195
432 3300009094 Ga0111539_10023215 Ga0111539_100232152 195
433 3300009094 Ga0111539_10095880 Ga0111539_100958803 195
434 3300009094 Ga0111539_10958025 Ga0111539_109580252 195
435 3300009098 Ga0105245_10635030 Ga0105245_106350302 195
436 3300009098 Ga0105245_10666128 Ga0105245_106661281 195
437 3300009101 Ga0105247_10004291 Ga0105247_100042915 195
438 3300009101 Ga0105247_10091168 Ga0105247_100911683 195
439 3300009101 Ga0105247_10324077 Ga0105247_103240772 195
440 3300009174 Ga0105241_10026175 Ga0105241_100261753 195
441 3300009174 Ga0105241_10164060 Ga0105241_101640602 195
442 3300009174 Ga0105241_10206365 Ga0105241_102063651 195
443 3300009174 Ga0105241_10585782 Ga0105241_105857822 195
444 3300009174 Ga0105241_10696428 Ga0105241_106964282 195
445 3300009176 Ga0105242_10023752 Ga0105242_100237525 195
446 3300009176 Ga0105242_10034030 Ga0105242_100340304 195
447 3300009176 Ga0105242_10078908 Ga0105242_100789083 195
448 3300009176 Ga0105242_10234417 Ga0105242_102344172 195
449 3300009176 Ga0105242_10951734 Ga0105242_109517341 195
450 3300009177 Ga0105248_10027463 Ga0105248_100274634 195
451 3300009177 Ga0105248_10048854 Ga0105248_100488543 195
452 3300009177 Ga0105248_10170656 Ga0105248_101706563 195
453 3300009177 Ga0105248_10364674 Ga0105248_103646742 195
454 3300009545 Ga0105237_10000561 Ga0105237_1000056122 195
455 3300009545 Ga0105237_10002380 Ga0105237_100023805 195
456 3300009545 Ga0105237_10009011 Ga0105237_100090119 195
457 3300009545 Ga0105237_10163203 Ga0105237_101632032 195
458 3300009545 Ga0105237_10181753 Ga0105237_101817533 195
459 3300009551 Ga0105238_10069229 Ga0105238_100692292 195
460 3300009553 Ga0105249_10001813 Ga0105249_1000181320 195
461 3300009553 Ga0105249_10014006 Ga0105249_100140065 195
462 3300009553 Ga0105249_10033642 Ga0105249_100336425 195
463 3300009553 Ga0105249_10056505 Ga0105249_100565053 195
464 3300009553 Ga0105249_10113817 Ga0105249_101138172 195
465 3300009553 Ga0105249_10160717 Ga0105249_101607172 195
466 3300009553 Ga0105249_10161804 Ga0105249_101618042 195
467 3300009553 Ga0105249_10199526 Ga0105249_101995262 195
468 3300009553 Ga0105249_10246578 Ga0105249_102465781 195
469 3300009553 Ga0105249_11167002 Ga0105249_111670021 195
470 3300009553 Ga0105249_11377412 Ga0105249_113774121 195
471 3300009553 Ga0105249_11642142 Ga0105249_116421421 195
472 3300010375 Ga0105239_10000580 Ga0105239_1000058024 195
473 3300010375 Ga0105239_10014827 Ga0105239_100148273 195
474 3300010375 Ga0105239_10025967 Ga0105239_100259672 195
475 3300010375 Ga0105239_10272507 Ga0105239_102725073 195
476 3300010375 Ga0105239_10642505 Ga0105239_106425052 195
477 3300010375 Ga0105239_11125727 Ga0105239_111257271 195
478 3300011119 Ga0105246_10001264 Ga0105246_100012645 195
479 3300011119 Ga0105246_10110814 Ga0105246_101108142 195
480 3300011119 Ga0105246_10112608 Ga0105246_101126083 195
481 3300011119 Ga0105246_10223331 Ga0105246_102233312 195
482 3300011119 Ga0105246_10343862 Ga0105246_103438621 195
483 3300011119 Ga0105246_10456187 Ga0105246_104561871 195
484 3300011119 Ga0105246_10703034 Ga0105246_107030341 195
485 3300011119 Ga0105246_11011060 Ga0105246_110110601 195
486 3300013100 Ga0157373_10038665 Ga0157373_100386652 195
487 3300013100 Ga0157373_10104215 Ga0157373_101042152 195
488 3300013100 Ga0157373_10181167 Ga0157373_101811672 195
489 3300013100 Ga0157373_10204234 Ga0157373_102042341 195
490 3300013100 Ga0157373_10448322 Ga0157373_104483222 195
491 3300013102 Ga0157371_10012610 Ga0157371_100126103 195
492 3300013102 Ga0157371_10016310 Ga0157371_100163102 195
493 3300013102 Ga0157371_10307673 Ga0157371_103076732 195
494 3300013102 Ga0157371_10333941 Ga0157371_103339412 195
495 3300013102 Ga0157371_10402923 Ga0157371_104029231 195
496 3300013104 Ga0157370_10017392 Ga0157370_100173927 195
497 3300013104 Ga0157370_10235369 Ga0157370_102353691 195
498 3300013104 Ga0157370_10491839 Ga0157370_104918392 195
499 3300013105 Ga0157369_10044560 Ga0157369_100445605 195
500 3300013105 Ga0157369_10050980 Ga0157369_100509803 195
501 3300013296 Ga0157374_10000011 Ga0157374_10000011435 195
502 3300013296 Ga0157374_10049099 Ga0157374_100490994 195
503 3300013296 Ga0157374_10058501 Ga0157374_100585013 195
504 3300013296 Ga0157374_10128677 Ga0157374_101286773 195
505 3300013296 Ga0157374_10327134 Ga0157374_103271342 195
506 3300013296 Ga0157374_11102403 Ga0157374_111024032 195
507 3300013296 Ga0157374_11583648 Ga0157374_115836481 195
508 3300013297 Ga0157378_10003885 Ga0157378_100038852 195
509 3300013297 Ga0157378_10022460 Ga0157378_100224603 195
510 3300013297 Ga0157378_10023168 Ga0157378_100231685 195
511 3300013297 Ga0157378_10122033 Ga0157378_101220332 195
512 3300013297 Ga0157378_10124362 Ga0157378_101243623 195
513 3300013297 Ga0157378_10145037 Ga0157378_101450372 195
514 3300013297 Ga0157378_10146238 Ga0157378_101462381 195
515 3300013306 Ga0163162_10001786 Ga0163162_1000178614 195
516 3300013306 Ga0163162_10010207 Ga0163162_100102075 195
517 3300013306 Ga0163162_10014954 Ga0163162_100149543 195
518 3300013306 Ga0163162_10023728 Ga0163162_100237282 195
519 3300013306 Ga0163162_10307954 Ga0163162_103079542 195
520 3300013306 Ga0163162_10353192 Ga0163162_103531922 195
521 3300013306 Ga0163162_10938397 Ga0163162_109383971 195
522 3300013306 Ga0163162_11182232 Ga0163162_111822322 195
523 3300013307 Ga0157372_10000171 Ga0157372_1000017134 195
524 3300013307 Ga0157372_10002594 Ga0157372_1000259415 195
525 3300013307 Ga0157372_10011230 Ga0157372_100112308 195
526 3300013307 Ga0157372_10059624 Ga0157372_100596243 195
527 3300013307 Ga0157372_10066128 Ga0157372_100661284 195
528 3300013307 Ga0157372_10216361 Ga0157372_102163612 195
529 3300013307 Ga0157372_10296905 Ga0157372_102969052 195
530 3300013307 Ga0157372_10414282 Ga0157372_104142822 195
531 3300013307 Ga0157372_10460271 Ga0157372_104602712 195
532 3300013307 Ga0157372_10622885 Ga0157372_106228852 195
533 3300013307 Ga0157372_11628241 Ga0157372_116282411 195
534 3300013307 Ga0157372_11657526 Ga0157372_116575261 195
535 3300013307 Ga0157372_12096753 Ga0157372_120967531 195
536 3300013308 Ga0157375_10000253 Ga0157375_1000025324 195
537 3300013308 Ga0157375_10018468 Ga0157375_100184684 195
538 3300013308 Ga0157375_10209713 Ga0157375_102097131 195
539 3300013308 Ga0157375_10219966 Ga0157375_102199662 195
540 3300013308 Ga0157375_10223380 Ga0157375_102233803 195
541 3300013308 Ga0157375_10503629 Ga0157375_105036292 195
542 3300013308 Ga0157375_11147721 Ga0157375_111477212 195
543 3300013308 Ga0157375_11238351 Ga0157375_112383512 195
544 3300013308 Ga0157375_12128856 Ga0157375_121288561 195
545 3300013308 Ga0157375_12268388 Ga0157375_122683881 195
546 3300014325 Ga0163163_10014364 Ga0163163_100143643 195
547 3300014325 Ga0163163_10079366 Ga0163163_100793663 195
548 3300014325 Ga0163163_10396739 Ga0163163_103967391 195
549 3300014325 Ga0163163_10557891 Ga0163163_105578912 195
550 3300014325 Ga0163163_10962002 Ga0163163_109620021 195
551 3300014325 Ga0163163_11071721 Ga0163163_110717211 195
552 3300014326 Ga0157380_10000255 Ga0157380_100002553 195
553 3300014326 Ga0157380_10033800 Ga0157380_100338003 195
554 3300014326 Ga0157380_10104836 Ga0157380_101048362 195
555 3300014326 Ga0157380_10244711 Ga0157380_102447111 195
556 3300014326 Ga0157380_10707913 Ga0157380_107079132 195
557 3300014745 Ga0157377_10000877 Ga0157377_1000087711 195
558 3300014745 Ga0157377_10053008 Ga0157377_100530082 195
559 3300014745 Ga0157377_10168175 Ga0157377_101681752 195
560 3300014745 Ga0157377_10245015 Ga0157377_102450152 195
561 3300014968 Ga0157379_10010237 Ga0157379_100102377 195
562 3300014968 Ga0157379_10012296 Ga0157379_100122965 195
563 3300014968 Ga0157379_10102352 Ga0157379_101023522 195
564 3300014968 Ga0157379_10110228 Ga0157379_101102282 195
565 3300014968 Ga0157379_10164121 Ga0157379_101641212 195
566 3300014968 Ga0157379_10974267 Ga0157379_109742672 195
567 3300014969 Ga0157376_10000714 Ga0157376_1000071416 195
568 3300014969 Ga0157376_10000961 Ga0157376_1000096112 195
569 3300014969 Ga0157376_10042263 Ga0157376_100422632 195
570 3300014969 Ga0157376_10128050 Ga0157376_101280502 195
571 3300014969 Ga0157376_10207857 Ga0157376_102078572 195
572 3300014969 Ga0157376_10392783 Ga0157376_103927832 195
573 3300014969 Ga0157376_10610114 Ga0157376_106101141 195
574 3300017792 Ga0163161_10006391 Ga0163161_100063915 195
575 3300017792 Ga0163161_10010207 Ga0163161_100102074 195
576 3300017792 Ga0163161_10208107 Ga0163161_102081073 195
577 3300017792 Ga0163161_10884223 Ga0163161_108842232 195
578 3300024225 Ga0224572_1030126 Ga0224572_10301262 195
579 3300025271 Ga0207666_1006968 Ga0207666_10069682 195
580 3300025271 Ga0207666_1036659 Ga0207666_10366591 195
581 3300025302 Ga0207426_1000040 Ga0207426_1000040140 195
582 3300025315 Ga0207697_10011691 Ga0207697_100116913 195
583 3300025315 Ga0207697_10022813 Ga0207697_100228132 195
584 3300025315 Ga0207697_10124080 Ga0207697_101240802 195
585 3300025321 Ga0207656_10016933 Ga0207656_100169332 195
586 3300025321 Ga0207656_10047246 Ga0207656_100472463 195
587 3300025321 Ga0207656_10059474 Ga0207656_100594742 195
588 3300025321 Ga0207656_10172435 Ga0207656_101724352 195
589 3300025321 Ga0207656_10329934 Ga0207656_103299341 195
590 3300025893 Ga0207682_10103487 Ga0207682_101034872 195
591 3300025893 Ga0207682_10155406 Ga0207682_101554062 195
592 3300025899 Ga0207642_10039087 Ga0207642_100390872 195
593 3300025900 Ga0207710_10007034 Ga0207710_100070343 195
594 3300025900 Ga0207710_10007383 Ga0207710_100073833 195
595 3300025901 Ga0207688_10007452 Ga0207688_100074523 195
596 3300025903 Ga0207680_10000385 Ga0207680_100003858 195
597 3300025903 Ga0207680_10112408 Ga0207680_101124082 195
598 3300025904 Ga0207647_10000267 Ga0207647_100002675 195
599 3300025904 Ga0207647_10102979 Ga0207647_101029792 195
600 3300025905 Ga0207685_10181909 Ga0207685_101819092 195
601 3300025907 Ga0207645_10084323 Ga0207645_100843232 195
602 3300025907 Ga0207645_10113964 Ga0207645_101139642 195
603 3300025907 Ga0207645_10124444 Ga0207645_101244442 195
604 3300025908 Ga0207643_10009151 Ga0207643_100091511 195
605 3300025908 Ga0207643_10023749 Ga0207643_100237493 195
606 3300025911 Ga0207654_10029309 Ga0207654_100293093 195
607 3300025911 Ga0207654_10143024 Ga0207654_101430242 195
608 3300025911 Ga0207654_10157829 Ga0207654_101578291 195
609 3300025911 Ga0207654_10419371 Ga0207654_104193712 195
610 3300025913 Ga0207695_10000087 Ga0207695_10000087159 195
611 3300025913 Ga0207695_10001064 Ga0207695_1000106416 195
612 3300025913 Ga0207695_10010725 Ga0207695_100107255 195
613 3300025913 Ga0207695_10035111 Ga0207695_100351112 195
614 3300025913 Ga0207695_10043256 Ga0207695_100432564 195
615 3300025914 Ga0207671_10001454 Ga0207671_1000145413 195
616 3300025914 Ga0207671_10002275 Ga0207671_1000227515 195
617 3300025914 Ga0207671_10119196 Ga0207671_101191962 195
618 3300025914 Ga0207671_10151250 Ga0207671_101512502 195
619 3300025918 Ga0207662_10007595 Ga0207662_100075952 195
620 3300025919 Ga0207657_10035191 Ga0207657_100351914 195
621 3300025920 Ga0207649_10653167 Ga0207649_106531671 195
622 3300025921 Ga0207652_10963259 Ga0207652_109632591 195
623 3300025923 Ga0207681_10006442 Ga0207681_100064425 195
624 3300025923 Ga0207681_10140802 Ga0207681_101408023 195
625 3300025924 Ga0207694_10032409 Ga0207694_100324093 195
626 3300025925 Ga0207650_10000886 Ga0207650_1000088618 195
627 3300025925 Ga0207650_10038753 Ga0207650_100387532 195
628 3300025925 Ga0207650_10094335 Ga0207650_100943353 195
629 3300025925 Ga0207650_10255577 Ga0207650_102555772 195
630 3300025925 Ga0207650_10287529 Ga0207650_102875292 195
631 3300025925 Ga0207650_10571944 Ga0207650_105719442 195
632 3300025926 Ga0207659_10024016 Ga0207659_100240162 195
633 3300025926 Ga0207659_10082611 Ga0207659_100826112 195
634 3300025926 Ga0207659_10133875 Ga0207659_101338751 195
635 3300025926 Ga0207659_10320533 Ga0207659_103205331 195
636 3300025926 Ga0207659_10385180 Ga0207659_103851802 195
637 3300025926 Ga0207659_10421993 Ga0207659_104219932 195
638 3300025931 Ga0207644_10211405 Ga0207644_102114052 195
639 3300025932 Ga0207690_10642972 Ga0207690_106429722 195
640 3300025933 Ga0207706_10098351 Ga0207706_100983512 195
641 3300025933 Ga0207706_10161317 Ga0207706_101613172 195
642 3300025934 Ga0207686_10002365 Ga0207686_100023654 195
643 3300025934 Ga0207686_10172081 Ga0207686_101720812 195
644 3300025936 Ga0207670_10013041 Ga0207670_100130413 195
645 3300025936 Ga0207670_10036422 Ga0207670_100364223 195
646 3300025936 Ga0207670_10046304 Ga0207670_100463044 195
647 3300025937 Ga0207669_10044594 Ga0207669_100445942 195
648 3300025937 Ga0207669_10046466 Ga0207669_100464663 195
649 3300025937 Ga0207669_10079120 Ga0207669_100791202 195
650 3300025938 Ga0207704_10272286 Ga0207704_102722862 195
651 3300025938 Ga0207704_10416621 Ga0207704_104166211 195
652 3300025938 Ga0207704_10672833 Ga0207704_106728331 195
653 3300025938 Ga0207704_10911796 Ga0207704_109117961 195
654 3300025938 Ga0207704_11191151 Ga0207704_111911511 195
655 3300025938 Ga0207704_11235418 Ga0207704_112354181 195
656 3300025940 Ga0207691_10028411 Ga0207691_100284113 195
657 3300025940 Ga0207691_10041189 Ga0207691_100411893 195
658 3300025940 Ga0207691_10122221 Ga0207691_101222212 195
659 3300025940 Ga0207691_10183594 Ga0207691_101835943 195
660 3300025940 Ga0207691_10193029 Ga0207691_101930292 195
661 3300025940 Ga0207691_10514004 Ga0207691_105140042 195
662 3300025940 Ga0207691_10640672 Ga0207691_106406722 195
663 3300025941 Ga0207711_10166409 Ga0207711_101664092 195
664 3300025941 Ga0207711_10455502 Ga0207711_104555022 195
665 3300025942 Ga0207689_10001049 Ga0207689_1000104915 195
666 3300025942 Ga0207689_10001807 Ga0207689_1000180712 195
667 3300025942 Ga0207689_10002381 Ga0207689_100023815 195
668 3300025942 Ga0207689_10009409 Ga0207689_100094092 195
669 3300025942 Ga0207689_10030982 Ga0207689_100309822 195
670 3300025942 Ga0207689_10127606 Ga0207689_101276064 195
671 3300025942 Ga0207689_10230627 Ga0207689_102306272 195
672 3300025942 Ga0207689_10251925 Ga0207689_102519252 195
673 3300025944 Ga0207661_10107524 Ga0207661_101075243 195
674 3300025944 Ga0207661_10366673 Ga0207661_103666731 195
675 3300025944 Ga0207661_10504259 Ga0207661_105042592 195
676 3300025945 Ga0207679_10013487 Ga0207679_100134872 195
677 3300025945 Ga0207679_10828352 Ga0207679_108283521 195
678 3300025949 Ga0207667_10000584 Ga0207667_1000058415 195
679 3300025960 Ga0207651_10009144 Ga0207651_100091445 195
680 3300025960 Ga0207651_10060146 Ga0207651_100601462 195
681 3300025960 Ga0207651_10187003 Ga0207651_101870032 195
682 3300025960 Ga0207651_10307609 Ga0207651_103076092 195
683 3300025960 Ga0207651_10465509 Ga0207651_104655092 195
684 3300025960 Ga0207651_10806072 Ga0207651_108060722 195
685 3300025961 Ga0207712_10001674 Ga0207712_100016748 195
686 3300025961 Ga0207712_10024390 Ga0207712_100243902 195
687 3300025961 Ga0207712_10033174 Ga0207712_100331742 195
688 3300025961 Ga0207712_10088473 Ga0207712_100884732 195
689 3300025961 Ga0207712_10147361 Ga0207712_101473612 195
690 3300025961 Ga0207712_10148194 Ga0207712_101481942 195
691 3300025961 Ga0207712_10212567 Ga0207712_102125671 195
692 3300025961 Ga0207712_10274813 Ga0207712_102748132 195
693 3300025961 Ga0207712_11001492 Ga0207712_110014921 195
694 3300025972 Ga0207668_10093747 Ga0207668_100937471 195
695 3300025972 Ga0207668_10218419 Ga0207668_102184192 195
696 3300025972 Ga0207668_10390789 Ga0207668_103907892 195
697 3300025972 Ga0207668_10485411 Ga0207668_104854112 195
698 3300025981 Ga0207640_10060803 Ga0207640_100608033 195
699 3300025981 Ga0207640_10566953 Ga0207640_105669532 195
700 3300025981 Ga0207640_10613757 Ga0207640_106137572 195
701 3300025981 Ga0207640_10645381 Ga0207640_106453811 195
702 3300025981 Ga0207640_10673307 Ga0207640_106733071 195
703 3300025986 Ga0207658_10153400 Ga0207658_101534001 195
704 3300025986 Ga0207658_10242920 Ga0207658_102429202 195
705 3300025986 Ga0207658_10421457 Ga0207658_104214572 195
706 3300025986 Ga0207658_10652137 Ga0207658_106521372 195
707 3300025986 Ga0207658_10749464 Ga0207658_107494642 195
708 3300026023 Ga0207677_10018792 Ga0207677_100187924 195
709 3300026023 Ga0207677_10081224 Ga0207677_100812241 195
710 3300026023 Ga0207677_10095568 Ga0207677_100955682 195
711 3300026023 Ga0207677_10465788 Ga0207677_104657881 195
712 3300026023 Ga0207677_10690272 Ga0207677_106902722 195
713 3300026035 Ga0207703_10005569 Ga0207703_100055693 195
714 3300026035 Ga0207703_10312904 Ga0207703_103129041 195
715 3300026041 Ga0207639_10026879 Ga0207639_100268792 195
716 3300026041 Ga0207639_10030308 Ga0207639_100303083 195
717 3300026075 Ga0207708_10020850 Ga0207708_100208503 195
718 3300026075 Ga0207708_10321977 Ga0207708_103219772 195
719 3300026075 Ga0207708_10443910 Ga0207708_104439102 195
720 3300026078 Ga0207702_10091198 Ga0207702_100911983 195
721 3300026088 Ga0207641_10000026 Ga0207641_1000002643 195
722 3300026088 Ga0207641_10000318 Ga0207641_1000031854 195
723 3300026088 Ga0207641_10121208 Ga0207641_101212082 195
724 3300026088 Ga0207641_10136282 Ga0207641_101362823 195
725 3300026088 Ga0207641_10851819 Ga0207641_108518192 195
726 3300026088 Ga0207641_11079495 Ga0207641_110794951 195
727 3300026089 Ga0207648_10001180 Ga0207648_100011805 195
728 3300026089 Ga0207648_10005292 Ga0207648_1000529215 195
729 3300026089 Ga0207648_10039078 Ga0207648_100390784 195
730 3300026089 Ga0207648_10224594 Ga0207648_102245943 195
731 3300026089 Ga0207648_10565590 Ga0207648_105655902 195
732 3300026089 Ga0207648_11245666 Ga0207648_112456661 195
733 3300026095 Ga0207676_10003469 Ga0207676_100034693 195
734 3300026095 Ga0207676_10157415 Ga0207676_101574152 195
735 3300026116 Ga0207674_10002491 Ga0207674_100024917 195
736 3300026116 Ga0207674_10016488 Ga0207674_100164885 195
737 3300026116 Ga0207674_10182973 Ga0207674_101829732 195
738 3300026118 Ga0207675_100000282 Ga0207675_10000028244 195
739 3300026118 Ga0207675_100041723 Ga0207675_1000417233 195
740 3300026118 Ga0207675_100057527 Ga0207675_1000575272 195
741 3300026118 Ga0207675_100083719 Ga0207675_1000837192 195
742 3300026118 Ga0207675_100181799 Ga0207675_1001817993 195
743 3300026118 Ga0207675_100947003 Ga0207675_1009470032 195
744 3300026121 Ga0207683_10000957 Ga0207683_1000095715 195
745 3300026121 Ga0207683_10091671 Ga0207683_100916712 195
746 3300026121 Ga0207683_10582529 Ga0207683_105825292 195
747 3300026121 Ga0207683_10738336 Ga0207683_107383361 195
748 3300026142 Ga0207698_10017582 Ga0207698_100175823 195
749 3300026142 Ga0207698_10085367 Ga0207698_100853672 195
750 3300027526 Ga0209968_1013041 Ga0209968_10130412 195
751 3300027876 Ga0209974_10082155 Ga0209974_100821552 195
752 3300027907 Ga0207428_10183867 Ga0207428_101838673 195
753 3300027907 Ga0207428_10242204 Ga0207428_102422041 195
754 3300028379 Ga0268266_10076201 Ga0268266_100762013 195
755 3300028380 Ga0268265_10023908 Ga0268265_100239083 195
756 3300028380 Ga0268265_10237047 Ga0268265_102370472 195
757 3300028381 Ga0268264_10000028 Ga0268264_10000028316 195
758 3300028381 Ga0268264_10004316 Ga0268264_100043168 195
759 3300028381 Ga0268264_10027091 Ga0268264_100270912 195
760 3300028381 Ga0268264_10042588 Ga0268264_100425882 195
761 3300028381 Ga0268264_10089071 Ga0268264_100890712 195
762 3300028381 Ga0268264_10467224 Ga0268264_104672241 195
763 3300028381 Ga0268264_10505685 Ga0268264_105056852 195
764 3300028381 Ga0268264_10973482 Ga0268264_109734821 195
765 3300028381 Ga0268264_11565799 Ga0268264_115657991 195
766 3300028786 Ga0307517_10000268 Ga0307517_1000026856 195
767 3300028786 Ga0307517_10306715 Ga0307517_103067152 195
768 3300028794 Ga0307515_10004954 Ga0307515_100049549 195
769 3300030521 Ga0307511_10001580 Ga0307511_100015802 195
770 3300031456 Ga0307513_10641763 Ga0307513_106417631 195
771 3300031507 Ga0307509_10297295 Ga0307509_102972952 195
772 3300031548 Ga0307408_100023915 Ga0307408_1000239154 195
773 3300031730 Ga0307516_10000159 Ga0307516_1000015928 195
774 3300031730 Ga0307516_10057074 Ga0307516_100570742 195
775 3300031852 Ga0307410_10089608 Ga0307410_100896082 195
776 3300031911 Ga0307412_10197586 Ga0307412_101975862 195
777 3300032002 Ga0307416_100051791 Ga0307416_1000517912 195
778 3300037418 Ga0395900_0352654 Ga0395900_0352654_319_909 195
779 3300037471 Ga0395905_0002097 Ga0395905_0002097_9284_9874 195
780 3300037471 Ga0395905_0594250 Ga0395905_0594250_99_686 195
781 3300037471 Ga0395905_0661318 Ga0395905_0661318_63_653 195
782 3300039437 Ga0436365_0083240 Ga0436365_0083240_424_1014 195
783 3300041408 Ga0439453_0032084 Ga0439453_0032084_73_663 195
784 3300042007 Ga0439449_0002319 Ga0439449_0002319_4521_5111 195
785 3300042011 Ga0439454_014142 Ga0439454_014142_379_969 195
786 3300042122 Ga0450920_015921 Ga0450920_015921_52_642 195
787 3300042435 Ga0439434_0039899 Ga0439434_0039899_337_927 195
788 3300044673 Ga0453683_0128832 Ga0453683_0128832_647_1237 195
789 3300044683 Ga0466965_0102697 Ga0466965_0102697_257_847 195
790 3300044693 Ga0466961_0007019 Ga0466961_0007019_95_685 195
791 3300044712 Ga0453684_0050332 Ga0453684_0050332_2789_3379 195
792 3300044719 Ga0466971_0007115 Ga0466971_0007115_2078_2668 195
793 3300045049 Ga0466959_0001773 Ga0466959_0001773_11247_11837 195
794 3300045049 Ga0466959_0080190 Ga0466959_0080190_1126_1716 195
795 3300045836 Ga0466958_0039672 Ga0466958_0039672_1488_2078 195
796 3300045976 Ga0466967_0315986 Ga0466967_0315986_699_1286 195
797 3300046471 Ga0495650_0011951 Ga0495650_0011951_3593_4183 195
798 3300046475 Ga0495639_0287509 Ga0495639_0287509_159_749 195
799 3300046499 Ga0495594_0344219 Ga0495594_0344219_245_835 195
800 3300046507 Ga0495606_0016536 Ga0495606_0016536_2650_3240 195
801 3300046523 Ga0495644_0153692 Ga0495644_0153692_83_673 195
802 3300046648 Ga0495611_0000677 Ga0495611_0000677_2162_2752 195
803 3300046648 Ga0495611_0119513 Ga0495611_0119513_87_677 195
804 3300046694 Ga0495649_0042810 Ga0495649_0042810_1482_2072 195
805 3300047321 Ga0495676_0248730 Ga0495676_0248730_391_981 195
806 3300047443 Ga0495687_002362 Ga0495687_002362_7472_8062 195
807 3300047472 Ga0495686_0000005 Ga0495686_0000005_624042_624632 195
808 3300048903 Ga0496100_0055860 Ga0496100_0055860_890_1483 195
809 3300048907 Ga0496104_0401033 Ga0496104_0401033_516_1109 195
810 3300048917 Ga0496114_0091779 Ga0496114_0091779_864_1457 195
811 3300048918 Ga0496115_0082594 Ga0496115_0082594_1051_1641 195
812 3300049161 Ga0501305_018559 Ga0501305_018559_356_946 195
813 3300049568 Ga0501031_0008289 Ga0501031_0008289_1728_2321 195
814 3300049569 Ga0501032_0021587 Ga0501032_0021587_1688_2281 195
815 3300049571 Ga0501034_0006265 Ga0501034_0006265_10876_11466 195
816 3300049572 Ga0501036_0012018 Ga0501036_0012018_2169_2762 195
817 3300049572 Ga0501036_0030300 Ga0501036_0030300_358_948 195
818 3300049574 Ga0501038_0002256 Ga0501038_0002256_7868_8461 195
819 3300049574 Ga0501038_0003120 Ga0501038_0003120_7591_8181 195
820 3300049575 Ga0501039_0012093 Ga0501039_0012093_164_754 195
821 3300049579 Ga0501043_0002067 Ga0501043_0002067_5654_6244 195
822 3300049579 Ga0501043_0075075 Ga0501043_0075075_1867_2457 195
823 3300049579 Ga0501043_0104821 Ga0501043_0104821_1252_1845 195
824 3300049580 Ga0501046_0015920 Ga0501046_0015920_3267_3857 195
825 3300049580 Ga0501046_0422323 Ga0501046_0422323_219_812 195
826 3300049580 Ga0501046_0671350 Ga0501046_0671350_33_623 195
827 3300049581 Ga0501047_0008193 Ga0501047_0008193_6555_7145 195
828 3300049581 Ga0501047_0044588 Ga0501047_0044588_1584_2174 195
829 3300049581 Ga0501047_0053122 Ga0501047_0053122_3059_3652 195
830 3300049581 Ga0501047_0092528 Ga0501047_0092528_2088_2678 195
831 3300049582 Ga0501048_0002001 Ga0501048_0002001_9627_10217 195
832 3300049582 Ga0501048_0049627 Ga0501048_0049627_56_646 195
833 3300049583 Ga0501067_0007424 Ga0501067_0007424_2330_2920 195
834 3300049584 Ga0501068_0059805 Ga0501068_0059805_1660_2250 195
835 3300049586 Ga0501070_0007289 Ga0501070_0007289_7317_7907 195
836 3300049588 Ga0501072_0065071 Ga0501072_0065071_1120_1710 195
837 3300049589 Ga0501073_0007586 Ga0501073_0007586_2893_3483 195
838 3300049590 Ga0501074_0001847 Ga0501074_0001847_7296_7886 195
839 3300049593 Ga0501077_0133495 Ga0501077_0133495_686_1276 195
840 3300049652 Ga0501202_000214 Ga0501202_000214_3929_4519 195
841 3300049654 Ga0501207_001734 Ga0501207_001734_1610_2200 195
842 3300049656 Ga0501209_147441 Ga0501209_147441_90_680 195
843 3300049664 Ga0501224_013114 Ga0501224_013114_107_697 195
844 3300049682 Ga0501252_005402 Ga0501252_005402_342_932 195
845 3300049686 Ga0501257_001328 Ga0501257_001328_1532_2122 195
846 3300049686 Ga0501257_019120 Ga0501257_019120_661_1251 195
847 3300049688 Ga0501259_000389 Ga0501259_000389_4786_5376 195
848 3300049704 Ga0501221_056007 Ga0501221_056007_198_788 195
849 3300049705 Ga0501225_0015699 Ga0501225_0015699_1477_2067 195
850 3300049705 Ga0501225_0017737 Ga0501225_0017737_806_1396 195
851 3300049708 Ga0501245_001131 Ga0501245_001131_903_1493 195
852 3300049741 Ga0501079_0074098 Ga0501079_0074098_1553_2143 195
853 3300049742 Ga0501080_0048628 Ga0501080_0048628_2393_2986 195
854 3300049742 Ga0501080_0060710 Ga0501080_0060710_1597_2187 195
855 3300049742 Ga0501080_0186185 Ga0501080_0186185_1280_1867 195
856 3300049744 Ga0501083_0007969 Ga0501083_0007969_384_974 195
857 3300049744 Ga0501083_0166701 Ga0501083_0166701_107_700 195
858 3300049757 Ga0501232_003982 Ga0501232_003982_477_1067 195
859 3300049763 Ga0501266_005869 Ga0501266_005869_427_1017 195
860 3300049822 Ga0501035_0001762 Ga0501035_0001762_14335_14925 195
861 3300049822 Ga0501035_0028811 Ga0501035_0028811_4444_5037 195
862 3300049823 Ga0501044_0003029 Ga0501044_0003029_11247_11837 195
863 3300049823 Ga0501044_0004698 Ga0501044_0004698_4999_5589 195
864 3300049823 Ga0501044_0058717 Ga0501044_0058717_959_1552 195
865 3300049823 Ga0501044_0128478 Ga0501044_0128478_1156_1746 195
866 3300050493 nmdc:mga0k408_35768_c1 nmdc:mga0k408_35768_c1_2186_2776 195
867 3300050496 nmdc:mga07m45_86419_c1 nmdc:mga07m45_86419_c1_906_1496 195
868 3300050508 nmdc:mga09592_298986_c1 nmdc:mga09592_298986_c1_774_1364 195
869 3300050508 nmdc:mga09592_774025_c1 nmdc:mga09592_774025_c1_162_752 195
870 3300050511 nmdc:mga08y16_1151308_c1 nmdc:mga08y16_1151308_c1_15_605 195
871 3300050511 nmdc:mga08y16_34132_c1 nmdc:mga08y16_34132_c1_2874_3464 195
872 3300050511 nmdc:mga08y16_437140_c1 nmdc:mga08y16_437140_c1_643_1233 195
873 3300050511 nmdc:mga08y16_85070_c1 nmdc:mga08y16_85070_c1_630_1259 195
874 3300053146 Ga0500588_0087389 Ga0500588_0087389_309_899 195
875 3300053153 Ga0500616_0068964 Ga0500616_0068964_489_1076 195
876 3300053156 Ga0500622_0000462 Ga0500622_0000462_11472_12059 195
877 3300053178 Ga0500637_0134446 Ga0500637_0134446_568_1158 195
878 3300053727 Ga0500611_000003 Ga0500611_000003_221819_222451 195
879 3300054114 Ga0501084_0034892 Ga0501084_0034892_3204_3794 195
880 3300060353 Ga0501082_0246325 Ga0501082_0246325_357_947 195
881 3300061719 Ga0466962_0263084 Ga0466962_0263084_111_698 195
882 3300003203 JGI25406J46586_10016281 JGI25406J46586_100162813 196
883 3300003320 rootH2_10031796 rootH2_100317965 196
884 3300003322 rootL2_10079796 rootL2_100797961 196
885 3300003322 rootL2_10152750 rootL2_101527503 196
886 3300003322 rootL2_10245767 rootL2_102457672 196
887 3300003323 rootH1_10011024 rootH1_100110244 196
888 3300003323 rootH1_10255312 rootH1_102553122 196
889 3300005289 Ga0065704_10136476 Ga0065704_101364762 196
890 3300005289 Ga0065704_10436151 Ga0065704_104361511 196
891 3300005290 Ga0065712_10361682 Ga0065712_103616821 196
892 3300005295 Ga0065707_10145885 Ga0065707_101458852 196
893 3300005327 Ga0070658_10049636 Ga0070658_100496362 196
894 3300005327 Ga0070658_10249989 Ga0070658_102499892 196
895 3300005328 Ga0070676_10006527 Ga0070676_100065273 196
896 3300005328 Ga0070676_10007632 Ga0070676_100076322 196
897 3300005329 Ga0070683_100001729 Ga0070683_10000172911 196
898 3300005329 Ga0070683_100005726 Ga0070683_1000057264 196
899 3300005329 Ga0070683_100034714 Ga0070683_1000347144 196
900 3300005329 Ga0070683_100331861 Ga0070683_1003318612 196
901 3300005329 Ga0070683_100466220 Ga0070683_1004662202 196
902 3300005330 Ga0070690_100009060 Ga0070690_1000090604 196
903 3300005330 Ga0070690_100082154 Ga0070690_1000821541 196
904 3300005330 Ga0070690_100923722 Ga0070690_1009237221 196
905 3300005331 Ga0070670_100265726 Ga0070670_1002657262 196
906 3300005331 Ga0070670_100784650 Ga0070670_1007846502 196
907 3300005334 Ga0068869_100008253 Ga0068869_1000082534 196
908 3300005334 Ga0068869_100317584 Ga0068869_1003175842 196
909 3300005335 Ga0070666_10007097 Ga0070666_100070976 196
910 3300005335 Ga0070666_10018579 Ga0070666_100185792 196
911 3300005335 Ga0070666_10096508 Ga0070666_100965082 196
912 3300005336 Ga0070680_100358167 Ga0070680_1003581671 196
913 3300005337 Ga0070682_100000817 Ga0070682_10000081720 196
914 3300005337 Ga0070682_100003764 Ga0070682_1000037642 196
915 3300005337 Ga0070682_100359106 Ga0070682_1003591062 196
916 3300005337 Ga0070682_100615412 Ga0070682_1006154122 196
917 3300005338 Ga0068868_100003574 Ga0068868_10000357410 196
918 3300005338 Ga0068868_100013019 Ga0068868_1000130192 196
919 3300005338 Ga0068868_100013615 Ga0068868_1000136153 196
920 3300005338 Ga0068868_100044829 Ga0068868_1000448292 196
921 3300005339 Ga0070660_100020166 Ga0070660_1000201662 196
922 3300005339 Ga0070660_100211118 Ga0070660_1002111182 196
923 3300005340 Ga0070689_100200815 Ga0070689_1002008152 196
924 3300005341 Ga0070691_10016505 Ga0070691_100165052 196
925 3300005343 Ga0070687_100036744 Ga0070687_1000367442 196
926 3300005344 Ga0070661_100010038 Ga0070661_1000100383 196
927 3300005344 Ga0070661_100010545 Ga0070661_1000105455 196
928 3300005344 Ga0070661_100051650 Ga0070661_1000516503 196
929 3300005347 Ga0070668_100001487 Ga0070668_10000148711 196
930 3300005353 Ga0070669_100409515 Ga0070669_1004095151 196
931 3300005353 Ga0070669_100964228 Ga0070669_1009642281 196
932 3300005354 Ga0070675_100017849 Ga0070675_1000178494 196
933 3300005354 Ga0070675_100033737 Ga0070675_1000337373 196
934 3300005354 Ga0070675_100078220 Ga0070675_1000782203 196
935 3300005354 Ga0070675_100234729 Ga0070675_1002347292 196
936 3300005354 Ga0070675_100308255 Ga0070675_1003082552 196
937 3300005355 Ga0070671_100368012 Ga0070671_1003680121 196
938 3300005355 Ga0070671_100373478 Ga0070671_1003734781 196
939 3300005355 Ga0070671_100728414 Ga0070671_1007284141 196
940 3300005364 Ga0070673_100002504 Ga0070673_1000025045 196
941 3300005364 Ga0070673_100016743 Ga0070673_1000167435 196
942 3300005364 Ga0070673_100032074 Ga0070673_1000320742 196
943 3300005364 Ga0070673_100317478 Ga0070673_1003174782 196
944 3300005364 Ga0070673_100468277 Ga0070673_1004682772 196
945 3300005365 Ga0070688_100052885 Ga0070688_1000528852 196
946 3300005365 Ga0070688_100571160 Ga0070688_1005711601 196
947 3300005366 Ga0070659_100003202 Ga0070659_1000032023 196
948 3300005366 Ga0070659_100016628 Ga0070659_1000166285 196
949 3300005366 Ga0070659_100178968 Ga0070659_1001789681 196
950 3300005366 Ga0070659_100398038 Ga0070659_1003980382 196
951 3300005367 Ga0070667_100126310 Ga0070667_1001263102 196
952 3300005436 Ga0070713_100327529 Ga0070713_1003275292 196
953 3300005441 Ga0070700_100036455 Ga0070700_1000364553 196
954 3300005441 Ga0070700_100133651 Ga0070700_1001336513 196
955 3300005455 Ga0070663_100759600 Ga0070663_1007596002 196
956 3300005456 Ga0070678_100168186 Ga0070678_1001681861 196
957 3300005456 Ga0070678_100754155 Ga0070678_1007541551 196
958 3300005457 Ga0070662_100001127 Ga0070662_1000011275 196
959 3300005457 Ga0070662_100034909 Ga0070662_1000349094 196
960 3300005457 Ga0070662_100052494 Ga0070662_1000524942 196
961 3300005458 Ga0070681_10046317 Ga0070681_100463173 196
962 3300005459 Ga0068867_100002814 Ga0068867_1000028147 196
963 3300005459 Ga0068867_100014495 Ga0068867_1000144953 196
964 3300005459 Ga0068867_100316524 Ga0068867_1003165242 196
965 3300005466 Ga0070685_10080204 Ga0070685_100802042 196
966 3300005471 Ga0070698_100001240 Ga0070698_10000124014 196
967 3300005471 Ga0070698_100609134 Ga0070698_1006091342 196
968 3300005530 Ga0070679_100451339 Ga0070679_1004513391 196
969 3300005535 Ga0070684_100024750 Ga0070684_1000247504 196
970 3300005535 Ga0070684_100221284 Ga0070684_1002212841 196
971 3300005539 Ga0068853_100029396 Ga0068853_1000293964 196
972 3300005539 Ga0068853_100029550 Ga0068853_1000295502 196
973 3300005539 Ga0068853_100030082 Ga0068853_1000300823 196
974 3300005539 Ga0068853_100202351 Ga0068853_1002023512 196
975 3300005539 Ga0068853_100261478 Ga0068853_1002614781 196
976 3300005539 Ga0068853_100437191 Ga0068853_1004371912 196
977 3300005539 Ga0068853_100768438 Ga0068853_1007684382 196
978 3300005543 Ga0070672_100003343 Ga0070672_1000033437 196
979 3300005543 Ga0070672_100111521 Ga0070672_1001115212 196
980 3300005543 Ga0070672_100227828 Ga0070672_1002278282 196
981 3300005543 Ga0070672_100434217 Ga0070672_1004342172 196
982 3300005544 Ga0070686_100034839 Ga0070686_1000348392 196
983 3300005548 Ga0070665_100013506 Ga0070665_1000135063 196
984 3300005548 Ga0070665_100135709 Ga0070665_1001357092 196
985 3300005548 Ga0070665_100578069 Ga0070665_1005780692 196
986 3300005563 Ga0068855_100028314 Ga0068855_1000283145 196
987 3300005563 Ga0068855_100047256 Ga0068855_1000472563 196
988 3300005563 Ga0068855_100068195 Ga0068855_1000681954 196
989 3300005564 Ga0070664_100002665 Ga0070664_1000026655 196
990 3300005564 Ga0070664_100011068 Ga0070664_1000110683 196
991 3300005564 Ga0070664_100012746 Ga0070664_1000127464 196
992 3300005564 Ga0070664_100023902 Ga0070664_1000239023 196
993 3300005564 Ga0070664_100059556 Ga0070664_1000595563 196
994 3300005577 Ga0068857_100002147 Ga0068857_10000214715 196
995 3300005577 Ga0068857_100021702 Ga0068857_1000217023 196
996 3300005577 Ga0068857_100040038 Ga0068857_1000400382 196
997 3300005577 Ga0068857_100042481 Ga0068857_1000424813 196
998 3300005577 Ga0068857_100048707 Ga0068857_1000487074 196
999 3300005578 Ga0068854_100014542 Ga0068854_1000145424 196
1000 3300005578 Ga0068854_100057512 Ga0068854_1000575122 196
1001 3300005578 Ga0068854_100454171 Ga0068854_1004541712 196
1002 3300005614 Ga0068856_100013213 Ga0068856_1000132132 196
1003 3300005614 Ga0068856_100077714 Ga0068856_1000777143 196
1004 3300005614 Ga0068856_100165278 Ga0068856_1001652782 196
1005 3300005615 Ga0070702_100138828 Ga0070702_1001388282 196
1006 3300005616 Ga0068852_100001315 Ga0068852_1000013153 196
1007 3300005616 Ga0068852_100021556 Ga0068852_1000215564 196
1008 3300005616 Ga0068852_100022444 Ga0068852_1000224442 196
1009 3300005616 Ga0068852_100034271 Ga0068852_1000342714 196
1010 3300005616 Ga0068852_100126566 Ga0068852_1001265663 196
1011 3300005617 Ga0068859_100137328 Ga0068859_1001373283 196
1012 3300005617 Ga0068859_100178034 Ga0068859_1001780343 196
1013 3300005617 Ga0068859_100427170 Ga0068859_1004271703 196
1014 3300005617 Ga0068859_100449886 Ga0068859_1004498862 196
1015 3300005617 Ga0068859_100450640 Ga0068859_1004506401 196
1016 3300005617 Ga0068859_100635313 Ga0068859_1006353132 196
1017 3300005618 Ga0068864_100007084 Ga0068864_1000070845 196
1018 3300005618 Ga0068864_100037255 Ga0068864_1000372552 196
1019 3300005618 Ga0068864_100267086 Ga0068864_1002670862 196
1020 3300005618 Ga0068864_100453334 Ga0068864_1004533341 196
1021 3300005718 Ga0068866_10302902 Ga0068866_103029021 196
1022 3300005718 Ga0068866_10708184 Ga0068866_107081841 196
1023 3300005719 Ga0068861_100060066 Ga0068861_1000600662 196
1024 3300005719 Ga0068861_100155625 Ga0068861_1001556252 196
1025 3300005719 Ga0068861_100375589 Ga0068861_1003755892 196
1026 3300005719 Ga0068861_100659867 Ga0068861_1006598672 196
1027 3300005834 Ga0068851_10013732 Ga0068851_100137322 196
1028 3300005834 Ga0068851_10037373 Ga0068851_100373733 196
1029 3300005834 Ga0068851_10359654 Ga0068851_103596541 196
1030 3300005840 Ga0068870_10178511 Ga0068870_101785112 196
1031 3300005841 Ga0068863_100005185 Ga0068863_10000518510 196
1032 3300005841 Ga0068863_100087712 Ga0068863_1000877121 196
1033 3300005841 Ga0068863_100214931 Ga0068863_1002149312 196
1034 3300005841 Ga0068863_100890110 Ga0068863_1008901101 196
1035 3300005842 Ga0068858_100002187 Ga0068858_1000021875 196
1036 3300005842 Ga0068858_100263131 Ga0068858_1002631312 196
1037 3300005843 Ga0068860_100000691 Ga0068860_10000069124 196
1038 3300005843 Ga0068860_100003814 Ga0068860_10000381410 196
1039 3300005843 Ga0068860_100067529 Ga0068860_1000675294 196
1040 3300005844 Ga0068862_100363185 Ga0068862_1003631851 196
1041 3300005985 Ga0081539_10001587 Ga0081539_1000158736 196
1042 3300005985 Ga0081539_10002627 Ga0081539_1000262712 196
1043 3300005985 Ga0081539_10025751 Ga0081539_100257512 196
1044 3300006195 Ga0075366_10163167 Ga0075366_101631672 196
1045 3300006195 Ga0075366_10189815 Ga0075366_101898151 196
1046 3300006237 Ga0097621_100015927 Ga0097621_1000159275 196
1047 3300006237 Ga0097621_100601330 Ga0097621_1006013302 196
1048 3300006358 Ga0068871_100002355 Ga0068871_1000023559 196
1049 3300006358 Ga0068871_100008522 Ga0068871_1000085224 196
1050 3300006358 Ga0068871_100143671 Ga0068871_1001436712 196
1051 3300006358 Ga0068871_100365015 Ga0068871_1003650152 196
1052 3300006358 Ga0068871_100465880 Ga0068871_1004658802 196
1053 3300006358 Ga0068871_100541812 Ga0068871_1005418122 196
1054 3300006844 Ga0075428_100019658 Ga0075428_1000196583 196
1055 3300006846 Ga0075430_100036022 Ga0075430_1000360223 196
1056 3300006847 Ga0075431_100064340 Ga0075431_1000643402 196
1057 3300006881 Ga0068865_100028398 Ga0068865_1000283984 196
1058 3300006881 Ga0068865_100161276 Ga0068865_1001612761 196
1059 3300006881 Ga0068865_100289257 Ga0068865_1002892571 196
1060 3300006881 Ga0068865_100661863 Ga0068865_1006618631 196
1061 3300006931 Ga0097620_100137326 Ga0097620_1001373263 196
1062 3300006931 Ga0097620_100178027 Ga0097620_1001780272 196
1063 3300006931 Ga0097620_100427189 Ga0097620_1004271893 196
1064 3300006931 Ga0097620_100449875 Ga0097620_1004498752 196
1065 3300006931 Ga0097620_100450647 Ga0097620_1004506472 196
1066 3300006931 Ga0097620_100635384 Ga0097620_1006353842 196
1067 3300009011 Ga0105251_10109748 Ga0105251_101097481 196
1068 3300009093 Ga0105240_10000106 Ga0105240_1000010654 196
1069 3300009093 Ga0105240_10010519 Ga0105240_100105199 196
1070 3300009093 Ga0105240_10074110 Ga0105240_100741106 196
1071 3300009093 Ga0105240_10085023 Ga0105240_100850233 196
1072 3300009093 Ga0105240_10092597 Ga0105240_100925973 196
1073 3300009093 Ga0105240_10109200 Ga0105240_101092003 196
1074 3300009093 Ga0105240_10154725 Ga0105240_101547252 196
1075 3300009094 Ga0111539_10046769 Ga0111539_100467695 196
1076 3300009094 Ga0111539_11166593 Ga0111539_111665931 196
1077 3300009098 Ga0105245_10213785 Ga0105245_102137853 196
1078 3300009101 Ga0105247_10019940 Ga0105247_100199402 196
1079 3300009147 Ga0114129_10097256 Ga0114129_100972563 196
1080 3300009147 Ga0114129_10654684 Ga0114129_106546841 196
1081 3300009148 Ga0105243_10886064 Ga0105243_108860641 196
1082 3300009174 Ga0105241_10001001 Ga0105241_100010013 196
1083 3300009174 Ga0105241_10001117 Ga0105241_1000111714 196
1084 3300009174 Ga0105241_10134161 Ga0105241_101341612 196
1085 3300009174 Ga0105241_10168883 Ga0105241_101688832 196
1086 3300009174 Ga0105241_10172154 Ga0105241_101721542 196
1087 3300009174 Ga0105241_10557038 Ga0105241_105570382 196
1088 3300009176 Ga0105242_10331489 Ga0105242_103314892 196
1089 3300009176 Ga0105242_10540892 Ga0105242_105408922 196
1090 3300009176 Ga0105242_10857753 Ga0105242_108577531 196
1091 3300009177 Ga0105248_10018548 Ga0105248_100185486 196
1092 3300009545 Ga0105237_10014958 Ga0105237_100149582 196
1093 3300009545 Ga0105237_10027964 Ga0105237_100279645 196
1094 3300009545 Ga0105237_10046256 Ga0105237_100462562 196
1095 3300009545 Ga0105237_10267031 Ga0105237_102670312 196
1096 3300009545 Ga0105237_10282510 Ga0105237_102825102 196
1097 3300009545 Ga0105237_10914406 Ga0105237_109144062 196
1098 3300009551 Ga0105238_10031474 Ga0105238_100314743 196
1099 3300009553 Ga0105249_10005427 Ga0105249_100054272 196
1100 3300009553 Ga0105249_11324343 Ga0105249_113243431 196
1101 3300010375 Ga0105239_10015390 Ga0105239_100153902 196
1102 3300010375 Ga0105239_10018651 Ga0105239_100186515 196
1103 3300010375 Ga0105239_10437167 Ga0105239_104371671 196
1104 3300010375 Ga0105239_11206934 Ga0105239_112069341 196
1105 3300010375 Ga0105239_11318998 Ga0105239_113189981 196
1106 3300011119 Ga0105246_10110700 Ga0105246_101107002 196
1107 3300013100 Ga0157373_10002876 Ga0157373_100028766 196
1108 3300013100 Ga0157373_10072067 Ga0157373_100720672 196
1109 3300013100 Ga0157373_10128381 Ga0157373_101283812 196
1110 3300013100 Ga0157373_10132980 Ga0157373_101329802 196
1111 3300013102 Ga0157371_10009545 Ga0157371_100095453 196
1112 3300013102 Ga0157371_10020936 Ga0157371_100209362 196
1113 3300013102 Ga0157371_10097065 Ga0157371_100970652 196
1114 3300013102 Ga0157371_10179682 Ga0157371_101796822 196
1115 3300013102 Ga0157371_10372098 Ga0157371_103720981 196
1116 3300013104 Ga0157370_10001381 Ga0157370_100013815 196
1117 3300013104 Ga0157370_10004229 Ga0157370_100042298 196
1118 3300013104 Ga0157370_10004529 Ga0157370_1000452910 196
1119 3300013104 Ga0157370_10069720 Ga0157370_100697203 196
1120 3300013104 Ga0157370_10747382 Ga0157370_107473821 196
1121 3300013105 Ga0157369_10019874 Ga0157369_100198745 196
1122 3300013105 Ga0157369_10077516 Ga0157369_100775162 196
1123 3300013105 Ga0157369_10104510 Ga0157369_101045103 196
1124 3300013105 Ga0157369_10214797 Ga0157369_102147973 196
1125 3300013105 Ga0157369_10455425 Ga0157369_104554252 196
1126 3300013105 Ga0157369_10575030 Ga0157369_105750302 196
1127 3300013296 Ga0157374_10002056 Ga0157374_100020568 196
1128 3300013296 Ga0157374_10002752 Ga0157374_100027526 196
1129 3300013296 Ga0157374_10007445 Ga0157374_100074455 196
1130 3300013297 Ga0157378_10005169 Ga0157378_100051698 196
1131 3300013297 Ga0157378_10007179 Ga0157378_100071794 196
1132 3300013297 Ga0157378_10137561 Ga0157378_101375612 196
1133 3300013306 Ga0163162_10003305 Ga0163162_100033055 196
1134 3300013306 Ga0163162_10011455 Ga0163162_100114555 196
1135 3300013306 Ga0163162_10040579 Ga0163162_100405795 196
1136 3300013306 Ga0163162_10256815 Ga0163162_102568152 196
1137 3300013306 Ga0163162_10283918 Ga0163162_102839181 196
1138 3300013306 Ga0163162_11628418 Ga0163162_116284181 196
1139 3300013307 Ga0157372_10000463 Ga0157372_1000046326 196
1140 3300013307 Ga0157372_10020732 Ga0157372_100207323 196
1141 3300013307 Ga0157372_10097927 Ga0157372_100979274 196
1142 3300013307 Ga0157372_10098970 Ga0157372_100989702 196
1143 3300013307 Ga0157372_10144671 Ga0157372_101446713 196
1144 3300013307 Ga0157372_10231196 Ga0157372_102311963 196
1145 3300013307 Ga0157372_10288029 Ga0157372_102880293 196
1146 3300013307 Ga0157372_10398778 Ga0157372_103987781 196
1147 3300013307 Ga0157372_10505780 Ga0157372_105057802 196
1148 3300013308 Ga0157375_10006781 Ga0157375_100067815 196
1149 3300013308 Ga0157375_10039295 Ga0157375_100392955 196
1150 3300013308 Ga0157375_10061193 Ga0157375_100611933 196
1151 3300013308 Ga0157375_10079386 Ga0157375_100793863 196
1152 3300013308 Ga0157375_10093329 Ga0157375_100933294 196
1153 3300013308 Ga0157375_10229514 Ga0157375_102295142 196
1154 3300013308 Ga0157375_10680661 Ga0157375_106806612 196
1155 3300013308 Ga0157375_11015244 Ga0157375_110152442 196
1156 3300014325 Ga0163163_10001998 Ga0163163_100019988 196
1157 3300014325 Ga0163163_10005703 Ga0163163_1000570313 196
1158 3300014325 Ga0163163_10067307 Ga0163163_100673073 196
1159 3300014325 Ga0163163_10209682 Ga0163163_102096821 196
1160 3300014325 Ga0163163_11868658 Ga0163163_118686581 196
1161 3300014326 Ga0157380_10191094 Ga0157380_101910942 196
1162 3300014326 Ga0157380_10998365 Ga0157380_109983652 196
1163 3300014745 Ga0157377_10033346 Ga0157377_100333462 196
1164 3300014745 Ga0157377_10104769 Ga0157377_101047692 196
1165 3300014745 Ga0157377_10119224 Ga0157377_101192242 196
1166 3300014968 Ga0157379_10003755 Ga0157379_100037556 196
1167 3300014968 Ga0157379_10072358 Ga0157379_100723582 196
1168 3300014968 Ga0157379_10239159 Ga0157379_102391592 196
1169 3300014968 Ga0157379_10416341 Ga0157379_104163412 196
1170 3300014968 Ga0157379_11319200 Ga0157379_113192001 196
1171 3300014969 Ga0157376_10013649 Ga0157376_100136492 196
1172 3300014969 Ga0157376_10020493 Ga0157376_100204933 196
1173 3300014969 Ga0157376_10037704 Ga0157376_100377042 196
1174 3300014969 Ga0157376_10454081 Ga0157376_104540811 196
1175 3300017792 Ga0163161_10057828 Ga0163161_100578283 196
1176 3300017792 Ga0163161_10063298 Ga0163161_100632983 196
1177 3300017792 Ga0163161_10071446 Ga0163161_100714463 196
1178 3300017792 Ga0163161_10072000 Ga0163161_100720002 196
1179 3300017792 Ga0163161_10194095 Ga0163161_101940952 196
1180 3300017792 Ga0163161_10450629 Ga0163161_104506291 196
1181 3300025246 Ga0209646_1001266 Ga0209646_10012665 196
1182 3300025315 Ga0207697_10011629 Ga0207697_100116292 196
1183 3300025321 Ga0207656_10002582 Ga0207656_100025823 196
1184 3300025321 Ga0207656_10080318 Ga0207656_100803182 196
1185 3300025900 Ga0207710_10012704 Ga0207710_100127044 196
1186 3300025901 Ga0207688_10021310 Ga0207688_100213102 196
1187 3300025901 Ga0207688_10401068 Ga0207688_104010682 196
1188 3300025901 Ga0207688_10434620 Ga0207688_104346202 196
1189 3300025903 Ga0207680_10093805 Ga0207680_100938052 196
1190 3300025903 Ga0207680_10162269 Ga0207680_101622692 196
1191 3300025903 Ga0207680_10572309 Ga0207680_105723091 196
1192 3300025904 Ga0207647_10021116 Ga0207647_100211163 196
1193 3300025904 Ga0207647_10032255 Ga0207647_100322552 196
1194 3300025904 Ga0207647_10106706 Ga0207647_101067062 196
1195 3300025907 Ga0207645_10010860 Ga0207645_100108604 196
1196 3300025907 Ga0207645_10011072 Ga0207645_100110725 196
1197 3300025907 Ga0207645_10026728 Ga0207645_100267282 196
1198 3300025909 Ga0207705_10010189 Ga0207705_100101896 196
1199 3300025909 Ga0207705_10425060 Ga0207705_104250601 196
1200 3300025911 Ga0207654_10000620 Ga0207654_100006206 196
1201 3300025911 Ga0207654_10005079 Ga0207654_100050793 196
1202 3300025911 Ga0207654_10017618 Ga0207654_100176182 196
1203 3300025911 Ga0207654_10074892 Ga0207654_100748922 196
1204 3300025912 Ga0207707_10006526 Ga0207707_100065264 196
1205 3300025912 Ga0207707_10128314 Ga0207707_101283142 196
1206 3300025913 Ga0207695_10003167 Ga0207695_100031677 196
1207 3300025913 Ga0207695_10013294 Ga0207695_100132941 196
1208 3300025913 Ga0207695_10026607 Ga0207695_100266075 196
1209 3300025914 Ga0207671_10002324 Ga0207671_100023248 196
1210 3300025914 Ga0207671_10002511 Ga0207671_1000251111 196
1211 3300025914 Ga0207671_10012471 Ga0207671_100124714 196
1212 3300025914 Ga0207671_10250176 Ga0207671_102501761 196
1213 3300025914 Ga0207671_10453712 Ga0207671_104537122 196
1214 3300025917 Ga0207660_10010532 Ga0207660_100105323 196
1215 3300025917 Ga0207660_10076527 Ga0207660_100765272 196
1216 3300025918 Ga0207662_10057432 Ga0207662_100574323 196
1217 3300025919 Ga0207657_10008173 Ga0207657_100081735 196
1218 3300025919 Ga0207657_10177169 Ga0207657_101771691 196
1219 3300025919 Ga0207657_10248567 Ga0207657_102485672 196
1220 3300025920 Ga0207649_10004322 Ga0207649_100043225 196
1221 3300025920 Ga0207649_10010183 Ga0207649_100101832 196
1222 3300025920 Ga0207649_10281232 Ga0207649_102812322 196
1223 3300025920 Ga0207649_10288048 Ga0207649_102880482 196
1224 3300025921 Ga0207652_10001428 Ga0207652_1000142811 196
1225 3300025921 Ga0207652_10174526 Ga0207652_101745264 196
1226 3300025923 Ga0207681_10050522 Ga0207681_100505223 196
1227 3300025924 Ga0207694_10037716 Ga0207694_100377164 196
1228 3300025924 Ga0207694_10266312 Ga0207694_102663122 196
1229 3300025925 Ga0207650_10165996 Ga0207650_101659961 196
1230 3300025925 Ga0207650_10217609 Ga0207650_102176092 196
1231 3300025925 Ga0207650_10261414 Ga0207650_102614142 196
1232 3300025926 Ga0207659_10025149 Ga0207659_100251492 196
1233 3300025926 Ga0207659_10176810 Ga0207659_101768102 196
1234 3300025926 Ga0207659_10185656 Ga0207659_101856562 196
1235 3300025926 Ga0207659_10631973 Ga0207659_106319732 196
1236 3300025928 Ga0207700_10151666 Ga0207700_101516662 196
1237 3300025931 Ga0207644_10039742 Ga0207644_100397423 196
1238 3300025931 Ga0207644_10553664 Ga0207644_105536641 196
1239 3300025932 Ga0207690_10323216 Ga0207690_103232162 196
1240 3300025932 Ga0207690_10341321 Ga0207690_103413212 196
1241 3300025932 Ga0207690_10588220 Ga0207690_105882201 196
1242 3300025933 Ga0207706_10003305 Ga0207706_1000330519 196
1243 3300025933 Ga0207706_10006233 Ga0207706_100062334 196
1244 3300025933 Ga0207706_10024736 Ga0207706_100247362 196
1245 3300025933 Ga0207706_10339753 Ga0207706_103397531 196
1246 3300025934 Ga0207686_10431623 Ga0207686_104316232 196
1247 3300025936 Ga0207670_10002414 Ga0207670_100024145 196
1248 3300025937 Ga0207669_10008719 Ga0207669_100087194 196
1249 3300025937 Ga0207669_10337155 Ga0207669_103371552 196
1250 3300025938 Ga0207704_10238108 Ga0207704_102381082 196
1251 3300025938 Ga0207704_10348124 Ga0207704_103481241 196
1252 3300025940 Ga0207691_10001280 Ga0207691_1000128010 196
1253 3300025940 Ga0207691_10021484 Ga0207691_100214842 196
1254 3300025940 Ga0207691_10154086 Ga0207691_101540862 196
1255 3300025940 Ga0207691_10201431 Ga0207691_102014312 196
1256 3300025940 Ga0207691_10425589 Ga0207691_104255892 196
1257 3300025941 Ga0207711_10107418 Ga0207711_101074182 196
1258 3300025942 Ga0207689_10033659 Ga0207689_100336592 196
1259 3300025942 Ga0207689_10064394 Ga0207689_100643942 196
1260 3300025942 Ga0207689_10297712 Ga0207689_102977122 196
1261 3300025944 Ga0207661_10004547 Ga0207661_100045475 196
1262 3300025944 Ga0207661_10066686 Ga0207661_100666862 196
1263 3300025944 Ga0207661_10617403 Ga0207661_106174032 196
1264 3300025944 Ga0207661_10926512 Ga0207661_109265122 196
1265 3300025945 Ga0207679_10001622 Ga0207679_100016223 196
1266 3300025945 Ga0207679_10001896 Ga0207679_1000189610 196
1267 3300025945 Ga0207679_10045820 Ga0207679_100458202 196
1268 3300025945 Ga0207679_10048432 Ga0207679_100484322 196
1269 3300025949 Ga0207667_10001242 Ga0207667_100012429 196
1270 3300025949 Ga0207667_10052749 Ga0207667_100527491 196
1271 3300025949 Ga0207667_10112572 Ga0207667_101125722 196
1272 3300025949 Ga0207667_10437896 Ga0207667_104378962 196
1273 3300025960 Ga0207651_10024767 Ga0207651_100247672 196
1274 3300025960 Ga0207651_10038166 Ga0207651_100381662 196
1275 3300025960 Ga0207651_10118387 Ga0207651_101183872 196
1276 3300025960 Ga0207651_10202383 Ga0207651_102023833 196
1277 3300025960 Ga0207651_10423199 Ga0207651_104231992 196
1278 3300025961 Ga0207712_10002942 Ga0207712_100029422 196
1279 3300025961 Ga0207712_10466706 Ga0207712_104667062 196
1280 3300025961 Ga0207712_10820779 Ga0207712_108207791 196
1281 3300025972 Ga0207668_10000514 Ga0207668_100005142 196
1282 3300025981 Ga0207640_10027405 Ga0207640_100274052 196
1283 3300025981 Ga0207640_10177489 Ga0207640_101774892 196
1284 3300025981 Ga0207640_10184743 Ga0207640_101847432 196
1285 3300025986 Ga0207658_10073650 Ga0207658_100736502 196
1286 3300025986 Ga0207658_10311895 Ga0207658_103118952 196
1287 3300025986 Ga0207658_11091660 Ga0207658_110916601 196
1288 3300026023 Ga0207677_10002620 Ga0207677_1000262010 196
1289 3300026023 Ga0207677_10122307 Ga0207677_101223072 196
1290 3300026023 Ga0207677_10262122 Ga0207677_102621222 196
1291 3300026035 Ga0207703_10063864 Ga0207703_100638642 196
1292 3300026035 Ga0207703_10546020 Ga0207703_105460201 196
1293 3300026041 Ga0207639_10112441 Ga0207639_101124412 196
1294 3300026041 Ga0207639_10227832 Ga0207639_102278323 196
1295 3300026067 Ga0207678_10105489 Ga0207678_101054891 196
1296 3300026067 Ga0207678_10716740 Ga0207678_107167401 196
1297 3300026078 Ga0207702_10016802 Ga0207702_100168025 196
1298 3300026078 Ga0207702_10031126 Ga0207702_100311262 196
1299 3300026078 Ga0207702_11436960 Ga0207702_114369601 196
1300 3300026088 Ga0207641_10042011 Ga0207641_100420112 196
1301 3300026088 Ga0207641_10217216 Ga0207641_102172163 196
1302 3300026089 Ga0207648_10001955 Ga0207648_100019558 196
1303 3300026089 Ga0207648_10006356 Ga0207648_1000635611 196
1304 3300026089 Ga0207648_10009551 Ga0207648_100095515 196
1305 3300026089 Ga0207648_10025583 Ga0207648_100255835 196
1306 3300026089 Ga0207648_10345188 Ga0207648_103451882 196
1307 3300026095 Ga0207676_10007891 Ga0207676_100078913 196
1308 3300026095 Ga0207676_10079691 Ga0207676_100796912 196
1309 3300026116 Ga0207674_10000453 Ga0207674_1000045324 196
1310 3300026116 Ga0207674_10007475 Ga0207674_100074754 196
1311 3300026116 Ga0207674_10063666 Ga0207674_100636664 196
1312 3300026116 Ga0207674_10067638 Ga0207674_100676382 196
1313 3300026118 Ga0207675_100012049 Ga0207675_1000120492 196
1314 3300026118 Ga0207675_100098932 Ga0207675_1000989322 196
1315 3300026118 Ga0207675_100153102 Ga0207675_1001531023 196
1316 3300026118 Ga0207675_100179080 Ga0207675_1001790802 196
1317 3300026118 Ga0207675_100647095 Ga0207675_1006470952 196
1318 3300026118 Ga0207675_100692954 Ga0207675_1006929541 196
1319 3300026118 Ga0207675_100794204 Ga0207675_1007942041 196
1320 3300026121 Ga0207683_10046934 Ga0207683_100469343 196
1321 3300026121 Ga0207683_10132622 Ga0207683_101326222 196
1322 3300026121 Ga0207683_10188197 Ga0207683_101881973 196
1323 3300026121 Ga0207683_10633094 Ga0207683_106330941 196
1324 3300026121 Ga0207683_11034915 Ga0207683_110349151 196
1325 3300026142 Ga0207698_10049284 Ga0207698_100492842 196
1326 3300026142 Ga0207698_10137644 Ga0207698_101376442 196
1327 3300026142 Ga0207698_10172445 Ga0207698_101724452 196
1328 3300026142 Ga0207698_10694142 Ga0207698_106941421 196
1329 3300027462 Ga0210000_1021596 Ga0210000_10215962 196
1330 3300027695 Ga0209966_1016341 Ga0209966_10163412 196
1331 3300027907 Ga0207428_10566450 Ga0207428_105664501 196
1332 3300028379 Ga0268266_10107224 Ga0268266_101072242 196
1333 3300028379 Ga0268266_10151973 Ga0268266_101519732 196
1334 3300028379 Ga0268266_10499561 Ga0268266_104995612 196
1335 3300028380 Ga0268265_11189766 Ga0268265_111897661 196
1336 3300028381 Ga0268264_10001799 Ga0268264_1000179914 196
1337 3300028381 Ga0268264_10075954 Ga0268264_100759542 196
1338 3300029957 Ga0265324_10078656 Ga0265324_100786562 196
1339 3300031251 Ga0265327_10000759 Ga0265327_1000075932 196
1340 3300031251 Ga0265327_10017464 Ga0265327_100174644 196
1341 3300031251 Ga0265327_10022312 Ga0265327_100223122 196
1342 3300031251 Ga0265327_10235397 Ga0265327_102353971 196
1343 3300031456 Ga0307513_10035906 Ga0307513_100359063 196
1344 3300031456 Ga0307513_10074827 Ga0307513_100748273 196
1345 3300031456 Ga0307513_10225954 Ga0307513_102259542 196
1346 3300031456 Ga0307513_10236821 Ga0307513_102368212 196
1347 3300031507 Ga0307509_10262921 Ga0307509_102629212 196
1348 3300031595 Ga0265313_10015704 Ga0265313_100157045 196
1349 3300031616 Ga0307508_10000111 Ga0307508_1000011135 196
1350 3300031616 Ga0307508_10035501 Ga0307508_100355013 196
1351 3300031730 Ga0307516_10134390 Ga0307516_101343902 196
1352 3300032002 Ga0307416_100682625 Ga0307416_1006826251 196
1353 3300032004 Ga0307414_11077908 Ga0307414_110779081 196
1354 3300035120 Ga0373957_0256809 Ga0373957_0256809_30_623 196
1355 3300035170 Ga0373943_0055211 Ga0373943_0055211_493_1086 196
1356 3300035171 Ga0373946_0102333 Ga0373946_0102333_574_1167 196
1357 3300035171 Ga0373946_0153596 Ga0373946_0153596_330_923 196
1358 3300035410 Ga0373924_0019466 Ga0373924_0019466_810_1403 196
1359 3300035692 Ga0373935_0164141 Ga0373935_0164141_388_981 196
1360 3300035692 Ga0373935_0280593 Ga0373935_0280593_554_1144 196
1361 3300035724 Ga0373933_0018459 Ga0373933_0018459_2969_3562 196
1362 3300035725 Ga0373947_0280338 Ga0373947_0280338_302_895 196
1363 3300036401 Ga0373937_0042138 Ga0373937_0042138_1687_2277 196
1364 3300036401 Ga0373937_0046915 Ga0373937_0046915_1476_2066 196
1365 3300036401 Ga0373937_0395816 Ga0373937_0395816_22_615 196
1366 3300036401 Ga0373937_0554403 Ga0373937_0554403_262_852 196
1367 3300037068 Ga0373925_0112422 Ga0373925_0112422_228_821 196
1368 3300039437 Ga0436365_1428787 Ga0436365_1428787_259_849 196
1369 3300041404 Ga0439436_0000372 Ga0439436_0000372_3394_3987 196
1370 3300041406 Ga0439439_0000478 Ga0439439_0000478_2159_2752 196
1371 3300041453 Ga0451797_1009180 Ga0451797_1009180_38_631 196
1372 3300041460 Ga0451802_1934870 Ga0451802_1934870_548_1141 196
1373 3300041486 Ga0451807_2257105 Ga0451807_2257105_98_691 196
1374 3300041491 Ga0451833_1492660 Ga0451833_1492660_52_645 196
1375 3300041494 Ga0451837_1728540 Ga0451837_1728540_364_957 196
1376 3300041512 Ga0451853_1906516 Ga0451853_1906516_297_890 196
1377 3300041997 Ga0439431_0005168 Ga0439431_0005168_787_1380 196
1378 3300042002 Ga0439442_004892 Ga0439442_004892_623_1216 196
1379 3300042004 Ga0439445_0015475 Ga0439445_0015475_1171_1764 196
1380 3300042007 Ga0439449_0017143 Ga0439449_0017143_1022_1615 196
1381 3300042007 Ga0439449_0111914 Ga0439449_0111914_369_962 196
1382 3300042014 Ga0439457_000079 Ga0439457_000079_11362_11955 196
1383 3300042015 Ga0439462_0066515 Ga0439462_0066515_289_882 196
1384 3300042435 Ga0439434_0072370 Ga0439434_0072370_412_1005 196
1385 3300042437 Ga0439444_0040570 Ga0439444_0040570_80_673 196
1386 3300042876 Ga0451577_0028037 Ga0451577_0028037_628_1224 196
1387 3300042876 Ga0451577_0056755 Ga0451577_0056755_1132_1725 196
1388 3300044656 Ga0466969_0017220 Ga0466969_0017220_2247_2840 196
1389 3300044658 Ga0466972_0000080 Ga0466972_0000080_3732_4325 196
1390 3300044658 Ga0466972_0036207 Ga0466972_0036207_479_1072 196
1391 3300044658 Ga0466972_0182716 Ga0466972_0182716_111_704 196
1392 3300044684 Ga0466966_0000096 Ga0466966_0000096_15522_16115 196
1393 3300044693 Ga0466961_0042205 Ga0466961_0042205_1445_2038 196
1394 3300044706 Ga0466964_0086320 Ga0466964_0086320_103_696 196
1395 3300044712 Ga0453684_0114590 Ga0453684_0114590_1220_1813 196
1396 3300044712 Ga0453684_0655220 Ga0453684_0655220_214_810 196
1397 3300044735 Ga0466968_0097385 Ga0466968_0097385_26_616 196
1398 3300044735 Ga0466968_0121709 Ga0466968_0121709_113_706 196
1399 3300044765 Ga0466970_0003085 Ga0466970_0003085_2989_3579 196
1400 3300044765 Ga0466970_0277576 Ga0466970_0277576_102_695 196
1401 3300044842 Ga0466957_0002754 Ga0466957_0002754_5901_6494 196
1402 3300044842 Ga0466957_0050097 Ga0466957_0050097_1413_2006 196
1403 3300044901 Ga0466960_0110459 Ga0466960_0110459_252_845 196
1404 3300045049 Ga0466959_0000014 Ga0466959_0000014_19720_20313 196
1405 3300045051 Ga0451576_0667996 Ga0451576_0667996_298_891 196
1406 3300046454 Ga0495592_0162911 Ga0495592_0162911_603_1196 196
1407 3300046460 Ga0495638_0182403 Ga0495638_0182403_584_1177 196
1408 3300046462 Ga0495651_0366710 Ga0495651_0366710_70_660 196
1409 3300046463 Ga0495653_0096922 Ga0495653_0096922_1019_1612 196
1410 3300046472 Ga0495580_0107068 Ga0495580_0107068_460_1053 196
1411 3300046473 Ga0495582_0040506 Ga0495582_0040506_1443_2033 196
1412 3300046473 Ga0495582_0122516 Ga0495582_0122516_843_1436 196
1413 3300046511 Ga0495608_0035015 Ga0495608_0035015_668_1261 196
1414 3300046514 Ga0495618_0016822 Ga0495618_0016822_3356_3949 196
1415 3300046516 Ga0495628_0032692 Ga0495628_0032692_2878_3471 196
1416 3300046517 Ga0495630_0015882 Ga0495630_0015882_2208_2801 196
1417 3300046517 Ga0495630_0082016 Ga0495630_0082016_716_1306 196
1418 3300046517 Ga0495630_0377092 Ga0495630_0377092_407_997 196
1419 3300046535 Ga0495586_0175148 Ga0495586_0175148_415_1008 196
1420 3300046536 Ga0495587_0165009 Ga0495587_0165009_353_943 196
1421 3300046558 Ga0495633_0055039 Ga0495633_0055039_312_902 196
1422 3300046559 Ga0495667_0225366 Ga0495667_0225366_13_603 196
1423 3300046616 Ga0495668_0097292 Ga0495668_0097292_234_827 196
1424 3300046616 Ga0495668_0332085 Ga0495668_0332085_93_686 196
1425 3300046642 Ga0495634_0089355 Ga0495634_0089355_167_760 196
1426 3300046663 Ga0495635_0108803 Ga0495635_0108803_98_691 196
1427 3300046663 Ga0495635_0121894 Ga0495635_0121894_79_675 196
1428 3300046675 Ga0495657_0185221 Ga0495657_0185221_478_1071 196
1429 3300046678 Ga0495599_0106619 Ga0495599_0106619_369_962 196
1430 3300046681 Ga0495647_0016078 Ga0495647_0016078_1798_2388 196
1431 3300046689 Ga0495613_0055863 Ga0495613_0055863_296_889 196
1432 3300046690 Ga0495624_0145290 Ga0495624_0145290_242_832 196
1433 3300046694 Ga0495649_0257556 Ga0495649_0257556_229_819 196
1434 3300046809 Ga0495600_0139636 Ga0495600_0139636_668_1258 196
1435 3300047317 Ga0495604_0376077 Ga0495604_0376077_147_737 196
1436 3300047319 Ga0495674_0295972 Ga0495674_0295972_352_942 196
1437 3300047320 Ga0495672_0094785 Ga0495672_0094785_185_775 196
1438 3300047322 Ga0495680_0106125 Ga0495680_0106125_389_982 196
1439 3300047444 Ga0495675_0120776 Ga0495675_0120776_673_1266 196
1440 3300047471 Ga0495684_0025148 Ga0495684_0025148_216_809 196
1441 3300048904 Ga0496101_1012481 Ga0496101_1012481_22_615 196
1442 3300048907 Ga0496104_0559961 Ga0496104_0559961_395_985 196
1443 3300048907 Ga0496104_0930327 Ga0496104_0930327_104_694 196
1444 3300048908 Ga0496105_0252689 Ga0496105_0252689_824_1414 196
1445 3300048910 Ga0496107_0292228 Ga0496107_0292228_228_818 196
1446 3300048912 Ga0496109_0758194 Ga0496109_0758194_301_894 196
1447 3300048916 Ga0496113_0189880 Ga0496113_0189880_239_832 196
1448 3300048918 Ga0496115_0886380 Ga0496115_0886380_51_641 196
1449 3300049569 Ga0501032_0260275 Ga0501032_0260275_406_999 196
1450 3300049570 Ga0501033_0376671 Ga0501033_0376671_386_979 196
1451 3300049570 Ga0501033_0641110 Ga0501033_0641110_35_628 196
1452 3300049571 Ga0501034_0066290 Ga0501034_0066290_1940_2530 196
1453 3300049571 Ga0501034_0119453 Ga0501034_0119453_674_1267 196
1454 3300049572 Ga0501036_0237401 Ga0501036_0237401_143_736 196
1455 3300049579 Ga0501043_0032076 Ga0501043_0032076_1227_1820 196
1456 3300049579 Ga0501043_0177536 Ga0501043_0177536_383_973 196
1457 3300049580 Ga0501046_0036697 Ga0501046_0036697_2655_3245 196
1458 3300049581 Ga0501047_0299797 Ga0501047_0299797_650_1243 196
1459 3300049582 Ga0501048_0067589 Ga0501048_0067589_876_1466 196
1460 3300049583 Ga0501067_0019596 Ga0501067_0019596_675_1265 196
1461 3300049587 Ga0501071_0031907 Ga0501071_0031907_1479_2069 196
1462 3300049590 Ga0501074_0070946 Ga0501074_0070946_20_610 196
1463 3300049705 Ga0501225_0000262 Ga0501225_0000262_12203_12796 196
1464 3300049741 Ga0501079_0101168 Ga0501079_0101168_1340_1930 196
1465 3300049742 Ga0501080_0074092 Ga0501080_0074092_783_1373 196
1466 3300049743 Ga0501081_0287945 Ga0501081_0287945_471_1061 196
1467 3300049823 Ga0501044_0054728 Ga0501044_0054728_1106_1696 196
1468 3300049823 Ga0501044_0346107 Ga0501044_0346107_254_847 196
1469 3300050493 nmdc:mga0k408_9259_c1 nmdc:mga0k408_9259_c1_3558_4151 196
1470 3300050508 nmdc:mga09592_223729_c1 nmdc:mga09592_223729_c1_419_1012 196
1471 3300050508 nmdc:mga09592_40106_c1 nmdc:mga09592_40106_c1_1879_2472 196
1472 3300050508 nmdc:mga09592_490921_c1 nmdc:mga09592_490921_c1_280_873 196
1473 3300050509 nmdc:mga0qj67_96858_c1 nmdc:mga0qj67_96858_c1_1623_2216 196
1474 3300050510 nmdc:mga06r32_529343_c1 nmdc:mga06r32_529343_c1_120_713 196
1475 3300050511 nmdc:mga08y16_1038383_c1 nmdc:mga08y16_1038383_c1_43_633 196
1476 3300050511 nmdc:mga08y16_116284_c1 nmdc:mga08y16_116284_c1_1876_2472 196
1477 3300053085 Ga0495619_0036042 Ga0495619_0036042_1538_2128 196
1478 3300053085 Ga0495619_0114423 Ga0495619_0114423_1195_1788 196
1479 3300053086 Ga0500578_0000325 Ga0500578_0000325_51001_51594 196
1480 3300053090 Ga0500646_0009752 Ga0500646_0009752_1292_1885 196
1481 3300053090 Ga0500646_0019574 Ga0500646_0019574_656_1249 196
1482 3300053090 Ga0500646_0051234 Ga0500646_0051234_129_722 196
1483 3300053092 Ga0500583_0000001 Ga0500583_0000001_8555_9148 196
1484 3300053092 Ga0500583_0001322 Ga0500583_0001322_4938_5531 196
1485 3300053093 Ga0500651_0261243 Ga0500651_0261243_85_678 196
1486 3300053098 Ga0500650_0117937 Ga0500650_0117937_92_685 196
1487 3300053108 Ga0500562_000070 Ga0500562_000070_25078_25668 196
1488 3300053118 Ga0500594_0035308 Ga0500594_0035308_71_664 196
1489 3300053139 Ga0500568_0000380 Ga0500568_0000380_28685_29287 196
1490 3300053151 Ga0500604_0001178 Ga0500604_0001178_3728_4321 196
1491 3300053151 Ga0500604_0061301 Ga0500604_0061301_198_791 196
1492 3300053153 Ga0500616_0067871 Ga0500616_0067871_732_1322 196
1493 3300053177 Ga0500636_0308496 Ga0500636_0308496_104_697 196
1494 3300053727 Ga0500611_004824 Ga0500611_004824_620_1213 196
1495 3300054114 Ga0501084_0134229 Ga0501084_0134229_787_1377 196
1496 3300059605 Ga0587106_024026 Ga0587106_024026_29_622 196
1497 3300059624 Ga0587109_011159 Ga0587109_011159_832_1425 196
1498 3300059647 Ga0587079_057938 Ga0587079_057938_216_806 196
1499 3300061719 Ga0466962_0171049 Ga0466962_0171049_344_937 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11821

ActD

Alternative complex III, ActD subunit

5

162

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_D cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.761 4 168
6loe-assembly1.cif.gz_D cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.7235 4 168
6f0k-assembly1.cif.gz_D alternative complex iii 0.6915 6 168
6btm-assembly1.cif.gz_D structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.691 4 169
7n2c-assembly1.cif.gz_EF elongating 70s ribosome complex in a fusidic acid-stalled intermediate state of translocation bound to ef-g(gdp) (int2) 0.6796 3 36
ID Description Score Start End Superfamily
af_Q5AEB7_1_155_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7377 54 121 1.20.1250.20
af_Q54UH8_328_406_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.6657 1 170 3.30.70.260
5ypwH00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.6578 4 170 3.30.70.260
af_Q9VY55_68_192_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6345 3 175 3.30.70.120
4d3hC01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.629 5 48 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A537KIM8-F1-model_v4 DUF3341 domain-containing protein 0.8133 101 188 GO:0016020
AF-A0A1I0PUT5-F1-model_v4 Quinol:cytochrome c oxidoreductase membrane protein 0.7994 1 186 GO:0016020
AF-A0A136ND17-F1-model_v4 Quinol:cytochrome C oxidoreductase 0.7961 1 187 GO:0016020
AF-A0A3C1CD72-F1-model_v4 DUF3341 domain-containing protein 0.7911 1 185 GO:0016020
AF-A0A5J5IPR9-F1-model_v4 DUF3341 domain-containing protein 0.7852 4 195 GO:0016020

Feature Viewer

pLDDT pTM Quality
78.8 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map