F494401
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1500 | 590 | 3000 | 281 |
Family's Representative Sequence
| Representative Sequence | 3300013308|Ga0157375_10462182|Ga0157375_104621822 |
| Length | 319 |
| Sequence | MTAVVDTAAALTATKADGVRTPWSEFWRKFKKQRVALAAGLFVVLLIVVALAAPWIVPYDAENYFDYDKLNARPSWQHWFGVDALGRDIFSRILMGTRISLAAGFVSVARIVMRICDVLFAFPGILLAIGIVAILGGGMTNVVVAVGWDRIIMRIADVLFAFPGILLAIGIVAILGGGMANVIVAVAVFSIPTFARLVRGNTLALKHLTFIEAARSLGAADRTIIFRHIFPGTIAAVVVYFSLRIGTSIITAASLSFLGMGAQPPTPEWGAMLDAARSDMLTAPHEAIFPALAILLTVLAFNLLGDGLRDALDPKIERR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 18 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 19 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 39 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 41 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 97 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 99 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 100 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 101 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 103 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 104 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 105 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 106 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 107 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 108 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 109 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 110 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 111 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 112 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 113 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 114 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 115 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 116 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 117 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 118 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 119 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 121 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 122 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 124 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 125 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 130 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 131 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 132 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 158 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 162 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 163 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 164 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 165 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 169 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 182 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 183 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 186 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 199 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 272 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 276 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 282 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 283 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 284 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 285 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 286 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 287 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 288 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 289 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 290 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 291 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 292 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 293 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 294 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 295 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 296 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 297 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 298 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 299 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 300 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 301 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 302 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 303 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 304 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 305 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 306 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 307 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 308 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 309 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 310 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 311 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 312 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 313 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 314 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 315 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 316 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 317 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 318 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 319 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 320 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 321 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 322 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 323 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 324 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 325 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 326 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 327 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 328 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 329 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 330 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 331 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 332 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 333 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 334 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 335 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 336 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 337 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 338 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 339 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 340 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 341 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 342 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 343 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 344 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 345 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 346 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 347 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 348 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 349 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 350 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 351 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 352 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 428 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 429 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 430 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 431 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 432 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 433 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 434 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 436 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 437 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 438 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 439 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 440 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 441 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 442 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 443 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 444 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 445 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 446 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 447 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 448 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 449 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 450 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 451 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 452 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 461 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 462 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 463 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 464 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 465 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 466 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 467 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 474 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 476 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 477 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 478 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 479 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 480 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 481 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 482 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 483 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 484 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 485 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 486 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 487 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 488 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 489 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 490 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 491 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 492 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 493 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 494 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 495 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 496 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 497 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 498 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 499 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 500 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 501 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 502 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 503 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 504 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 505 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 506 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 507 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 508 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 509 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 510 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 511 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 512 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 513 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 514 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 515 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 516 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 517 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 518 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 519 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 520 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 521 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 522 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 523 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 524 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 525 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 526 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 527 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 528 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 529 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 530 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 531 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 532 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 533 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 534 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 535 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 536 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 537 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 538 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 539 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 540 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 541 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 542 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 543 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 544 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 545 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 546 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 547 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 548 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 549 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 550 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 551 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 552 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 553 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 554 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 555 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 556 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 557 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 558 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 559 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 560 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 561 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 562 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 563 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 564 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 565 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 566 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 567 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 568 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 569 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 570 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 571 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 572 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 573 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 574 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 575 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 576 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 577 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 578 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 579 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 580 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 581 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 582 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 583 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 584 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 585 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 586 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 587 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 588 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 589 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 590 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.27 |
| Metatranscriptomes | 0.27 |
| Isolates | 6.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.13 |
| Bulb | 0 |
| Endosphere | 16.33 |
| Nodule | 0.8 |
| Rhizoplane | 2.2 |
| Rhizosphere | 70.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157375_10462182 | 3300013308 | Bacteria | 1435 |
| 2 | JGI24741J21665_1001323 | 3300001915 | Bacteria | 7247 |
| 3 | JGI24740J21852_10000707 | 3300001979 | Bacteria | 14462 |
| 4 | JGI24740J21852_10001478 | 3300001979 | Bacteria | 10792 |
| 5 | JGI24740J21852_10009017 | 3300001979 | Bacteria | 3932 |
| 6 | JGI24739J22299_10003562 | 3300001989 | Bacteria | 5951 |
| 7 | JGI24739J22299_10028661 | 3300001989 | Bacteria | 1941 |
| 8 | JGI25155J39150_1000009 | 3300002704 | Bacteria | 224358 |
| 9 | JGI25156J39149_1000009 | 3300002705 | Bacteria | 224379 |
| 10 | JGI25156J39149_1001288 | 3300002705 | Bacteria | 10886 |
| 11 | JGI25156J39149_1002086 | 3300002705 | Bacteria | 7574 |
| 12 | JGI25156J39149_1002833 | 3300002705 | Bacteria | 5965 |
| 13 | JGI25156J39149_1013563 | 3300002705 | Bacteria | 1723 |
| 14 | JGI25162J39368_1000040 | 3300002737 | Bacteria | 175938 |
| 15 | JGI25154J39366_1000024 | 3300002738 | Bacteria | 211372 |
| 16 | JGI25154J39366_1000362 | 3300002738 | Bacteria | 25735 |
| 17 | JGI25157J39369_1000007 | 3300002741 | Bacteria | 224377 |
| 18 | JGI25152J39213_1002358 | 3300002773 | Bacteria | 7248 |
| 19 | JGI25150J39212_1008224 | 3300002774 | Bacteria | 2052 |
| 20 | JGI25150J39212_1010444 | 3300002774 | Bacteria | 1726 |
| 21 | JGI25159J45721_1009054 | 3300002987 | Bacteria | 2666 |
| 22 | JGI25159J45721_1013251 | 3300002987 | Bacteria | 1918 |
| 23 | JGI25151J46595_10037152 | 3300003187 | Bacteria | 1829 |
| 24 | JGI25165J46597_1000051 | 3300003214 | Bacteria | 241012 |
| 25 | JGI25165J46597_1001429 | 3300003214 | Bacteria | 12836 |
| 26 | JGI25153J46596_10003022 | 3300003215 | Bacteria | 9518 |
| 27 | JGI25153J46596_10004243 | 3300003215 | Bacteria | 7756 |
| 28 | JGI25160J50197_1000240 | 3300003354 | Bacteria | 42558 |
| 29 | JGI25161J50226_1000009 | 3300003374 | Bacteria | 224699 |
| 30 | JGI25161J50226_1002517 | 3300003374 | Bacteria | 4650 |
| 31 | JGI25161J50226_1005364 | 3300003374 | Bacteria | 2496 |
| 32 | Ga0006562J51391_1103912 | 3300003578 | Bacteria | 1640 |
| 33 | Ga0006562J51391_1112229 | 3300003578 | Bacteria | 1397 |
| 34 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 35 | Ga0055538_1000025 | 3300003751 | Bacteria | 241012 |
| 36 | Ga0055538_1002535 | 3300003751 | Bacteria | 2633 |
| 37 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 38 | Ga0055539_1000032 | 3300003752 | Bacteria | 241012 |
| 39 | Ga0055539_1000100 | 3300003752 | Bacteria | 100406 |
| 40 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 41 | Ga0055533_1000042 | 3300003756 | Bacteria | 241012 |
| 42 | Ga0055533_1000257 | 3300003756 | Bacteria | 31683 |
| 43 | Ga0055532_1000012 | 3300003758 | Bacteria | 382698 |
| 44 | Ga0055532_1000029 | 3300003758 | Bacteria | 232900 |
| 45 | Ga0055532_1001367 | 3300003758 | Bacteria | 6928 |
| 46 | Ga0055532_1002326 | 3300003758 | Bacteria | 4035 |
| 47 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 48 | Ga0055525_1000050 | 3300003759 | Bacteria | 241012 |
| 49 | Ga0055525_1000444 | 3300003759 | Bacteria | 23721 |
| 50 | Ga0055525_1000505 | 3300003759 | Bacteria | 19389 |
| 51 | Ga0055527_1000011 | 3300003760 | Bacteria | 354560 |
| 52 | Ga0055535_1000009 | 3300003761 | Bacteria | 382698 |
| 53 | Ga0055535_1000093 | 3300003761 | Bacteria | 97771 |
| 54 | Ga0055535_1000689 | 3300003761 | Bacteria | 26039 |
| 55 | Ga0055542_1000015 | 3300003762 | Bacteria | 382698 |
| 56 | Ga0055542_1000039 | 3300003762 | Bacteria | 215126 |
| 57 | Ga0055542_1000106 | 3300003762 | Bacteria | 112713 |
| 58 | Ga0055542_1001376 | 3300003762 | Bacteria | 12374 |
| 59 | Ga0055529_1000011 | 3300003763 | Bacteria | 382698 |
| 60 | Ga0055529_1000124 | 3300003763 | Bacteria | 112731 |
| 61 | Ga0055529_1000376 | 3300003763 | Bacteria | 48166 |
| 62 | Ga0055526_1003692 | 3300003771 | Bacteria | 9574 |
| 63 | Ga0055526_1009131 | 3300003771 | Bacteria | 4825 |
| 64 | Ga0055526_1009501 | 3300003771 | Bacteria | 4664 |
| 65 | Ga0055537_1000020 | 3300003773 | Bacteria | 117325 |
| 66 | Ga0055537_1000491 | 3300003773 | Bacteria | 24128 |
| 67 | Ga0055537_1019921 | 3300003773 | Bacteria | 1031 |
| 68 | Ga0055524_1000047 | 3300003775 | Bacteria | 150887 |
| 69 | Ga0055524_1015136 | 3300003775 | Bacteria | 2824 |
| 70 | Ga0055536_1002265 | 3300003781 | Bacteria | 10933 |
| 71 | Ga0055536_1004266 | 3300003781 | Bacteria | 7375 |
| 72 | Ga0055536_1005338 | 3300003781 | Bacteria | 6308 |
| 73 | Ga0055536_1018976 | 3300003781 | Bacteria | 2180 |
| 74 | Ga0055536_1024865 | 3300003781 | Bacteria | 1723 |
| 75 | Ga0055536_1034695 | 3300003781 | Bacteria | 1270 |
| 76 | Ga0055534_1000450 | 3300003784 | Bacteria | 24128 |
| 77 | Ga0055534_1000633 | 3300003784 | Bacteria | 17962 |
| 78 | Ga0055534_1011996 | 3300003784 | Bacteria | 1736 |
| 79 | Ga0055528_1000934 | 3300003790 | Bacteria | 19533 |
| 80 | Ga0055528_1000973 | 3300003790 | Bacteria | 19015 |
| 81 | Ga0055528_1013206 | 3300003790 | Bacteria | 3148 |
| 82 | Ga0055530_10002364 | 3300003791 | Bacteria | 12244 |
| 83 | Ga0055530_10003258 | 3300003791 | Bacteria | 9458 |
| 84 | Ga0055540_1000027 | 3300003792 | Bacteria | 187454 |
| 85 | Ga0055540_1002734 | 3300003792 | Bacteria | 9068 |
| 86 | Ga0055540_1007848 | 3300003792 | Bacteria | 3948 |
| 87 | Ga0055540_1032478 | 3300003792 | Bacteria | 1191 |
| 88 | Ga0055531_10001909 | 3300003794 | Bacteria | 14594 |
| 89 | Ga0055541_1000023 | 3300003841 | Bacteria | 241012 |
| 90 | Ga0055541_1000043 | 3300003841 | Bacteria | 161703 |
| 91 | Ga0055541_1008584 | 3300003841 | Bacteria | 1620 |
| 92 | Ga0058692_1000297 | 3300003856 | Bacteria | 25557 |
| 93 | Ga0055543_1000199 | 3300004625 | Bacteria | 49097 |
| 94 | Ga0055543_1002895 | 3300004625 | Bacteria | 5390 |
| 95 | Ga0055543_1012484 | 3300004625 | Bacteria | 1706 |
| 96 | Ga0065165_1001969 | 3300005262 | Bacteria | 19408 |
| 97 | Ga0065704_10012722 | 3300005289 | Bacteria | 1825 |
| 98 | Ga0065715_10019317 | 3300005293 | Bacteria | 3103 |
| 99 | Ga0065715_10174718 | 3300005293 | Bacteria | 1520 |
| 100 | Ga0070658_10025574 | 3300005327 | Bacteria | 4732 |
| 101 | Ga0070658_10035798 | 3300005327 | Bacteria | 3999 |
| 102 | Ga0070658_10245085 | 3300005327 | Bacteria | 1520 |
| 103 | Ga0070676_10002706 | 3300005328 | Bacteria | 9136 |
| 104 | Ga0070676_10145652 | 3300005328 | Bacteria | 1512 |
| 105 | Ga0070676_10157451 | 3300005328 | Bacteria | 1459 |
| 106 | Ga0070683_100029745 | 3300005329 | Bacteria | 4949 |
| 107 | Ga0070683_100307344 | 3300005329 | Bacteria | 1508 |
| 108 | Ga0070683_100345721 | 3300005329 | Bacteria | 1416 |
| 109 | Ga0070683_100517215 | 3300005329 | Bacteria | 1140 |
| 110 | Ga0070690_100048399 | 3300005330 | Bacteria | 2707 |
| 111 | Ga0070670_100014778 | 3300005331 | Bacteria | 6700 |
| 112 | Ga0070670_100134363 | 3300005331 | Bacteria | 2137 |
| 113 | Ga0070677_10004255 | 3300005333 | Bacteria | 4660 |
| 114 | Ga0068869_100007462 | 3300005334 | Bacteria | 6993 |
| 115 | Ga0070680_100030518 | 3300005336 | Bacteria | 4330 |
| 116 | Ga0070680_100057278 | 3300005336 | Bacteria | 3186 |
| 117 | Ga0070680_100092804 | 3300005336 | Bacteria | 2500 |
| 118 | Ga0070682_100041859 | 3300005337 | Bacteria | 2825 |
| 119 | Ga0070682_100073205 | 3300005337 | Bacteria | 2197 |
| 120 | Ga0070682_100329487 | 3300005337 | Bacteria | 1131 |
| 121 | Ga0068868_100010083 | 3300005338 | Bacteria | 6825 |
| 122 | Ga0068868_100024239 | 3300005338 | Bacteria | 4602 |
| 123 | Ga0068868_100063202 | 3300005338 | Bacteria | 2937 |
| 124 | Ga0068868_100069739 | 3300005338 | Bacteria | 2802 |
| 125 | Ga0068868_100121194 | 3300005338 | Bacteria | 2133 |
| 126 | Ga0068868_100363261 | 3300005338 | Bacteria | 1242 |
| 127 | Ga0070660_100000161 | 3300005339 | Bacteria | 43884 |
| 128 | Ga0070660_100056004 | 3300005339 | Bacteria | 3049 |
| 129 | Ga0070660_100128362 | 3300005339 | Bacteria | 2027 |
| 130 | Ga0070660_100259956 | 3300005339 | Bacteria | 1417 |
| 131 | Ga0070689_100250730 | 3300005340 | Bacteria | 1460 |
| 132 | Ga0070687_100038283 | 3300005343 | Bacteria | 2403 |
| 133 | Ga0070687_100181501 | 3300005343 | Bacteria | 1261 |
| 134 | Ga0070661_100000057 | 3300005344 | Bacteria | 87637 |
| 135 | Ga0070661_100002317 | 3300005344 | Bacteria | 13077 |
| 136 | Ga0070661_100017237 | 3300005344 | Bacteria | 5121 |
| 137 | Ga0070661_100135331 | 3300005344 | Bacteria | 1854 |
| 138 | Ga0070692_10003401 | 3300005345 | Bacteria | 6451 |
| 139 | Ga0070692_10009557 | 3300005345 | Bacteria | 4376 |
| 140 | Ga0070668_100007630 | 3300005347 | Bacteria | 8029 |
| 141 | Ga0070668_100051229 | 3300005347 | Bacteria | 3180 |
| 142 | Ga0070668_100153842 | 3300005347 | Bacteria | 1862 |
| 143 | Ga0070669_100130830 | 3300005353 | Bacteria | 1925 |
| 144 | Ga0070675_100004084 | 3300005354 | Bacteria | 11084 |
| 145 | Ga0070671_100002197 | 3300005355 | Bacteria | 15066 |
| 146 | Ga0070671_100052121 | 3300005355 | Bacteria | 3403 |
| 147 | Ga0070671_100065336 | 3300005355 | Bacteria | 3030 |
| 148 | Ga0070671_100122510 | 3300005355 | Bacteria | 2188 |
| 149 | Ga0070671_100130067 | 3300005355 | Bacteria | 2120 |
| 150 | Ga0070674_100028680 | 3300005356 | Bacteria | 3657 |
| 151 | Ga0070674_100040580 | 3300005356 | Bacteria | 3149 |
| 152 | Ga0070673_100001432 | 3300005364 | Bacteria | 13947 |
| 153 | Ga0070673_100009049 | 3300005364 | Bacteria | 6665 |
| 154 | Ga0070673_100156678 | 3300005364 | Bacteria | 1933 |
| 155 | Ga0070673_100194814 | 3300005364 | Bacteria | 1742 |
| 156 | Ga0070673_100436178 | 3300005364 | Bacteria | 1176 |
| 157 | Ga0070688_100026504 | 3300005365 | Bacteria | 3444 |
| 158 | Ga0070659_100000510 | 3300005366 | Bacteria | 28529 |
| 159 | Ga0070659_100001591 | 3300005366 | Bacteria | 16357 |
| 160 | Ga0070659_100008091 | 3300005366 | Bacteria | 7668 |
| 161 | Ga0070659_100063640 | 3300005366 | Bacteria | 2918 |
| 162 | Ga0070659_100097024 | 3300005366 | Bacteria | 2368 |
| 163 | Ga0070667_100220317 | 3300005367 | Bacteria | 1689 |
| 164 | Ga0070667_100232366 | 3300005367 | Bacteria | 1645 |
| 165 | Ga0070667_100257670 | 3300005367 | Bacteria | 1561 |
| 166 | Ga0070667_100446390 | 3300005367 | Bacteria | 1182 |
| 167 | Ga0070709_10014488 | 3300005434 | Bacteria | 4460 |
| 168 | Ga0070709_10035545 | 3300005434 | Bacteria | 3028 |
| 169 | Ga0070709_10169964 | 3300005434 | Bacteria | 1523 |
| 170 | Ga0070714_100007945 | 3300005435 | Bacteria | 8265 |
| 171 | Ga0070714_100014020 | 3300005435 | Bacteria | 6430 |
| 172 | Ga0070714_100035131 | 3300005435 | Bacteria | 4199 |
| 173 | Ga0070714_100036382 | 3300005435 | Bacteria | 4129 |
| 174 | Ga0070713_100000032 | 3300005436 | Bacteria | 86800 |
| 175 | Ga0070713_100006613 | 3300005436 | Bacteria | 8058 |
| 176 | Ga0070713_100015987 | 3300005436 | Bacteria | 5632 |
| 177 | Ga0070713_100032725 | 3300005436 | Bacteria | 4157 |
| 178 | Ga0070713_100157445 | 3300005436 | Bacteria | 2025 |
| 179 | Ga0070711_100019144 | 3300005439 | Bacteria | 4386 |
| 180 | Ga0070711_100134686 | 3300005439 | Bacteria | 1845 |
| 181 | Ga0070711_100136673 | 3300005439 | Bacteria | 1833 |
| 182 | Ga0070705_100083040 | 3300005440 | Bacteria | 1973 |
| 183 | Ga0070700_100002762 | 3300005441 | Bacteria | 8974 |
| 184 | Ga0070694_100024359 | 3300005444 | Bacteria | 3907 |
| 185 | Ga0070708_100120354 | 3300005445 | Bacteria | 2422 |
| 186 | Ga0070663_100000105 | 3300005455 | Bacteria | 38796 |
| 187 | Ga0070663_100004364 | 3300005455 | Bacteria | 8298 |
| 188 | Ga0070663_100058982 | 3300005455 | Bacteria | 2758 |
| 189 | Ga0070663_100095971 | 3300005455 | Bacteria | 2205 |
| 190 | Ga0070678_100001542 | 3300005456 | Bacteria | 12321 |
| 191 | Ga0070678_100037327 | 3300005456 | Bacteria | 3411 |
| 192 | Ga0070678_100164074 | 3300005456 | Bacteria | 1803 |
| 193 | Ga0070662_100000149 | 3300005457 | Bacteria | 39863 |
| 194 | Ga0070662_100035491 | 3300005457 | Bacteria | 3522 |
| 195 | Ga0070662_100049985 | 3300005457 | Bacteria | 3016 |
| 196 | Ga0070662_100050379 | 3300005457 | Bacteria | 3004 |
| 197 | Ga0070662_100184225 | 3300005457 | Bacteria | 1648 |
| 198 | Ga0070662_100305005 | 3300005457 | Bacteria | 1294 |
| 199 | Ga0070681_10000229 | 3300005458 | Bacteria | 44150 |
| 200 | Ga0070681_10001327 | 3300005458 | Bacteria | 21605 |
| 201 | Ga0070681_10048539 | 3300005458 | Bacteria | 4242 |
| 202 | Ga0070681_10091627 | 3300005458 | Bacteria | 2990 |
| 203 | Ga0070681_10096433 | 3300005458 | Bacteria | 2905 |
| 204 | Ga0068867_100009953 | 3300005459 | Bacteria | 6700 |
| 205 | Ga0068867_100019344 | 3300005459 | Bacteria | 4853 |
| 206 | Ga0068867_100182185 | 3300005459 | Bacteria | 1671 |
| 207 | Ga0068867_100225741 | 3300005459 | Bacteria | 1511 |
| 208 | Ga0070685_10003742 | 3300005466 | Bacteria | 7702 |
| 209 | Ga0070706_100001663 | 3300005467 | Bacteria | 23150 |
| 210 | Ga0070707_100078247 | 3300005468 | Bacteria | 3190 |
| 211 | Ga0070707_100124488 | 3300005468 | Bacteria | 2504 |
| 212 | Ga0070698_100022134 | 3300005471 | Bacteria | 6654 |
| 213 | Ga0070698_100153853 | 3300005471 | Bacteria | 2246 |
| 214 | Ga0070698_100224844 | 3300005471 | Bacteria | 1810 |
| 215 | Ga0070698_100511636 | 3300005471 | Bacteria | 1139 |
| 216 | Ga0070699_100158833 | 3300005518 | Bacteria | 2000 |
| 217 | Ga0070699_100488578 | 3300005518 | Bacteria | 1118 |
| 218 | Ga0070679_100001752 | 3300005530 | Bacteria | 19536 |
| 219 | Ga0070679_100024796 | 3300005530 | Bacteria | 5879 |
| 220 | Ga0070679_100077570 | 3300005530 | Bacteria | 3311 |
| 221 | Ga0070679_100255296 | 3300005530 | Bacteria | 1709 |
| 222 | Ga0070679_100424606 | 3300005530 | Bacteria | 1275 |
| 223 | Ga0070684_100002568 | 3300005535 | Bacteria | 13408 |
| 224 | Ga0070684_100019630 | 3300005535 | Bacteria | 5593 |
| 225 | Ga0070684_100209007 | 3300005535 | Bacteria | 1779 |
| 226 | Ga0070697_100018068 | 3300005536 | Bacteria | 5557 |
| 227 | Ga0070697_100062705 | 3300005536 | Bacteria | 3034 |
| 228 | Ga0070697_100086262 | 3300005536 | Bacteria | 2590 |
| 229 | Ga0068853_100000618 | 3300005539 | Bacteria | 24365 |
| 230 | Ga0068853_100023163 | 3300005539 | Bacteria | 5196 |
| 231 | Ga0068853_100209951 | 3300005539 | Bacteria | 1774 |
| 232 | Ga0068853_100274010 | 3300005539 | Bacteria | 1554 |
| 233 | Ga0070672_100064046 | 3300005543 | Bacteria | 2904 |
| 234 | Ga0070672_100098129 | 3300005543 | Bacteria | 2372 |
| 235 | Ga0070672_100441018 | 3300005543 | Bacteria | 1120 |
| 236 | Ga0070686_100049895 | 3300005544 | Bacteria | 2657 |
| 237 | Ga0070695_100029763 | 3300005545 | Bacteria | 3395 |
| 238 | Ga0070696_100007257 | 3300005546 | Bacteria | 7400 |
| 239 | Ga0070696_100016969 | 3300005546 | Bacteria | 4912 |
| 240 | Ga0070696_100042617 | 3300005546 | Bacteria | 3137 |
| 241 | Ga0070693_100000701 | 3300005547 | Bacteria | 14785 |
| 242 | Ga0070665_100004456 | 3300005548 | Bacteria | 14713 |
| 243 | Ga0070665_100008740 | 3300005548 | Bacteria | 10253 |
| 244 | Ga0070665_100112939 | 3300005548 | Bacteria | 2719 |
| 245 | Ga0070665_100245041 | 3300005548 | Bacteria | 1793 |
| 246 | Ga0070704_100031792 | 3300005549 | Bacteria | 3553 |
| 247 | Ga0068855_100000065 | 3300005563 | Bacteria | 129307 |
| 248 | Ga0068855_100000814 | 3300005563 | Bacteria | 38635 |
| 249 | Ga0068855_100033827 | 3300005563 | Bacteria | 6097 |
| 250 | Ga0068855_100056314 | 3300005563 | Bacteria | 4614 |
| 251 | Ga0068855_100071755 | 3300005563 | Bacteria | 4026 |
| 252 | Ga0068855_100080702 | 3300005563 | Bacteria | 3772 |
| 253 | Ga0068855_100104458 | 3300005563 | Bacteria | 3259 |
| 254 | Ga0068855_100128650 | 3300005563 | Bacteria | 2893 |
| 255 | Ga0068855_100137688 | 3300005563 | Bacteria | 2785 |
| 256 | Ga0068855_100150705 | 3300005563 | Bacteria | 2645 |
| 257 | Ga0068855_100201491 | 3300005563 | Bacteria | 2240 |
| 258 | Ga0070664_100000008 | 3300005564 | Bacteria | 173734 |
| 259 | Ga0070664_100000371 | 3300005564 | Bacteria | 33275 |
| 260 | Ga0070664_100000976 | 3300005564 | Bacteria | 22395 |
| 261 | Ga0070664_100031961 | 3300005564 | Bacteria | 4403 |
| 262 | Ga0070664_100049121 | 3300005564 | Bacteria | 3567 |
| 263 | Ga0070664_100052409 | 3300005564 | Bacteria | 3456 |
| 264 | Ga0070664_100128177 | 3300005564 | Bacteria | 2227 |
| 265 | Ga0070664_100150055 | 3300005564 | Bacteria | 2057 |
| 266 | Ga0070664_100183183 | 3300005564 | Bacteria | 1862 |
| 267 | Ga0068857_100000964 | 3300005577 | Bacteria | 21993 |
| 268 | Ga0068857_100002479 | 3300005577 | Bacteria | 15090 |
| 269 | Ga0068857_100003440 | 3300005577 | Bacteria | 13215 |
| 270 | Ga0068857_100012910 | 3300005577 | Bacteria | 7278 |
| 271 | Ga0068857_100027691 | 3300005577 | Bacteria | 4999 |
| 272 | Ga0068857_100037434 | 3300005577 | Bacteria | 4297 |
| 273 | Ga0068857_100229773 | 3300005577 | Bacteria | 1697 |
| 274 | Ga0068854_100000072 | 3300005578 | Bacteria | 72718 |
| 275 | Ga0068854_100008004 | 3300005578 | Bacteria | 6772 |
| 276 | Ga0068854_100024239 | 3300005578 | Bacteria | 4152 |
| 277 | Ga0068854_100054874 | 3300005578 | Bacteria | 2868 |
| 278 | Ga0068854_100116812 | 3300005578 | Bacteria | 2020 |
| 279 | Ga0068854_100159925 | 3300005578 | Bacteria | 1743 |
| 280 | Ga0068854_100222229 | 3300005578 | Bacteria | 1495 |
| 281 | Ga0068856_100000009 | 3300005614 | Bacteria | 181448 |
| 282 | Ga0068856_100000381 | 3300005614 | Bacteria | 48540 |
| 283 | Ga0068856_100007513 | 3300005614 | Bacteria | 10641 |
| 284 | Ga0068856_100039316 | 3300005614 | Bacteria | 4644 |
| 285 | Ga0068856_100071796 | 3300005614 | Bacteria | 3427 |
| 286 | Ga0068856_100110111 | 3300005614 | Bacteria | 2751 |
| 287 | Ga0068856_100146549 | 3300005614 | Bacteria | 2368 |
| 288 | Ga0068856_100443537 | 3300005614 | Bacteria | 1319 |
| 289 | Ga0068856_100499001 | 3300005614 | Bacteria | 1238 |
| 290 | Ga0070702_100041952 | 3300005615 | Bacteria | 2570 |
| 291 | Ga0068852_100011015 | 3300005616 | Bacteria | 6785 |
| 292 | Ga0068852_100015740 | 3300005616 | Bacteria | 5879 |
| 293 | Ga0068852_100015760 | 3300005616 | Bacteria | 5877 |
| 294 | Ga0068852_100049214 | 3300005616 | Bacteria | 3605 |
| 295 | Ga0068852_100125474 | 3300005616 | Bacteria | 2356 |
| 296 | Ga0068852_100126895 | 3300005616 | Bacteria | 2344 |
| 297 | Ga0068852_100177080 | 3300005616 | Bacteria | 2003 |
| 298 | Ga0068852_100261300 | 3300005616 | Bacteria | 1662 |
| 299 | Ga0068852_100400755 | 3300005616 | Bacteria | 1350 |
| 300 | Ga0068859_100010089 | 3300005617 | Bacteria | 9521 |
| 301 | Ga0068859_100049387 | 3300005617 | Bacteria | 4225 |
| 302 | Ga0068859_100175084 | 3300005617 | Bacteria | 2227 |
| 303 | Ga0068864_100036132 | 3300005618 | Bacteria | 4209 |
| 304 | Ga0068864_100052039 | 3300005618 | Bacteria | 3529 |
| 305 | Ga0068864_100344725 | 3300005618 | Bacteria | 1404 |
| 306 | Ga0068866_10000875 | 3300005718 | Bacteria | 13297 |
| 307 | Ga0068866_10006393 | 3300005718 | Bacteria | 4907 |
| 308 | Ga0068861_100273431 | 3300005719 | Bacteria | 1452 |
| 309 | Ga0068851_10002246 | 3300005834 | Bacteria | 8492 |
| 310 | Ga0068851_10002598 | 3300005834 | Bacteria | 7962 |
| 311 | Ga0068851_10002993 | 3300005834 | Bacteria | 7461 |
| 312 | Ga0068851_10013339 | 3300005834 | Bacteria | 3890 |
| 313 | Ga0068870_10041982 | 3300005840 | Bacteria | 2379 |
| 314 | Ga0068870_10061792 | 3300005840 | Bacteria | 2015 |
| 315 | Ga0068863_100047814 | 3300005841 | Bacteria | 4057 |
| 316 | Ga0068863_100048955 | 3300005841 | Bacteria | 4007 |
| 317 | Ga0068863_100460484 | 3300005841 | Bacteria | 1249 |
| 318 | Ga0068858_100004190 | 3300005842 | Bacteria | 14195 |
| 319 | Ga0068858_100006956 | 3300005842 | Bacteria | 10989 |
| 320 | Ga0068858_100035327 | 3300005842 | Bacteria | 4636 |
| 321 | Ga0068858_100106299 | 3300005842 | Bacteria | 2619 |
| 322 | Ga0068860_100013479 | 3300005843 | Bacteria | 8017 |
| 323 | Ga0068860_100085295 | 3300005843 | Bacteria | 3005 |
| 324 | Ga0068862_100006988 | 3300005844 | Bacteria | 9367 |
| 325 | Ga0081539_10019130 | 3300005985 | Bacteria | 4704 |
| 326 | Ga0075365_10001116 | 3300006038 | Bacteria | 11720 |
| 327 | Ga0075363_100002525 | 3300006048 | Bacteria | 7503 |
| 328 | Ga0075364_10002412 | 3300006051 | Bacteria | 10475 |
| 329 | Ga0075364_10005636 | 3300006051 | Bacteria | 7299 |
| 330 | Ga0075364_10007917 | 3300006051 | Bacteria | 6331 |
| 331 | Ga0075432_10005289 | 3300006058 | Bacteria | 4396 |
| 332 | Ga0075432_10082882 | 3300006058 | Bacteria | 1165 |
| 333 | Ga0070715_10097676 | 3300006163 | Bacteria | 1364 |
| 334 | Ga0070715_10133470 | 3300006163 | Bacteria | 1198 |
| 335 | Ga0070712_100015039 | 3300006175 | Bacteria | 4975 |
| 336 | Ga0075362_10017034 | 3300006177 | Bacteria | 2987 |
| 337 | Ga0075366_10004606 | 3300006195 | Bacteria | 7407 |
| 338 | Ga0075366_10043213 | 3300006195 | Bacteria | 2669 |
| 339 | Ga0075366_10137234 | 3300006195 | Bacteria | 1477 |
| 340 | Ga0097621_100007071 | 3300006237 | Bacteria | 7999 |
| 341 | Ga0097621_100119038 | 3300006237 | Bacteria | 2238 |
| 342 | Ga0075370_10001052 | 3300006353 | Bacteria | 11482 |
| 343 | Ga0075370_10005993 | 3300006353 | Bacteria | 6087 |
| 344 | Ga0075370_10006478 | 3300006353 | Bacteria | 5893 |
| 345 | Ga0075370_10011878 | 3300006353 | Bacteria | 4586 |
| 346 | Ga0075370_10027724 | 3300006353 | Bacteria | 3145 |
| 347 | Ga0075370_10042864 | 3300006353 | Bacteria | 2557 |
| 348 | Ga0075370_10053563 | 3300006353 | Bacteria | 2290 |
| 349 | Ga0075370_10129466 | 3300006353 | Bacteria | 1472 |
| 350 | Ga0068871_100010132 | 3300006358 | Bacteria | 6860 |
| 351 | Ga0068871_100011438 | 3300006358 | Bacteria | 6510 |
| 352 | Ga0068871_100294527 | 3300006358 | Bacteria | 1423 |
| 353 | Ga0075434_100137774 | 3300006871 | Bacteria | 2460 |
| 354 | Ga0075434_100438060 | 3300006871 | Bacteria | 1328 |
| 355 | Ga0068865_100112171 | 3300006881 | Bacteria | 2013 |
| 356 | Ga0075436_100171298 | 3300006914 | Bacteria | 1533 |
| 357 | Ga0097620_100010089 | 3300006931 | Bacteria | 9521 |
| 358 | Ga0097620_100049385 | 3300006931 | Bacteria | 4225 |
| 359 | Ga0097620_100175085 | 3300006931 | Bacteria | 2227 |
| 360 | Ga0097620_100211476 | 3300006931 | Bacteria | 2026 |
| 361 | Ga0079104_1000231 | 3300006946 | Bacteria | 75264 |
| 362 | Ga0079104_1000864 | 3300006946 | Bacteria | 25084 |
| 363 | Ga0079104_1001566 | 3300006946 | Bacteria | 14986 |
| 364 | Ga0099826_10000238 | 3300006948 | Bacteria | 24197 |
| 365 | Ga0075435_100031847 | 3300007076 | Bacteria | 4159 |
| 366 | Ga0105251_10000128 | 3300009011 | Bacteria | 75973 |
| 367 | Ga0105251_10000280 | 3300009011 | Bacteria | 51407 |
| 368 | Ga0105251_10000892 | 3300009011 | Bacteria | 26709 |
| 369 | Ga0105251_10002010 | 3300009011 | Bacteria | 16527 |
| 370 | Ga0105251_10003742 | 3300009011 | Bacteria | 10889 |
| 371 | Ga0105251_10014555 | 3300009011 | Bacteria | 4340 |
| 372 | Ga0105251_10046774 | 3300009011 | Bacteria | 2081 |
| 373 | Ga0105244_10000836 | 3300009036 | Bacteria | 26055 |
| 374 | Ga0105244_10003234 | 3300009036 | Bacteria | 11785 |
| 375 | Ga0105244_10012661 | 3300009036 | Bacteria | 4974 |
| 376 | Ga0105244_10103412 | 3300009036 | Bacteria | 1391 |
| 377 | Ga0105250_10000003 | 3300009092 | Bacteria | 547770 |
| 378 | Ga0105250_10001728 | 3300009092 | Bacteria | 11514 |
| 379 | Ga0105250_10009475 | 3300009092 | Bacteria | 4098 |
| 380 | Ga0105250_10017251 | 3300009092 | Bacteria | 2935 |
| 381 | Ga0105240_10001226 | 3300009093 | Bacteria | 44605 |
| 382 | Ga0105240_10020181 | 3300009093 | Bacteria | 8896 |
| 383 | Ga0105240_10020537 | 3300009093 | Bacteria | 8805 |
| 384 | Ga0105240_10034137 | 3300009093 | Bacteria | 6565 |
| 385 | Ga0105240_10045681 | 3300009093 | Bacteria | 5555 |
| 386 | Ga0105240_10070546 | 3300009093 | Bacteria | 4322 |
| 387 | Ga0105240_10083821 | 3300009093 | Bacteria | 3910 |
| 388 | Ga0105240_10086744 | 3300009093 | Bacteria | 3834 |
| 389 | Ga0105240_10154485 | 3300009093 | Bacteria | 2730 |
| 390 | Ga0105240_10168533 | 3300009093 | Bacteria | 2596 |
| 391 | Ga0105245_10011793 | 3300009098 | Bacteria | 7603 |
| 392 | Ga0105245_10081881 | 3300009098 | Bacteria | 2951 |
| 393 | Ga0105245_10097490 | 3300009098 | Bacteria | 2715 |
| 394 | Ga0105247_10000025 | 3300009101 | Bacteria | 208459 |
| 395 | Ga0114129_10063689 | 3300009147 | Bacteria | 5147 |
| 396 | Ga0105243_10012776 | 3300009148 | Bacteria | 6343 |
| 397 | Ga0105243_10019159 | 3300009148 | Bacteria | 5189 |
| 398 | Ga0105243_10124092 | 3300009148 | Bacteria | 2182 |
| 399 | Ga0105243_10215976 | 3300009148 | Bacteria | 1692 |
| 400 | Ga0105241_10004859 | 3300009174 | Bacteria | 9911 |
| 401 | Ga0105241_10009081 | 3300009174 | Bacteria | 7314 |
| 402 | Ga0105241_10170548 | 3300009174 | Bacteria | 1797 |
| 403 | Ga0105242_10001479 | 3300009176 | Bacteria | 18502 |
| 404 | Ga0105242_10003609 | 3300009176 | Bacteria | 12037 |
| 405 | Ga0105248_10001100 | 3300009177 | Bacteria | 29922 |
| 406 | Ga0105248_10021561 | 3300009177 | Bacteria | 7136 |
| 407 | Ga0105248_10231464 | 3300009177 | Bacteria | 2080 |
| 408 | Ga0105248_10694320 | 3300009177 | Bacteria | 1148 |
| 409 | Ga0105248_10865413 | 3300009177 | Bacteria | 1020 |
| 410 | Ga0105237_10007380 | 3300009545 | Bacteria | 12039 |
| 411 | Ga0105237_10198579 | 3300009545 | Bacteria | 2005 |
| 412 | Ga0105237_10394179 | 3300009545 | Bacteria | 1389 |
| 413 | Ga0105237_10454371 | 3300009545 | Bacteria | 1287 |
| 414 | Ga0105238_10003854 | 3300009551 | Bacteria | 14893 |
| 415 | Ga0105238_10008692 | 3300009551 | Bacteria | 10160 |
| 416 | Ga0105238_10016180 | 3300009551 | Bacteria | 7547 |
| 417 | Ga0105238_10066930 | 3300009551 | Bacteria | 3593 |
| 418 | Ga0105238_10327290 | 3300009551 | Bacteria | 1519 |
| 419 | Ga0105249_10081230 | 3300009553 | Bacteria | 3013 |
| 420 | Ga0105239_10018646 | 3300010375 | Bacteria | 7666 |
| 421 | Ga0105239_10046798 | 3300010375 | Bacteria | 4740 |
| 422 | Ga0105239_10058381 | 3300010375 | Bacteria | 4234 |
| 423 | Ga0105239_10814223 | 3300010375 | Bacteria | 1070 |
| 424 | Ga0105246_10029427 | 3300011119 | Bacteria | 3617 |
| 425 | Ga0105246_10071635 | 3300011119 | Bacteria | 2441 |
| 426 | Ga0105246_10176018 | 3300011119 | Bacteria | 1643 |
| 427 | Ga0105246_10371569 | 3300011119 | Unclassified | 1178 |
| 428 | Ga0157373_10000246 | 3300013100 | Bacteria | 44392 |
| 429 | Ga0157373_10000690 | 3300013100 | Bacteria | 26488 |
| 430 | Ga0157373_10003596 | 3300013100 | Bacteria | 11704 |
| 431 | Ga0157373_10004570 | 3300013100 | Bacteria | 10409 |
| 432 | Ga0157373_10042899 | 3300013100 | Bacteria | 3232 |
| 433 | Ga0157373_10052705 | 3300013100 | Bacteria | 2894 |
| 434 | Ga0157371_10000068 | 3300013102 | Bacteria | 168110 |
| 435 | Ga0157371_10000403 | 3300013102 | Bacteria | 54162 |
| 436 | Ga0157371_10001844 | 3300013102 | Bacteria | 21340 |
| 437 | Ga0157371_10022773 | 3300013102 | Bacteria | 4583 |
| 438 | Ga0157371_10029347 | 3300013102 | Bacteria | 3979 |
| 439 | Ga0157371_10050004 | 3300013102 | Bacteria | 2970 |
| 440 | Ga0157371_10102698 | 3300013102 | Bacteria | 2028 |
| 441 | Ga0157370_10000588 | 3300013104 | Bacteria | 45380 |
| 442 | Ga0157370_10033262 | 3300013104 | Bacteria | 5026 |
| 443 | Ga0157370_10046640 | 3300013104 | Bacteria | 4154 |
| 444 | Ga0157370_10067702 | 3300013104 | Bacteria | 3375 |
| 445 | Ga0157370_10083102 | 3300013104 | Bacteria | 3011 |
| 446 | Ga0157370_10203762 | 3300013104 | Bacteria | 1835 |
| 447 | Ga0157369_10000806 | 3300013105 | Bacteria | 40098 |
| 448 | Ga0157369_10001198 | 3300013105 | Bacteria | 32287 |
| 449 | Ga0157369_10039686 | 3300013105 | Bacteria | 5143 |
| 450 | Ga0157369_10057748 | 3300013105 | Bacteria | 4185 |
| 451 | Ga0157369_10071126 | 3300013105 | Bacteria | 3736 |
| 452 | Ga0157369_10146496 | 3300013105 | Bacteria | 2497 |
| 453 | Ga0157369_10260040 | 3300013105 | Bacteria | 1810 |
| 454 | Ga0157369_10494501 | 3300013105 | Bacteria | 1265 |
| 455 | Ga0157374_10010415 | 3300013296 | Bacteria | 7995 |
| 456 | Ga0157378_10012484 | 3300013297 | Bacteria | 7438 |
| 457 | Ga0157378_10026369 | 3300013297 | Bacteria | 5123 |
| 458 | Ga0157378_10047254 | 3300013297 | Bacteria | 3826 |
| 459 | Ga0157378_10136045 | 3300013297 | Bacteria | 2278 |
| 460 | Ga0163162_10002664 | 3300013306 | Bacteria | 16928 |
| 461 | Ga0163162_10008020 | 3300013306 | Bacteria | 10302 |
| 462 | Ga0163162_10200481 | 3300013306 | Bacteria | 2124 |
| 463 | Ga0163162_10328247 | 3300013306 | Bacteria | 1662 |
| 464 | Ga0163162_10380477 | 3300013306 | Bacteria | 1545 |
| 465 | Ga0157372_10002109 | 3300013307 | Bacteria | 21612 |
| 466 | Ga0157372_10013717 | 3300013307 | Bacteria | 8660 |
| 467 | Ga0157372_10025209 | 3300013307 | Bacteria | 6464 |
| 468 | Ga0157372_10026577 | 3300013307 | Bacteria | 6298 |
| 469 | Ga0157372_10029945 | 3300013307 | Bacteria | 5948 |
| 470 | Ga0157372_10047958 | 3300013307 | Bacteria | 4747 |
| 471 | Ga0157372_10201638 | 3300013307 | Bacteria | 2305 |
| 472 | Ga0157372_10225700 | 3300013307 | Bacteria | 2171 |
| 473 | Ga0157372_10389608 | 3300013307 | Bacteria | 1624 |
| 474 | Ga0157372_10808244 | 3300013307 | Bacteria | 1089 |
| 475 | Ga0157375_10014030 | 3300013308 | Bacteria | 7146 |
| 476 | Ga0157375_10109466 | 3300013308 | Bacteria | 2859 |
| 477 | Ga0163163_10137043 | 3300014325 | Bacteria | 2489 |
| 478 | Ga0163163_10300795 | 3300014325 | Bacteria | 1657 |
| 479 | Ga0182008_10008606 | 3300014497 | Bacteria | 5557 |
| 480 | Ga0182008_10017906 | 3300014497 | Bacteria | 3670 |
| 481 | Ga0182008_10053551 | 3300014497 | Bacteria | 1998 |
| 482 | Ga0182008_10054352 | 3300014497 | Bacteria | 1981 |
| 483 | Ga0182008_10054448 | 3300014497 | Bacteria | 1979 |
| 484 | Ga0157377_10207867 | 3300014745 | Bacteria | 1246 |
| 485 | Ga0157379_10000822 | 3300014968 | Bacteria | 25188 |
| 486 | Ga0157379_10031635 | 3300014968 | Bacteria | 4715 |
| 487 | Ga0157379_10043114 | 3300014968 | Bacteria | 4028 |
| 488 | Ga0157379_10172638 | 3300014968 | Bacteria | 1951 |
| 489 | Ga0157376_10040111 | 3300014969 | Bacteria | 3825 |
| 490 | Ga0157376_10050364 | 3300014969 | Bacteria | 3455 |
| 491 | Ga0157376_10065990 | 3300014969 | Bacteria | 3058 |
| 492 | Ga0157376_10066190 | 3300014969 | Bacteria | 3054 |
| 493 | Ga0182006_1002752 | 3300015261 | Bacteria | 9417 |
| 494 | Ga0182006_1004738 | 3300015261 | Bacteria | 6647 |
| 495 | Ga0182006_1010306 | 3300015261 | Bacteria | 4160 |
| 496 | Ga0182006_1065386 | 3300015261 | Bacteria | 1362 |
| 497 | Ga0182007_10004564 | 3300015262 | Bacteria | 6258 |
| 498 | Ga0182005_1000072 | 3300015265 | Bacteria | 84500 |
| 499 | Ga0183361_11773 | 3300016635 | Bacteria | 1132 |
| 500 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 501 | Ga0163161_10000092 | 3300017792 | Bacteria | 90636 |
| 502 | Ga0163161_10040958 | 3300017792 | Bacteria | 3328 |
| 503 | Ga0163161_10052349 | 3300017792 | Bacteria | 2959 |
| 504 | Ga0206356_11752824 | 3300020070 | Bacteria | 1983 |
| 505 | Ga0206353_10213026 | 3300020082 | Bacteria | 1899 |
| 506 | Ga0213872_10028976 | 3300021361 | Bacteria | 2539 |
| 507 | Ga0213872_10032545 | 3300021361 | Bacteria | 2389 |
| 508 | Ga0209435_100008 | 3300025206 | Bacteria | 503644 |
| 509 | Ga0209760_100605 | 3300025207 | Bacteria | 6193 |
| 510 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 511 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 512 | Ga0209784_100815 | 3300025224 | Bacteria | 7115 |
| 513 | Ga0209784_101126 | 3300025224 | Bacteria | 4344 |
| 514 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 515 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 516 | Ga0209566_100421 | 3300025225 | Bacteria | 32639 |
| 517 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 518 | Ga0209674_100013 | 3300025226 | Bacteria | 813140 |
| 519 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 520 | Ga0209674_100188 | 3300025226 | Bacteria | 67031 |
| 521 | Ga0209674_100199 | 3300025226 | Bacteria | 62593 |
| 522 | Ga0209674_100267 | 3300025226 | Bacteria | 40569 |
| 523 | Ga0209672_100010 | 3300025228 | Bacteria | 873151 |
| 524 | Ga0209672_100031 | 3300025228 | Bacteria | 332889 |
| 525 | Ga0209672_100335 | 3300025228 | Bacteria | 30277 |
| 526 | Ga0209672_101072 | 3300025228 | Bacteria | 11673 |
| 527 | Ga0209147_100006 | 3300025229 | Bacteria | 873276 |
| 528 | Ga0209147_100040 | 3300025229 | Bacteria | 307612 |
| 529 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 530 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 531 | Ga0207427_100762 | 3300025231 | Bacteria | 14665 |
| 532 | Ga0207427_101758 | 3300025231 | Bacteria | 7064 |
| 533 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 534 | Ga0209437_100045 | 3300025233 | Bacteria | 429809 |
| 535 | Ga0209258_100010 | 3300025242 | Bacteria | 873276 |
| 536 | Ga0209258_100061 | 3300025242 | Bacteria | 313501 |
| 537 | Ga0209258_100099 | 3300025242 | Bacteria | 214924 |
| 538 | Ga0207425_1000350 | 3300025245 | Bacteria | 32028 |
| 539 | Ga0207425_1003335 | 3300025245 | Bacteria | 5190 |
| 540 | Ga0209646_1000029 | 3300025246 | Bacteria | 386414 |
| 541 | Ga0209646_1000059 | 3300025246 | Bacteria | 256909 |
| 542 | Ga0209026_1000016 | 3300025250 | Bacteria | 386457 |
| 543 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 544 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 545 | Ga0209148_1000018 | 3300025254 | Bacteria | 756247 |
| 546 | Ga0209148_1000021 | 3300025254 | Bacteria | 714645 |
| 547 | Ga0209148_1000070 | 3300025254 | Bacteria | 332889 |
| 548 | Ga0209148_1000103 | 3300025254 | Bacteria | 215356 |
| 549 | Ga0209759_1000016 | 3300025256 | Bacteria | 386414 |
| 550 | Ga0209759_1000251 | 3300025256 | Bacteria | 79885 |
| 551 | Ga0209759_1000261 | 3300025256 | Bacteria | 76336 |
| 552 | Ga0209759_1000309 | 3300025256 | Bacteria | 65969 |
| 553 | Ga0209759_1013107 | 3300025256 | Bacteria | 2259 |
| 554 | Ga0209129_1000007 | 3300025258 | Bacteria | 771325 |
| 555 | Ga0209129_1000164 | 3300025258 | Bacteria | 98984 |
| 556 | Ga0209129_1023641 | 3300025258 | Bacteria | 1093 |
| 557 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 558 | Ga0209233_1000093 | 3300025261 | Bacteria | 306016 |
| 559 | Ga0209565_1000061 | 3300025263 | Bacteria | 185308 |
| 560 | Ga0209565_1000075 | 3300025263 | Bacteria | 162259 |
| 561 | Ga0209565_1000697 | 3300025263 | Bacteria | 20786 |
| 562 | Ga0209565_1003533 | 3300025263 | Bacteria | 5014 |
| 563 | Ga0209455_1000015 | 3300025272 | Bacteria | 756128 |
| 564 | Ga0209455_1000069 | 3300025272 | Bacteria | 308247 |
| 565 | Ga0209673_1000026 | 3300025273 | Bacteria | 373739 |
| 566 | Ga0209673_1000133 | 3300025273 | Bacteria | 161740 |
| 567 | Ga0209673_1000298 | 3300025273 | Bacteria | 91771 |
| 568 | Ga0209673_1000304 | 3300025273 | Bacteria | 91151 |
| 569 | Ga0209673_1001340 | 3300025273 | Bacteria | 24629 |
| 570 | Ga0209673_1002778 | 3300025273 | Bacteria | 11389 |
| 571 | Ga0209673_1017220 | 3300025273 | Bacteria | 2669 |
| 572 | Ga0209130_1000014 | 3300025284 | Bacteria | 412039 |
| 573 | Ga0209130_1002015 | 3300025284 | Bacteria | 11066 |
| 574 | Ga0209130_1003534 | 3300025284 | Bacteria | 6554 |
| 575 | Ga0209130_1003764 | 3300025284 | Bacteria | 6187 |
| 576 | Ga0209675_1000074 | 3300025291 | Bacteria | 162260 |
| 577 | Ga0209675_1000098 | 3300025291 | Bacteria | 130512 |
| 578 | Ga0209675_1000660 | 3300025291 | Bacteria | 24237 |
| 579 | Ga0209675_1000884 | 3300025291 | Bacteria | 19276 |
| 580 | Ga0209675_1007168 | 3300025291 | Bacteria | 4324 |
| 581 | Ga0209675_1014643 | 3300025291 | Bacteria | 2375 |
| 582 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 583 | Ga0209676_1000122 | 3300025292 | Bacteria | 195510 |
| 584 | Ga0209676_1000301 | 3300025292 | Bacteria | 99952 |
| 585 | Ga0209676_1005284 | 3300025292 | Bacteria | 6810 |
| 586 | Ga0209676_1027095 | 3300025292 | Bacteria | 1808 |
| 587 | Ga0209025_1000073 | 3300025294 | Bacteria | 282133 |
| 588 | Ga0209025_1000935 | 3300025294 | Bacteria | 44463 |
| 589 | Ga0209025_1001239 | 3300025294 | Bacteria | 35471 |
| 590 | Ga0209025_1006026 | 3300025294 | Bacteria | 9609 |
| 591 | Ga0209025_1017606 | 3300025294 | Bacteria | 4110 |
| 592 | Ga0209025_1022432 | 3300025294 | Bacteria | 3347 |
| 593 | Ga0209025_1023192 | 3300025294 | Bacteria | 3254 |
| 594 | Ga0209564_1000062 | 3300025295 | Bacteria | 321275 |
| 595 | Ga0209564_1000181 | 3300025295 | Bacteria | 151002 |
| 596 | Ga0209564_1000247 | 3300025295 | Bacteria | 116628 |
| 597 | Ga0209564_1000524 | 3300025295 | Bacteria | 62668 |
| 598 | Ga0209564_1000594 | 3300025295 | Bacteria | 56686 |
| 599 | Ga0209564_1007384 | 3300025295 | Bacteria | 5689 |
| 600 | Ga0209564_1028162 | 3300025295 | Bacteria | 1805 |
| 601 | Ga0209758_1000025 | 3300025297 | Bacteria | 586687 |
| 602 | Ga0209758_1000280 | 3300025297 | Bacteria | 101103 |
| 603 | Ga0209758_1000820 | 3300025297 | Bacteria | 43617 |
| 604 | Ga0209758_1032246 | 3300025297 | Bacteria | 2131 |
| 605 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 606 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 607 | Ga0209050_1000736 | 3300025298 | Bacteria | 47556 |
| 608 | Ga0209050_1004147 | 3300025298 | Bacteria | 10038 |
| 609 | Ga0209050_1020428 | 3300025298 | Bacteria | 2465 |
| 610 | Ga0209256_1000039 | 3300025299 | Bacteria | 372337 |
| 611 | Ga0209256_1000050 | 3300025299 | Bacteria | 308622 |
| 612 | Ga0209256_1000063 | 3300025299 | Bacteria | 252716 |
| 613 | Ga0209256_1000280 | 3300025299 | Bacteria | 89706 |
| 614 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 615 | Ga0207426_1000028 | 3300025302 | Bacteria | 483955 |
| 616 | Ga0207426_1000242 | 3300025302 | Bacteria | 122839 |
| 617 | Ga0207426_1001464 | 3300025302 | Bacteria | 19473 |
| 618 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 619 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 620 | Ga0209051_1000541 | 3300025303 | Bacteria | 46579 |
| 621 | Ga0209051_1000936 | 3300025303 | Bacteria | 28816 |
| 622 | Ga0209051_1006164 | 3300025303 | Bacteria | 6811 |
| 623 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 624 | Ga0209257_1000031 | 3300025304 | Bacteria | 688770 |
| 625 | Ga0209257_1007245 | 3300025304 | Bacteria | 6780 |
| 626 | Ga0209257_1017216 | 3300025304 | Bacteria | 2862 |
| 627 | Ga0209257_1023053 | 3300025304 | Bacteria | 2201 |
| 628 | Ga0207697_10003784 | 3300025315 | Bacteria | 7388 |
| 629 | Ga0207656_10002257 | 3300025321 | Bacteria | 6461 |
| 630 | Ga0207656_10026122 | 3300025321 | Bacteria | 2377 |
| 631 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 632 | Ga0207696_1000003 | 3300025711 | Bacteria | 860639 |
| 633 | Ga0207696_1000966 | 3300025711 | Bacteria | 17437 |
| 634 | Ga0207655_1007127 | 3300025728 | Bacteria | 7297 |
| 635 | Ga0207655_1016097 | 3300025728 | Bacteria | 4115 |
| 636 | Ga0207655_1064726 | 3300025728 | Bacteria | 1392 |
| 637 | Ga0207713_1000006 | 3300025735 | Bacteria | 586163 |
| 638 | Ga0207713_1000024 | 3300025735 | Bacteria | 339156 |
| 639 | Ga0207713_1000026 | 3300025735 | Bacteria | 319032 |
| 640 | Ga0207713_1000135 | 3300025735 | Bacteria | 112173 |
| 641 | Ga0207713_1003242 | 3300025735 | Bacteria | 11220 |
| 642 | Ga0207682_10016861 | 3300025893 | Bacteria | 2851 |
| 643 | Ga0207692_10175089 | 3300025898 | Bacteria | 1246 |
| 644 | Ga0207642_10010691 | 3300025899 | Bacteria | 3247 |
| 645 | Ga0207710_10000140 | 3300025900 | Bacteria | 83223 |
| 646 | Ga0207688_10033081 | 3300025901 | Bacteria | 2858 |
| 647 | Ga0207688_10119514 | 3300025901 | Bacteria | 1537 |
| 648 | Ga0207680_10072320 | 3300025903 | Bacteria | 2140 |
| 649 | Ga0207680_10159552 | 3300025903 | Bacteria | 1511 |
| 650 | Ga0207647_10007601 | 3300025904 | Bacteria | 7811 |
| 651 | Ga0207685_10075687 | 3300025905 | Bacteria | 1378 |
| 652 | Ga0207699_10009877 | 3300025906 | Bacteria | 4768 |
| 653 | Ga0207699_10027146 | 3300025906 | Bacteria | 3166 |
| 654 | Ga0207699_10222174 | 3300025906 | Bacteria | 1290 |
| 655 | Ga0207699_10352647 | 3300025906 | Bacteria | 1039 |
| 656 | Ga0207645_10000888 | 3300025907 | Bacteria | 24819 |
| 657 | Ga0207645_10005425 | 3300025907 | Bacteria | 9245 |
| 658 | Ga0207645_10044963 | 3300025907 | Bacteria | 2824 |
| 659 | Ga0207645_10112440 | 3300025907 | Bacteria | 1764 |
| 660 | Ga0207643_10000322 | 3300025908 | Bacteria | 32870 |
| 661 | Ga0207643_10029888 | 3300025908 | Bacteria | 3031 |
| 662 | Ga0207705_10079291 | 3300025909 | Bacteria | 2391 |
| 663 | Ga0207705_10288222 | 3300025909 | Bacteria | 1258 |
| 664 | Ga0207705_10382617 | 3300025909 | Bacteria | 1087 |
| 665 | Ga0207684_10011218 | 3300025910 | Bacteria | 7850 |
| 666 | Ga0207684_10076043 | 3300025910 | Bacteria | 2854 |
| 667 | Ga0207684_10360358 | 3300025910 | Bacteria | 1251 |
| 668 | Ga0207654_10000006 | 3300025911 | Bacteria | 815027 |
| 669 | Ga0207654_10006307 | 3300025911 | Bacteria | 5961 |
| 670 | Ga0207654_10057067 | 3300025911 | Bacteria | 2267 |
| 671 | Ga0207707_10000943 | 3300025912 | Bacteria | 28017 |
| 672 | Ga0207707_10003952 | 3300025912 | Bacteria | 13171 |
| 673 | Ga0207707_10008846 | 3300025912 | Bacteria | 8746 |
| 674 | Ga0207707_10015683 | 3300025912 | Bacteria | 6602 |
| 675 | Ga0207695_10000729 | 3300025913 | Bacteria | 63923 |
| 676 | Ga0207695_10001256 | 3300025913 | Bacteria | 43272 |
| 677 | Ga0207695_10003589 | 3300025913 | Bacteria | 21707 |
| 678 | Ga0207695_10018907 | 3300025913 | Bacteria | 7949 |
| 679 | Ga0207695_10158828 | 3300025913 | Bacteria | 2194 |
| 680 | Ga0207671_10061577 | 3300025914 | Bacteria | 2784 |
| 681 | Ga0207671_10225037 | 3300025914 | Bacteria | 1470 |
| 682 | Ga0207671_10401030 | 3300025914 | Bacteria | 1091 |
| 683 | Ga0207693_10003904 | 3300025915 | Bacteria | 12692 |
| 684 | Ga0207693_10020216 | 3300025915 | Bacteria | 5296 |
| 685 | Ga0207693_10022217 | 3300025915 | Bacteria | 5042 |
| 686 | Ga0207693_10191345 | 3300025915 | Bacteria | 1610 |
| 687 | Ga0207663_10008013 | 3300025916 | Bacteria | 5509 |
| 688 | Ga0207663_10053911 | 3300025916 | Bacteria | 2515 |
| 689 | Ga0207663_10088532 | 3300025916 | Bacteria | 2048 |
| 690 | Ga0207663_10192868 | 3300025916 | Bacteria | 1464 |
| 691 | Ga0207663_10201148 | 3300025916 | Bacteria | 1437 |
| 692 | Ga0207660_10009870 | 3300025917 | Bacteria | 6183 |
| 693 | Ga0207660_10018713 | 3300025917 | Bacteria | 4622 |
| 694 | Ga0207660_10101650 | 3300025917 | Bacteria | 2148 |
| 695 | Ga0207660_10131415 | 3300025917 | Bacteria | 1906 |
| 696 | Ga0207662_10046737 | 3300025918 | Bacteria | 2562 |
| 697 | Ga0207657_10000846 | 3300025919 | Bacteria | 32366 |
| 698 | Ga0207657_10001947 | 3300025919 | Bacteria | 22296 |
| 699 | Ga0207657_10005399 | 3300025919 | Bacteria | 13360 |
| 700 | Ga0207657_10016935 | 3300025919 | Bacteria | 7014 |
| 701 | Ga0207657_10136976 | 3300025919 | Bacteria | 2002 |
| 702 | Ga0207657_10149832 | 3300025919 | Bacteria | 1901 |
| 703 | Ga0207657_10331218 | 3300025919 | Bacteria | 1202 |
| 704 | Ga0207649_10007371 | 3300025920 | Bacteria | 5985 |
| 705 | Ga0207649_10009890 | 3300025920 | Bacteria | 5227 |
| 706 | Ga0207649_10018324 | 3300025920 | Bacteria | 3979 |
| 707 | Ga0207649_10151136 | 3300025920 | Bacteria | 1599 |
| 708 | Ga0207652_10005810 | 3300025921 | Bacteria | 10008 |
| 709 | Ga0207652_10006828 | 3300025921 | Bacteria | 9198 |
| 710 | Ga0207652_10011458 | 3300025921 | Bacteria | 7148 |
| 711 | Ga0207652_10014396 | 3300025921 | Bacteria | 6408 |
| 712 | Ga0207652_10032103 | 3300025921 | Bacteria | 4411 |
| 713 | Ga0207652_10039078 | 3300025921 | Bacteria | 4026 |
| 714 | Ga0207652_10194820 | 3300025921 | Bacteria | 1823 |
| 715 | Ga0207652_10287003 | 3300025921 | Bacteria | 1485 |
| 716 | Ga0207646_10050698 | 3300025922 | Bacteria | 3714 |
| 717 | Ga0207646_10077610 | 3300025922 | Bacteria | 2968 |
| 718 | Ga0207646_10226137 | 3300025922 | Bacteria | 1690 |
| 719 | Ga0207681_10010633 | 3300025923 | Bacteria | 5644 |
| 720 | Ga0207694_10002475 | 3300025924 | Bacteria | 15033 |
| 721 | Ga0207694_10004184 | 3300025924 | Bacteria | 11321 |
| 722 | Ga0207694_10005105 | 3300025924 | Bacteria | 10143 |
| 723 | Ga0207650_10001677 | 3300025925 | Bacteria | 15731 |
| 724 | Ga0207659_10028667 | 3300025926 | Bacteria | 3786 |
| 725 | Ga0207659_10199690 | 3300025926 | Bacteria | 1596 |
| 726 | Ga0207687_10002669 | 3300025927 | Bacteria | 12071 |
| 727 | Ga0207687_10012091 | 3300025927 | Bacteria | 5645 |
| 728 | Ga0207687_10149996 | 3300025927 | Bacteria | 1778 |
| 729 | Ga0207687_10396380 | 3300025927 | Bacteria | 1134 |
| 730 | Ga0207700_10000092 | 3300025928 | Bacteria | 55014 |
| 731 | Ga0207700_10030270 | 3300025928 | Bacteria | 3831 |
| 732 | Ga0207700_10039869 | 3300025928 | Bacteria | 3423 |
| 733 | Ga0207700_10148136 | 3300025928 | Bacteria | 1937 |
| 734 | Ga0207664_10001295 | 3300025929 | Bacteria | 16518 |
| 735 | Ga0207664_10017931 | 3300025929 | Bacteria | 5201 |
| 736 | Ga0207664_10075941 | 3300025929 | Bacteria | 2718 |
| 737 | Ga0207664_10320201 | 3300025929 | Bacteria | 1368 |
| 738 | Ga0207644_10016637 | 3300025931 | Bacteria | 4951 |
| 739 | Ga0207644_10032606 | 3300025931 | Bacteria | 3635 |
| 740 | Ga0207644_10034362 | 3300025931 | Bacteria | 3547 |
| 741 | Ga0207644_10036956 | 3300025931 | Bacteria | 3432 |
| 742 | Ga0207644_10066784 | 3300025931 | Bacteria | 2619 |
| 743 | Ga0207644_10112437 | 3300025931 | Bacteria | 2061 |
| 744 | Ga0207644_10143078 | 3300025931 | Bacteria | 1843 |
| 745 | Ga0207690_10001326 | 3300025932 | Bacteria | 15559 |
| 746 | Ga0207690_10013278 | 3300025932 | Bacteria | 4946 |
| 747 | Ga0207690_10013760 | 3300025932 | Bacteria | 4871 |
| 748 | Ga0207690_10077490 | 3300025932 | Bacteria | 2311 |
| 749 | Ga0207690_10089767 | 3300025932 | Bacteria | 2167 |
| 750 | Ga0207690_10123091 | 3300025932 | Bacteria | 1887 |
| 751 | Ga0207706_10000002 | 3300025933 | Bacteria | 360309 |
| 752 | Ga0207706_10000542 | 3300025933 | Bacteria | 40183 |
| 753 | Ga0207706_10001871 | 3300025933 | Bacteria | 20626 |
| 754 | Ga0207706_10011474 | 3300025933 | Bacteria | 8070 |
| 755 | Ga0207706_10021360 | 3300025933 | Bacteria | 5815 |
| 756 | Ga0207706_10049534 | 3300025933 | Bacteria | 3712 |
| 757 | Ga0207706_10083462 | 3300025933 | Bacteria | 2809 |
| 758 | Ga0207686_10000264 | 3300025934 | Bacteria | 39340 |
| 759 | Ga0207686_10010340 | 3300025934 | Bacteria | 5079 |
| 760 | Ga0207709_10000830 | 3300025935 | Bacteria | 23784 |
| 761 | Ga0207709_10017575 | 3300025935 | Bacteria | 3992 |
| 762 | Ga0207669_10012201 | 3300025937 | Bacteria | 4217 |
| 763 | Ga0207669_10097649 | 3300025937 | Bacteria | 1932 |
| 764 | Ga0207704_10064481 | 3300025938 | Bacteria | 2289 |
| 765 | Ga0207704_10104060 | 3300025938 | Bacteria | 1900 |
| 766 | Ga0207665_10295189 | 3300025939 | Bacteria | 1210 |
| 767 | Ga0207691_10012463 | 3300025940 | Bacteria | 8152 |
| 768 | Ga0207691_10033680 | 3300025940 | Bacteria | 4770 |
| 769 | Ga0207691_10062625 | 3300025940 | Bacteria | 3374 |
| 770 | Ga0207691_10064868 | 3300025940 | Bacteria | 3308 |
| 771 | Ga0207691_10438498 | 3300025940 | Bacteria | 1112 |
| 772 | Ga0207711_10011935 | 3300025941 | Bacteria | 7221 |
| 773 | Ga0207711_10090596 | 3300025941 | Bacteria | 2688 |
| 774 | Ga0207711_10096552 | 3300025941 | Bacteria | 2608 |
| 775 | Ga0207711_10125750 | 3300025941 | Bacteria | 2293 |
| 776 | Ga0207711_10136888 | 3300025941 | Bacteria | 2200 |
| 777 | Ga0207689_10000028 | 3300025942 | Bacteria | 100652 |
| 778 | Ga0207689_10010418 | 3300025942 | Bacteria | 8003 |
| 779 | Ga0207689_10047828 | 3300025942 | Bacteria | 3529 |
| 780 | Ga0207661_10016709 | 3300025944 | Bacteria | 5416 |
| 781 | Ga0207661_10387660 | 3300025944 | Bacteria | 1265 |
| 782 | Ga0207679_10001031 | 3300025945 | Bacteria | 17798 |
| 783 | Ga0207679_10019797 | 3300025945 | Bacteria | 4531 |
| 784 | Ga0207679_10038640 | 3300025945 | Bacteria | 3402 |
| 785 | Ga0207679_10046787 | 3300025945 | Bacteria | 3138 |
| 786 | Ga0207679_10052011 | 3300025945 | Bacteria | 3002 |
| 787 | Ga0207679_10086417 | 3300025945 | Bacteria | 2412 |
| 788 | Ga0207679_10143390 | 3300025945 | Bacteria | 1934 |
| 789 | Ga0207679_10250811 | 3300025945 | Bacteria | 1505 |
| 790 | Ga0207667_10000025 | 3300025949 | Bacteria | 350159 |
| 791 | Ga0207667_10000771 | 3300025949 | Bacteria | 41653 |
| 792 | Ga0207667_10003035 | 3300025949 | Bacteria | 20831 |
| 793 | Ga0207667_10023049 | 3300025949 | Bacteria | 6861 |
| 794 | Ga0207667_10043960 | 3300025949 | Bacteria | 4738 |
| 795 | Ga0207667_10083700 | 3300025949 | Bacteria | 3303 |
| 796 | Ga0207667_10121123 | 3300025949 | Bacteria | 2696 |
| 797 | Ga0207667_10180193 | 3300025949 | Bacteria | 2170 |
| 798 | Ga0207667_10273894 | 3300025949 | Bacteria | 1725 |
| 799 | Ga0207667_10344735 | 3300025949 | Bacteria | 1520 |
| 800 | Ga0207651_10000809 | 3300025960 | Bacteria | 13481 |
| 801 | Ga0207651_10010536 | 3300025960 | Bacteria | 5129 |
| 802 | Ga0207651_10047380 | 3300025960 | Bacteria | 2898 |
| 803 | Ga0207651_10128613 | 3300025960 | Bacteria | 1934 |
| 804 | Ga0207651_10171297 | 3300025960 | Bacteria | 1712 |
| 805 | Ga0207651_10217695 | 3300025960 | Bacteria | 1541 |
| 806 | Ga0207712_10071437 | 3300025961 | Bacteria | 2496 |
| 807 | Ga0207668_10011691 | 3300025972 | Bacteria | 5342 |
| 808 | Ga0207668_10280006 | 3300025972 | Bacteria | 1367 |
| 809 | Ga0207640_10000088 | 3300025981 | Bacteria | 72802 |
| 810 | Ga0207640_10008896 | 3300025981 | Bacteria | 5595 |
| 811 | Ga0207640_10037096 | 3300025981 | Bacteria | 3064 |
| 812 | Ga0207640_10043546 | 3300025981 | Bacteria | 2870 |
| 813 | Ga0207640_10431298 | 3300025981 | Bacteria | 1081 |
| 814 | Ga0207658_10011284 | 3300025986 | Bacteria | 6084 |
| 815 | Ga0207658_10079531 | 3300025986 | Bacteria | 2508 |
| 816 | Ga0207658_10168185 | 3300025986 | Bacteria | 1803 |
| 817 | Ga0207658_10264907 | 3300025986 | Bacteria | 1466 |
| 818 | Ga0207677_10000683 | 3300026023 | Bacteria | 20069 |
| 819 | Ga0207677_10008644 | 3300026023 | Bacteria | 5701 |
| 820 | Ga0207677_10020504 | 3300026023 | Bacteria | 4014 |
| 821 | Ga0207677_10099109 | 3300026023 | Bacteria | 2139 |
| 822 | Ga0207677_10245412 | 3300026023 | Bacteria | 1451 |
| 823 | Ga0207703_10014654 | 3300026035 | Bacteria | 6116 |
| 824 | Ga0207703_10018635 | 3300026035 | Bacteria | 5421 |
| 825 | Ga0207703_10065942 | 3300026035 | Bacteria | 2977 |
| 826 | Ga0207703_10166464 | 3300026035 | Bacteria | 1935 |
| 827 | Ga0207639_10001521 | 3300026041 | Bacteria | 15579 |
| 828 | Ga0207639_10008293 | 3300026041 | Bacteria | 7120 |
| 829 | Ga0207639_10337871 | 3300026041 | Bacteria | 1342 |
| 830 | Ga0207678_10007039 | 3300026067 | Bacteria | 9987 |
| 831 | Ga0207678_10053259 | 3300026067 | Bacteria | 3488 |
| 832 | Ga0207678_10061782 | 3300026067 | Bacteria | 3222 |
| 833 | Ga0207678_10079885 | 3300026067 | Bacteria | 2800 |
| 834 | Ga0207678_10113627 | 3300026067 | Bacteria | 2310 |
| 835 | Ga0207678_10161176 | 3300026067 | Bacteria | 1916 |
| 836 | Ga0207678_10209094 | 3300026067 | Bacteria | 1669 |
| 837 | Ga0207708_10000643 | 3300026075 | Bacteria | 26779 |
| 838 | Ga0207708_10153046 | 3300026075 | Bacteria | 1817 |
| 839 | Ga0207702_10000925 | 3300026078 | Bacteria | 30287 |
| 840 | Ga0207702_10053553 | 3300026078 | Bacteria | 3417 |
| 841 | Ga0207702_10088357 | 3300026078 | Bacteria | 2707 |
| 842 | Ga0207702_10096176 | 3300026078 | Bacteria | 2604 |
| 843 | Ga0207702_10170898 | 3300026078 | Bacteria | 1993 |
| 844 | Ga0207702_10407851 | 3300026078 | Bacteria | 1312 |
| 845 | Ga0207641_10012053 | 3300026088 | Bacteria | 7092 |
| 846 | Ga0207641_10040206 | 3300026088 | Bacteria | 3914 |
| 847 | Ga0207648_10000894 | 3300026089 | Bacteria | 33651 |
| 848 | Ga0207648_10001620 | 3300026089 | Bacteria | 24687 |
| 849 | Ga0207648_10001939 | 3300026089 | Bacteria | 22632 |
| 850 | Ga0207648_10022177 | 3300026089 | Bacteria | 5705 |
| 851 | Ga0207648_10027470 | 3300026089 | Bacteria | 5051 |
| 852 | Ga0207676_10001707 | 3300026095 | Bacteria | 16184 |
| 853 | Ga0207676_10016541 | 3300026095 | Bacteria | 5341 |
| 854 | Ga0207676_10018372 | 3300026095 | Bacteria | 5081 |
| 855 | Ga0207676_10024146 | 3300026095 | Bacteria | 4496 |
| 856 | Ga0207676_10228281 | 3300026095 | Bacteria | 1662 |
| 857 | Ga0207674_10000064 | 3300026116 | Bacteria | 109914 |
| 858 | Ga0207674_10000296 | 3300026116 | Bacteria | 63065 |
| 859 | Ga0207674_10001590 | 3300026116 | Bacteria | 29225 |
| 860 | Ga0207674_10002028 | 3300026116 | Bacteria | 25707 |
| 861 | Ga0207674_10002285 | 3300026116 | Bacteria | 24300 |
| 862 | Ga0207674_10018501 | 3300026116 | Bacteria | 7572 |
| 863 | Ga0207674_10026383 | 3300026116 | Bacteria | 6172 |
| 864 | Ga0207674_10026973 | 3300026116 | Bacteria | 6090 |
| 865 | Ga0207674_10033552 | 3300026116 | Bacteria | 5374 |
| 866 | Ga0207675_100000552 | 3300026118 | Bacteria | 36552 |
| 867 | Ga0207675_100128149 | 3300026118 | Bacteria | 2405 |
| 868 | Ga0207675_100154198 | 3300026118 | Bacteria | 2188 |
| 869 | Ga0207675_100179395 | 3300026118 | Bacteria | 2027 |
| 870 | Ga0207683_10000546 | 3300026121 | Bacteria | 34831 |
| 871 | Ga0207683_10000722 | 3300026121 | Bacteria | 30052 |
| 872 | Ga0207683_10002014 | 3300026121 | Bacteria | 17980 |
| 873 | Ga0207683_10085585 | 3300026121 | Bacteria | 2802 |
| 874 | Ga0207683_10134740 | 3300026121 | Bacteria | 2223 |
| 875 | Ga0207683_10248920 | 3300026121 | Bacteria | 1622 |
| 876 | Ga0207698_10006318 | 3300026142 | Bacteria | 7377 |
| 877 | Ga0207698_10008199 | 3300026142 | Bacteria | 6590 |
| 878 | Ga0207698_10027589 | 3300026142 | Bacteria | 4033 |
| 879 | Ga0207698_10046993 | 3300026142 | Bacteria | 3265 |
| 880 | Ga0207698_10081071 | 3300026142 | Bacteria | 2617 |
| 881 | Ga0207698_10128975 | 3300026142 | Bacteria | 2157 |
| 882 | Ga0207698_10147383 | 3300026142 | Bacteria | 2037 |
| 883 | Ga0207698_10186768 | 3300026142 | Bacteria | 1842 |
| 884 | Ga0207698_10197704 | 3300026142 | Bacteria | 1797 |
| 885 | Ga0207698_10311928 | 3300026142 | Bacteria | 1469 |
| 886 | Ga0209281_1000008 | 3300027111 | Bacteria | 867470 |
| 887 | Ga0209281_1000148 | 3300027111 | Bacteria | 168332 |
| 888 | Ga0209281_1000204 | 3300027111 | Bacteria | 134173 |
| 889 | Ga0209281_1000354 | 3300027111 | Bacteria | 75625 |
| 890 | Ga0209371_1000177 | 3300027312 | Bacteria | 94023 |
| 891 | Ga0209371_1000215 | 3300027312 | Bacteria | 78569 |
| 892 | Ga0209371_1001362 | 3300027312 | Bacteria | 16911 |
| 893 | Ga0209371_1003669 | 3300027312 | Bacteria | 7257 |
| 894 | Ga0209371_1022028 | 3300027312 | Bacteria | 1532 |
| 895 | Ga0209371_1022036 | 3300027312 | Bacteria | 1532 |
| 896 | Ga0209999_1010228 | 3300027543 | Bacteria | 1695 |
| 897 | Ga0209983_1012647 | 3300027665 | Bacteria | 1733 |
| 898 | Ga0209282_1000114 | 3300027666 | Bacteria | 51706 |
| 899 | Ga0209971_1003810 | 3300027682 | Bacteria | 3567 |
| 900 | Ga0209998_10008075 | 3300027717 | Bacteria | 2184 |
| 901 | Ga0209974_10003049 | 3300027876 | Bacteria | 6058 |
| 902 | Ga0268266_10010671 | 3300028379 | Bacteria | 8006 |
| 903 | Ga0268266_10058221 | 3300028379 | Bacteria | 3327 |
| 904 | Ga0268266_10067378 | 3300028379 | Bacteria | 3098 |
| 905 | Ga0268266_10128712 | 3300028379 | Bacteria | 2262 |
| 906 | Ga0268266_10421255 | 3300028379 | Bacteria | 1265 |
| 907 | Ga0268264_10004834 | 3300028381 | Bacteria | 11415 |
| 908 | Ga0268264_10022048 | 3300028381 | Bacteria | 5197 |
| 909 | Ga0268264_10037345 | 3300028381 | Bacteria | 4005 |
| 910 | Ga0268264_10097863 | 3300028381 | Bacteria | 2544 |
| 911 | Ga0268264_10228777 | 3300028381 | Bacteria | 1716 |
| 912 | Ga0268264_10505854 | 3300028381 | Bacteria | 1179 |
| 913 | Ga0307517_10000395 | 3300028786 | Bacteria | 74663 |
| 914 | Ga0307517_10045823 | 3300028786 | Bacteria | 4582 |
| 915 | Ga0307517_10148469 | 3300028786 | Bacteria | 1618 |
| 916 | Ga0307515_10000463 | 3300028794 | Bacteria | 97084 |
| 917 | Ga0307515_10000515 | 3300028794 | Bacteria | 92187 |
| 918 | Ga0307515_10001074 | 3300028794 | Bacteria | 62572 |
| 919 | Ga0307515_10027481 | 3300028794 | Bacteria | 9725 |
| 920 | Ga0265338_10021924 | 3300028800 | Bacteria | 6637 |
| 921 | Ga0268256_1000172 | 3300030500 | Bacteria | 78620 |
| 922 | Ga0268256_1000191 | 3300030500 | Bacteria | 71516 |
| 923 | Ga0268256_1001592 | 3300030500 | Bacteria | 13248 |
| 924 | Ga0268256_1001905 | 3300030500 | Bacteria | 11504 |
| 925 | Ga0268256_1024808 | 3300030500 | Bacteria | 1532 |
| 926 | Ga0307512_10030754 | 3300030522 | Bacteria | 4665 |
| 927 | Ga0307512_10200560 | 3300030522 | Bacteria | 1081 |
| 928 | Ga0316180_1113847 | 3300030736 | Bacteria | 2599 |
| 929 | Ga0316181_1060367 | 3300030744 | Bacteria | 8109 |
| 930 | Ga0265330_10003359 | 3300031235 | Bacteria | 8391 |
| 931 | Ga0265332_10000438 | 3300031238 | Bacteria | 29335 |
| 932 | Ga0265328_10068599 | 3300031239 | Bacteria | 1303 |
| 933 | Ga0265325_10078903 | 3300031241 | Bacteria | 1639 |
| 934 | Ga0265327_10030070 | 3300031251 | Bacteria | 3077 |
| 935 | Ga0265327_10046166 | 3300031251 | Bacteria | 2309 |
| 936 | Ga0265316_10017701 | 3300031344 | Bacteria | 6145 |
| 937 | Ga0307513_10002544 | 3300031456 | Bacteria | 25207 |
| 938 | Ga0307513_10057955 | 3300031456 | Bacteria | 4121 |
| 939 | Ga0307513_10145442 | 3300031456 | Bacteria | 2289 |
| 940 | Ga0307513_10272959 | 3300031456 | Bacteria | 1473 |
| 941 | Ga0307509_10004851 | 3300031507 | Bacteria | 19085 |
| 942 | Ga0307509_10014070 | 3300031507 | Bacteria | 9434 |
| 943 | Ga0307509_10040885 | 3300031507 | Bacteria | 5038 |
| 944 | Ga0307509_10059845 | 3300031507 | Bacteria | 4029 |
| 945 | Ga0307408_100003042 | 3300031548 | Bacteria | 11582 |
| 946 | Ga0307408_100004174 | 3300031548 | Bacteria | 9846 |
| 947 | Ga0307408_100012408 | 3300031548 | Bacteria | 5644 |
| 948 | Ga0307508_10000130 | 3300031616 | Bacteria | 89085 |
| 949 | Ga0307508_10003625 | 3300031616 | Bacteria | 15506 |
| 950 | Ga0307508_10016910 | 3300031616 | Bacteria | 6638 |
| 951 | Ga0307508_10059234 | 3300031616 | Bacteria | 3387 |
| 952 | Ga0307508_10068121 | 3300031616 | Bacteria | 3129 |
| 953 | Ga0307508_10076807 | 3300031616 | Bacteria | 2918 |
| 954 | Ga0307514_10000529 | 3300031649 | Bacteria | 74752 |
| 955 | Ga0307514_10068998 | 3300031649 | Bacteria | 2662 |
| 956 | Ga0307514_10095226 | 3300031649 | Bacteria | 2155 |
| 957 | Ga0265314_10079452 | 3300031711 | Bacteria | 2168 |
| 958 | Ga0307516_10019556 | 3300031730 | Bacteria | 7012 |
| 959 | Ga0307516_10029179 | 3300031730 | Bacteria | 5578 |
| 960 | Ga0307516_10069305 | 3300031730 | Bacteria | 3393 |
| 961 | Ga0307405_10004432 | 3300031731 | Bacteria | 6639 |
| 962 | Ga0307413_10003848 | 3300031824 | Bacteria | 6409 |
| 963 | Ga0307410_10052589 | 3300031852 | Bacteria | 2752 |
| 964 | Ga0307406_10004110 | 3300031901 | Bacteria | 7925 |
| 965 | Ga0307406_10020893 | 3300031901 | Bacteria | 3864 |
| 966 | Ga0307406_10111223 | 3300031901 | Bacteria | 1886 |
| 967 | Ga0307407_10328653 | 3300031903 | Bacteria | 1075 |
| 968 | Ga0307412_10031403 | 3300031911 | Bacteria | 3354 |
| 969 | Ga0307412_10074524 | 3300031911 | Bacteria | 2325 |
| 970 | Ga0307409_100031965 | 3300031995 | Bacteria | 3807 |
| 971 | Ga0307409_100035738 | 3300031995 | Bacteria | 3644 |
| 972 | Ga0307409_100152169 | 3300031995 | Bacteria | 2010 |
| 973 | Ga0307416_100002137 | 3300032002 | Bacteria | 11177 |
| 974 | Ga0307416_100013476 | 3300032002 | Bacteria | 5559 |
| 975 | Ga0307416_100019776 | 3300032002 | Bacteria | 4784 |
| 976 | Ga0307416_100319239 | 3300032002 | Bacteria | 1554 |
| 977 | Ga0307414_10019272 | 3300032004 | Bacteria | 4224 |
| 978 | Ga0307414_10029101 | 3300032004 | Bacteria | 3592 |
| 979 | Ga0307414_10174423 | 3300032004 | Bacteria | 1722 |
| 980 | Ga0307411_10068599 | 3300032005 | Bacteria | 2391 |
| 981 | Ga0307507_10070943 | 3300033179 | Bacteria | 3154 |
| 982 | Ga0307510_10018668 | 3300033180 | Bacteria | 8153 |
| 983 | Ga0307510_10064176 | 3300033180 | Bacteria | 3731 |
| 984 | Ga0307510_10121617 | 3300033180 | Bacteria | 2313 |
| 985 | Ga0373948_0009747 | 3300034817 | Bacteria | 1664 |
| 986 | Ga0373944_0046992 | 3300035089 | Bacteria | 1351 |
| 987 | Ga0373953_0003510 | 3300035117 | Bacteria | 4895 |
| 988 | Ga0373954_0092908 | 3300035118 | Bacteria | 1450 |
| 989 | Ga0373956_0012147 | 3300035119 | Bacteria | 3563 |
| 990 | Ga0373943_0013632 | 3300035170 | Bacteria | 3674 |
| 991 | Ga0373943_0095092 | 3300035170 | Bacteria | 1549 |
| 992 | Ga0373946_0002067 | 3300035171 | Bacteria | 7047 |
| 993 | Ga0373946_0035278 | 3300035171 | Bacteria | 2023 |
| 994 | Ga0373955_0015896 | 3300035172 | Bacteria | 3693 |
| 995 | Ga0373955_0025344 | 3300035172 | Bacteria | 3044 |
| 996 | Ga0373955_0078877 | 3300035172 | Bacteria | 1857 |
| 997 | Ga0373935_0054218 | 3300035692 | Bacteria | 2552 |
| 998 | Ga0373935_0150850 | 3300035692 | Bacteria | 1577 |
| 999 | Ga0373935_0240751 | 3300035692 | Bacteria | 1263 |
| 1000 | Ga0373927_0041944 | 3300035695 | Bacteria | 2967 |
| 1001 | Ga0373927_0085034 | 3300035695 | Bacteria | 2052 |
| 1002 | Ga0373933_0094684 | 3300035724 | Bacteria | 1847 |
| 1003 | Ga0373933_0141124 | 3300035724 | Bacteria | 1521 |
| 1004 | Ga0373947_0026904 | 3300035725 | Bacteria | 3364 |
| 1005 | Ga0373947_0037116 | 3300035725 | Bacteria | 2891 |
| 1006 | Ga0373947_0057791 | 3300035725 | Bacteria | 2348 |
| 1007 | Ga0373947_0302774 | 3300035725 | Bacteria | 1066 |
| 1008 | Ga0373937_0030237 | 3300036401 | Bacteria | 4906 |
| 1009 | Ga0373937_0050884 | 3300036401 | Bacteria | 3796 |
| 1010 | Ga0373937_0067007 | 3300036401 | Bacteria | 3307 |
| 1011 | Ga0373937_0408180 | 3300036401 | Bacteria | 1289 |
| 1012 | Ga0373925_0003796 | 3300037068 | Bacteria | 11617 |
| 1013 | Ga0373925_0018343 | 3300037068 | Bacteria | 5086 |
| 1014 | Ga0373925_0069217 | 3300037068 | Bacteria | 2665 |
| 1015 | Ga0373925_0083616 | 3300037068 | Bacteria | 2431 |
| 1016 | Ga0373925_0091297 | 3300037068 | Bacteria | 2329 |
| 1017 | Ga0373925_0091667 | 3300037068 | Bacteria | 2324 |
| 1018 | Ga0395899_0036110 | 3300037312 | Bacteria | 3709 |
| 1019 | Ga0395899_0110094 | 3300037312 | Bacteria | 1981 |
| 1020 | Ga0395900_0021769 | 3300037418 | Bacteria | 6555 |
| 1021 | Ga0395900_0085986 | 3300037418 | Bacteria | 3232 |
| 1022 | Ga0395900_0117199 | 3300037418 | Bacteria | 2733 |
| 1023 | Ga0395900_0123864 | 3300037418 | Bacteria | 2651 |
| 1024 | Ga0395900_0159417 | 3300037418 | Bacteria | 2302 |
| 1025 | Ga0395898_0068061 | 3300037466 | Bacteria | 3446 |
| 1026 | Ga0395905_0000004 | 3300037471 | Bacteria | 674991 |
| 1027 | Ga0395905_0242018 | 3300037471 | Bacteria | 1686 |
| 1028 | Ga0395901_0000095 | 3300038443 | Bacteria | 119290 |
| 1029 | Ga0395901_0029761 | 3300038443 | Bacteria | 5624 |
| 1030 | Ga0395901_0116449 | 3300038443 | Bacteria | 2807 |
| 1031 | Ga0395901_0671044 | 3300038443 | Bacteria | 1037 |
| 1032 | Ga0436361_0097666 | 3300039447 | Bacteria | 18811 |
| 1033 | Ga0436361_0371933 | 3300039447 | Bacteria | 1230 |
| 1034 | Ga0436361_0767394 | 3300039447 | Bacteria | 56110 |
| 1035 | Ga0439466_0065556 | 3300041411 | Bacteria | 1164 |
| 1036 | Ga0451833_0434451 | 3300041491 | Bacteria | 1615 |
| 1037 | Ga0451837_1483507 | 3300041494 | Bacteria | 1324 |
| 1038 | Ga0451853_4081205 | 3300041512 | Bacteria | 1471 |
| 1039 | Ga0439431_0001194 | 3300041997 | Bacteria | 5695 |
| 1040 | Ga0439442_005272 | 3300042002 | Bacteria | 2592 |
| 1041 | Ga0439432_008000 | 3300042006 | Bacteria | 3726 |
| 1042 | Ga0439432_020234 | 3300042006 | Bacteria | 2214 |
| 1043 | Ga0439452_000001 | 3300042010 | Bacteria | 1725439 |
| 1044 | Ga0439452_023789 | 3300042010 | Bacteria | 1573 |
| 1045 | Ga0450908_001364 | 3300042184 | Bacteria | 4732 |
| 1046 | Ga0450918_000203 | 3300042531 | Bacteria | 13437 |
| 1047 | Ga0466969_0034777 | 3300044656 | Bacteria | 2552 |
| 1048 | Ga0466972_0156050 | 3300044658 | Bacteria | 1072 |
| 1049 | Ga0466977_0007265 | 3300044666 | Bacteria | 6024 |
| 1050 | Ga0466966_0000107 | 3300044684 | Bacteria | 51017 |
| 1051 | Ga0466961_0000068 | 3300044693 | Bacteria | 62703 |
| 1052 | Ga0466963_0004228 | 3300044694 | Bacteria | 8328 |
| 1053 | Ga0451576_0122776 | 3300045051 | Bacteria | 2705 |
| 1054 | Ga0466958_0062195 | 3300045836 | Bacteria | 2275 |
| 1055 | Ga0466958_0151295 | 3300045836 | Bacteria | 1464 |
| 1056 | Ga0466967_0537169 | 3300045976 | Bacteria | 1150 |
| 1057 | Ga0495627_000018 | 3300046453 | Bacteria | 315125 |
| 1058 | Ga0495627_011240 | 3300046453 | Bacteria | 3220 |
| 1059 | Ga0495592_0002659 | 3300046454 | Bacteria | 12636 |
| 1060 | Ga0495592_0015849 | 3300046454 | Bacteria | 5717 |
| 1061 | Ga0495592_0048280 | 3300046454 | Bacteria | 3167 |
| 1062 | Ga0495592_0060087 | 3300046454 | Bacteria | 2796 |
| 1063 | Ga0495592_0080844 | 3300046454 | Bacteria | 2350 |
| 1064 | Ga0495603_0000357 | 3300046455 | Bacteria | 24624 |
| 1065 | Ga0495603_0010443 | 3300046455 | Bacteria | 5624 |
| 1066 | Ga0495603_0143118 | 3300046455 | Bacteria | 1390 |
| 1067 | Ga0495590_0001953 | 3300046457 | Bacteria | 8718 |
| 1068 | Ga0495590_0064363 | 3300046457 | Bacteria | 1283 |
| 1069 | Ga0495591_001746 | 3300046458 | Bacteria | 12954 |
| 1070 | Ga0495629_0000019 | 3300046459 | Bacteria | 163652 |
| 1071 | Ga0495629_0000324 | 3300046459 | Bacteria | 40913 |
| 1072 | Ga0495629_0016801 | 3300046459 | Bacteria | 5251 |
| 1073 | Ga0495629_0267931 | 3300046459 | Bacteria | 1174 |
| 1074 | Ga0495638_0008187 | 3300046460 | Bacteria | 7433 |
| 1075 | Ga0495651_0013765 | 3300046462 | Bacteria | 6254 |
| 1076 | Ga0495651_0047323 | 3300046462 | Bacteria | 3326 |
| 1077 | Ga0495653_0001772 | 3300046463 | Bacteria | 17027 |
| 1078 | Ga0495653_0003919 | 3300046463 | Bacteria | 12035 |
| 1079 | Ga0495653_0006411 | 3300046463 | Bacteria | 9648 |
| 1080 | Ga0495653_0038033 | 3300046463 | Bacteria | 3777 |
| 1081 | Ga0495653_0326251 | 3300046463 | Bacteria | 993 |
| 1082 | Ga0495650_0020095 | 3300046471 | Bacteria | 3266 |
| 1083 | Ga0495580_0001459 | 3300046472 | Bacteria | 20738 |
| 1084 | Ga0495580_0002389 | 3300046472 | Bacteria | 16394 |
| 1085 | Ga0495580_0015985 | 3300046472 | Bacteria | 5644 |
| 1086 | Ga0495580_0027959 | 3300046472 | Bacteria | 4102 |
| 1087 | Ga0495580_0043830 | 3300046472 | Bacteria | 3183 |
| 1088 | Ga0495582_0001061 | 3300046473 | Bacteria | 15458 |
| 1089 | Ga0495582_0011323 | 3300046473 | Bacteria | 4914 |
| 1090 | Ga0495582_0021956 | 3300046473 | Bacteria | 3492 |
| 1091 | Ga0495582_0024214 | 3300046473 | Bacteria | 3320 |
| 1092 | Ga0495605_0004558 | 3300046474 | Bacteria | 8114 |
| 1093 | Ga0495605_0007909 | 3300046474 | Bacteria | 6023 |
| 1094 | Ga0495639_0121035 | 3300046475 | Bacteria | 1249 |
| 1095 | Ga0495664_0002904 | 3300046477 | Bacteria | 9243 |
| 1096 | Ga0495664_0007199 | 3300046477 | Bacteria | 6169 |
| 1097 | Ga0495664_0010869 | 3300046477 | Bacteria | 5118 |
| 1098 | Ga0495596_0003607 | 3300046500 | Bacteria | 7781 |
| 1099 | Ga0495607_0000222 | 3300046501 | Bacteria | 60428 |
| 1100 | Ga0495583_0001486 | 3300046506 | Bacteria | 23452 |
| 1101 | Ga0495583_0010931 | 3300046506 | Bacteria | 5243 |
| 1102 | Ga0495606_0053530 | 3300046507 | Bacteria | 2618 |
| 1103 | Ga0495606_0128822 | 3300046507 | Bacteria | 1506 |
| 1104 | Ga0495608_0026339 | 3300046511 | Bacteria | 3965 |
| 1105 | Ga0495608_0069251 | 3300046511 | Bacteria | 2305 |
| 1106 | Ga0495608_0141463 | 3300046511 | Bacteria | 1535 |
| 1107 | Ga0495616_0020440 | 3300046513 | Bacteria | 3601 |
| 1108 | Ga0495618_0027868 | 3300046514 | Bacteria | 3518 |
| 1109 | Ga0495618_0036016 | 3300046514 | Bacteria | 3105 |
| 1110 | Ga0495618_0062376 | 3300046514 | Bacteria | 2365 |
| 1111 | Ga0495620_0005744 | 3300046515 | Bacteria | 6899 |
| 1112 | Ga0495620_0020987 | 3300046515 | Bacteria | 3179 |
| 1113 | Ga0495628_0001514 | 3300046516 | Bacteria | 21316 |
| 1114 | Ga0495628_0016911 | 3300046516 | Bacteria | 6078 |
| 1115 | Ga0495628_0026223 | 3300046516 | Bacteria | 4756 |
| 1116 | Ga0495628_0057183 | 3300046516 | Bacteria | 3068 |
| 1117 | Ga0495628_0147222 | 3300046516 | Bacteria | 1795 |
| 1118 | Ga0495628_0372747 | 3300046516 | Bacteria | 1046 |
| 1119 | Ga0495628_0406625 | 3300046516 | Bacteria | 993 |
| 1120 | Ga0495630_0030909 | 3300046517 | Bacteria | 3986 |
| 1121 | Ga0495630_0042170 | 3300046517 | Bacteria | 3408 |
| 1122 | Ga0495630_0205007 | 3300046517 | Bacteria | 1505 |
| 1123 | Ga0495630_0236657 | 3300046517 | Bacteria | 1395 |
| 1124 | Ga0495631_0001000 | 3300046518 | Bacteria | 17547 |
| 1125 | Ga0495632_0005609 | 3300046519 | Bacteria | 8259 |
| 1126 | Ga0495632_0007553 | 3300046519 | Bacteria | 6809 |
| 1127 | Ga0495643_0027689 | 3300046522 | Bacteria | 3183 |
| 1128 | Ga0495648_0023429 | 3300046524 | Bacteria | 4227 |
| 1129 | Ga0495648_0028656 | 3300046524 | Bacteria | 3705 |
| 1130 | Ga0495648_0055020 | 3300046524 | Bacteria | 2400 |
| 1131 | Ga0495666_0000226 | 3300046526 | Bacteria | 24003 |
| 1132 | Ga0495666_0008250 | 3300046526 | Bacteria | 5220 |
| 1133 | Ga0495666_0089437 | 3300046526 | Bacteria | 1453 |
| 1134 | Ga0495652_0016659 | 3300046529 | Bacteria | 6568 |
| 1135 | Ga0495652_0034597 | 3300046529 | Bacteria | 4403 |
| 1136 | Ga0495652_0036332 | 3300046529 | Bacteria | 4285 |
| 1137 | Ga0495652_0104348 | 3300046529 | Bacteria | 2292 |
| 1138 | Ga0495652_0253880 | 3300046529 | Bacteria | 1301 |
| 1139 | Ga0495654_0001734 | 3300046530 | Bacteria | 14624 |
| 1140 | Ga0495654_0007676 | 3300046530 | Bacteria | 6002 |
| 1141 | Ga0495654_0013733 | 3300046530 | Bacteria | 4328 |
| 1142 | Ga0495654_0027712 | 3300046530 | Bacteria | 2901 |
| 1143 | Ga0495654_0109599 | 3300046530 | Bacteria | 1261 |
| 1144 | Ga0495665_0000719 | 3300046531 | Bacteria | 17106 |
| 1145 | Ga0495665_0001886 | 3300046531 | Bacteria | 11322 |
| 1146 | Ga0495665_0020567 | 3300046531 | Bacteria | 3543 |
| 1147 | Ga0495665_0027050 | 3300046531 | Bacteria | 3079 |
| 1148 | Ga0495665_0066714 | 3300046531 | Bacteria | 1899 |
| 1149 | Ga0495640_0003354 | 3300046533 | Bacteria | 12890 |
| 1150 | Ga0495640_0003716 | 3300046533 | Bacteria | 12259 |
| 1151 | Ga0495640_0037582 | 3300046533 | Bacteria | 3415 |
| 1152 | Ga0495586_0001072 | 3300046535 | Bacteria | 15448 |
| 1153 | Ga0495587_0004090 | 3300046536 | Bacteria | 9659 |
| 1154 | Ga0495587_0023429 | 3300046536 | Bacteria | 3793 |
| 1155 | Ga0495587_0280687 | 3300046536 | Bacteria | 933 |
| 1156 | Ga0495621_0010337 | 3300046539 | Bacteria | 2851 |
| 1157 | Ga0495597_0000426 | 3300046542 | Bacteria | 36182 |
| 1158 | Ga0495645_0002971 | 3300046543 | Bacteria | 11474 |
| 1159 | Ga0495645_0013550 | 3300046543 | Bacteria | 5769 |
| 1160 | Ga0495633_0001594 | 3300046558 | Bacteria | 17196 |
| 1161 | Ga0495667_0010311 | 3300046559 | Bacteria | 6321 |
| 1162 | Ga0495634_0007743 | 3300046642 | Bacteria | 8037 |
| 1163 | Ga0495634_0029938 | 3300046642 | Bacteria | 3764 |
| 1164 | Ga0495634_0096159 | 3300046642 | Bacteria | 1918 |
| 1165 | Ga0495634_0114734 | 3300046642 | Bacteria | 1729 |
| 1166 | Ga0495611_0021100 | 3300046648 | Bacteria | 2811 |
| 1167 | Ga0495625_0000044 | 3300046660 | Bacteria | 203855 |
| 1168 | Ga0495625_0005617 | 3300046660 | Bacteria | 11371 |
| 1169 | Ga0495625_0017290 | 3300046660 | Bacteria | 5647 |
| 1170 | Ga0495625_0045384 | 3300046660 | Bacteria | 3177 |
| 1171 | Ga0495635_0001277 | 3300046663 | Bacteria | 16796 |
| 1172 | Ga0495635_0030140 | 3300046663 | Bacteria | 3770 |
| 1173 | Ga0495635_0034782 | 3300046663 | Bacteria | 3494 |
| 1174 | Ga0495635_0091209 | 3300046663 | Bacteria | 2084 |
| 1175 | Ga0495661_0001965 | 3300046665 | Bacteria | 16317 |
| 1176 | Ga0495661_0044822 | 3300046665 | Bacteria | 2708 |
| 1177 | Ga0495588_0007251 | 3300046674 | Bacteria | 5035 |
| 1178 | Ga0495588_0114008 | 3300046674 | Bacteria | 1424 |
| 1179 | Ga0495657_0117898 | 3300046675 | Bacteria | 1675 |
| 1180 | Ga0495657_0131207 | 3300046675 | Bacteria | 1569 |
| 1181 | Ga0495599_0021985 | 3300046678 | Bacteria | 3980 |
| 1182 | Ga0495599_0076326 | 3300046678 | Bacteria | 2092 |
| 1183 | Ga0495599_0087123 | 3300046678 | Bacteria | 1950 |
| 1184 | Ga0495599_0102375 | 3300046678 | Bacteria | 1785 |
| 1185 | Ga0495623_0006180 | 3300046679 | Bacteria | 7785 |
| 1186 | Ga0495623_0016213 | 3300046679 | Bacteria | 4812 |
| 1187 | Ga0495623_0209783 | 3300046679 | Bacteria | 1115 |
| 1188 | Ga0495646_0000701 | 3300046680 | Bacteria | 18534 |
| 1189 | Ga0495646_0009225 | 3300046680 | Bacteria | 6260 |
| 1190 | Ga0495646_0015429 | 3300046680 | Bacteria | 4849 |
| 1191 | Ga0495646_0068551 | 3300046680 | Bacteria | 2093 |
| 1192 | Ga0495647_0010734 | 3300046681 | Bacteria | 3124 |
| 1193 | Ga0495613_0001967 | 3300046689 | Bacteria | 15597 |
| 1194 | Ga0495613_0003507 | 3300046689 | Bacteria | 11744 |
| 1195 | Ga0495613_0172351 | 3300046689 | Bacteria | 1535 |
| 1196 | Ga0495624_0012912 | 3300046690 | Bacteria | 5699 |
| 1197 | Ga0495624_0024394 | 3300046690 | Bacteria | 3979 |
| 1198 | Ga0495624_0039929 | 3300046690 | Bacteria | 3008 |
| 1199 | Ga0495624_0041251 | 3300046690 | Bacteria | 2953 |
| 1200 | Ga0495624_0211750 | 3300046690 | Bacteria | 1175 |
| 1201 | Ga0495671_0000697 | 3300046692 | Bacteria | 24363 |
| 1202 | Ga0495671_0010602 | 3300046692 | Bacteria | 5096 |
| 1203 | Ga0495671_0017834 | 3300046692 | Bacteria | 3775 |
| 1204 | Ga0495671_0027191 | 3300046692 | Bacteria | 2956 |
| 1205 | Ga0495649_0003585 | 3300046694 | Bacteria | 10409 |
| 1206 | Ga0495649_0016776 | 3300046694 | Bacteria | 4147 |
| 1207 | Ga0495649_0051973 | 3300046694 | Bacteria | 2221 |
| 1208 | Ga0495589_0008221 | 3300046794 | Bacteria | 5452 |
| 1209 | Ga0495589_0053454 | 3300046794 | Bacteria | 1993 |
| 1210 | Ga0495600_0006710 | 3300046809 | Bacteria | 7014 |
| 1211 | Ga0495600_0052670 | 3300046809 | Bacteria | 2657 |
| 1212 | Ga0495600_0089532 | 3300046809 | Bacteria | 2007 |
| 1213 | Ga0495660_0141770 | 3300046810 | Bacteria | 1195 |
| 1214 | Ga0495581_0000184 | 3300047315 | Bacteria | 28849 |
| 1215 | Ga0495581_0030839 | 3300047315 | Bacteria | 3105 |
| 1216 | Ga0495604_0049157 | 3300047317 | Bacteria | 3278 |
| 1217 | Ga0495604_0049796 | 3300047317 | Bacteria | 3253 |
| 1218 | Ga0495604_0059663 | 3300047317 | Bacteria | 2923 |
| 1219 | Ga0495604_0077463 | 3300047317 | Bacteria | 2498 |
| 1220 | Ga0495674_0016934 | 3300047319 | Bacteria | 6794 |
| 1221 | Ga0495674_0033202 | 3300047319 | Bacteria | 4676 |
| 1222 | Ga0495674_0116478 | 3300047319 | Bacteria | 2260 |
| 1223 | Ga0495674_0239155 | 3300047319 | Bacteria | 1497 |
| 1224 | Ga0495672_0000009 | 3300047320 | Bacteria | 557755 |
| 1225 | Ga0495672_0005294 | 3300047320 | Bacteria | 10270 |
| 1226 | Ga0495672_0074110 | 3300047320 | Bacteria | 1918 |
| 1227 | Ga0495676_0009854 | 3300047321 | Bacteria | 8679 |
| 1228 | Ga0495676_0068792 | 3300047321 | Bacteria | 2734 |
| 1229 | Ga0495676_0072217 | 3300047321 | Bacteria | 2650 |
| 1230 | Ga0495676_0093956 | 3300047321 | Bacteria | 2235 |
| 1231 | Ga0495680_0001480 | 3300047322 | Bacteria | 25333 |
| 1232 | Ga0495680_0006595 | 3300047322 | Bacteria | 10768 |
| 1233 | Ga0495680_0019532 | 3300047322 | Bacteria | 5716 |
| 1234 | Ga0495680_0111098 | 3300047322 | Bacteria | 2031 |
| 1235 | Ga0495680_0197578 | 3300047322 | Bacteria | 1444 |
| 1236 | Ga0495683_0003301 | 3300047323 | Bacteria | 9428 |
| 1237 | Ga0495683_0012696 | 3300047323 | Bacteria | 4421 |
| 1238 | Ga0495683_0033221 | 3300047323 | Bacteria | 2626 |
| 1239 | Ga0495687_013333 | 3300047443 | Bacteria | 4300 |
| 1240 | Ga0495687_060952 | 3300047443 | Bacteria | 1554 |
| 1241 | Ga0495687_064028 | 3300047443 | Bacteria | 1503 |
| 1242 | Ga0495675_0003511 | 3300047444 | Bacteria | 9445 |
| 1243 | Ga0495675_0004372 | 3300047444 | Bacteria | 8553 |
| 1244 | Ga0495675_0018518 | 3300047444 | Bacteria | 4420 |
| 1245 | Ga0495675_0022944 | 3300047444 | Bacteria | 3977 |
| 1246 | Ga0495679_000037 | 3300047446 | Bacteria | 158099 |
| 1247 | Ga0495679_000177 | 3300047446 | Bacteria | 57800 |
| 1248 | Ga0495679_000702 | 3300047446 | Bacteria | 21779 |
| 1249 | Ga0495684_0041845 | 3300047471 | Bacteria | 3510 |
| 1250 | Ga0495684_0137308 | 3300047471 | Bacteria | 1834 |
| 1251 | Ga0495684_0284000 | 3300047471 | Bacteria | 1193 |
| 1252 | Ga0495593_0000287 | 3300047673 | Bacteria | 27425 |
| 1253 | Ga0495593_0002263 | 3300047673 | Bacteria | 11539 |
| 1254 | Ga0495593_0005587 | 3300047673 | Bacteria | 7425 |
| 1255 | Ga0495593_0045005 | 3300047673 | Bacteria | 2357 |
| 1256 | Ga0495602_0000447 | 3300048088 | Bacteria | 38647 |
| 1257 | Ga0495602_0026442 | 3300048088 | Bacteria | 5596 |
| 1258 | Ga0495602_0040022 | 3300048088 | Bacteria | 4307 |
| 1259 | Ga0495602_0055472 | 3300048088 | Bacteria | 3489 |
| 1260 | Ga0495602_0126758 | 3300048088 | Bacteria | 2043 |
| 1261 | Ga0495602_0167686 | 3300048088 | Bacteria | 1707 |
| 1262 | Ga0495602_0168279 | 3300048088 | Bacteria | 1703 |
| 1263 | Ga0495614_0000608 | 3300048089 | Bacteria | 15027 |
| 1264 | Ga0495614_0007949 | 3300048089 | Bacteria | 4713 |
| 1265 | Ga0495626_0011433 | 3300048091 | Bacteria | 4695 |
| 1266 | Ga0496100_0000449 | 3300048903 | Bacteria | 19895 |
| 1267 | Ga0496101_0000430 | 3300048904 | Bacteria | 26892 |
| 1268 | Ga0496101_0241798 | 3300048904 | Bacteria | 1405 |
| 1269 | Ga0496102_0000128 | 3300048905 | Bacteria | 104717 |
| 1270 | Ga0496102_0001072 | 3300048905 | Bacteria | 25286 |
| 1271 | Ga0496102_0155028 | 3300048905 | Bacteria | 2153 |
| 1272 | Ga0496103_0000394 | 3300048906 | Bacteria | 38815 |
| 1273 | Ga0496103_0038137 | 3300048906 | Bacteria | 2947 |
| 1274 | Ga0496104_0029946 | 3300048907 | Bacteria | 5054 |
| 1275 | Ga0496104_0049604 | 3300048907 | Bacteria | 3958 |
| 1276 | Ga0496105_0042040 | 3300048908 | Bacteria | 3768 |
| 1277 | Ga0496105_0051246 | 3300048908 | Bacteria | 3410 |
| 1278 | Ga0496105_0113650 | 3300048908 | Bacteria | 2234 |
| 1279 | Ga0496106_0000479 | 3300048909 | Bacteria | 28403 |
| 1280 | Ga0496106_0409087 | 3300048909 | Bacteria | 1090 |
| 1281 | Ga0496107_0009594 | 3300048910 | Bacteria | 6713 |
| 1282 | Ga0496107_0100161 | 3300048910 | Bacteria | 2124 |
| 1283 | Ga0496109_0188840 | 3300048912 | Bacteria | 1936 |
| 1284 | Ga0496110_0139408 | 3300048913 | Bacteria | 2192 |
| 1285 | Ga0496110_0301997 | 3300048913 | Bacteria | 1458 |
| 1286 | Ga0496111_0098337 | 3300048914 | Bacteria | 2149 |
| 1287 | Ga0496112_0030846 | 3300048915 | Bacteria | 5193 |
| 1288 | Ga0496113_0004607 | 3300048916 | Bacteria | 8501 |
| 1289 | Ga0496113_0053862 | 3300048916 | Bacteria | 3009 |
| 1290 | Ga0496114_0005380 | 3300048917 | Bacteria | 10011 |
| 1291 | Ga0496115_0000486 | 3300048918 | Bacteria | 31495 |
| 1292 | Ga0496115_0016930 | 3300048918 | Bacteria | 5561 |
| 1293 | Ga0496115_0427617 | 3300048918 | Bacteria | 1072 |
| 1294 | Ga0496116_0000023 | 3300048919 | Bacteria | 475792 |
| 1295 | Ga0496116_0000460 | 3300048919 | Bacteria | 56287 |
| 1296 | Ga0496116_0013582 | 3300048919 | Bacteria | 6551 |
| 1297 | Ga0496117_0000203 | 3300048920 | Bacteria | 117413 |
| 1298 | Ga0496117_0000463 | 3300048920 | Bacteria | 67832 |
| 1299 | Ga0496117_0005563 | 3300048920 | Bacteria | 13188 |
| 1300 | Ga0496117_0071053 | 3300048920 | Bacteria | 2334 |
| 1301 | Ga0496117_0150624 | 3300048920 | Bacteria | 1377 |
| 1302 | Ga0496118_0000079 | 3300048921 | Bacteria | 190113 |
| 1303 | Ga0496118_0003815 | 3300048921 | Bacteria | 18566 |
| 1304 | Ga0496118_0005103 | 3300048921 | Bacteria | 15094 |
| 1305 | Ga0496118_0005771 | 3300048921 | Bacteria | 13908 |
| 1306 | Ga0496118_0036321 | 3300048921 | Bacteria | 3985 |
| 1307 | Ga0496119_0000056 | 3300048922 | Bacteria | 174042 |
| 1308 | Ga0496119_0001891 | 3300048922 | Bacteria | 24077 |
| 1309 | Ga0496119_0004881 | 3300048922 | Bacteria | 13128 |
| 1310 | Ga0496119_0092153 | 3300048922 | Bacteria | 1720 |
| 1311 | Ga0496120_0000052 | 3300048923 | Bacteria | 186071 |
| 1312 | Ga0496120_0000063 | 3300048923 | Bacteria | 170325 |
| 1313 | Ga0496120_0000137 | 3300048923 | Bacteria | 123518 |
| 1314 | Ga0496121_0000860 | 3300048924 | Bacteria | 54968 |
| 1315 | Ga0496121_0001688 | 3300048924 | Bacteria | 36327 |
| 1316 | Ga0496121_0006093 | 3300048924 | Bacteria | 15173 |
| 1317 | Ga0496121_0029115 | 3300048924 | Bacteria | 5119 |
| 1318 | Ga0496121_0032218 | 3300048924 | Bacteria | 4769 |
| 1319 | Ga0496121_0043019 | 3300048924 | Bacteria | 3918 |
| 1320 | Ga0496121_0065425 | 3300048924 | Bacteria | 2958 |
| 1321 | Ga0496122_0000887 | 3300048925 | Bacteria | 55765 |
| 1322 | Ga0496122_0015744 | 3300048925 | Bacteria | 7208 |
| 1323 | Ga0496122_0031349 | 3300048925 | Bacteria | 4427 |
| 1324 | Ga0496122_0047575 | 3300048925 | Bacteria | 3310 |
| 1325 | Ga0496123_0000180 | 3300048926 | Bacteria | 127726 |
| 1326 | Ga0496123_0004798 | 3300048926 | Bacteria | 13954 |
| 1327 | Ga0496123_0017330 | 3300048926 | Bacteria | 5801 |
| 1328 | Ga0496123_0096875 | 3300048926 | Bacteria | 1730 |
| 1329 | Ga0496124_0000017 | 3300048927 | Bacteria | 444389 |
| 1330 | Ga0496124_0000024 | 3300048927 | Bacteria | 414291 |
| 1331 | Ga0496124_0000451 | 3300048927 | Bacteria | 72191 |
| 1332 | Ga0496124_0047249 | 3300048927 | Bacteria | 3683 |
| 1333 | Ga0496124_0102154 | 3300048927 | Bacteria | 2321 |
| 1334 | Ga0496125_0000016 | 3300048928 | Bacteria | 512512 |
| 1335 | Ga0496125_0003043 | 3300048928 | Bacteria | 20963 |
| 1336 | Ga0496125_0052210 | 3300048928 | Bacteria | 3363 |
| 1337 | Ga0496125_0056369 | 3300048928 | Bacteria | 3191 |
| 1338 | Ga0496125_0138487 | 3300048928 | Bacteria | 1697 |
| 1339 | Ga0496126_0000225 | 3300048929 | Bacteria | 122842 |
| 1340 | Ga0496126_0002445 | 3300048929 | Bacteria | 25073 |
| 1341 | Ga0496126_0009549 | 3300048929 | Bacteria | 10292 |
| 1342 | Ga0501034_0360886 | 3300049571 | Bacteria | 1380 |
| 1343 | Ga0501047_0036259 | 3300049581 | Bacteria | 4766 |
| 1344 | Ga0501067_0040551 | 3300049583 | Bacteria | 2585 |
| 1345 | Ga0501070_0278723 | 3300049586 | Bacteria | 1364 |
| 1346 | Ga0501072_0016539 | 3300049588 | Bacteria | 5667 |
| 1347 | Ga0501073_0023853 | 3300049589 | Bacteria | 4393 |
| 1348 | Ga0501074_0030094 | 3300049590 | Bacteria | 3935 |
| 1349 | Ga0501080_0008273 | 3300049742 | Bacteria | 9422 |
| 1350 | Ga0501080_0178214 | 3300049742 | Bacteria | 1957 |
| 1351 | Ga0501262_000239 | 3300049759 | Bacteria | 6781 |
| 1352 | nmdc:mga03683_29708_c1 | 3300050489 | Bacteria | 2181 |
| 1353 | nmdc:mga03683_3151_c1 | 3300050489 | Bacteria | 5259 |
| 1354 | nmdc:mga00v17_27802_c1 | 3300050491 | Bacteria | 3306 |
| 1355 | nmdc:mga00v17_7455_c1 | 3300050491 | Bacteria | 5839 |
| 1356 | nmdc:mga00v17_9465_c1 | 3300050491 | Bacteria | 5275 |
| 1357 | nmdc:mga0yw44_9423_c1 | 3300050492 | Bacteria | 4937 |
| 1358 | nmdc:mga0k408_39416_c1 | 3300050493 | Bacteria | 2714 |
| 1359 | nmdc:mga0k408_43487_c1 | 3300050493 | Bacteria | 2589 |
| 1360 | nmdc:mga0k408_6138_c1 | 3300050493 | Bacteria | 6408 |
| 1361 | nmdc:mga0k408_75692_c1 | 3300050493 | Bacteria | 1967 |
| 1362 | nmdc:mga06z11_224376_c1 | 3300050494 | Bacteria | 1099 |
| 1363 | nmdc:mga07m45_15935_c1 | 3300050496 | Bacteria | 4020 |
| 1364 | nmdc:mga07m45_2254_c1 | 3300050496 | Bacteria | 9003 |
| 1365 | nmdc:mga07m45_42983_c1 | 3300050496 | Bacteria | 2534 |
| 1366 | nmdc:mga07m45_5807_c1 | 3300050496 | Bacteria | 6185 |
| 1367 | nmdc:mga07m45_6577_c1 | 3300050496 | Bacteria | 5886 |
| 1368 | nmdc:mga07m45_6685_c1 | 3300050496 | Bacteria | 5849 |
| 1369 | nmdc:mga07m45_98480_c1 | 3300050496 | Bacteria | 1679 |
| 1370 | nmdc:mga05p37_172807_c1 | 3300050507 | Bacteria | 2634 |
| 1371 | nmdc:mga09592_313808_c1 | 3300050508 | Bacteria | 1358 |
| 1372 | nmdc:mga0n895_601081_c1 | 3300050512 | Bacteria | 1102 |
| 1373 | nmdc:mga0n895_602527_c1 | 3300050512 | Bacteria | 1101 |
| 1374 | nmdc:mga0rr50_194203_c1 | 3300050513 | Bacteria | 1665 |
| 1375 | nmdc:mga08x19_129164_c1 | 3300050514 | Bacteria | 1698 |
| 1376 | Ga0495612_0059844 | 3300053078 | Bacteria | 1576 |
| 1377 | Ga0500610_0009985 | 3300053079 | Bacteria | 4246 |
| 1378 | Ga0500610_0024124 | 3300053079 | Bacteria | 3019 |
| 1379 | Ga0495619_0008531 | 3300053085 | Bacteria | 6482 |
| 1380 | Ga0495619_0031100 | 3300053085 | Bacteria | 3457 |
| 1381 | Ga0495619_0130008 | 3300053085 | Bacteria | 1730 |
| 1382 | Ga0495619_0160812 | 3300053085 | Bacteria | 1551 |
| 1383 | Ga0495619_0305053 | 3300053085 | Bacteria | 1103 |
| 1384 | Ga0500578_0000244 | 3300053086 | Bacteria | 67335 |
| 1385 | Ga0500651_0000440 | 3300053093 | Bacteria | 22226 |
| 1386 | Ga0500566_0119307 | 3300053094 | Bacteria | 1424 |
| 1387 | Ga0500571_017194 | 3300053110 | Bacteria | 4048 |
| 1388 | Ga0500593_001081 | 3300053117 | Bacteria | 9841 |
| 1389 | Ga0500594_0002394 | 3300053118 | Bacteria | 4083 |
| 1390 | Ga0500595_000507 | 3300053119 | Bacteria | 23504 |
| 1391 | Ga0500607_002946 | 3300053121 | Bacteria | 12972 |
| 1392 | Ga0500618_000376 | 3300053125 | Bacteria | 30780 |
| 1393 | Ga0500642_0143056 | 3300053130 | Bacteria | 1122 |
| 1394 | Ga0500655_001505 | 3300053133 | Bacteria | 4411 |
| 1395 | Ga0500658_0009124 | 3300053134 | Bacteria | 3661 |
| 1396 | Ga0500564_033255 | 3300053138 | Bacteria | 2379 |
| 1397 | Ga0500568_0003041 | 3300053139 | Bacteria | 9587 |
| 1398 | Ga0500574_000053 | 3300053141 | Bacteria | 13704 |
| 1399 | Ga0500622_0000043 | 3300053156 | Bacteria | 161080 |
| 1400 | Ga0500627_0012941 | 3300053158 | Bacteria | 3144 |
| 1401 | Ga0500634_0008211 | 3300053161 | Bacteria | 5206 |
| 1402 | Ga0500634_0042530 | 3300053161 | Bacteria | 2465 |
| 1403 | Ga0501084_0076341 | 3300054114 | Bacteria | 2809 |
| 1404 | 2509076495 | 2508501114 | Bacteria | 7082538 |
| 1405 | 2511246598 | 2511231002 | Bacteria | 5042903 |
| 1406 | 2511383975 | 2511231026 | Bacteria | 5225445 |
| 1407 | 2512037037 | 2511231221 | Bacteria | 6846400 |
| 1408 | 2513232076 | 2513020051 | Bacteria | 6053213 |
| 1409 | 2521557795 | 2521172590 | Bacteria | 5047645 |
| 1410 | 2553002916 | 2551306416 | Bacteria | 6152985 |
| 1411 | 2555261438 | 2554235234 | Bacteria | 5762085 |
| 1412 | 2587727029 | 2585428057 | Bacteria | 6737412 |
| 1413 | 2587732031 | 2585428058 | Bacteria | 6853932 |
| 1414 | 2587756972 | 2585428062 | Bacteria | 6842168 |
| 1415 | 2588291456 | 2588253510 | Bacteria | 6901809 |
| 1416 | 2599623592 | 2599185214 | Bacteria | 8209958 |
| 1417 | 2599671790 | 2599185226 | Bacteria | 8233575 |
| 1418 | 2599681197 | 2599185227 | Bacteria | 8246414 |
| 1419 | 2599693399 | 2599185229 | Bacteria | 8216126 |
| 1420 | 2599927398 | 2599185299 | Bacteria | 4854625 |
| 1421 | 2600811292 | 2600255067 | Bacteria | 6795583 |
| 1422 | 2643970584 | 2643221592 | Bacteria | 6608788 |
| 1423 | 2644139135 | 2643221625 | Bacteria | 6512927 |
| 1424 | 2644163194 | 2643221628 | Bacteria | 5745828 |
| 1425 | 2644274745 | 2643221648 | Bacteria | 6521465 |
| 1426 | 2644327575 | 2643221658 | Bacteria | 6064537 |
| 1427 | 2644401531 | 2643221672 | Bacteria | 6322190 |
| 1428 | 2644468112 | 2643221683 | Bacteria | 5749203 |
| 1429 | 2650896746 | 2648501693 | Bacteria | 5069560 |
| 1430 | 2686352745 | 2684622997 | Bacteria | 4624240 |
| 1431 | 2738717667 | 2738541277 | Bacteria | 7458140 |
| 1432 | 2738879278 | 2738541307 | Bacteria | 8606193 |
| 1433 | 2739278353 | 2738543019 | Bacteria | 7459457 |
| 1434 | 2739611377 | 2739367655 | Bacteria | 4051151 |
| 1435 | 2746088370 | 2744054900 | Bacteria | 8399525 |
| 1436 | 2746096735 | 2744054901 | Bacteria | 8397047 |
| 1437 | 2765568899 | 2765235838 | Bacteria | 5445269 |
| 1438 | 2772438099 | 2772190666 | Bacteria | 5117644 |
| 1439 | 2808984562 | 2808606386 | Bacteria | 4471946 |
| 1440 | 2809127632 | 2808606414 | Bacteria | 4917181 |
| 1441 | 2809130608 | 2808606415 | Bacteria | 4576710 |
| 1442 | 2809149915 | 2808606419 | Bacteria | 4576925 |
| 1443 | 2819597153 | 2818991446 | Bacteria | 7757362 |
| 1444 | 2819615062 | 2818991449 | Bacteria | 5518009 |
| 1445 | 2831266278 | 2831265667 | Bacteria | 7184833 |
| 1446 | 2838057612 | 2838054893 | Bacteria | 7451788 |
| 1447 | 2839096219 | 2839094727 | Bacteria | 5534556 |
| 1448 | 2842681946 | 2842677519 | Bacteria | 5615038 |
| 1449 | 2847800575 | 2847797336 | Bacteria | 5176640 |
| 1450 | 2852619939 | 2852618963 | Bacteria | 4577824 |
| 1451 | 2857545267 | 2857542790 | Bacteria | 5326616 |
| 1452 | 2857578152 | 2857576091 | Bacteria | 5465855 |
| 1453 | 2858955682 | 2858950400 | Bacteria | 6783797 |
| 1454 | 2881928944 | 2881927736 | Bacteria | 3993927 |
| 1455 | 2885204392 | 2885198086 | Bacteria | 7212419 |
| 1456 | 2885218045 | 2885211737 | Bacteria | 7212420 |
| 1457 | 2888368114 | 2888366609 | Bacteria | 5155009 |
| 1458 | 2899924656 | 2899924645 | Bacteria | 7487985 |
| 1459 | 2904441443 | 2904439833 | Bacteria | 5931679 |
| 1460 | 2904455806 | 2904449895 | Bacteria | 6927402 |
| 1461 | 2904457763 | 2904456579 | Bacteria | 6819253 |
| 1462 | 2904481559 | 2904479285 | Bacteria | 5073931 |
| 1463 | 2904505327 | 2904504865 | Bacteria | 5152820 |
| 1464 | 2904531619 | 2904530477 | Bacteria | 5876334 |
| 1465 | 2904548096 | 2904541872 | Bacteria | 8915136 |
| 1466 | 2904586741 | 2904584206 | Bacteria | 6028872 |
| 1467 | 2904593226 | 2904589729 | Bacteria | 6113573 |
| 1468 | 2904602931 | 2904601388 | Bacteria | 5884906 |
| 1469 | 2919046259 | 2919046199 | Bacteria | 5567169 |
| 1470 | 2919084049 | 2919079590 | Bacteria | 5946433 |
| 1471 | 2919467558 | 2919462493 | Bacteria | 5817112 |
| 1472 | 2923511013 | 2923510766 | Bacteria | 5926163 |
| 1473 | 2928039217 | 2928037797 | Bacteria | 7273642 |
| 1474 | 2928045178 | 2928044640 | Bacteria | 7271509 |
| 1475 | 2928052983 | 2928051484 | Bacteria | 7773759 |
| 1476 | 2928064346 | 2928064002 | Bacteria | 7419480 |
| 1477 | 2928071794 | 2928070936 | Bacteria | 8062541 |
| 1478 | 2928084263 | 2928084124 | Bacteria | 7159212 |
| 1479 | 2928130975 | 2928130867 | Bacteria | 5467269 |
| 1480 | 2928511201 | 2928510474 | Bacteria | 4815308 |
| 1481 | 2929163027 | 2929160207 | Bacteria | 9075316 |
| 1482 | 2929522789 | 2929520902 | Bacteria | 6765052 |
| 1483 | 2932408458 | 2932406140 | Bacteria | 5134491 |
| 1484 | 2932423395 | 2932422444 | Bacteria | 4678430 |
| 1485 | 2939580119 | 2939577877 | Bacteria | 5132791 |
| 1486 | 2939608227 | 2939607340 | Bacteria | 4719256 |
| 1487 | 2945911534 | 2945909444 | Bacteria | 7065066 |
| 1488 | 2945947662 | 2945945610 | Bacteria | 5951079 |
| 1489 | 2945977474 | 2945972063 | Bacteria | 6086495 |
| 1490 | 2945986125 | 2945984333 | Bacteria | 7358892 |
| 1491 | 2954772492 | 2954767861 | Bacteria | 5535784 |
| 1492 | 2980127431 | 2980125574 | Bacteria | 5567337 |
| 1493 | 2984495971 | 2984494565 | Bacteria | 5000175 |
| 1494 | 2990262653 | 2990261002 | Bacteria | 4919493 |
| 1495 | 3000379832 | 3000376612 | Bacteria | 4705565 |
| 1496 | 8005662400 | 8005658619 | Bacteria | 4500593 |
| 1497 | 8048748982 | 8048746797 | Bacteria | 3557226 |
| 1498 | 8054846520 | 8054844752 | Bacteria | 4450330 |
| 1499 | 8054851854 | 8054849141 | Bacteria | 5232694 |
| 1500 | 8055432569 | 8055431914 | Bacteria | 4551896 |
| 1501 | Ga0157375_10462182 | |||
| 1502 | JGI24741J21665_1001323 | |||
| 1503 | JGI24740J21852_10000707 | |||
| 1504 | JGI24740J21852_10001478 | |||
| 1505 | JGI24740J21852_10009017 | |||
| 1506 | JGI24739J22299_10003562 | |||
| 1507 | JGI24739J22299_10028661 | |||
| 1508 | JGI25155J39150_1000009 | |||
| 1509 | JGI25156J39149_1000009 | |||
| 1510 | JGI25156J39149_1001288 | |||
| 1511 | JGI25156J39149_1002086 | |||
| 1512 | JGI25156J39149_1002833 | |||
| 1513 | JGI25156J39149_1013563 | |||
| 1514 | JGI25162J39368_1000040 | |||
| 1515 | JGI25154J39366_1000024 | |||
| 1516 | JGI25154J39366_1000362 | |||
| 1517 | JGI25157J39369_1000007 | |||
| 1518 | JGI25152J39213_1002358 | |||
| 1519 | JGI25150J39212_1008224 | |||
| 1520 | JGI25150J39212_1010444 | |||
| 1521 | JGI25159J45721_1009054 | |||
| 1522 | JGI25159J45721_1013251 | |||
| 1523 | JGI25151J46595_10037152 | |||
| 1524 | JGI25165J46597_1000051 | |||
| 1525 | JGI25165J46597_1001429 | |||
| 1526 | JGI25153J46596_10003022 | |||
| 1527 | JGI25153J46596_10004243 | |||
| 1528 | JGI25160J50197_1000240 | |||
| 1529 | JGI25161J50226_1000009 | |||
| 1530 | JGI25161J50226_1002517 | |||
| 1531 | JGI25161J50226_1005364 | |||
| 1532 | Ga0006562J51391_1103912 | |||
| 1533 | Ga0006562J51391_1112229 | |||
| 1534 | Ga0055538_1000002 | |||
| 1535 | Ga0055538_1000025 | |||
| 1536 | Ga0055538_1002535 | |||
| 1537 | Ga0055539_1000002 | |||
| 1538 | Ga0055539_1000032 | |||
| 1539 | Ga0055539_1000100 | |||
| 1540 | Ga0055533_1000004 | |||
| 1541 | Ga0055533_1000042 | |||
| 1542 | Ga0055533_1000257 | |||
| 1543 | Ga0055532_1000012 | |||
| 1544 | Ga0055532_1000029 | |||
| 1545 | Ga0055532_1001367 | |||
| 1546 | Ga0055532_1002326 | |||
| 1547 | Ga0055525_1000002 | |||
| 1548 | Ga0055525_1000050 | |||
| 1549 | Ga0055525_1000444 | |||
| 1550 | Ga0055525_1000505 | |||
| 1551 | Ga0055527_1000011 | |||
| 1552 | Ga0055535_1000009 | |||
| 1553 | Ga0055535_1000093 | |||
| 1554 | Ga0055535_1000689 | |||
| 1555 | Ga0055542_1000015 | |||
| 1556 | Ga0055542_1000039 | |||
| 1557 | Ga0055542_1000106 | |||
| 1558 | Ga0055542_1001376 | |||
| 1559 | Ga0055529_1000011 | |||
| 1560 | Ga0055529_1000124 | |||
| 1561 | Ga0055529_1000376 | |||
| 1562 | Ga0055526_1003692 | |||
| 1563 | Ga0055526_1009131 | |||
| 1564 | Ga0055526_1009501 | |||
| 1565 | Ga0055537_1000020 | |||
| 1566 | Ga0055537_1000491 | |||
| 1567 | Ga0055537_1019921 | |||
| 1568 | Ga0055524_1000047 | |||
| 1569 | Ga0055524_1015136 | |||
| 1570 | Ga0055536_1002265 | |||
| 1571 | Ga0055536_1004266 | |||
| 1572 | Ga0055536_1005338 | |||
| 1573 | Ga0055536_1018976 | |||
| 1574 | Ga0055536_1024865 | |||
| 1575 | Ga0055536_1034695 | |||
| 1576 | Ga0055534_1000450 | |||
| 1577 | Ga0055534_1000633 | |||
| 1578 | Ga0055534_1011996 | |||
| 1579 | Ga0055528_1000934 | |||
| 1580 | Ga0055528_1000973 | |||
| 1581 | Ga0055528_1013206 | |||
| 1582 | Ga0055530_10002364 | |||
| 1583 | Ga0055530_10003258 | |||
| 1584 | Ga0055540_1000027 | |||
| 1585 | Ga0055540_1002734 | |||
| 1586 | Ga0055540_1007848 | |||
| 1587 | Ga0055540_1032478 | |||
| 1588 | Ga0055531_10001909 | |||
| 1589 | Ga0055541_1000023 | |||
| 1590 | Ga0055541_1000043 | |||
| 1591 | Ga0055541_1008584 | |||
| 1592 | Ga0058692_1000297 | |||
| 1593 | Ga0055543_1000199 | |||
| 1594 | Ga0055543_1002895 | |||
| 1595 | Ga0055543_1012484 | |||
| 1596 | Ga0065165_1001969 | |||
| 1597 | Ga0065704_10012722 | |||
| 1598 | Ga0065715_10019317 | |||
| 1599 | Ga0065715_10174718 | |||
| 1600 | Ga0070658_10025574 | |||
| 1601 | Ga0070658_10035798 | |||
| 1602 | Ga0070658_10245085 | |||
| 1603 | Ga0070676_10002706 | |||
| 1604 | Ga0070676_10145652 | |||
| 1605 | Ga0070676_10157451 | |||
| 1606 | Ga0070683_100029745 | |||
| 1607 | Ga0070683_100307344 | |||
| 1608 | Ga0070683_100345721 | |||
| 1609 | Ga0070683_100517215 | |||
| 1610 | Ga0070690_100048399 | |||
| 1611 | Ga0070670_100014778 | |||
| 1612 | Ga0070670_100134363 | |||
| 1613 | Ga0070677_10004255 | |||
| 1614 | Ga0068869_100007462 | |||
| 1615 | Ga0070680_100030518 | |||
| 1616 | Ga0070680_100057278 | |||
| 1617 | Ga0070680_100092804 | |||
| 1618 | Ga0070682_100041859 | |||
| 1619 | Ga0070682_100073205 | |||
| 1620 | Ga0070682_100329487 | |||
| 1621 | Ga0068868_100010083 | |||
| 1622 | Ga0068868_100024239 | |||
| 1623 | Ga0068868_100063202 | |||
| 1624 | Ga0068868_100069739 | |||
| 1625 | Ga0068868_100121194 | |||
| 1626 | Ga0068868_100363261 | |||
| 1627 | Ga0070660_100000161 | |||
| 1628 | Ga0070660_100056004 | |||
| 1629 | Ga0070660_100128362 | |||
| 1630 | Ga0070660_100259956 | |||
| 1631 | Ga0070689_100250730 | |||
| 1632 | Ga0070687_100038283 | |||
| 1633 | Ga0070687_100181501 | |||
| 1634 | Ga0070661_100000057 | |||
| 1635 | Ga0070661_100002317 | |||
| 1636 | Ga0070661_100017237 | |||
| 1637 | Ga0070661_100135331 | |||
| 1638 | Ga0070692_10003401 | |||
| 1639 | Ga0070692_10009557 | |||
| 1640 | Ga0070668_100007630 | |||
| 1641 | Ga0070668_100051229 | |||
| 1642 | Ga0070668_100153842 | |||
| 1643 | Ga0070669_100130830 | |||
| 1644 | Ga0070675_100004084 | |||
| 1645 | Ga0070671_100002197 | |||
| 1646 | Ga0070671_100052121 | |||
| 1647 | Ga0070671_100065336 | |||
| 1648 | Ga0070671_100122510 | |||
| 1649 | Ga0070671_100130067 | |||
| 1650 | Ga0070674_100028680 | |||
| 1651 | Ga0070674_100040580 | |||
| 1652 | Ga0070673_100001432 | |||
| 1653 | Ga0070673_100009049 | |||
| 1654 | Ga0070673_100156678 | |||
| 1655 | Ga0070673_100194814 | |||
| 1656 | Ga0070673_100436178 | |||
| 1657 | Ga0070688_100026504 | |||
| 1658 | Ga0070659_100000510 | |||
| 1659 | Ga0070659_100001591 | |||
| 1660 | Ga0070659_100008091 | |||
| 1661 | Ga0070659_100063640 | |||
| 1662 | Ga0070659_100097024 | |||
| 1663 | Ga0070667_100220317 | |||
| 1664 | Ga0070667_100232366 | |||
| 1665 | Ga0070667_100257670 | |||
| 1666 | Ga0070667_100446390 | |||
| 1667 | Ga0070709_10014488 | |||
| 1668 | Ga0070709_10035545 | |||
| 1669 | Ga0070709_10169964 | |||
| 1670 | Ga0070714_100007945 | |||
| 1671 | Ga0070714_100014020 | |||
| 1672 | Ga0070714_100035131 | |||
| 1673 | Ga0070714_100036382 | |||
| 1674 | Ga0070713_100000032 | |||
| 1675 | Ga0070713_100006613 | |||
| 1676 | Ga0070713_100015987 | |||
| 1677 | Ga0070713_100032725 | |||
| 1678 | Ga0070713_100157445 | |||
| 1679 | Ga0070711_100019144 | |||
| 1680 | Ga0070711_100134686 | |||
| 1681 | Ga0070711_100136673 | |||
| 1682 | Ga0070705_100083040 | |||
| 1683 | Ga0070700_100002762 | |||
| 1684 | Ga0070694_100024359 | |||
| 1685 | Ga0070708_100120354 | |||
| 1686 | Ga0070663_100000105 | |||
| 1687 | Ga0070663_100004364 | |||
| 1688 | Ga0070663_100058982 | |||
| 1689 | Ga0070663_100095971 | |||
| 1690 | Ga0070678_100001542 | |||
| 1691 | Ga0070678_100037327 | |||
| 1692 | Ga0070678_100164074 | |||
| 1693 | Ga0070662_100000149 | |||
| 1694 | Ga0070662_100035491 | |||
| 1695 | Ga0070662_100049985 | |||
| 1696 | Ga0070662_100050379 | |||
| 1697 | Ga0070662_100184225 | |||
| 1698 | Ga0070662_100305005 | |||
| 1699 | Ga0070681_10000229 | |||
| 1700 | Ga0070681_10001327 | |||
| 1701 | Ga0070681_10048539 | |||
| 1702 | Ga0070681_10091627 | |||
| 1703 | Ga0070681_10096433 | |||
| 1704 | Ga0068867_100009953 | |||
| 1705 | Ga0068867_100019344 | |||
| 1706 | Ga0068867_100182185 | |||
| 1707 | Ga0068867_100225741 | |||
| 1708 | Ga0070685_10003742 | |||
| 1709 | Ga0070706_100001663 | |||
| 1710 | Ga0070707_100078247 | |||
| 1711 | Ga0070707_100124488 | |||
| 1712 | Ga0070698_100022134 | |||
| 1713 | Ga0070698_100153853 | |||
| 1714 | Ga0070698_100224844 | |||
| 1715 | Ga0070698_100511636 | |||
| 1716 | Ga0070699_100158833 | |||
| 1717 | Ga0070699_100488578 | |||
| 1718 | Ga0070679_100001752 | |||
| 1719 | Ga0070679_100024796 | |||
| 1720 | Ga0070679_100077570 | |||
| 1721 | Ga0070679_100255296 | |||
| 1722 | Ga0070679_100424606 | |||
| 1723 | Ga0070684_100002568 | |||
| 1724 | Ga0070684_100019630 | |||
| 1725 | Ga0070684_100209007 | |||
| 1726 | Ga0070697_100018068 | |||
| 1727 | Ga0070697_100062705 | |||
| 1728 | Ga0070697_100086262 | |||
| 1729 | Ga0068853_100000618 | |||
| 1730 | Ga0068853_100023163 | |||
| 1731 | Ga0068853_100209951 | |||
| 1732 | Ga0068853_100274010 | |||
| 1733 | Ga0070672_100064046 | |||
| 1734 | Ga0070672_100098129 | |||
| 1735 | Ga0070672_100441018 | |||
| 1736 | Ga0070686_100049895 | |||
| 1737 | Ga0070695_100029763 | |||
| 1738 | Ga0070696_100007257 | |||
| 1739 | Ga0070696_100016969 | |||
| 1740 | Ga0070696_100042617 | |||
| 1741 | Ga0070693_100000701 | |||
| 1742 | Ga0070665_100004456 | |||
| 1743 | Ga0070665_100008740 | |||
| 1744 | Ga0070665_100112939 | |||
| 1745 | Ga0070665_100245041 | |||
| 1746 | Ga0070704_100031792 | |||
| 1747 | Ga0068855_100000065 | |||
| 1748 | Ga0068855_100000814 | |||
| 1749 | Ga0068855_100033827 | |||
| 1750 | Ga0068855_100056314 | |||
| 1751 | Ga0068855_100071755 | |||
| 1752 | Ga0068855_100080702 | |||
| 1753 | Ga0068855_100104458 | |||
| 1754 | Ga0068855_100128650 | |||
| 1755 | Ga0068855_100137688 | |||
| 1756 | Ga0068855_100150705 | |||
| 1757 | Ga0068855_100201491 | |||
| 1758 | Ga0070664_100000008 | |||
| 1759 | Ga0070664_100000371 | |||
| 1760 | Ga0070664_100000976 | |||
| 1761 | Ga0070664_100031961 | |||
| 1762 | Ga0070664_100049121 | |||
| 1763 | Ga0070664_100052409 | |||
| 1764 | Ga0070664_100128177 | |||
| 1765 | Ga0070664_100150055 | |||
| 1766 | Ga0070664_100183183 | |||
| 1767 | Ga0068857_100000964 | |||
| 1768 | Ga0068857_100002479 | |||
| 1769 | Ga0068857_100003440 | |||
| 1770 | Ga0068857_100012910 | |||
| 1771 | Ga0068857_100027691 | |||
| 1772 | Ga0068857_100037434 | |||
| 1773 | Ga0068857_100229773 | |||
| 1774 | Ga0068854_100000072 | |||
| 1775 | Ga0068854_100008004 | |||
| 1776 | Ga0068854_100024239 | |||
| 1777 | Ga0068854_100054874 | |||
| 1778 | Ga0068854_100116812 | |||
| 1779 | Ga0068854_100159925 | |||
| 1780 | Ga0068854_100222229 | |||
| 1781 | Ga0068856_100000009 | |||
| 1782 | Ga0068856_100000381 | |||
| 1783 | Ga0068856_100007513 | |||
| 1784 | Ga0068856_100039316 | |||
| 1785 | Ga0068856_100071796 | |||
| 1786 | Ga0068856_100110111 | |||
| 1787 | Ga0068856_100146549 | |||
| 1788 | Ga0068856_100443537 | |||
| 1789 | Ga0068856_100499001 | |||
| 1790 | Ga0070702_100041952 | |||
| 1791 | Ga0068852_100011015 | |||
| 1792 | Ga0068852_100015740 | |||
| 1793 | Ga0068852_100015760 | |||
| 1794 | Ga0068852_100049214 | |||
| 1795 | Ga0068852_100125474 | |||
| 1796 | Ga0068852_100126895 | |||
| 1797 | Ga0068852_100177080 | |||
| 1798 | Ga0068852_100261300 | |||
| 1799 | Ga0068852_100400755 | |||
| 1800 | Ga0068859_100010089 | |||
| 1801 | Ga0068859_100049387 | |||
| 1802 | Ga0068859_100175084 | |||
| 1803 | Ga0068864_100036132 | |||
| 1804 | Ga0068864_100052039 | |||
| 1805 | Ga0068864_100344725 | |||
| 1806 | Ga0068866_10000875 | |||
| 1807 | Ga0068866_10006393 | |||
| 1808 | Ga0068861_100273431 | |||
| 1809 | Ga0068851_10002246 | |||
| 1810 | Ga0068851_10002598 | |||
| 1811 | Ga0068851_10002993 | |||
| 1812 | Ga0068851_10013339 | |||
| 1813 | Ga0068870_10041982 | |||
| 1814 | Ga0068870_10061792 | |||
| 1815 | Ga0068863_100047814 | |||
| 1816 | Ga0068863_100048955 | |||
| 1817 | Ga0068863_100460484 | |||
| 1818 | Ga0068858_100004190 | |||
| 1819 | Ga0068858_100006956 | |||
| 1820 | Ga0068858_100035327 | |||
| 1821 | Ga0068858_100106299 | |||
| 1822 | Ga0068860_100013479 | |||
| 1823 | Ga0068860_100085295 | |||
| 1824 | Ga0068862_100006988 | |||
| 1825 | Ga0081539_10019130 | |||
| 1826 | Ga0075365_10001116 | |||
| 1827 | Ga0075363_100002525 | |||
| 1828 | Ga0075364_10002412 | |||
| 1829 | Ga0075364_10005636 | |||
| 1830 | Ga0075364_10007917 | |||
| 1831 | Ga0075432_10005289 | |||
| 1832 | Ga0075432_10082882 | |||
| 1833 | Ga0070715_10097676 | |||
| 1834 | Ga0070715_10133470 | |||
| 1835 | Ga0070712_100015039 | |||
| 1836 | Ga0075362_10017034 | |||
| 1837 | Ga0075366_10004606 | |||
| 1838 | Ga0075366_10043213 | |||
| 1839 | Ga0075366_10137234 | |||
| 1840 | Ga0097621_100007071 | |||
| 1841 | Ga0097621_100119038 | |||
| 1842 | Ga0075370_10001052 | |||
| 1843 | Ga0075370_10005993 | |||
| 1844 | Ga0075370_10006478 | |||
| 1845 | Ga0075370_10011878 | |||
| 1846 | Ga0075370_10027724 | |||
| 1847 | Ga0075370_10042864 | |||
| 1848 | Ga0075370_10053563 | |||
| 1849 | Ga0075370_10129466 | |||
| 1850 | Ga0068871_100010132 | |||
| 1851 | Ga0068871_100011438 | |||
| 1852 | Ga0068871_100294527 | |||
| 1853 | Ga0075434_100137774 | |||
| 1854 | Ga0075434_100438060 | |||
| 1855 | Ga0068865_100112171 | |||
| 1856 | Ga0075436_100171298 | |||
| 1857 | Ga0097620_100010089 | |||
| 1858 | Ga0097620_100049385 | |||
| 1859 | Ga0097620_100175085 | |||
| 1860 | Ga0097620_100211476 | |||
| 1861 | Ga0079104_1000231 | |||
| 1862 | Ga0079104_1000864 | |||
| 1863 | Ga0079104_1001566 | |||
| 1864 | Ga0099826_10000238 | |||
| 1865 | Ga0075435_100031847 | |||
| 1866 | Ga0105251_10000128 | |||
| 1867 | Ga0105251_10000280 | |||
| 1868 | Ga0105251_10000892 | |||
| 1869 | Ga0105251_10002010 | |||
| 1870 | Ga0105251_10003742 | |||
| 1871 | Ga0105251_10014555 | |||
| 1872 | Ga0105251_10046774 | |||
| 1873 | Ga0105244_10000836 | |||
| 1874 | Ga0105244_10003234 | |||
| 1875 | Ga0105244_10012661 | |||
| 1876 | Ga0105244_10103412 | |||
| 1877 | Ga0105250_10000003 | |||
| 1878 | Ga0105250_10001728 | |||
| 1879 | Ga0105250_10009475 | |||
| 1880 | Ga0105250_10017251 | |||
| 1881 | Ga0105240_10001226 | |||
| 1882 | Ga0105240_10020181 | |||
| 1883 | Ga0105240_10020537 | |||
| 1884 | Ga0105240_10034137 | |||
| 1885 | Ga0105240_10045681 | |||
| 1886 | Ga0105240_10070546 | |||
| 1887 | Ga0105240_10083821 | |||
| 1888 | Ga0105240_10086744 | |||
| 1889 | Ga0105240_10154485 | |||
| 1890 | Ga0105240_10168533 | |||
| 1891 | Ga0105245_10011793 | |||
| 1892 | Ga0105245_10081881 | |||
| 1893 | Ga0105245_10097490 | |||
| 1894 | Ga0105247_10000025 | |||
| 1895 | Ga0114129_10063689 | |||
| 1896 | Ga0105243_10012776 | |||
| 1897 | Ga0105243_10019159 | |||
| 1898 | Ga0105243_10124092 | |||
| 1899 | Ga0105243_10215976 | |||
| 1900 | Ga0105241_10004859 | |||
| 1901 | Ga0105241_10009081 | |||
| 1902 | Ga0105241_10170548 | |||
| 1903 | Ga0105242_10001479 | |||
| 1904 | Ga0105242_10003609 | |||
| 1905 | Ga0105248_10001100 | |||
| 1906 | Ga0105248_10021561 | |||
| 1907 | Ga0105248_10231464 | |||
| 1908 | Ga0105248_10694320 | |||
| 1909 | Ga0105248_10865413 | |||
| 1910 | Ga0105237_10007380 | |||
| 1911 | Ga0105237_10198579 | |||
| 1912 | Ga0105237_10394179 | |||
| 1913 | Ga0105237_10454371 | |||
| 1914 | Ga0105238_10003854 | |||
| 1915 | Ga0105238_10008692 | |||
| 1916 | Ga0105238_10016180 | |||
| 1917 | Ga0105238_10066930 | |||
| 1918 | Ga0105238_10327290 | |||
| 1919 | Ga0105249_10081230 | |||
| 1920 | Ga0105239_10018646 | |||
| 1921 | Ga0105239_10046798 | |||
| 1922 | Ga0105239_10058381 | |||
| 1923 | Ga0105239_10814223 | |||
| 1924 | Ga0105246_10029427 | |||
| 1925 | Ga0105246_10071635 | |||
| 1926 | Ga0105246_10176018 | |||
| 1927 | Ga0105246_10371569 | |||
| 1928 | Ga0157373_10000246 | |||
| 1929 | Ga0157373_10000690 | |||
| 1930 | Ga0157373_10003596 | |||
| 1931 | Ga0157373_10004570 | |||
| 1932 | Ga0157373_10042899 | |||
| 1933 | Ga0157373_10052705 | |||
| 1934 | Ga0157371_10000068 | |||
| 1935 | Ga0157371_10000403 | |||
| 1936 | Ga0157371_10001844 | |||
| 1937 | Ga0157371_10022773 | |||
| 1938 | Ga0157371_10029347 | |||
| 1939 | Ga0157371_10050004 | |||
| 1940 | Ga0157371_10102698 | |||
| 1941 | Ga0157370_10000588 | |||
| 1942 | Ga0157370_10033262 | |||
| 1943 | Ga0157370_10046640 | |||
| 1944 | Ga0157370_10067702 | |||
| 1945 | Ga0157370_10083102 | |||
| 1946 | Ga0157370_10203762 | |||
| 1947 | Ga0157369_10000806 | |||
| 1948 | Ga0157369_10001198 | |||
| 1949 | Ga0157369_10039686 | |||
| 1950 | Ga0157369_10057748 | |||
| 1951 | Ga0157369_10071126 | |||
| 1952 | Ga0157369_10146496 | |||
| 1953 | Ga0157369_10260040 | |||
| 1954 | Ga0157369_10494501 | |||
| 1955 | Ga0157374_10010415 | |||
| 1956 | Ga0157378_10012484 | |||
| 1957 | Ga0157378_10026369 | |||
| 1958 | Ga0157378_10047254 | |||
| 1959 | Ga0157378_10136045 | |||
| 1960 | Ga0163162_10002664 | |||
| 1961 | Ga0163162_10008020 | |||
| 1962 | Ga0163162_10200481 | |||
| 1963 | Ga0163162_10328247 | |||
| 1964 | Ga0163162_10380477 | |||
| 1965 | Ga0157372_10002109 | |||
| 1966 | Ga0157372_10013717 | |||
| 1967 | Ga0157372_10025209 | |||
| 1968 | Ga0157372_10026577 | |||
| 1969 | Ga0157372_10029945 | |||
| 1970 | Ga0157372_10047958 | |||
| 1971 | Ga0157372_10201638 | |||
| 1972 | Ga0157372_10225700 | |||
| 1973 | Ga0157372_10389608 | |||
| 1974 | Ga0157372_10808244 | |||
| 1975 | Ga0157375_10014030 | |||
| 1976 | Ga0157375_10109466 | |||
| 1977 | Ga0163163_10137043 | |||
| 1978 | Ga0163163_10300795 | |||
| 1979 | Ga0182008_10008606 | |||
| 1980 | Ga0182008_10017906 | |||
| 1981 | Ga0182008_10053551 | |||
| 1982 | Ga0182008_10054352 | |||
| 1983 | Ga0182008_10054448 | |||
| 1984 | Ga0157377_10207867 | |||
| 1985 | Ga0157379_10000822 | |||
| 1986 | Ga0157379_10031635 | |||
| 1987 | Ga0157379_10043114 | |||
| 1988 | Ga0157379_10172638 | |||
| 1989 | Ga0157376_10040111 | |||
| 1990 | Ga0157376_10050364 | |||
| 1991 | Ga0157376_10065990 | |||
| 1992 | Ga0157376_10066190 | |||
| 1993 | Ga0182006_1002752 | |||
| 1994 | Ga0182006_1004738 | |||
| 1995 | Ga0182006_1010306 | |||
| 1996 | Ga0182006_1065386 | |||
| 1997 | Ga0182007_10004564 | |||
| 1998 | Ga0182005_1000072 | |||
| 1999 | Ga0183361_11773 | |||
| 2000 | Ga0163161_10000001 | |||
| 2001 | Ga0163161_10000092 | |||
| 2002 | Ga0163161_10040958 | |||
| 2003 | Ga0163161_10052349 | |||
| 2004 | Ga0206356_11752824 | |||
| 2005 | Ga0206353_10213026 | |||
| 2006 | Ga0213872_10028976 | |||
| 2007 | Ga0213872_10032545 | |||
| 2008 | Ga0209435_100008 | |||
| 2009 | Ga0209760_100605 | |||
| 2010 | Ga0209784_100002 | |||
| 2011 | Ga0209784_100010 | |||
| 2012 | Ga0209784_100815 | |||
| 2013 | Ga0209784_101126 | |||
| 2014 | Ga0209566_100003 | |||
| 2015 | Ga0209566_100008 | |||
| 2016 | Ga0209566_100421 | |||
| 2017 | Ga0209674_100004 | |||
| 2018 | Ga0209674_100013 | |||
| 2019 | Ga0209674_100019 | |||
| 2020 | Ga0209674_100188 | |||
| 2021 | Ga0209674_100199 | |||
| 2022 | Ga0209674_100267 | |||
| 2023 | Ga0209672_100010 | |||
| 2024 | Ga0209672_100031 | |||
| 2025 | Ga0209672_100335 | |||
| 2026 | Ga0209672_101072 | |||
| 2027 | Ga0209147_100006 | |||
| 2028 | Ga0209147_100040 | |||
| 2029 | Ga0209563_100006 | |||
| 2030 | Ga0209563_100021 | |||
| 2031 | Ga0207427_100762 | |||
| 2032 | Ga0207427_101758 | |||
| 2033 | Ga0209437_100019 | |||
| 2034 | Ga0209437_100045 | |||
| 2035 | Ga0209258_100010 | |||
| 2036 | Ga0209258_100061 | |||
| 2037 | Ga0209258_100099 | |||
| 2038 | Ga0207425_1000350 | |||
| 2039 | Ga0207425_1003335 | |||
| 2040 | Ga0209646_1000029 | |||
| 2041 | Ga0209646_1000059 | |||
| 2042 | Ga0209026_1000016 | |||
| 2043 | Ga0209677_100003 | |||
| 2044 | Ga0209677_100011 | |||
| 2045 | Ga0209148_1000018 | |||
| 2046 | Ga0209148_1000021 | |||
| 2047 | Ga0209148_1000070 | |||
| 2048 | Ga0209148_1000103 | |||
| 2049 | Ga0209759_1000016 | |||
| 2050 | Ga0209759_1000251 | |||
| 2051 | Ga0209759_1000261 | |||
| 2052 | Ga0209759_1000309 | |||
| 2053 | Ga0209759_1013107 | |||
| 2054 | Ga0209129_1000007 | |||
| 2055 | Ga0209129_1000164 | |||
| 2056 | Ga0209129_1023641 | |||
| 2057 | Ga0209233_1000025 | |||
| 2058 | Ga0209233_1000093 | |||
| 2059 | Ga0209565_1000061 | |||
| 2060 | Ga0209565_1000075 | |||
| 2061 | Ga0209565_1000697 | |||
| 2062 | Ga0209565_1003533 | |||
| 2063 | Ga0209455_1000015 | |||
| 2064 | Ga0209455_1000069 | |||
| 2065 | Ga0209673_1000026 | |||
| 2066 | Ga0209673_1000133 | |||
| 2067 | Ga0209673_1000298 | |||
| 2068 | Ga0209673_1000304 | |||
| 2069 | Ga0209673_1001340 | |||
| 2070 | Ga0209673_1002778 | |||
| 2071 | Ga0209673_1017220 | |||
| 2072 | Ga0209130_1000014 | |||
| 2073 | Ga0209130_1002015 | |||
| 2074 | Ga0209130_1003534 | |||
| 2075 | Ga0209130_1003764 | |||
| 2076 | Ga0209675_1000074 | |||
| 2077 | Ga0209675_1000098 | |||
| 2078 | Ga0209675_1000660 | |||
| 2079 | Ga0209675_1000884 | |||
| 2080 | Ga0209675_1007168 | |||
| 2081 | Ga0209675_1014643 | |||
| 2082 | Ga0209676_1000013 | |||
| 2083 | Ga0209676_1000122 | |||
| 2084 | Ga0209676_1000301 | |||
| 2085 | Ga0209676_1005284 | |||
| 2086 | Ga0209676_1027095 | |||
| 2087 | Ga0209025_1000073 | |||
| 2088 | Ga0209025_1000935 | |||
| 2089 | Ga0209025_1001239 | |||
| 2090 | Ga0209025_1006026 | |||
| 2091 | Ga0209025_1017606 | |||
| 2092 | Ga0209025_1022432 | |||
| 2093 | Ga0209025_1023192 | |||
| 2094 | Ga0209564_1000062 | |||
| 2095 | Ga0209564_1000181 | |||
| 2096 | Ga0209564_1000247 | |||
| 2097 | Ga0209564_1000524 | |||
| 2098 | Ga0209564_1000594 | |||
| 2099 | Ga0209564_1007384 | |||
| 2100 | Ga0209564_1028162 | |||
| 2101 | Ga0209758_1000025 | |||
| 2102 | Ga0209758_1000280 | |||
| 2103 | Ga0209758_1000820 | |||
| 2104 | Ga0209758_1032246 | |||
| 2105 | Ga0209050_1000002 | |||
| 2106 | Ga0209050_1000008 | |||
| 2107 | Ga0209050_1000736 | |||
| 2108 | Ga0209050_1004147 | |||
| 2109 | Ga0209050_1020428 | |||
| 2110 | Ga0209256_1000039 | |||
| 2111 | Ga0209256_1000050 | |||
| 2112 | Ga0209256_1000063 | |||
| 2113 | Ga0209256_1000280 | |||
| 2114 | Ga0207426_1000001 | |||
| 2115 | Ga0207426_1000028 | |||
| 2116 | Ga0207426_1000242 | |||
| 2117 | Ga0207426_1001464 | |||
| 2118 | Ga0209051_1000002 | |||
| 2119 | Ga0209051_1000005 | |||
| 2120 | Ga0209051_1000541 | |||
| 2121 | Ga0209051_1000936 | |||
| 2122 | Ga0209051_1006164 | |||
| 2123 | Ga0209257_1000002 | |||
| 2124 | Ga0209257_1000031 | |||
| 2125 | Ga0209257_1007245 | |||
| 2126 | Ga0209257_1017216 | |||
| 2127 | Ga0209257_1023053 | |||
| 2128 | Ga0207697_10003784 | |||
| 2129 | Ga0207656_10002257 | |||
| 2130 | Ga0207656_10026122 | |||
| 2131 | Ga0207696_1000001 | |||
| 2132 | Ga0207696_1000003 | |||
| 2133 | Ga0207696_1000966 | |||
| 2134 | Ga0207655_1007127 | |||
| 2135 | Ga0207655_1016097 | |||
| 2136 | Ga0207655_1064726 | |||
| 2137 | Ga0207713_1000006 | |||
| 2138 | Ga0207713_1000024 | |||
| 2139 | Ga0207713_1000026 | |||
| 2140 | Ga0207713_1000135 | |||
| 2141 | Ga0207713_1003242 | |||
| 2142 | Ga0207682_10016861 | |||
| 2143 | Ga0207692_10175089 | |||
| 2144 | Ga0207642_10010691 | |||
| 2145 | Ga0207710_10000140 | |||
| 2146 | Ga0207688_10033081 | |||
| 2147 | Ga0207688_10119514 | |||
| 2148 | Ga0207680_10072320 | |||
| 2149 | Ga0207680_10159552 | |||
| 2150 | Ga0207647_10007601 | |||
| 2151 | Ga0207685_10075687 | |||
| 2152 | Ga0207699_10009877 | |||
| 2153 | Ga0207699_10027146 | |||
| 2154 | Ga0207699_10222174 | |||
| 2155 | Ga0207699_10352647 | |||
| 2156 | Ga0207645_10000888 | |||
| 2157 | Ga0207645_10005425 | |||
| 2158 | Ga0207645_10044963 | |||
| 2159 | Ga0207645_10112440 | |||
| 2160 | Ga0207643_10000322 | |||
| 2161 | Ga0207643_10029888 | |||
| 2162 | Ga0207705_10079291 | |||
| 2163 | Ga0207705_10288222 | |||
| 2164 | Ga0207705_10382617 | |||
| 2165 | Ga0207684_10011218 | |||
| 2166 | Ga0207684_10076043 | |||
| 2167 | Ga0207684_10360358 | |||
| 2168 | Ga0207654_10000006 | |||
| 2169 | Ga0207654_10006307 | |||
| 2170 | Ga0207654_10057067 | |||
| 2171 | Ga0207707_10000943 | |||
| 2172 | Ga0207707_10003952 | |||
| 2173 | Ga0207707_10008846 | |||
| 2174 | Ga0207707_10015683 | |||
| 2175 | Ga0207695_10000729 | |||
| 2176 | Ga0207695_10001256 | |||
| 2177 | Ga0207695_10003589 | |||
| 2178 | Ga0207695_10018907 | |||
| 2179 | Ga0207695_10158828 | |||
| 2180 | Ga0207671_10061577 | |||
| 2181 | Ga0207671_10225037 | |||
| 2182 | Ga0207671_10401030 | |||
| 2183 | Ga0207693_10003904 | |||
| 2184 | Ga0207693_10020216 | |||
| 2185 | Ga0207693_10022217 | |||
| 2186 | Ga0207693_10191345 | |||
| 2187 | Ga0207663_10008013 | |||
| 2188 | Ga0207663_10053911 | |||
| 2189 | Ga0207663_10088532 | |||
| 2190 | Ga0207663_10192868 | |||
| 2191 | Ga0207663_10201148 | |||
| 2192 | Ga0207660_10009870 | |||
| 2193 | Ga0207660_10018713 | |||
| 2194 | Ga0207660_10101650 | |||
| 2195 | Ga0207660_10131415 | |||
| 2196 | Ga0207662_10046737 | |||
| 2197 | Ga0207657_10000846 | |||
| 2198 | Ga0207657_10001947 | |||
| 2199 | Ga0207657_10005399 | |||
| 2200 | Ga0207657_10016935 | |||
| 2201 | Ga0207657_10136976 | |||
| 2202 | Ga0207657_10149832 | |||
| 2203 | Ga0207657_10331218 | |||
| 2204 | Ga0207649_10007371 | |||
| 2205 | Ga0207649_10009890 | |||
| 2206 | Ga0207649_10018324 | |||
| 2207 | Ga0207649_10151136 | |||
| 2208 | Ga0207652_10005810 | |||
| 2209 | Ga0207652_10006828 | |||
| 2210 | Ga0207652_10011458 | |||
| 2211 | Ga0207652_10014396 | |||
| 2212 | Ga0207652_10032103 | |||
| 2213 | Ga0207652_10039078 | |||
| 2214 | Ga0207652_10194820 | |||
| 2215 | Ga0207652_10287003 | |||
| 2216 | Ga0207646_10050698 | |||
| 2217 | Ga0207646_10077610 | |||
| 2218 | Ga0207646_10226137 | |||
| 2219 | Ga0207681_10010633 | |||
| 2220 | Ga0207694_10002475 | |||
| 2221 | Ga0207694_10004184 | |||
| 2222 | Ga0207694_10005105 | |||
| 2223 | Ga0207650_10001677 | |||
| 2224 | Ga0207659_10028667 | |||
| 2225 | Ga0207659_10199690 | |||
| 2226 | Ga0207687_10002669 | |||
| 2227 | Ga0207687_10012091 | |||
| 2228 | Ga0207687_10149996 | |||
| 2229 | Ga0207687_10396380 | |||
| 2230 | Ga0207700_10000092 | |||
| 2231 | Ga0207700_10030270 | |||
| 2232 | Ga0207700_10039869 | |||
| 2233 | Ga0207700_10148136 | |||
| 2234 | Ga0207664_10001295 | |||
| 2235 | Ga0207664_10017931 | |||
| 2236 | Ga0207664_10075941 | |||
| 2237 | Ga0207664_10320201 | |||
| 2238 | Ga0207644_10016637 | |||
| 2239 | Ga0207644_10032606 | |||
| 2240 | Ga0207644_10034362 | |||
| 2241 | Ga0207644_10036956 | |||
| 2242 | Ga0207644_10066784 | |||
| 2243 | Ga0207644_10112437 | |||
| 2244 | Ga0207644_10143078 | |||
| 2245 | Ga0207690_10001326 | |||
| 2246 | Ga0207690_10013278 | |||
| 2247 | Ga0207690_10013760 | |||
| 2248 | Ga0207690_10077490 | |||
| 2249 | Ga0207690_10089767 | |||
| 2250 | Ga0207690_10123091 | |||
| 2251 | Ga0207706_10000002 | |||
| 2252 | Ga0207706_10000542 | |||
| 2253 | Ga0207706_10001871 | |||
| 2254 | Ga0207706_10011474 | |||
| 2255 | Ga0207706_10021360 | |||
| 2256 | Ga0207706_10049534 | |||
| 2257 | Ga0207706_10083462 | |||
| 2258 | Ga0207686_10000264 | |||
| 2259 | Ga0207686_10010340 | |||
| 2260 | Ga0207709_10000830 | |||
| 2261 | Ga0207709_10017575 | |||
| 2262 | Ga0207669_10012201 | |||
| 2263 | Ga0207669_10097649 | |||
| 2264 | Ga0207704_10064481 | |||
| 2265 | Ga0207704_10104060 | |||
| 2266 | Ga0207665_10295189 | |||
| 2267 | Ga0207691_10012463 | |||
| 2268 | Ga0207691_10033680 | |||
| 2269 | Ga0207691_10062625 | |||
| 2270 | Ga0207691_10064868 | |||
| 2271 | Ga0207691_10438498 | |||
| 2272 | Ga0207711_10011935 | |||
| 2273 | Ga0207711_10090596 | |||
| 2274 | Ga0207711_10096552 | |||
| 2275 | Ga0207711_10125750 | |||
| 2276 | Ga0207711_10136888 | |||
| 2277 | Ga0207689_10000028 | |||
| 2278 | Ga0207689_10010418 | |||
| 2279 | Ga0207689_10047828 | |||
| 2280 | Ga0207661_10016709 | |||
| 2281 | Ga0207661_10387660 | |||
| 2282 | Ga0207679_10001031 | |||
| 2283 | Ga0207679_10019797 | |||
| 2284 | Ga0207679_10038640 | |||
| 2285 | Ga0207679_10046787 | |||
| 2286 | Ga0207679_10052011 | |||
| 2287 | Ga0207679_10086417 | |||
| 2288 | Ga0207679_10143390 | |||
| 2289 | Ga0207679_10250811 | |||
| 2290 | Ga0207667_10000025 | |||
| 2291 | Ga0207667_10000771 | |||
| 2292 | Ga0207667_10003035 | |||
| 2293 | Ga0207667_10023049 | |||
| 2294 | Ga0207667_10043960 | |||
| 2295 | Ga0207667_10083700 | |||
| 2296 | Ga0207667_10121123 | |||
| 2297 | Ga0207667_10180193 | |||
| 2298 | Ga0207667_10273894 | |||
| 2299 | Ga0207667_10344735 | |||
| 2300 | Ga0207651_10000809 | |||
| 2301 | Ga0207651_10010536 | |||
| 2302 | Ga0207651_10047380 | |||
| 2303 | Ga0207651_10128613 | |||
| 2304 | Ga0207651_10171297 | |||
| 2305 | Ga0207651_10217695 | |||
| 2306 | Ga0207712_10071437 | |||
| 2307 | Ga0207668_10011691 | |||
| 2308 | Ga0207668_10280006 | |||
| 2309 | Ga0207640_10000088 | |||
| 2310 | Ga0207640_10008896 | |||
| 2311 | Ga0207640_10037096 | |||
| 2312 | Ga0207640_10043546 | |||
| 2313 | Ga0207640_10431298 | |||
| 2314 | Ga0207658_10011284 | |||
| 2315 | Ga0207658_10079531 | |||
| 2316 | Ga0207658_10168185 | |||
| 2317 | Ga0207658_10264907 | |||
| 2318 | Ga0207677_10000683 | |||
| 2319 | Ga0207677_10008644 | |||
| 2320 | Ga0207677_10020504 | |||
| 2321 | Ga0207677_10099109 | |||
| 2322 | Ga0207677_10245412 | |||
| 2323 | Ga0207703_10014654 | |||
| 2324 | Ga0207703_10018635 | |||
| 2325 | Ga0207703_10065942 | |||
| 2326 | Ga0207703_10166464 | |||
| 2327 | Ga0207639_10001521 | |||
| 2328 | Ga0207639_10008293 | |||
| 2329 | Ga0207639_10337871 | |||
| 2330 | Ga0207678_10007039 | |||
| 2331 | Ga0207678_10053259 | |||
| 2332 | Ga0207678_10061782 | |||
| 2333 | Ga0207678_10079885 | |||
| 2334 | Ga0207678_10113627 | |||
| 2335 | Ga0207678_10161176 | |||
| 2336 | Ga0207678_10209094 | |||
| 2337 | Ga0207708_10000643 | |||
| 2338 | Ga0207708_10153046 | |||
| 2339 | Ga0207702_10000925 | |||
| 2340 | Ga0207702_10053553 | |||
| 2341 | Ga0207702_10088357 | |||
| 2342 | Ga0207702_10096176 | |||
| 2343 | Ga0207702_10170898 | |||
| 2344 | Ga0207702_10407851 | |||
| 2345 | Ga0207641_10012053 | |||
| 2346 | Ga0207641_10040206 | |||
| 2347 | Ga0207648_10000894 | |||
| 2348 | Ga0207648_10001620 | |||
| 2349 | Ga0207648_10001939 | |||
| 2350 | Ga0207648_10022177 | |||
| 2351 | Ga0207648_10027470 | |||
| 2352 | Ga0207676_10001707 | |||
| 2353 | Ga0207676_10016541 | |||
| 2354 | Ga0207676_10018372 | |||
| 2355 | Ga0207676_10024146 | |||
| 2356 | Ga0207676_10228281 | |||
| 2357 | Ga0207674_10000064 | |||
| 2358 | Ga0207674_10000296 | |||
| 2359 | Ga0207674_10001590 | |||
| 2360 | Ga0207674_10002028 | |||
| 2361 | Ga0207674_10002285 | |||
| 2362 | Ga0207674_10018501 | |||
| 2363 | Ga0207674_10026383 | |||
| 2364 | Ga0207674_10026973 | |||
| 2365 | Ga0207674_10033552 | |||
| 2366 | Ga0207675_100000552 | |||
| 2367 | Ga0207675_100128149 | |||
| 2368 | Ga0207675_100154198 | |||
| 2369 | Ga0207675_100179395 | |||
| 2370 | Ga0207683_10000546 | |||
| 2371 | Ga0207683_10000722 | |||
| 2372 | Ga0207683_10002014 | |||
| 2373 | Ga0207683_10085585 | |||
| 2374 | Ga0207683_10134740 | |||
| 2375 | Ga0207683_10248920 | |||
| 2376 | Ga0207698_10006318 | |||
| 2377 | Ga0207698_10008199 | |||
| 2378 | Ga0207698_10027589 | |||
| 2379 | Ga0207698_10046993 | |||
| 2380 | Ga0207698_10081071 | |||
| 2381 | Ga0207698_10128975 | |||
| 2382 | Ga0207698_10147383 | |||
| 2383 | Ga0207698_10186768 | |||
| 2384 | Ga0207698_10197704 | |||
| 2385 | Ga0207698_10311928 | |||
| 2386 | Ga0209281_1000008 | |||
| 2387 | Ga0209281_1000148 | |||
| 2388 | Ga0209281_1000204 | |||
| 2389 | Ga0209281_1000354 | |||
| 2390 | Ga0209371_1000177 | |||
| 2391 | Ga0209371_1000215 | |||
| 2392 | Ga0209371_1001362 | |||
| 2393 | Ga0209371_1003669 | |||
| 2394 | Ga0209371_1022028 | |||
| 2395 | Ga0209371_1022036 | |||
| 2396 | Ga0209999_1010228 | |||
| 2397 | Ga0209983_1012647 | |||
| 2398 | Ga0209282_1000114 | |||
| 2399 | Ga0209971_1003810 | |||
| 2400 | Ga0209998_10008075 | |||
| 2401 | Ga0209974_10003049 | |||
| 2402 | Ga0268266_10010671 | |||
| 2403 | Ga0268266_10058221 | |||
| 2404 | Ga0268266_10067378 | |||
| 2405 | Ga0268266_10128712 | |||
| 2406 | Ga0268266_10421255 | |||
| 2407 | Ga0268264_10004834 | |||
| 2408 | Ga0268264_10022048 | |||
| 2409 | Ga0268264_10037345 | |||
| 2410 | Ga0268264_10097863 | |||
| 2411 | Ga0268264_10228777 | |||
| 2412 | Ga0268264_10505854 | |||
| 2413 | Ga0307517_10000395 | |||
| 2414 | Ga0307517_10045823 | |||
| 2415 | Ga0307517_10148469 | |||
| 2416 | Ga0307515_10000463 | |||
| 2417 | Ga0307515_10000515 | |||
| 2418 | Ga0307515_10001074 | |||
| 2419 | Ga0307515_10027481 | |||
| 2420 | Ga0265338_10021924 | |||
| 2421 | Ga0268256_1000172 | |||
| 2422 | Ga0268256_1000191 | |||
| 2423 | Ga0268256_1001592 | |||
| 2424 | Ga0268256_1001905 | |||
| 2425 | Ga0268256_1024808 | |||
| 2426 | Ga0307512_10030754 | |||
| 2427 | Ga0307512_10200560 | |||
| 2428 | Ga0316180_1113847 | |||
| 2429 | Ga0316181_1060367 | |||
| 2430 | Ga0265330_10003359 | |||
| 2431 | Ga0265332_10000438 | |||
| 2432 | Ga0265328_10068599 | |||
| 2433 | Ga0265325_10078903 | |||
| 2434 | Ga0265327_10030070 | |||
| 2435 | Ga0265327_10046166 | |||
| 2436 | Ga0265316_10017701 | |||
| 2437 | Ga0307513_10002544 | |||
| 2438 | Ga0307513_10057955 | |||
| 2439 | Ga0307513_10145442 | |||
| 2440 | Ga0307513_10272959 | |||
| 2441 | Ga0307509_10004851 | |||
| 2442 | Ga0307509_10014070 | |||
| 2443 | Ga0307509_10040885 | |||
| 2444 | Ga0307509_10059845 | |||
| 2445 | Ga0307408_100003042 | |||
| 2446 | Ga0307408_100004174 | |||
| 2447 | Ga0307408_100012408 | |||
| 2448 | Ga0307508_10000130 | |||
| 2449 | Ga0307508_10003625 | |||
| 2450 | Ga0307508_10016910 | |||
| 2451 | Ga0307508_10059234 | |||
| 2452 | Ga0307508_10068121 | |||
| 2453 | Ga0307508_10076807 | |||
| 2454 | Ga0307514_10000529 | |||
| 2455 | Ga0307514_10068998 | |||
| 2456 | Ga0307514_10095226 | |||
| 2457 | Ga0265314_10079452 | |||
| 2458 | Ga0307516_10019556 | |||
| 2459 | Ga0307516_10029179 | |||
| 2460 | Ga0307516_10069305 | |||
| 2461 | Ga0307405_10004432 | |||
| 2462 | Ga0307413_10003848 | |||
| 2463 | Ga0307410_10052589 | |||
| 2464 | Ga0307406_10004110 | |||
| 2465 | Ga0307406_10020893 | |||
| 2466 | Ga0307406_10111223 | |||
| 2467 | Ga0307407_10328653 | |||
| 2468 | Ga0307412_10031403 | |||
| 2469 | Ga0307412_10074524 | |||
| 2470 | Ga0307409_100031965 | |||
| 2471 | Ga0307409_100035738 | |||
| 2472 | Ga0307409_100152169 | |||
| 2473 | Ga0307416_100002137 | |||
| 2474 | Ga0307416_100013476 | |||
| 2475 | Ga0307416_100019776 | |||
| 2476 | Ga0307416_100319239 | |||
| 2477 | Ga0307414_10019272 | |||
| 2478 | Ga0307414_10029101 | |||
| 2479 | Ga0307414_10174423 | |||
| 2480 | Ga0307411_10068599 | |||
| 2481 | Ga0307507_10070943 | |||
| 2482 | Ga0307510_10018668 | |||
| 2483 | Ga0307510_10064176 | |||
| 2484 | Ga0307510_10121617 | |||
| 2485 | Ga0373948_0009747 | |||
| 2486 | Ga0373944_0046992 | |||
| 2487 | Ga0373953_0003510 | |||
| 2488 | Ga0373954_0092908 | |||
| 2489 | Ga0373956_0012147 | |||
| 2490 | Ga0373943_0013632 | |||
| 2491 | Ga0373943_0095092 | |||
| 2492 | Ga0373946_0002067 | |||
| 2493 | Ga0373946_0035278 | |||
| 2494 | Ga0373955_0015896 | |||
| 2495 | Ga0373955_0025344 | |||
| 2496 | Ga0373955_0078877 | |||
| 2497 | Ga0373935_0054218 | |||
| 2498 | Ga0373935_0150850 | |||
| 2499 | Ga0373935_0240751 | |||
| 2500 | Ga0373927_0041944 | |||
| 2501 | Ga0373927_0085034 | |||
| 2502 | Ga0373933_0094684 | |||
| 2503 | Ga0373933_0141124 | |||
| 2504 | Ga0373947_0026904 | |||
| 2505 | Ga0373947_0037116 | |||
| 2506 | Ga0373947_0057791 | |||
| 2507 | Ga0373947_0302774 | |||
| 2508 | Ga0373937_0030237 | |||
| 2509 | Ga0373937_0050884 | |||
| 2510 | Ga0373937_0067007 | |||
| 2511 | Ga0373937_0408180 | |||
| 2512 | Ga0373925_0003796 | |||
| 2513 | Ga0373925_0018343 | |||
| 2514 | Ga0373925_0069217 | |||
| 2515 | Ga0373925_0083616 | |||
| 2516 | Ga0373925_0091297 | |||
| 2517 | Ga0373925_0091667 | |||
| 2518 | Ga0395899_0036110 | |||
| 2519 | Ga0395899_0110094 | |||
| 2520 | Ga0395900_0021769 | |||
| 2521 | Ga0395900_0085986 | |||
| 2522 | Ga0395900_0117199 | |||
| 2523 | Ga0395900_0123864 | |||
| 2524 | Ga0395900_0159417 | |||
| 2525 | Ga0395898_0068061 | |||
| 2526 | Ga0395905_0000004 | |||
| 2527 | Ga0395905_0242018 | |||
| 2528 | Ga0395901_0000095 | |||
| 2529 | Ga0395901_0029761 | |||
| 2530 | Ga0395901_0116449 | |||
| 2531 | Ga0395901_0671044 | |||
| 2532 | Ga0436361_0097666 | |||
| 2533 | Ga0436361_0371933 | |||
| 2534 | Ga0436361_0767394 | |||
| 2535 | Ga0439466_0065556 | |||
| 2536 | Ga0451833_0434451 | |||
| 2537 | Ga0451837_1483507 | |||
| 2538 | Ga0451853_4081205 | |||
| 2539 | Ga0439431_0001194 | |||
| 2540 | Ga0439442_005272 | |||
| 2541 | Ga0439432_008000 | |||
| 2542 | Ga0439432_020234 | |||
| 2543 | Ga0439452_000001 | |||
| 2544 | Ga0439452_023789 | |||
| 2545 | Ga0450908_001364 | |||
| 2546 | Ga0450918_000203 | |||
| 2547 | Ga0466969_0034777 | |||
| 2548 | Ga0466972_0156050 | |||
| 2549 | Ga0466977_0007265 | |||
| 2550 | Ga0466966_0000107 | |||
| 2551 | Ga0466961_0000068 | |||
| 2552 | Ga0466963_0004228 | |||
| 2553 | Ga0451576_0122776 | |||
| 2554 | Ga0466958_0062195 | |||
| 2555 | Ga0466958_0151295 | |||
| 2556 | Ga0466967_0537169 | |||
| 2557 | Ga0495627_000018 | |||
| 2558 | Ga0495627_011240 | |||
| 2559 | Ga0495592_0002659 | |||
| 2560 | Ga0495592_0015849 | |||
| 2561 | Ga0495592_0048280 | |||
| 2562 | Ga0495592_0060087 | |||
| 2563 | Ga0495592_0080844 | |||
| 2564 | Ga0495603_0000357 | |||
| 2565 | Ga0495603_0010443 | |||
| 2566 | Ga0495603_0143118 | |||
| 2567 | Ga0495590_0001953 | |||
| 2568 | Ga0495590_0064363 | |||
| 2569 | Ga0495591_001746 | |||
| 2570 | Ga0495629_0000019 | |||
| 2571 | Ga0495629_0000324 | |||
| 2572 | Ga0495629_0016801 | |||
| 2573 | Ga0495629_0267931 | |||
| 2574 | Ga0495638_0008187 | |||
| 2575 | Ga0495651_0013765 | |||
| 2576 | Ga0495651_0047323 | |||
| 2577 | Ga0495653_0001772 | |||
| 2578 | Ga0495653_0003919 | |||
| 2579 | Ga0495653_0006411 | |||
| 2580 | Ga0495653_0038033 | |||
| 2581 | Ga0495653_0326251 | |||
| 2582 | Ga0495650_0020095 | |||
| 2583 | Ga0495580_0001459 | |||
| 2584 | Ga0495580_0002389 | |||
| 2585 | Ga0495580_0015985 | |||
| 2586 | Ga0495580_0027959 | |||
| 2587 | Ga0495580_0043830 | |||
| 2588 | Ga0495582_0001061 | |||
| 2589 | Ga0495582_0011323 | |||
| 2590 | Ga0495582_0021956 | |||
| 2591 | Ga0495582_0024214 | |||
| 2592 | Ga0495605_0004558 | |||
| 2593 | Ga0495605_0007909 | |||
| 2594 | Ga0495639_0121035 | |||
| 2595 | Ga0495664_0002904 | |||
| 2596 | Ga0495664_0007199 | |||
| 2597 | Ga0495664_0010869 | |||
| 2598 | Ga0495596_0003607 | |||
| 2599 | Ga0495607_0000222 | |||
| 2600 | Ga0495583_0001486 | |||
| 2601 | Ga0495583_0010931 | |||
| 2602 | Ga0495606_0053530 | |||
| 2603 | Ga0495606_0128822 | |||
| 2604 | Ga0495608_0026339 | |||
| 2605 | Ga0495608_0069251 | |||
| 2606 | Ga0495608_0141463 | |||
| 2607 | Ga0495616_0020440 | |||
| 2608 | Ga0495618_0027868 | |||
| 2609 | Ga0495618_0036016 | |||
| 2610 | Ga0495618_0062376 | |||
| 2611 | Ga0495620_0005744 | |||
| 2612 | Ga0495620_0020987 | |||
| 2613 | Ga0495628_0001514 | |||
| 2614 | Ga0495628_0016911 | |||
| 2615 | Ga0495628_0026223 | |||
| 2616 | Ga0495628_0057183 | |||
| 2617 | Ga0495628_0147222 | |||
| 2618 | Ga0495628_0372747 | |||
| 2619 | Ga0495628_0406625 | |||
| 2620 | Ga0495630_0030909 | |||
| 2621 | Ga0495630_0042170 | |||
| 2622 | Ga0495630_0205007 | |||
| 2623 | Ga0495630_0236657 | |||
| 2624 | Ga0495631_0001000 | |||
| 2625 | Ga0495632_0005609 | |||
| 2626 | Ga0495632_0007553 | |||
| 2627 | Ga0495643_0027689 | |||
| 2628 | Ga0495648_0023429 | |||
| 2629 | Ga0495648_0028656 | |||
| 2630 | Ga0495648_0055020 | |||
| 2631 | Ga0495666_0000226 | |||
| 2632 | Ga0495666_0008250 | |||
| 2633 | Ga0495666_0089437 | |||
| 2634 | Ga0495652_0016659 | |||
| 2635 | Ga0495652_0034597 | |||
| 2636 | Ga0495652_0036332 | |||
| 2637 | Ga0495652_0104348 | |||
| 2638 | Ga0495652_0253880 | |||
| 2639 | Ga0495654_0001734 | |||
| 2640 | Ga0495654_0007676 | |||
| 2641 | Ga0495654_0013733 | |||
| 2642 | Ga0495654_0027712 | |||
| 2643 | Ga0495654_0109599 | |||
| 2644 | Ga0495665_0000719 | |||
| 2645 | Ga0495665_0001886 | |||
| 2646 | Ga0495665_0020567 | |||
| 2647 | Ga0495665_0027050 | |||
| 2648 | Ga0495665_0066714 | |||
| 2649 | Ga0495640_0003354 | |||
| 2650 | Ga0495640_0003716 | |||
| 2651 | Ga0495640_0037582 | |||
| 2652 | Ga0495586_0001072 | |||
| 2653 | Ga0495587_0004090 | |||
| 2654 | Ga0495587_0023429 | |||
| 2655 | Ga0495587_0280687 | |||
| 2656 | Ga0495621_0010337 | |||
| 2657 | Ga0495597_0000426 | |||
| 2658 | Ga0495645_0002971 | |||
| 2659 | Ga0495645_0013550 | |||
| 2660 | Ga0495633_0001594 | |||
| 2661 | Ga0495667_0010311 | |||
| 2662 | Ga0495634_0007743 | |||
| 2663 | Ga0495634_0029938 | |||
| 2664 | Ga0495634_0096159 | |||
| 2665 | Ga0495634_0114734 | |||
| 2666 | Ga0495611_0021100 | |||
| 2667 | Ga0495625_0000044 | |||
| 2668 | Ga0495625_0005617 | |||
| 2669 | Ga0495625_0017290 | |||
| 2670 | Ga0495625_0045384 | |||
| 2671 | Ga0495635_0001277 | |||
| 2672 | Ga0495635_0030140 | |||
| 2673 | Ga0495635_0034782 | |||
| 2674 | Ga0495635_0091209 | |||
| 2675 | Ga0495661_0001965 | |||
| 2676 | Ga0495661_0044822 | |||
| 2677 | Ga0495588_0007251 | |||
| 2678 | Ga0495588_0114008 | |||
| 2679 | Ga0495657_0117898 | |||
| 2680 | Ga0495657_0131207 | |||
| 2681 | Ga0495599_0021985 | |||
| 2682 | Ga0495599_0076326 | |||
| 2683 | Ga0495599_0087123 | |||
| 2684 | Ga0495599_0102375 | |||
| 2685 | Ga0495623_0006180 | |||
| 2686 | Ga0495623_0016213 | |||
| 2687 | Ga0495623_0209783 | |||
| 2688 | Ga0495646_0000701 | |||
| 2689 | Ga0495646_0009225 | |||
| 2690 | Ga0495646_0015429 | |||
| 2691 | Ga0495646_0068551 | |||
| 2692 | Ga0495647_0010734 | |||
| 2693 | Ga0495613_0001967 | |||
| 2694 | Ga0495613_0003507 | |||
| 2695 | Ga0495613_0172351 | |||
| 2696 | Ga0495624_0012912 | |||
| 2697 | Ga0495624_0024394 | |||
| 2698 | Ga0495624_0039929 | |||
| 2699 | Ga0495624_0041251 | |||
| 2700 | Ga0495624_0211750 | |||
| 2701 | Ga0495671_0000697 | |||
| 2702 | Ga0495671_0010602 | |||
| 2703 | Ga0495671_0017834 | |||
| 2704 | Ga0495671_0027191 | |||
| 2705 | Ga0495649_0003585 | |||
| 2706 | Ga0495649_0016776 | |||
| 2707 | Ga0495649_0051973 | |||
| 2708 | Ga0495589_0008221 | |||
| 2709 | Ga0495589_0053454 | |||
| 2710 | Ga0495600_0006710 | |||
| 2711 | Ga0495600_0052670 | |||
| 2712 | Ga0495600_0089532 | |||
| 2713 | Ga0495660_0141770 | |||
| 2714 | Ga0495581_0000184 | |||
| 2715 | Ga0495581_0030839 | |||
| 2716 | Ga0495604_0049157 | |||
| 2717 | Ga0495604_0049796 | |||
| 2718 | Ga0495604_0059663 | |||
| 2719 | Ga0495604_0077463 | |||
| 2720 | Ga0495674_0016934 | |||
| 2721 | Ga0495674_0033202 | |||
| 2722 | Ga0495674_0116478 | |||
| 2723 | Ga0495674_0239155 | |||
| 2724 | Ga0495672_0000009 | |||
| 2725 | Ga0495672_0005294 | |||
| 2726 | Ga0495672_0074110 | |||
| 2727 | Ga0495676_0009854 | |||
| 2728 | Ga0495676_0068792 | |||
| 2729 | Ga0495676_0072217 | |||
| 2730 | Ga0495676_0093956 | |||
| 2731 | Ga0495680_0001480 | |||
| 2732 | Ga0495680_0006595 | |||
| 2733 | Ga0495680_0019532 | |||
| 2734 | Ga0495680_0111098 | |||
| 2735 | Ga0495680_0197578 | |||
| 2736 | Ga0495683_0003301 | |||
| 2737 | Ga0495683_0012696 | |||
| 2738 | Ga0495683_0033221 | |||
| 2739 | Ga0495687_013333 | |||
| 2740 | Ga0495687_060952 | |||
| 2741 | Ga0495687_064028 | |||
| 2742 | Ga0495675_0003511 | |||
| 2743 | Ga0495675_0004372 | |||
| 2744 | Ga0495675_0018518 | |||
| 2745 | Ga0495675_0022944 | |||
| 2746 | Ga0495679_000037 | |||
| 2747 | Ga0495679_000177 | |||
| 2748 | Ga0495679_000702 | |||
| 2749 | Ga0495684_0041845 | |||
| 2750 | Ga0495684_0137308 | |||
| 2751 | Ga0495684_0284000 | |||
| 2752 | Ga0495593_0000287 | |||
| 2753 | Ga0495593_0002263 | |||
| 2754 | Ga0495593_0005587 | |||
| 2755 | Ga0495593_0045005 | |||
| 2756 | Ga0495602_0000447 | |||
| 2757 | Ga0495602_0026442 | |||
| 2758 | Ga0495602_0040022 | |||
| 2759 | Ga0495602_0055472 | |||
| 2760 | Ga0495602_0126758 | |||
| 2761 | Ga0495602_0167686 | |||
| 2762 | Ga0495602_0168279 | |||
| 2763 | Ga0495614_0000608 | |||
| 2764 | Ga0495614_0007949 | |||
| 2765 | Ga0495626_0011433 | |||
| 2766 | Ga0496100_0000449 | |||
| 2767 | Ga0496101_0000430 | |||
| 2768 | Ga0496101_0241798 | |||
| 2769 | Ga0496102_0000128 | |||
| 2770 | Ga0496102_0001072 | |||
| 2771 | Ga0496102_0155028 | |||
| 2772 | Ga0496103_0000394 | |||
| 2773 | Ga0496103_0038137 | |||
| 2774 | Ga0496104_0029946 | |||
| 2775 | Ga0496104_0049604 | |||
| 2776 | Ga0496105_0042040 | |||
| 2777 | Ga0496105_0051246 | |||
| 2778 | Ga0496105_0113650 | |||
| 2779 | Ga0496106_0000479 | |||
| 2780 | Ga0496106_0409087 | |||
| 2781 | Ga0496107_0009594 | |||
| 2782 | Ga0496107_0100161 | |||
| 2783 | Ga0496109_0188840 | |||
| 2784 | Ga0496110_0139408 | |||
| 2785 | Ga0496110_0301997 | |||
| 2786 | Ga0496111_0098337 | |||
| 2787 | Ga0496112_0030846 | |||
| 2788 | Ga0496113_0004607 | |||
| 2789 | Ga0496113_0053862 | |||
| 2790 | Ga0496114_0005380 | |||
| 2791 | Ga0496115_0000486 | |||
| 2792 | Ga0496115_0016930 | |||
| 2793 | Ga0496115_0427617 | |||
| 2794 | Ga0496116_0000023 | |||
| 2795 | Ga0496116_0000460 | |||
| 2796 | Ga0496116_0013582 | |||
| 2797 | Ga0496117_0000203 | |||
| 2798 | Ga0496117_0000463 | |||
| 2799 | Ga0496117_0005563 | |||
| 2800 | Ga0496117_0071053 | |||
| 2801 | Ga0496117_0150624 | |||
| 2802 | Ga0496118_0000079 | |||
| 2803 | Ga0496118_0003815 | |||
| 2804 | Ga0496118_0005103 | |||
| 2805 | Ga0496118_0005771 | |||
| 2806 | Ga0496118_0036321 | |||
| 2807 | Ga0496119_0000056 | |||
| 2808 | Ga0496119_0001891 | |||
| 2809 | Ga0496119_0004881 | |||
| 2810 | Ga0496119_0092153 | |||
| 2811 | Ga0496120_0000052 | |||
| 2812 | Ga0496120_0000063 | |||
| 2813 | Ga0496120_0000137 | |||
| 2814 | Ga0496121_0000860 | |||
| 2815 | Ga0496121_0001688 | |||
| 2816 | Ga0496121_0006093 | |||
| 2817 | Ga0496121_0029115 | |||
| 2818 | Ga0496121_0032218 | |||
| 2819 | Ga0496121_0043019 | |||
| 2820 | Ga0496121_0065425 | |||
| 2821 | Ga0496122_0000887 | |||
| 2822 | Ga0496122_0015744 | |||
| 2823 | Ga0496122_0031349 | |||
| 2824 | Ga0496122_0047575 | |||
| 2825 | Ga0496123_0000180 | |||
| 2826 | Ga0496123_0004798 | |||
| 2827 | Ga0496123_0017330 | |||
| 2828 | Ga0496123_0096875 | |||
| 2829 | Ga0496124_0000017 | |||
| 2830 | Ga0496124_0000024 | |||
| 2831 | Ga0496124_0000451 | |||
| 2832 | Ga0496124_0047249 | |||
| 2833 | Ga0496124_0102154 | |||
| 2834 | Ga0496125_0000016 | |||
| 2835 | Ga0496125_0003043 | |||
| 2836 | Ga0496125_0052210 | |||
| 2837 | Ga0496125_0056369 | |||
| 2838 | Ga0496125_0138487 | |||
| 2839 | Ga0496126_0000225 | |||
| 2840 | Ga0496126_0002445 | |||
| 2841 | Ga0496126_0009549 | |||
| 2842 | Ga0501034_0360886 | |||
| 2843 | Ga0501047_0036259 | |||
| 2844 | Ga0501067_0040551 | |||
| 2845 | Ga0501070_0278723 | |||
| 2846 | Ga0501072_0016539 | |||
| 2847 | Ga0501073_0023853 | |||
| 2848 | Ga0501074_0030094 | |||
| 2849 | Ga0501080_0008273 | |||
| 2850 | Ga0501080_0178214 | |||
| 2851 | Ga0501262_000239 | |||
| 2852 | nmdc:mga03683_29708_c1 | |||
| 2853 | nmdc:mga03683_3151_c1 | |||
| 2854 | nmdc:mga00v17_27802_c1 | |||
| 2855 | nmdc:mga00v17_7455_c1 | |||
| 2856 | nmdc:mga00v17_9465_c1 | |||
| 2857 | nmdc:mga0yw44_9423_c1 | |||
| 2858 | nmdc:mga0k408_39416_c1 | |||
| 2859 | nmdc:mga0k408_43487_c1 | |||
| 2860 | nmdc:mga0k408_6138_c1 | |||
| 2861 | nmdc:mga0k408_75692_c1 | |||
| 2862 | nmdc:mga06z11_224376_c1 | |||
| 2863 | nmdc:mga07m45_15935_c1 | |||
| 2864 | nmdc:mga07m45_2254_c1 | |||
| 2865 | nmdc:mga07m45_42983_c1 | |||
| 2866 | nmdc:mga07m45_5807_c1 | |||
| 2867 | nmdc:mga07m45_6577_c1 | |||
| 2868 | nmdc:mga07m45_6685_c1 | |||
| 2869 | nmdc:mga07m45_98480_c1 | |||
| 2870 | nmdc:mga05p37_172807_c1 | |||
| 2871 | nmdc:mga09592_313808_c1 | |||
| 2872 | nmdc:mga0n895_601081_c1 | |||
| 2873 | nmdc:mga0n895_602527_c1 | |||
| 2874 | nmdc:mga0rr50_194203_c1 | |||
| 2875 | nmdc:mga08x19_129164_c1 | |||
| 2876 | Ga0495612_0059844 | |||
| 2877 | Ga0500610_0009985 | |||
| 2878 | Ga0500610_0024124 | |||
| 2879 | Ga0495619_0008531 | |||
| 2880 | Ga0495619_0031100 | |||
| 2881 | Ga0495619_0130008 | |||
| 2882 | Ga0495619_0160812 | |||
| 2883 | Ga0495619_0305053 | |||
| 2884 | Ga0500578_0000244 | |||
| 2885 | Ga0500651_0000440 | |||
| 2886 | Ga0500566_0119307 | |||
| 2887 | Ga0500571_017194 | |||
| 2888 | Ga0500593_001081 | |||
| 2889 | Ga0500594_0002394 | |||
| 2890 | Ga0500595_000507 | |||
| 2891 | Ga0500607_002946 | |||
| 2892 | Ga0500618_000376 | |||
| 2893 | Ga0500642_0143056 | |||
| 2894 | Ga0500655_001505 | |||
| 2895 | Ga0500658_0009124 | |||
| 2896 | Ga0500564_033255 | |||
| 2897 | Ga0500568_0003041 | |||
| 2898 | Ga0500574_000053 | |||
| 2899 | Ga0500622_0000043 | |||
| 2900 | Ga0500627_0012941 | |||
| 2901 | Ga0500634_0008211 | |||
| 2902 | Ga0500634_0042530 | |||
| 2903 | Ga0501084_0076341 | |||
| 2904 | 2509076495 | |||
| 2905 | 2511246598 | |||
| 2906 | 2511383975 | |||
| 2907 | 2512037037 | |||
| 2908 | 2513232076 | |||
| 2909 | 2521557795 | |||
| 2910 | 2553002916 | |||
| 2911 | 2555261438 | |||
| 2912 | 2587727029 | |||
| 2913 | 2587732031 | |||
| 2914 | 2587756972 | |||
| 2915 | 2588291456 | |||
| 2916 | 2599623592 | |||
| 2917 | 2599671790 | |||
| 2918 | 2599681197 | |||
| 2919 | 2599693399 | |||
| 2920 | 2599927398 | |||
| 2921 | 2600811292 | |||
| 2922 | 2643970584 | |||
| 2923 | 2644139135 | |||
| 2924 | 2644163194 | |||
| 2925 | 2644274745 | |||
| 2926 | 2644327575 | |||
| 2927 | 2644401531 | |||
| 2928 | 2644468112 | |||
| 2929 | 2650896746 | |||
| 2930 | 2686352745 | |||
| 2931 | 2738717667 | |||
| 2932 | 2738879278 | |||
| 2933 | 2739278353 | |||
| 2934 | 2739611377 | |||
| 2935 | 2746088370 | |||
| 2936 | 2746096735 | |||
| 2937 | 2765568899 | |||
| 2938 | 2772438099 | |||
| 2939 | 2808984562 | |||
| 2940 | 2809127632 | |||
| 2941 | 2809130608 | |||
| 2942 | 2809149915 | |||
| 2943 | 2819597153 | |||
| 2944 | 2819615062 | |||
| 2945 | 2831266278 | |||
| 2946 | 2838057612 | |||
| 2947 | 2839096219 | |||
| 2948 | 2842681946 | |||
| 2949 | 2847800575 | |||
| 2950 | 2852619939 | |||
| 2951 | 2857545267 | |||
| 2952 | 2857578152 | |||
| 2953 | 2858955682 | |||
| 2954 | 2881928944 | |||
| 2955 | 2885204392 | |||
| 2956 | 2885218045 | |||
| 2957 | 2888368114 | |||
| 2958 | 2899924656 | |||
| 2959 | 2904441443 | |||
| 2960 | 2904455806 | |||
| 2961 | 2904457763 | |||
| 2962 | 2904481559 | |||
| 2963 | 2904505327 | |||
| 2964 | 2904531619 | |||
| 2965 | 2904548096 | |||
| 2966 | 2904586741 | |||
| 2967 | 2904593226 | |||
| 2968 | 2904602931 | |||
| 2969 | 2919046259 | |||
| 2970 | 2919084049 | |||
| 2971 | 2919467558 | |||
| 2972 | 2923511013 | |||
| 2973 | 2928039217 | |||
| 2974 | 2928045178 | |||
| 2975 | 2928052983 | |||
| 2976 | 2928064346 | |||
| 2977 | 2928071794 | |||
| 2978 | 2928084263 | |||
| 2979 | 2928130975 | |||
| 2980 | 2928511201 | |||
| 2981 | 2929163027 | |||
| 2982 | 2929522789 | |||
| 2983 | 2932408458 | |||
| 2984 | 2932423395 | |||
| 2985 | 2939580119 | |||
| 2986 | 2939608227 | |||
| 2987 | 2945911534 | |||
| 2988 | 2945947662 | |||
| 2989 | 2945977474 | |||
| 2990 | 2945986125 | |||
| 2991 | 2954772492 | |||
| 2992 | 2980127431 | |||
| 2993 | 2984495971 | |||
| 2994 | 2990262653 | |||
| 2995 | 3000379832 | |||
| 2996 | 8005662400 | |||
| 2997 | 8048748982 | |||
| 2998 | 8054846520 | |||
| 2999 | 8054851854 | |||
| 3000 | 8055432569 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
147
318
0.98
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.5977 | 81 | 249 |
| 7ahh-assembly1.cif.gz_B | opua inhibited inward-facing, sbd docked | 0.5966 | 77 | 246 |
| 7ahd-assembly1.cif.gz_A | opua (e190q) occluded | 0.5843 | 87 | 246 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.5729 | 64 | 249 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.5651 | 97 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0DP70_1_121_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.6711 | 121 | 248 | 1.10.3720.10 |
| af_P45767_178_390_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.6707 | 114 | 249 | 1.10.3720.10 |
| af_P9WFZ7_89_318_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.662 | 118 | 248 | 1.10.3720.10 |
| af_P0DP70_1_121_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.659 | 121 | 248 | 1.10.3720.10 |
| af_Q2FVL3_18_236_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.6565 | 118 | 250 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X6GP56-F1-model_v4 | deleted | 0.8446 | 129 | 253 |
|
| AF-A0A6N9U5T1-F1-model_v4 | ABC transporter permease subunit | 0.8361 | 124 | 256 |
GO:0005886
GO:0055085 |
| AF-A0A4Q3F9M9-F1-model_v4 | ABC transporter permease | 0.8281 | 113 | 256 |
GO:0005886
GO:0055085 |
| AF-A0A1M3BMJ4-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.8219 | 135 | 255 |
GO:0005886
GO:0055085 |
| AF-A0A3D2SP41-F1-model_v4 | Peptide ABC transporter permease | 0.8174 | 127 | 255 |
GO:0005886
GO:0055085 |