F494401

General Info

Members Datasets Scaffolds Average Seq Length
1500 590 3000 281

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10462182|Ga0157375_104621822
Length 319
Sequence MTAVVDTAAALTATKADGVRTPWSEFWRKFKKQRVALAAGLFVVLLIVVALAAPWIVPYDAENYFDYDKLNARPSWQHWFGVDALGRDIFSRILMGTRISLAAGFVSVARIVMRICDVLFAFPGILLAIGIVAILGGGMTNVVVAVGWDRIIMRIADVLFAFPGILLAIGIVAILGGGMANVIVAVAVFSIPTFARLVRGNTLALKHLTFIEAARSLGAADRTIIFRHIFPGTIAAVVVYFSLRIGTSIITAASLSFLGMGAQPPTPEWGAMLDAARSDMLTAPHEAIFPALAILLTVLAFNLLGDGLRDALDPKIERR

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
33 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
39 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
42 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
68 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
69 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
70 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
71 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
72 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
73 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
74 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
83 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
84 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
90 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
91 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
92 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
93 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
94 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
95 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
96 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
97 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
98 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
99 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
100 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
101 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
104 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
105 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
106 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
107 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
108 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
114 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
115 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
116 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
117 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
118 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
119 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
122 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
124 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
125 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
130 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
131 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
132 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
133 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
134 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
137 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
138 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
141 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
145 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
153 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
154 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
155 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
158 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
159 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
160 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
161 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
162 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
163 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
164 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
165 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
166 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
169 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
170 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
178 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
179 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
181 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
182 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
183 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
186 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
187 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
188 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
195 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
197 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
200 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
272 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
276 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
282 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
283 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
284 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
285 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
286 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
287 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
288 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
289 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
290 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
291 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
292 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
293 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
294 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
295 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
296 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
297 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
298 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
299 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
300 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
301 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
302 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
303 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
304 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
305 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
306 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
307 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
308 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
309 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
310 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
311 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
312 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
313 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
314 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
315 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
316 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
317 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
318 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
319 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
320 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
321 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
322 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
323 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
324 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
325 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
326 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
327 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
328 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
329 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
330 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
331 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
332 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
333 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
334 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
335 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
336 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
337 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
338 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
339 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
340 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
341 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
342 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
343 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
344 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
345 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
346 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
347 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
348 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
349 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
350 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
351 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
352 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
353 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
354 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
355 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
356 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
357 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
358 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
359 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
360 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
361 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
362 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
363 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
364 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
365 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
366 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
367 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
368 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
369 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
370 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
371 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
372 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
373 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
374 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
375 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
376 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
377 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
378 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
379 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
380 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
381 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
382 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
383 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
384 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
385 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
386 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
387 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
388 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
389 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
390 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
391 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
392 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
393 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
394 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
395 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
396 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
397 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
398 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
399 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
400 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
401 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
402 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
403 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
404 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
405 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
406 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
407 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
408 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
409 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
410 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
411 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
412 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
413 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
414 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
415 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
416 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
417 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
418 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
419 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
420 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
421 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
422 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
423 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
424 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
425 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
426 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
427 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
428 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
429 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
430 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
431 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
432 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
433 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
434 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
435 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
436 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
437 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
438 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
439 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
440 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
441 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
442 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
443 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
444 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
445 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
446 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
447 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
448 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
449 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
450 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
451 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
452 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
455 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
456 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
457 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
458 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
459 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
460 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
461 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
462 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
463 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
464 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
465 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
466 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
467 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
468 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
469 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
470 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
471 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
472 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
473 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
474 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
475 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
476 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
477 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
478 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
479 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
480 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
481 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
482 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
483 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
484 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
485 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
486 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
487 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
488 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
489 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
490 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
491 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
492 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
493 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
494 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
495 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
496 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
497 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
498 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
499 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
500 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
501 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
502 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
503 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
504 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
505 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
506 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
507 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
508 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
509 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
510 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
511 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
512 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
513 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
514 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
515 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
516 2643221658 Variovorax sp. Root411 Isolate Unclassified
517 2643221672 Variovorax sp. Root434 Isolate Unclassified
518 2643221683 Variovorax sp. Root473 Isolate Unclassified
519 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
520 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
521 2738541277 Variovorax sp. GV051 Isolate Unclassified
522 2738541307 Variovorax sp. GV008 Isolate Unclassified
523 2738543019 Variovorax sp. GV040 Isolate Unclassified
524 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
525 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
526 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
527 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
528 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
529 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
530 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
531 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
532 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
533 2818991446 Variovorax sp. 1180 Isolate Unclassified
534 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
535 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
536 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
537 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
538 2842677519 Variovorax sp. R-72495 Isolate Unclassified
539 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
540 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
541 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
542 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
543 2858950400 Achromobacter sp. K91 Isolate Unclassified
544 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
545 2885198086 Variovorax sp. 679 Isolate Unclassified
546 2885211737 Variovorax sp. 553 Isolate Unclassified
547 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
548 2899924645 Variovorax sp. 369 Isolate Unclassified
549 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
550 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
551 2904456579 Variovorax sp. 2002 Isolate Unclassified
552 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
553 2904504865 Serratia marcescens 1822 Isolate Unclassified
554 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
555 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
556 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
557 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
558 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
559 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
560 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
561 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
562 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
563 2928037797 Variovorax sp. 1126 Isolate Unclassified
564 2928044640 Variovorax sp. 1128 Isolate Unclassified
565 2928051484 Variovorax sp. 1133 Isolate Unclassified
566 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
567 2928070936 Variovorax gossypii 1167 Isolate Unclassified
568 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
569 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
570 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
571 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
572 2929520902 Variovorax beijingensis 502 Isolate Unclassified
573 2932406140 Serratia sp. 2723 Isolate Rhizosphere
574 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
575 2939577877 Serratia sp. 509 Isolate Rhizosphere
576 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
577 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
578 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
579 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
580 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
581 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
582 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
583 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
584 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
585 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
586 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
587 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
588 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
589 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
590 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.27
Metatranscriptomes 0.27
Isolates 6.47

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 16.33
Nodule 0.8
Rhizoplane 2.2
Rhizosphere 70.4
Stem 0
Stem Tuber 0
Unclassified 0.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10462182 3300013308 Bacteria 1435
2 JGI24741J21665_1001323 3300001915 Bacteria 7247
3 JGI24740J21852_10000707 3300001979 Bacteria 14462
4 JGI24740J21852_10001478 3300001979 Bacteria 10792
5 JGI24740J21852_10009017 3300001979 Bacteria 3932
6 JGI24739J22299_10003562 3300001989 Bacteria 5951
7 JGI24739J22299_10028661 3300001989 Bacteria 1941
8 JGI25155J39150_1000009 3300002704 Bacteria 224358
9 JGI25156J39149_1000009 3300002705 Bacteria 224379
10 JGI25156J39149_1001288 3300002705 Bacteria 10886
11 JGI25156J39149_1002086 3300002705 Bacteria 7574
12 JGI25156J39149_1002833 3300002705 Bacteria 5965
13 JGI25156J39149_1013563 3300002705 Bacteria 1723
14 JGI25162J39368_1000040 3300002737 Bacteria 175938
15 JGI25154J39366_1000024 3300002738 Bacteria 211372
16 JGI25154J39366_1000362 3300002738 Bacteria 25735
17 JGI25157J39369_1000007 3300002741 Bacteria 224377
18 JGI25152J39213_1002358 3300002773 Bacteria 7248
19 JGI25150J39212_1008224 3300002774 Bacteria 2052
20 JGI25150J39212_1010444 3300002774 Bacteria 1726
21 JGI25159J45721_1009054 3300002987 Bacteria 2666
22 JGI25159J45721_1013251 3300002987 Bacteria 1918
23 JGI25151J46595_10037152 3300003187 Bacteria 1829
24 JGI25165J46597_1000051 3300003214 Bacteria 241012
25 JGI25165J46597_1001429 3300003214 Bacteria 12836
26 JGI25153J46596_10003022 3300003215 Bacteria 9518
27 JGI25153J46596_10004243 3300003215 Bacteria 7756
28 JGI25160J50197_1000240 3300003354 Bacteria 42558
29 JGI25161J50226_1000009 3300003374 Bacteria 224699
30 JGI25161J50226_1002517 3300003374 Bacteria 4650
31 JGI25161J50226_1005364 3300003374 Bacteria 2496
32 Ga0006562J51391_1103912 3300003578 Bacteria 1640
33 Ga0006562J51391_1112229 3300003578 Bacteria 1397
34 Ga0055538_1000002 3300003751 Bacteria 999437
35 Ga0055538_1000025 3300003751 Bacteria 241012
36 Ga0055538_1002535 3300003751 Bacteria 2633
37 Ga0055539_1000002 3300003752 Bacteria 999437
38 Ga0055539_1000032 3300003752 Bacteria 241012
39 Ga0055539_1000100 3300003752 Bacteria 100406
40 Ga0055533_1000004 3300003756 Bacteria 999437
41 Ga0055533_1000042 3300003756 Bacteria 241012
42 Ga0055533_1000257 3300003756 Bacteria 31683
43 Ga0055532_1000012 3300003758 Bacteria 382698
44 Ga0055532_1000029 3300003758 Bacteria 232900
45 Ga0055532_1001367 3300003758 Bacteria 6928
46 Ga0055532_1002326 3300003758 Bacteria 4035
47 Ga0055525_1000002 3300003759 Bacteria 999437
48 Ga0055525_1000050 3300003759 Bacteria 241012
49 Ga0055525_1000444 3300003759 Bacteria 23721
50 Ga0055525_1000505 3300003759 Bacteria 19389
51 Ga0055527_1000011 3300003760 Bacteria 354560
52 Ga0055535_1000009 3300003761 Bacteria 382698
53 Ga0055535_1000093 3300003761 Bacteria 97771
54 Ga0055535_1000689 3300003761 Bacteria 26039
55 Ga0055542_1000015 3300003762 Bacteria 382698
56 Ga0055542_1000039 3300003762 Bacteria 215126
57 Ga0055542_1000106 3300003762 Bacteria 112713
58 Ga0055542_1001376 3300003762 Bacteria 12374
59 Ga0055529_1000011 3300003763 Bacteria 382698
60 Ga0055529_1000124 3300003763 Bacteria 112731
61 Ga0055529_1000376 3300003763 Bacteria 48166
62 Ga0055526_1003692 3300003771 Bacteria 9574
63 Ga0055526_1009131 3300003771 Bacteria 4825
64 Ga0055526_1009501 3300003771 Bacteria 4664
65 Ga0055537_1000020 3300003773 Bacteria 117325
66 Ga0055537_1000491 3300003773 Bacteria 24128
67 Ga0055537_1019921 3300003773 Bacteria 1031
68 Ga0055524_1000047 3300003775 Bacteria 150887
69 Ga0055524_1015136 3300003775 Bacteria 2824
70 Ga0055536_1002265 3300003781 Bacteria 10933
71 Ga0055536_1004266 3300003781 Bacteria 7375
72 Ga0055536_1005338 3300003781 Bacteria 6308
73 Ga0055536_1018976 3300003781 Bacteria 2180
74 Ga0055536_1024865 3300003781 Bacteria 1723
75 Ga0055536_1034695 3300003781 Bacteria 1270
76 Ga0055534_1000450 3300003784 Bacteria 24128
77 Ga0055534_1000633 3300003784 Bacteria 17962
78 Ga0055534_1011996 3300003784 Bacteria 1736
79 Ga0055528_1000934 3300003790 Bacteria 19533
80 Ga0055528_1000973 3300003790 Bacteria 19015
81 Ga0055528_1013206 3300003790 Bacteria 3148
82 Ga0055530_10002364 3300003791 Bacteria 12244
83 Ga0055530_10003258 3300003791 Bacteria 9458
84 Ga0055540_1000027 3300003792 Bacteria 187454
85 Ga0055540_1002734 3300003792 Bacteria 9068
86 Ga0055540_1007848 3300003792 Bacteria 3948
87 Ga0055540_1032478 3300003792 Bacteria 1191
88 Ga0055531_10001909 3300003794 Bacteria 14594
89 Ga0055541_1000023 3300003841 Bacteria 241012
90 Ga0055541_1000043 3300003841 Bacteria 161703
91 Ga0055541_1008584 3300003841 Bacteria 1620
92 Ga0058692_1000297 3300003856 Bacteria 25557
93 Ga0055543_1000199 3300004625 Bacteria 49097
94 Ga0055543_1002895 3300004625 Bacteria 5390
95 Ga0055543_1012484 3300004625 Bacteria 1706
96 Ga0065165_1001969 3300005262 Bacteria 19408
97 Ga0065704_10012722 3300005289 Bacteria 1825
98 Ga0065715_10019317 3300005293 Bacteria 3103
99 Ga0065715_10174718 3300005293 Bacteria 1520
100 Ga0070658_10025574 3300005327 Bacteria 4732
101 Ga0070658_10035798 3300005327 Bacteria 3999
102 Ga0070658_10245085 3300005327 Bacteria 1520
103 Ga0070676_10002706 3300005328 Bacteria 9136
104 Ga0070676_10145652 3300005328 Bacteria 1512
105 Ga0070676_10157451 3300005328 Bacteria 1459
106 Ga0070683_100029745 3300005329 Bacteria 4949
107 Ga0070683_100307344 3300005329 Bacteria 1508
108 Ga0070683_100345721 3300005329 Bacteria 1416
109 Ga0070683_100517215 3300005329 Bacteria 1140
110 Ga0070690_100048399 3300005330 Bacteria 2707
111 Ga0070670_100014778 3300005331 Bacteria 6700
112 Ga0070670_100134363 3300005331 Bacteria 2137
113 Ga0070677_10004255 3300005333 Bacteria 4660
114 Ga0068869_100007462 3300005334 Bacteria 6993
115 Ga0070680_100030518 3300005336 Bacteria 4330
116 Ga0070680_100057278 3300005336 Bacteria 3186
117 Ga0070680_100092804 3300005336 Bacteria 2500
118 Ga0070682_100041859 3300005337 Bacteria 2825
119 Ga0070682_100073205 3300005337 Bacteria 2197
120 Ga0070682_100329487 3300005337 Bacteria 1131
121 Ga0068868_100010083 3300005338 Bacteria 6825
122 Ga0068868_100024239 3300005338 Bacteria 4602
123 Ga0068868_100063202 3300005338 Bacteria 2937
124 Ga0068868_100069739 3300005338 Bacteria 2802
125 Ga0068868_100121194 3300005338 Bacteria 2133
126 Ga0068868_100363261 3300005338 Bacteria 1242
127 Ga0070660_100000161 3300005339 Bacteria 43884
128 Ga0070660_100056004 3300005339 Bacteria 3049
129 Ga0070660_100128362 3300005339 Bacteria 2027
130 Ga0070660_100259956 3300005339 Bacteria 1417
131 Ga0070689_100250730 3300005340 Bacteria 1460
132 Ga0070687_100038283 3300005343 Bacteria 2403
133 Ga0070687_100181501 3300005343 Bacteria 1261
134 Ga0070661_100000057 3300005344 Bacteria 87637
135 Ga0070661_100002317 3300005344 Bacteria 13077
136 Ga0070661_100017237 3300005344 Bacteria 5121
137 Ga0070661_100135331 3300005344 Bacteria 1854
138 Ga0070692_10003401 3300005345 Bacteria 6451
139 Ga0070692_10009557 3300005345 Bacteria 4376
140 Ga0070668_100007630 3300005347 Bacteria 8029
141 Ga0070668_100051229 3300005347 Bacteria 3180
142 Ga0070668_100153842 3300005347 Bacteria 1862
143 Ga0070669_100130830 3300005353 Bacteria 1925
144 Ga0070675_100004084 3300005354 Bacteria 11084
145 Ga0070671_100002197 3300005355 Bacteria 15066
146 Ga0070671_100052121 3300005355 Bacteria 3403
147 Ga0070671_100065336 3300005355 Bacteria 3030
148 Ga0070671_100122510 3300005355 Bacteria 2188
149 Ga0070671_100130067 3300005355 Bacteria 2120
150 Ga0070674_100028680 3300005356 Bacteria 3657
151 Ga0070674_100040580 3300005356 Bacteria 3149
152 Ga0070673_100001432 3300005364 Bacteria 13947
153 Ga0070673_100009049 3300005364 Bacteria 6665
154 Ga0070673_100156678 3300005364 Bacteria 1933
155 Ga0070673_100194814 3300005364 Bacteria 1742
156 Ga0070673_100436178 3300005364 Bacteria 1176
157 Ga0070688_100026504 3300005365 Bacteria 3444
158 Ga0070659_100000510 3300005366 Bacteria 28529
159 Ga0070659_100001591 3300005366 Bacteria 16357
160 Ga0070659_100008091 3300005366 Bacteria 7668
161 Ga0070659_100063640 3300005366 Bacteria 2918
162 Ga0070659_100097024 3300005366 Bacteria 2368
163 Ga0070667_100220317 3300005367 Bacteria 1689
164 Ga0070667_100232366 3300005367 Bacteria 1645
165 Ga0070667_100257670 3300005367 Bacteria 1561
166 Ga0070667_100446390 3300005367 Bacteria 1182
167 Ga0070709_10014488 3300005434 Bacteria 4460
168 Ga0070709_10035545 3300005434 Bacteria 3028
169 Ga0070709_10169964 3300005434 Bacteria 1523
170 Ga0070714_100007945 3300005435 Bacteria 8265
171 Ga0070714_100014020 3300005435 Bacteria 6430
172 Ga0070714_100035131 3300005435 Bacteria 4199
173 Ga0070714_100036382 3300005435 Bacteria 4129
174 Ga0070713_100000032 3300005436 Bacteria 86800
175 Ga0070713_100006613 3300005436 Bacteria 8058
176 Ga0070713_100015987 3300005436 Bacteria 5632
177 Ga0070713_100032725 3300005436 Bacteria 4157
178 Ga0070713_100157445 3300005436 Bacteria 2025
179 Ga0070711_100019144 3300005439 Bacteria 4386
180 Ga0070711_100134686 3300005439 Bacteria 1845
181 Ga0070711_100136673 3300005439 Bacteria 1833
182 Ga0070705_100083040 3300005440 Bacteria 1973
183 Ga0070700_100002762 3300005441 Bacteria 8974
184 Ga0070694_100024359 3300005444 Bacteria 3907
185 Ga0070708_100120354 3300005445 Bacteria 2422
186 Ga0070663_100000105 3300005455 Bacteria 38796
187 Ga0070663_100004364 3300005455 Bacteria 8298
188 Ga0070663_100058982 3300005455 Bacteria 2758
189 Ga0070663_100095971 3300005455 Bacteria 2205
190 Ga0070678_100001542 3300005456 Bacteria 12321
191 Ga0070678_100037327 3300005456 Bacteria 3411
192 Ga0070678_100164074 3300005456 Bacteria 1803
193 Ga0070662_100000149 3300005457 Bacteria 39863
194 Ga0070662_100035491 3300005457 Bacteria 3522
195 Ga0070662_100049985 3300005457 Bacteria 3016
196 Ga0070662_100050379 3300005457 Bacteria 3004
197 Ga0070662_100184225 3300005457 Bacteria 1648
198 Ga0070662_100305005 3300005457 Bacteria 1294
199 Ga0070681_10000229 3300005458 Bacteria 44150
200 Ga0070681_10001327 3300005458 Bacteria 21605
201 Ga0070681_10048539 3300005458 Bacteria 4242
202 Ga0070681_10091627 3300005458 Bacteria 2990
203 Ga0070681_10096433 3300005458 Bacteria 2905
204 Ga0068867_100009953 3300005459 Bacteria 6700
205 Ga0068867_100019344 3300005459 Bacteria 4853
206 Ga0068867_100182185 3300005459 Bacteria 1671
207 Ga0068867_100225741 3300005459 Bacteria 1511
208 Ga0070685_10003742 3300005466 Bacteria 7702
209 Ga0070706_100001663 3300005467 Bacteria 23150
210 Ga0070707_100078247 3300005468 Bacteria 3190
211 Ga0070707_100124488 3300005468 Bacteria 2504
212 Ga0070698_100022134 3300005471 Bacteria 6654
213 Ga0070698_100153853 3300005471 Bacteria 2246
214 Ga0070698_100224844 3300005471 Bacteria 1810
215 Ga0070698_100511636 3300005471 Bacteria 1139
216 Ga0070699_100158833 3300005518 Bacteria 2000
217 Ga0070699_100488578 3300005518 Bacteria 1118
218 Ga0070679_100001752 3300005530 Bacteria 19536
219 Ga0070679_100024796 3300005530 Bacteria 5879
220 Ga0070679_100077570 3300005530 Bacteria 3311
221 Ga0070679_100255296 3300005530 Bacteria 1709
222 Ga0070679_100424606 3300005530 Bacteria 1275
223 Ga0070684_100002568 3300005535 Bacteria 13408
224 Ga0070684_100019630 3300005535 Bacteria 5593
225 Ga0070684_100209007 3300005535 Bacteria 1779
226 Ga0070697_100018068 3300005536 Bacteria 5557
227 Ga0070697_100062705 3300005536 Bacteria 3034
228 Ga0070697_100086262 3300005536 Bacteria 2590
229 Ga0068853_100000618 3300005539 Bacteria 24365
230 Ga0068853_100023163 3300005539 Bacteria 5196
231 Ga0068853_100209951 3300005539 Bacteria 1774
232 Ga0068853_100274010 3300005539 Bacteria 1554
233 Ga0070672_100064046 3300005543 Bacteria 2904
234 Ga0070672_100098129 3300005543 Bacteria 2372
235 Ga0070672_100441018 3300005543 Bacteria 1120
236 Ga0070686_100049895 3300005544 Bacteria 2657
237 Ga0070695_100029763 3300005545 Bacteria 3395
238 Ga0070696_100007257 3300005546 Bacteria 7400
239 Ga0070696_100016969 3300005546 Bacteria 4912
240 Ga0070696_100042617 3300005546 Bacteria 3137
241 Ga0070693_100000701 3300005547 Bacteria 14785
242 Ga0070665_100004456 3300005548 Bacteria 14713
243 Ga0070665_100008740 3300005548 Bacteria 10253
244 Ga0070665_100112939 3300005548 Bacteria 2719
245 Ga0070665_100245041 3300005548 Bacteria 1793
246 Ga0070704_100031792 3300005549 Bacteria 3553
247 Ga0068855_100000065 3300005563 Bacteria 129307
248 Ga0068855_100000814 3300005563 Bacteria 38635
249 Ga0068855_100033827 3300005563 Bacteria 6097
250 Ga0068855_100056314 3300005563 Bacteria 4614
251 Ga0068855_100071755 3300005563 Bacteria 4026
252 Ga0068855_100080702 3300005563 Bacteria 3772
253 Ga0068855_100104458 3300005563 Bacteria 3259
254 Ga0068855_100128650 3300005563 Bacteria 2893
255 Ga0068855_100137688 3300005563 Bacteria 2785
256 Ga0068855_100150705 3300005563 Bacteria 2645
257 Ga0068855_100201491 3300005563 Bacteria 2240
258 Ga0070664_100000008 3300005564 Bacteria 173734
259 Ga0070664_100000371 3300005564 Bacteria 33275
260 Ga0070664_100000976 3300005564 Bacteria 22395
261 Ga0070664_100031961 3300005564 Bacteria 4403
262 Ga0070664_100049121 3300005564 Bacteria 3567
263 Ga0070664_100052409 3300005564 Bacteria 3456
264 Ga0070664_100128177 3300005564 Bacteria 2227
265 Ga0070664_100150055 3300005564 Bacteria 2057
266 Ga0070664_100183183 3300005564 Bacteria 1862
267 Ga0068857_100000964 3300005577 Bacteria 21993
268 Ga0068857_100002479 3300005577 Bacteria 15090
269 Ga0068857_100003440 3300005577 Bacteria 13215
270 Ga0068857_100012910 3300005577 Bacteria 7278
271 Ga0068857_100027691 3300005577 Bacteria 4999
272 Ga0068857_100037434 3300005577 Bacteria 4297
273 Ga0068857_100229773 3300005577 Bacteria 1697
274 Ga0068854_100000072 3300005578 Bacteria 72718
275 Ga0068854_100008004 3300005578 Bacteria 6772
276 Ga0068854_100024239 3300005578 Bacteria 4152
277 Ga0068854_100054874 3300005578 Bacteria 2868
278 Ga0068854_100116812 3300005578 Bacteria 2020
279 Ga0068854_100159925 3300005578 Bacteria 1743
280 Ga0068854_100222229 3300005578 Bacteria 1495
281 Ga0068856_100000009 3300005614 Bacteria 181448
282 Ga0068856_100000381 3300005614 Bacteria 48540
283 Ga0068856_100007513 3300005614 Bacteria 10641
284 Ga0068856_100039316 3300005614 Bacteria 4644
285 Ga0068856_100071796 3300005614 Bacteria 3427
286 Ga0068856_100110111 3300005614 Bacteria 2751
287 Ga0068856_100146549 3300005614 Bacteria 2368
288 Ga0068856_100443537 3300005614 Bacteria 1319
289 Ga0068856_100499001 3300005614 Bacteria 1238
290 Ga0070702_100041952 3300005615 Bacteria 2570
291 Ga0068852_100011015 3300005616 Bacteria 6785
292 Ga0068852_100015740 3300005616 Bacteria 5879
293 Ga0068852_100015760 3300005616 Bacteria 5877
294 Ga0068852_100049214 3300005616 Bacteria 3605
295 Ga0068852_100125474 3300005616 Bacteria 2356
296 Ga0068852_100126895 3300005616 Bacteria 2344
297 Ga0068852_100177080 3300005616 Bacteria 2003
298 Ga0068852_100261300 3300005616 Bacteria 1662
299 Ga0068852_100400755 3300005616 Bacteria 1350
300 Ga0068859_100010089 3300005617 Bacteria 9521
301 Ga0068859_100049387 3300005617 Bacteria 4225
302 Ga0068859_100175084 3300005617 Bacteria 2227
303 Ga0068864_100036132 3300005618 Bacteria 4209
304 Ga0068864_100052039 3300005618 Bacteria 3529
305 Ga0068864_100344725 3300005618 Bacteria 1404
306 Ga0068866_10000875 3300005718 Bacteria 13297
307 Ga0068866_10006393 3300005718 Bacteria 4907
308 Ga0068861_100273431 3300005719 Bacteria 1452
309 Ga0068851_10002246 3300005834 Bacteria 8492
310 Ga0068851_10002598 3300005834 Bacteria 7962
311 Ga0068851_10002993 3300005834 Bacteria 7461
312 Ga0068851_10013339 3300005834 Bacteria 3890
313 Ga0068870_10041982 3300005840 Bacteria 2379
314 Ga0068870_10061792 3300005840 Bacteria 2015
315 Ga0068863_100047814 3300005841 Bacteria 4057
316 Ga0068863_100048955 3300005841 Bacteria 4007
317 Ga0068863_100460484 3300005841 Bacteria 1249
318 Ga0068858_100004190 3300005842 Bacteria 14195
319 Ga0068858_100006956 3300005842 Bacteria 10989
320 Ga0068858_100035327 3300005842 Bacteria 4636
321 Ga0068858_100106299 3300005842 Bacteria 2619
322 Ga0068860_100013479 3300005843 Bacteria 8017
323 Ga0068860_100085295 3300005843 Bacteria 3005
324 Ga0068862_100006988 3300005844 Bacteria 9367
325 Ga0081539_10019130 3300005985 Bacteria 4704
326 Ga0075365_10001116 3300006038 Bacteria 11720
327 Ga0075363_100002525 3300006048 Bacteria 7503
328 Ga0075364_10002412 3300006051 Bacteria 10475
329 Ga0075364_10005636 3300006051 Bacteria 7299
330 Ga0075364_10007917 3300006051 Bacteria 6331
331 Ga0075432_10005289 3300006058 Bacteria 4396
332 Ga0075432_10082882 3300006058 Bacteria 1165
333 Ga0070715_10097676 3300006163 Bacteria 1364
334 Ga0070715_10133470 3300006163 Bacteria 1198
335 Ga0070712_100015039 3300006175 Bacteria 4975
336 Ga0075362_10017034 3300006177 Bacteria 2987
337 Ga0075366_10004606 3300006195 Bacteria 7407
338 Ga0075366_10043213 3300006195 Bacteria 2669
339 Ga0075366_10137234 3300006195 Bacteria 1477
340 Ga0097621_100007071 3300006237 Bacteria 7999
341 Ga0097621_100119038 3300006237 Bacteria 2238
342 Ga0075370_10001052 3300006353 Bacteria 11482
343 Ga0075370_10005993 3300006353 Bacteria 6087
344 Ga0075370_10006478 3300006353 Bacteria 5893
345 Ga0075370_10011878 3300006353 Bacteria 4586
346 Ga0075370_10027724 3300006353 Bacteria 3145
347 Ga0075370_10042864 3300006353 Bacteria 2557
348 Ga0075370_10053563 3300006353 Bacteria 2290
349 Ga0075370_10129466 3300006353 Bacteria 1472
350 Ga0068871_100010132 3300006358 Bacteria 6860
351 Ga0068871_100011438 3300006358 Bacteria 6510
352 Ga0068871_100294527 3300006358 Bacteria 1423
353 Ga0075434_100137774 3300006871 Bacteria 2460
354 Ga0075434_100438060 3300006871 Bacteria 1328
355 Ga0068865_100112171 3300006881 Bacteria 2013
356 Ga0075436_100171298 3300006914 Bacteria 1533
357 Ga0097620_100010089 3300006931 Bacteria 9521
358 Ga0097620_100049385 3300006931 Bacteria 4225
359 Ga0097620_100175085 3300006931 Bacteria 2227
360 Ga0097620_100211476 3300006931 Bacteria 2026
361 Ga0079104_1000231 3300006946 Bacteria 75264
362 Ga0079104_1000864 3300006946 Bacteria 25084
363 Ga0079104_1001566 3300006946 Bacteria 14986
364 Ga0099826_10000238 3300006948 Bacteria 24197
365 Ga0075435_100031847 3300007076 Bacteria 4159
366 Ga0105251_10000128 3300009011 Bacteria 75973
367 Ga0105251_10000280 3300009011 Bacteria 51407
368 Ga0105251_10000892 3300009011 Bacteria 26709
369 Ga0105251_10002010 3300009011 Bacteria 16527
370 Ga0105251_10003742 3300009011 Bacteria 10889
371 Ga0105251_10014555 3300009011 Bacteria 4340
372 Ga0105251_10046774 3300009011 Bacteria 2081
373 Ga0105244_10000836 3300009036 Bacteria 26055
374 Ga0105244_10003234 3300009036 Bacteria 11785
375 Ga0105244_10012661 3300009036 Bacteria 4974
376 Ga0105244_10103412 3300009036 Bacteria 1391
377 Ga0105250_10000003 3300009092 Bacteria 547770
378 Ga0105250_10001728 3300009092 Bacteria 11514
379 Ga0105250_10009475 3300009092 Bacteria 4098
380 Ga0105250_10017251 3300009092 Bacteria 2935
381 Ga0105240_10001226 3300009093 Bacteria 44605
382 Ga0105240_10020181 3300009093 Bacteria 8896
383 Ga0105240_10020537 3300009093 Bacteria 8805
384 Ga0105240_10034137 3300009093 Bacteria 6565
385 Ga0105240_10045681 3300009093 Bacteria 5555
386 Ga0105240_10070546 3300009093 Bacteria 4322
387 Ga0105240_10083821 3300009093 Bacteria 3910
388 Ga0105240_10086744 3300009093 Bacteria 3834
389 Ga0105240_10154485 3300009093 Bacteria 2730
390 Ga0105240_10168533 3300009093 Bacteria 2596
391 Ga0105245_10011793 3300009098 Bacteria 7603
392 Ga0105245_10081881 3300009098 Bacteria 2951
393 Ga0105245_10097490 3300009098 Bacteria 2715
394 Ga0105247_10000025 3300009101 Bacteria 208459
395 Ga0114129_10063689 3300009147 Bacteria 5147
396 Ga0105243_10012776 3300009148 Bacteria 6343
397 Ga0105243_10019159 3300009148 Bacteria 5189
398 Ga0105243_10124092 3300009148 Bacteria 2182
399 Ga0105243_10215976 3300009148 Bacteria 1692
400 Ga0105241_10004859 3300009174 Bacteria 9911
401 Ga0105241_10009081 3300009174 Bacteria 7314
402 Ga0105241_10170548 3300009174 Bacteria 1797
403 Ga0105242_10001479 3300009176 Bacteria 18502
404 Ga0105242_10003609 3300009176 Bacteria 12037
405 Ga0105248_10001100 3300009177 Bacteria 29922
406 Ga0105248_10021561 3300009177 Bacteria 7136
407 Ga0105248_10231464 3300009177 Bacteria 2080
408 Ga0105248_10694320 3300009177 Bacteria 1148
409 Ga0105248_10865413 3300009177 Bacteria 1020
410 Ga0105237_10007380 3300009545 Bacteria 12039
411 Ga0105237_10198579 3300009545 Bacteria 2005
412 Ga0105237_10394179 3300009545 Bacteria 1389
413 Ga0105237_10454371 3300009545 Bacteria 1287
414 Ga0105238_10003854 3300009551 Bacteria 14893
415 Ga0105238_10008692 3300009551 Bacteria 10160
416 Ga0105238_10016180 3300009551 Bacteria 7547
417 Ga0105238_10066930 3300009551 Bacteria 3593
418 Ga0105238_10327290 3300009551 Bacteria 1519
419 Ga0105249_10081230 3300009553 Bacteria 3013
420 Ga0105239_10018646 3300010375 Bacteria 7666
421 Ga0105239_10046798 3300010375 Bacteria 4740
422 Ga0105239_10058381 3300010375 Bacteria 4234
423 Ga0105239_10814223 3300010375 Bacteria 1070
424 Ga0105246_10029427 3300011119 Bacteria 3617
425 Ga0105246_10071635 3300011119 Bacteria 2441
426 Ga0105246_10176018 3300011119 Bacteria 1643
427 Ga0105246_10371569 3300011119 Unclassified 1178
428 Ga0157373_10000246 3300013100 Bacteria 44392
429 Ga0157373_10000690 3300013100 Bacteria 26488
430 Ga0157373_10003596 3300013100 Bacteria 11704
431 Ga0157373_10004570 3300013100 Bacteria 10409
432 Ga0157373_10042899 3300013100 Bacteria 3232
433 Ga0157373_10052705 3300013100 Bacteria 2894
434 Ga0157371_10000068 3300013102 Bacteria 168110
435 Ga0157371_10000403 3300013102 Bacteria 54162
436 Ga0157371_10001844 3300013102 Bacteria 21340
437 Ga0157371_10022773 3300013102 Bacteria 4583
438 Ga0157371_10029347 3300013102 Bacteria 3979
439 Ga0157371_10050004 3300013102 Bacteria 2970
440 Ga0157371_10102698 3300013102 Bacteria 2028
441 Ga0157370_10000588 3300013104 Bacteria 45380
442 Ga0157370_10033262 3300013104 Bacteria 5026
443 Ga0157370_10046640 3300013104 Bacteria 4154
444 Ga0157370_10067702 3300013104 Bacteria 3375
445 Ga0157370_10083102 3300013104 Bacteria 3011
446 Ga0157370_10203762 3300013104 Bacteria 1835
447 Ga0157369_10000806 3300013105 Bacteria 40098
448 Ga0157369_10001198 3300013105 Bacteria 32287
449 Ga0157369_10039686 3300013105 Bacteria 5143
450 Ga0157369_10057748 3300013105 Bacteria 4185
451 Ga0157369_10071126 3300013105 Bacteria 3736
452 Ga0157369_10146496 3300013105 Bacteria 2497
453 Ga0157369_10260040 3300013105 Bacteria 1810
454 Ga0157369_10494501 3300013105 Bacteria 1265
455 Ga0157374_10010415 3300013296 Bacteria 7995
456 Ga0157378_10012484 3300013297 Bacteria 7438
457 Ga0157378_10026369 3300013297 Bacteria 5123
458 Ga0157378_10047254 3300013297 Bacteria 3826
459 Ga0157378_10136045 3300013297 Bacteria 2278
460 Ga0163162_10002664 3300013306 Bacteria 16928
461 Ga0163162_10008020 3300013306 Bacteria 10302
462 Ga0163162_10200481 3300013306 Bacteria 2124
463 Ga0163162_10328247 3300013306 Bacteria 1662
464 Ga0163162_10380477 3300013306 Bacteria 1545
465 Ga0157372_10002109 3300013307 Bacteria 21612
466 Ga0157372_10013717 3300013307 Bacteria 8660
467 Ga0157372_10025209 3300013307 Bacteria 6464
468 Ga0157372_10026577 3300013307 Bacteria 6298
469 Ga0157372_10029945 3300013307 Bacteria 5948
470 Ga0157372_10047958 3300013307 Bacteria 4747
471 Ga0157372_10201638 3300013307 Bacteria 2305
472 Ga0157372_10225700 3300013307 Bacteria 2171
473 Ga0157372_10389608 3300013307 Bacteria 1624
474 Ga0157372_10808244 3300013307 Bacteria 1089
475 Ga0157375_10014030 3300013308 Bacteria 7146
476 Ga0157375_10109466 3300013308 Bacteria 2859
477 Ga0163163_10137043 3300014325 Bacteria 2489
478 Ga0163163_10300795 3300014325 Bacteria 1657
479 Ga0182008_10008606 3300014497 Bacteria 5557
480 Ga0182008_10017906 3300014497 Bacteria 3670
481 Ga0182008_10053551 3300014497 Bacteria 1998
482 Ga0182008_10054352 3300014497 Bacteria 1981
483 Ga0182008_10054448 3300014497 Bacteria 1979
484 Ga0157377_10207867 3300014745 Bacteria 1246
485 Ga0157379_10000822 3300014968 Bacteria 25188
486 Ga0157379_10031635 3300014968 Bacteria 4715
487 Ga0157379_10043114 3300014968 Bacteria 4028
488 Ga0157379_10172638 3300014968 Bacteria 1951
489 Ga0157376_10040111 3300014969 Bacteria 3825
490 Ga0157376_10050364 3300014969 Bacteria 3455
491 Ga0157376_10065990 3300014969 Bacteria 3058
492 Ga0157376_10066190 3300014969 Bacteria 3054
493 Ga0182006_1002752 3300015261 Bacteria 9417
494 Ga0182006_1004738 3300015261 Bacteria 6647
495 Ga0182006_1010306 3300015261 Bacteria 4160
496 Ga0182006_1065386 3300015261 Bacteria 1362
497 Ga0182007_10004564 3300015262 Bacteria 6258
498 Ga0182005_1000072 3300015265 Bacteria 84500
499 Ga0183361_11773 3300016635 Bacteria 1132
500 Ga0163161_10000001 3300017792 Bacteria 2041488
501 Ga0163161_10000092 3300017792 Bacteria 90636
502 Ga0163161_10040958 3300017792 Bacteria 3328
503 Ga0163161_10052349 3300017792 Bacteria 2959
504 Ga0206356_11752824 3300020070 Bacteria 1983
505 Ga0206353_10213026 3300020082 Bacteria 1899
506 Ga0213872_10028976 3300021361 Bacteria 2539
507 Ga0213872_10032545 3300021361 Bacteria 2389
508 Ga0209435_100008 3300025206 Bacteria 503644
509 Ga0209760_100605 3300025207 Bacteria 6193
510 Ga0209784_100002 3300025224 Bacteria 1753105
511 Ga0209784_100010 3300025224 Bacteria 683664
512 Ga0209784_100815 3300025224 Bacteria 7115
513 Ga0209784_101126 3300025224 Bacteria 4344
514 Ga0209566_100003 3300025225 Bacteria 1753105
515 Ga0209566_100008 3300025225 Bacteria 683664
516 Ga0209566_100421 3300025225 Bacteria 32639
517 Ga0209674_100004 3300025226 Bacteria 1753105
518 Ga0209674_100013 3300025226 Bacteria 813140
519 Ga0209674_100019 3300025226 Bacteria 683664
520 Ga0209674_100188 3300025226 Bacteria 67031
521 Ga0209674_100199 3300025226 Bacteria 62593
522 Ga0209674_100267 3300025226 Bacteria 40569
523 Ga0209672_100010 3300025228 Bacteria 873151
524 Ga0209672_100031 3300025228 Bacteria 332889
525 Ga0209672_100335 3300025228 Bacteria 30277
526 Ga0209672_101072 3300025228 Bacteria 11673
527 Ga0209147_100006 3300025229 Bacteria 873276
528 Ga0209147_100040 3300025229 Bacteria 307612
529 Ga0209563_100006 3300025230 Bacteria 1753105
530 Ga0209563_100021 3300025230 Bacteria 683764
531 Ga0207427_100762 3300025231 Bacteria 14665
532 Ga0207427_101758 3300025231 Bacteria 7064
533 Ga0209437_100019 3300025233 Bacteria 683764
534 Ga0209437_100045 3300025233 Bacteria 429809
535 Ga0209258_100010 3300025242 Bacteria 873276
536 Ga0209258_100061 3300025242 Bacteria 313501
537 Ga0209258_100099 3300025242 Bacteria 214924
538 Ga0207425_1000350 3300025245 Bacteria 32028
539 Ga0207425_1003335 3300025245 Bacteria 5190
540 Ga0209646_1000029 3300025246 Bacteria 386414
541 Ga0209646_1000059 3300025246 Bacteria 256909
542 Ga0209026_1000016 3300025250 Bacteria 386457
543 Ga0209677_100003 3300025253 Bacteria 1753105
544 Ga0209677_100011 3300025253 Bacteria 683664
545 Ga0209148_1000018 3300025254 Bacteria 756247
546 Ga0209148_1000021 3300025254 Bacteria 714645
547 Ga0209148_1000070 3300025254 Bacteria 332889
548 Ga0209148_1000103 3300025254 Bacteria 215356
549 Ga0209759_1000016 3300025256 Bacteria 386414
550 Ga0209759_1000251 3300025256 Bacteria 79885
551 Ga0209759_1000261 3300025256 Bacteria 76336
552 Ga0209759_1000309 3300025256 Bacteria 65969
553 Ga0209759_1013107 3300025256 Bacteria 2259
554 Ga0209129_1000007 3300025258 Bacteria 771325
555 Ga0209129_1000164 3300025258 Bacteria 98984
556 Ga0209129_1023641 3300025258 Bacteria 1093
557 Ga0209233_1000025 3300025261 Bacteria 683764
558 Ga0209233_1000093 3300025261 Bacteria 306016
559 Ga0209565_1000061 3300025263 Bacteria 185308
560 Ga0209565_1000075 3300025263 Bacteria 162259
561 Ga0209565_1000697 3300025263 Bacteria 20786
562 Ga0209565_1003533 3300025263 Bacteria 5014
563 Ga0209455_1000015 3300025272 Bacteria 756128
564 Ga0209455_1000069 3300025272 Bacteria 308247
565 Ga0209673_1000026 3300025273 Bacteria 373739
566 Ga0209673_1000133 3300025273 Bacteria 161740
567 Ga0209673_1000298 3300025273 Bacteria 91771
568 Ga0209673_1000304 3300025273 Bacteria 91151
569 Ga0209673_1001340 3300025273 Bacteria 24629
570 Ga0209673_1002778 3300025273 Bacteria 11389
571 Ga0209673_1017220 3300025273 Bacteria 2669
572 Ga0209130_1000014 3300025284 Bacteria 412039
573 Ga0209130_1002015 3300025284 Bacteria 11066
574 Ga0209130_1003534 3300025284 Bacteria 6554
575 Ga0209130_1003764 3300025284 Bacteria 6187
576 Ga0209675_1000074 3300025291 Bacteria 162260
577 Ga0209675_1000098 3300025291 Bacteria 130512
578 Ga0209675_1000660 3300025291 Bacteria 24237
579 Ga0209675_1000884 3300025291 Bacteria 19276
580 Ga0209675_1007168 3300025291 Bacteria 4324
581 Ga0209675_1014643 3300025291 Bacteria 2375
582 Ga0209676_1000013 3300025292 Bacteria 816080
583 Ga0209676_1000122 3300025292 Bacteria 195510
584 Ga0209676_1000301 3300025292 Bacteria 99952
585 Ga0209676_1005284 3300025292 Bacteria 6810
586 Ga0209676_1027095 3300025292 Bacteria 1808
587 Ga0209025_1000073 3300025294 Bacteria 282133
588 Ga0209025_1000935 3300025294 Bacteria 44463
589 Ga0209025_1001239 3300025294 Bacteria 35471
590 Ga0209025_1006026 3300025294 Bacteria 9609
591 Ga0209025_1017606 3300025294 Bacteria 4110
592 Ga0209025_1022432 3300025294 Bacteria 3347
593 Ga0209025_1023192 3300025294 Bacteria 3254
594 Ga0209564_1000062 3300025295 Bacteria 321275
595 Ga0209564_1000181 3300025295 Bacteria 151002
596 Ga0209564_1000247 3300025295 Bacteria 116628
597 Ga0209564_1000524 3300025295 Bacteria 62668
598 Ga0209564_1000594 3300025295 Bacteria 56686
599 Ga0209564_1007384 3300025295 Bacteria 5689
600 Ga0209564_1028162 3300025295 Bacteria 1805
601 Ga0209758_1000025 3300025297 Bacteria 586687
602 Ga0209758_1000280 3300025297 Bacteria 101103
603 Ga0209758_1000820 3300025297 Bacteria 43617
604 Ga0209758_1032246 3300025297 Bacteria 2131
605 Ga0209050_1000002 3300025298 Bacteria 1792849
606 Ga0209050_1000008 3300025298 Bacteria 1144179
607 Ga0209050_1000736 3300025298 Bacteria 47556
608 Ga0209050_1004147 3300025298 Bacteria 10038
609 Ga0209050_1020428 3300025298 Bacteria 2465
610 Ga0209256_1000039 3300025299 Bacteria 372337
611 Ga0209256_1000050 3300025299 Bacteria 308622
612 Ga0209256_1000063 3300025299 Bacteria 252716
613 Ga0209256_1000280 3300025299 Bacteria 89706
614 Ga0207426_1000001 3300025302 Bacteria 1341301
615 Ga0207426_1000028 3300025302 Bacteria 483955
616 Ga0207426_1000242 3300025302 Bacteria 122839
617 Ga0207426_1001464 3300025302 Bacteria 19473
618 Ga0209051_1000002 3300025303 Bacteria 1631846
619 Ga0209051_1000005 3300025303 Bacteria 1142353
620 Ga0209051_1000541 3300025303 Bacteria 46579
621 Ga0209051_1000936 3300025303 Bacteria 28816
622 Ga0209051_1006164 3300025303 Bacteria 6811
623 Ga0209257_1000002 3300025304 Bacteria 1767052
624 Ga0209257_1000031 3300025304 Bacteria 688770
625 Ga0209257_1007245 3300025304 Bacteria 6780
626 Ga0209257_1017216 3300025304 Bacteria 2862
627 Ga0209257_1023053 3300025304 Bacteria 2201
628 Ga0207697_10003784 3300025315 Bacteria 7388
629 Ga0207656_10002257 3300025321 Bacteria 6461
630 Ga0207656_10026122 3300025321 Bacteria 2377
631 Ga0207696_1000001 3300025711 Bacteria 2579611
632 Ga0207696_1000003 3300025711 Bacteria 860639
633 Ga0207696_1000966 3300025711 Bacteria 17437
634 Ga0207655_1007127 3300025728 Bacteria 7297
635 Ga0207655_1016097 3300025728 Bacteria 4115
636 Ga0207655_1064726 3300025728 Bacteria 1392
637 Ga0207713_1000006 3300025735 Bacteria 586163
638 Ga0207713_1000024 3300025735 Bacteria 339156
639 Ga0207713_1000026 3300025735 Bacteria 319032
640 Ga0207713_1000135 3300025735 Bacteria 112173
641 Ga0207713_1003242 3300025735 Bacteria 11220
642 Ga0207682_10016861 3300025893 Bacteria 2851
643 Ga0207692_10175089 3300025898 Bacteria 1246
644 Ga0207642_10010691 3300025899 Bacteria 3247
645 Ga0207710_10000140 3300025900 Bacteria 83223
646 Ga0207688_10033081 3300025901 Bacteria 2858
647 Ga0207688_10119514 3300025901 Bacteria 1537
648 Ga0207680_10072320 3300025903 Bacteria 2140
649 Ga0207680_10159552 3300025903 Bacteria 1511
650 Ga0207647_10007601 3300025904 Bacteria 7811
651 Ga0207685_10075687 3300025905 Bacteria 1378
652 Ga0207699_10009877 3300025906 Bacteria 4768
653 Ga0207699_10027146 3300025906 Bacteria 3166
654 Ga0207699_10222174 3300025906 Bacteria 1290
655 Ga0207699_10352647 3300025906 Bacteria 1039
656 Ga0207645_10000888 3300025907 Bacteria 24819
657 Ga0207645_10005425 3300025907 Bacteria 9245
658 Ga0207645_10044963 3300025907 Bacteria 2824
659 Ga0207645_10112440 3300025907 Bacteria 1764
660 Ga0207643_10000322 3300025908 Bacteria 32870
661 Ga0207643_10029888 3300025908 Bacteria 3031
662 Ga0207705_10079291 3300025909 Bacteria 2391
663 Ga0207705_10288222 3300025909 Bacteria 1258
664 Ga0207705_10382617 3300025909 Bacteria 1087
665 Ga0207684_10011218 3300025910 Bacteria 7850
666 Ga0207684_10076043 3300025910 Bacteria 2854
667 Ga0207684_10360358 3300025910 Bacteria 1251
668 Ga0207654_10000006 3300025911 Bacteria 815027
669 Ga0207654_10006307 3300025911 Bacteria 5961
670 Ga0207654_10057067 3300025911 Bacteria 2267
671 Ga0207707_10000943 3300025912 Bacteria 28017
672 Ga0207707_10003952 3300025912 Bacteria 13171
673 Ga0207707_10008846 3300025912 Bacteria 8746
674 Ga0207707_10015683 3300025912 Bacteria 6602
675 Ga0207695_10000729 3300025913 Bacteria 63923
676 Ga0207695_10001256 3300025913 Bacteria 43272
677 Ga0207695_10003589 3300025913 Bacteria 21707
678 Ga0207695_10018907 3300025913 Bacteria 7949
679 Ga0207695_10158828 3300025913 Bacteria 2194
680 Ga0207671_10061577 3300025914 Bacteria 2784
681 Ga0207671_10225037 3300025914 Bacteria 1470
682 Ga0207671_10401030 3300025914 Bacteria 1091
683 Ga0207693_10003904 3300025915 Bacteria 12692
684 Ga0207693_10020216 3300025915 Bacteria 5296
685 Ga0207693_10022217 3300025915 Bacteria 5042
686 Ga0207693_10191345 3300025915 Bacteria 1610
687 Ga0207663_10008013 3300025916 Bacteria 5509
688 Ga0207663_10053911 3300025916 Bacteria 2515
689 Ga0207663_10088532 3300025916 Bacteria 2048
690 Ga0207663_10192868 3300025916 Bacteria 1464
691 Ga0207663_10201148 3300025916 Bacteria 1437
692 Ga0207660_10009870 3300025917 Bacteria 6183
693 Ga0207660_10018713 3300025917 Bacteria 4622
694 Ga0207660_10101650 3300025917 Bacteria 2148
695 Ga0207660_10131415 3300025917 Bacteria 1906
696 Ga0207662_10046737 3300025918 Bacteria 2562
697 Ga0207657_10000846 3300025919 Bacteria 32366
698 Ga0207657_10001947 3300025919 Bacteria 22296
699 Ga0207657_10005399 3300025919 Bacteria 13360
700 Ga0207657_10016935 3300025919 Bacteria 7014
701 Ga0207657_10136976 3300025919 Bacteria 2002
702 Ga0207657_10149832 3300025919 Bacteria 1901
703 Ga0207657_10331218 3300025919 Bacteria 1202
704 Ga0207649_10007371 3300025920 Bacteria 5985
705 Ga0207649_10009890 3300025920 Bacteria 5227
706 Ga0207649_10018324 3300025920 Bacteria 3979
707 Ga0207649_10151136 3300025920 Bacteria 1599
708 Ga0207652_10005810 3300025921 Bacteria 10008
709 Ga0207652_10006828 3300025921 Bacteria 9198
710 Ga0207652_10011458 3300025921 Bacteria 7148
711 Ga0207652_10014396 3300025921 Bacteria 6408
712 Ga0207652_10032103 3300025921 Bacteria 4411
713 Ga0207652_10039078 3300025921 Bacteria 4026
714 Ga0207652_10194820 3300025921 Bacteria 1823
715 Ga0207652_10287003 3300025921 Bacteria 1485
716 Ga0207646_10050698 3300025922 Bacteria 3714
717 Ga0207646_10077610 3300025922 Bacteria 2968
718 Ga0207646_10226137 3300025922 Bacteria 1690
719 Ga0207681_10010633 3300025923 Bacteria 5644
720 Ga0207694_10002475 3300025924 Bacteria 15033
721 Ga0207694_10004184 3300025924 Bacteria 11321
722 Ga0207694_10005105 3300025924 Bacteria 10143
723 Ga0207650_10001677 3300025925 Bacteria 15731
724 Ga0207659_10028667 3300025926 Bacteria 3786
725 Ga0207659_10199690 3300025926 Bacteria 1596
726 Ga0207687_10002669 3300025927 Bacteria 12071
727 Ga0207687_10012091 3300025927 Bacteria 5645
728 Ga0207687_10149996 3300025927 Bacteria 1778
729 Ga0207687_10396380 3300025927 Bacteria 1134
730 Ga0207700_10000092 3300025928 Bacteria 55014
731 Ga0207700_10030270 3300025928 Bacteria 3831
732 Ga0207700_10039869 3300025928 Bacteria 3423
733 Ga0207700_10148136 3300025928 Bacteria 1937
734 Ga0207664_10001295 3300025929 Bacteria 16518
735 Ga0207664_10017931 3300025929 Bacteria 5201
736 Ga0207664_10075941 3300025929 Bacteria 2718
737 Ga0207664_10320201 3300025929 Bacteria 1368
738 Ga0207644_10016637 3300025931 Bacteria 4951
739 Ga0207644_10032606 3300025931 Bacteria 3635
740 Ga0207644_10034362 3300025931 Bacteria 3547
741 Ga0207644_10036956 3300025931 Bacteria 3432
742 Ga0207644_10066784 3300025931 Bacteria 2619
743 Ga0207644_10112437 3300025931 Bacteria 2061
744 Ga0207644_10143078 3300025931 Bacteria 1843
745 Ga0207690_10001326 3300025932 Bacteria 15559
746 Ga0207690_10013278 3300025932 Bacteria 4946
747 Ga0207690_10013760 3300025932 Bacteria 4871
748 Ga0207690_10077490 3300025932 Bacteria 2311
749 Ga0207690_10089767 3300025932 Bacteria 2167
750 Ga0207690_10123091 3300025932 Bacteria 1887
751 Ga0207706_10000002 3300025933 Bacteria 360309
752 Ga0207706_10000542 3300025933 Bacteria 40183
753 Ga0207706_10001871 3300025933 Bacteria 20626
754 Ga0207706_10011474 3300025933 Bacteria 8070
755 Ga0207706_10021360 3300025933 Bacteria 5815
756 Ga0207706_10049534 3300025933 Bacteria 3712
757 Ga0207706_10083462 3300025933 Bacteria 2809
758 Ga0207686_10000264 3300025934 Bacteria 39340
759 Ga0207686_10010340 3300025934 Bacteria 5079
760 Ga0207709_10000830 3300025935 Bacteria 23784
761 Ga0207709_10017575 3300025935 Bacteria 3992
762 Ga0207669_10012201 3300025937 Bacteria 4217
763 Ga0207669_10097649 3300025937 Bacteria 1932
764 Ga0207704_10064481 3300025938 Bacteria 2289
765 Ga0207704_10104060 3300025938 Bacteria 1900
766 Ga0207665_10295189 3300025939 Bacteria 1210
767 Ga0207691_10012463 3300025940 Bacteria 8152
768 Ga0207691_10033680 3300025940 Bacteria 4770
769 Ga0207691_10062625 3300025940 Bacteria 3374
770 Ga0207691_10064868 3300025940 Bacteria 3308
771 Ga0207691_10438498 3300025940 Bacteria 1112
772 Ga0207711_10011935 3300025941 Bacteria 7221
773 Ga0207711_10090596 3300025941 Bacteria 2688
774 Ga0207711_10096552 3300025941 Bacteria 2608
775 Ga0207711_10125750 3300025941 Bacteria 2293
776 Ga0207711_10136888 3300025941 Bacteria 2200
777 Ga0207689_10000028 3300025942 Bacteria 100652
778 Ga0207689_10010418 3300025942 Bacteria 8003
779 Ga0207689_10047828 3300025942 Bacteria 3529
780 Ga0207661_10016709 3300025944 Bacteria 5416
781 Ga0207661_10387660 3300025944 Bacteria 1265
782 Ga0207679_10001031 3300025945 Bacteria 17798
783 Ga0207679_10019797 3300025945 Bacteria 4531
784 Ga0207679_10038640 3300025945 Bacteria 3402
785 Ga0207679_10046787 3300025945 Bacteria 3138
786 Ga0207679_10052011 3300025945 Bacteria 3002
787 Ga0207679_10086417 3300025945 Bacteria 2412
788 Ga0207679_10143390 3300025945 Bacteria 1934
789 Ga0207679_10250811 3300025945 Bacteria 1505
790 Ga0207667_10000025 3300025949 Bacteria 350159
791 Ga0207667_10000771 3300025949 Bacteria 41653
792 Ga0207667_10003035 3300025949 Bacteria 20831
793 Ga0207667_10023049 3300025949 Bacteria 6861
794 Ga0207667_10043960 3300025949 Bacteria 4738
795 Ga0207667_10083700 3300025949 Bacteria 3303
796 Ga0207667_10121123 3300025949 Bacteria 2696
797 Ga0207667_10180193 3300025949 Bacteria 2170
798 Ga0207667_10273894 3300025949 Bacteria 1725
799 Ga0207667_10344735 3300025949 Bacteria 1520
800 Ga0207651_10000809 3300025960 Bacteria 13481
801 Ga0207651_10010536 3300025960 Bacteria 5129
802 Ga0207651_10047380 3300025960 Bacteria 2898
803 Ga0207651_10128613 3300025960 Bacteria 1934
804 Ga0207651_10171297 3300025960 Bacteria 1712
805 Ga0207651_10217695 3300025960 Bacteria 1541
806 Ga0207712_10071437 3300025961 Bacteria 2496
807 Ga0207668_10011691 3300025972 Bacteria 5342
808 Ga0207668_10280006 3300025972 Bacteria 1367
809 Ga0207640_10000088 3300025981 Bacteria 72802
810 Ga0207640_10008896 3300025981 Bacteria 5595
811 Ga0207640_10037096 3300025981 Bacteria 3064
812 Ga0207640_10043546 3300025981 Bacteria 2870
813 Ga0207640_10431298 3300025981 Bacteria 1081
814 Ga0207658_10011284 3300025986 Bacteria 6084
815 Ga0207658_10079531 3300025986 Bacteria 2508
816 Ga0207658_10168185 3300025986 Bacteria 1803
817 Ga0207658_10264907 3300025986 Bacteria 1466
818 Ga0207677_10000683 3300026023 Bacteria 20069
819 Ga0207677_10008644 3300026023 Bacteria 5701
820 Ga0207677_10020504 3300026023 Bacteria 4014
821 Ga0207677_10099109 3300026023 Bacteria 2139
822 Ga0207677_10245412 3300026023 Bacteria 1451
823 Ga0207703_10014654 3300026035 Bacteria 6116
824 Ga0207703_10018635 3300026035 Bacteria 5421
825 Ga0207703_10065942 3300026035 Bacteria 2977
826 Ga0207703_10166464 3300026035 Bacteria 1935
827 Ga0207639_10001521 3300026041 Bacteria 15579
828 Ga0207639_10008293 3300026041 Bacteria 7120
829 Ga0207639_10337871 3300026041 Bacteria 1342
830 Ga0207678_10007039 3300026067 Bacteria 9987
831 Ga0207678_10053259 3300026067 Bacteria 3488
832 Ga0207678_10061782 3300026067 Bacteria 3222
833 Ga0207678_10079885 3300026067 Bacteria 2800
834 Ga0207678_10113627 3300026067 Bacteria 2310
835 Ga0207678_10161176 3300026067 Bacteria 1916
836 Ga0207678_10209094 3300026067 Bacteria 1669
837 Ga0207708_10000643 3300026075 Bacteria 26779
838 Ga0207708_10153046 3300026075 Bacteria 1817
839 Ga0207702_10000925 3300026078 Bacteria 30287
840 Ga0207702_10053553 3300026078 Bacteria 3417
841 Ga0207702_10088357 3300026078 Bacteria 2707
842 Ga0207702_10096176 3300026078 Bacteria 2604
843 Ga0207702_10170898 3300026078 Bacteria 1993
844 Ga0207702_10407851 3300026078 Bacteria 1312
845 Ga0207641_10012053 3300026088 Bacteria 7092
846 Ga0207641_10040206 3300026088 Bacteria 3914
847 Ga0207648_10000894 3300026089 Bacteria 33651
848 Ga0207648_10001620 3300026089 Bacteria 24687
849 Ga0207648_10001939 3300026089 Bacteria 22632
850 Ga0207648_10022177 3300026089 Bacteria 5705
851 Ga0207648_10027470 3300026089 Bacteria 5051
852 Ga0207676_10001707 3300026095 Bacteria 16184
853 Ga0207676_10016541 3300026095 Bacteria 5341
854 Ga0207676_10018372 3300026095 Bacteria 5081
855 Ga0207676_10024146 3300026095 Bacteria 4496
856 Ga0207676_10228281 3300026095 Bacteria 1662
857 Ga0207674_10000064 3300026116 Bacteria 109914
858 Ga0207674_10000296 3300026116 Bacteria 63065
859 Ga0207674_10001590 3300026116 Bacteria 29225
860 Ga0207674_10002028 3300026116 Bacteria 25707
861 Ga0207674_10002285 3300026116 Bacteria 24300
862 Ga0207674_10018501 3300026116 Bacteria 7572
863 Ga0207674_10026383 3300026116 Bacteria 6172
864 Ga0207674_10026973 3300026116 Bacteria 6090
865 Ga0207674_10033552 3300026116 Bacteria 5374
866 Ga0207675_100000552 3300026118 Bacteria 36552
867 Ga0207675_100128149 3300026118 Bacteria 2405
868 Ga0207675_100154198 3300026118 Bacteria 2188
869 Ga0207675_100179395 3300026118 Bacteria 2027
870 Ga0207683_10000546 3300026121 Bacteria 34831
871 Ga0207683_10000722 3300026121 Bacteria 30052
872 Ga0207683_10002014 3300026121 Bacteria 17980
873 Ga0207683_10085585 3300026121 Bacteria 2802
874 Ga0207683_10134740 3300026121 Bacteria 2223
875 Ga0207683_10248920 3300026121 Bacteria 1622
876 Ga0207698_10006318 3300026142 Bacteria 7377
877 Ga0207698_10008199 3300026142 Bacteria 6590
878 Ga0207698_10027589 3300026142 Bacteria 4033
879 Ga0207698_10046993 3300026142 Bacteria 3265
880 Ga0207698_10081071 3300026142 Bacteria 2617
881 Ga0207698_10128975 3300026142 Bacteria 2157
882 Ga0207698_10147383 3300026142 Bacteria 2037
883 Ga0207698_10186768 3300026142 Bacteria 1842
884 Ga0207698_10197704 3300026142 Bacteria 1797
885 Ga0207698_10311928 3300026142 Bacteria 1469
886 Ga0209281_1000008 3300027111 Bacteria 867470
887 Ga0209281_1000148 3300027111 Bacteria 168332
888 Ga0209281_1000204 3300027111 Bacteria 134173
889 Ga0209281_1000354 3300027111 Bacteria 75625
890 Ga0209371_1000177 3300027312 Bacteria 94023
891 Ga0209371_1000215 3300027312 Bacteria 78569
892 Ga0209371_1001362 3300027312 Bacteria 16911
893 Ga0209371_1003669 3300027312 Bacteria 7257
894 Ga0209371_1022028 3300027312 Bacteria 1532
895 Ga0209371_1022036 3300027312 Bacteria 1532
896 Ga0209999_1010228 3300027543 Bacteria 1695
897 Ga0209983_1012647 3300027665 Bacteria 1733
898 Ga0209282_1000114 3300027666 Bacteria 51706
899 Ga0209971_1003810 3300027682 Bacteria 3567
900 Ga0209998_10008075 3300027717 Bacteria 2184
901 Ga0209974_10003049 3300027876 Bacteria 6058
902 Ga0268266_10010671 3300028379 Bacteria 8006
903 Ga0268266_10058221 3300028379 Bacteria 3327
904 Ga0268266_10067378 3300028379 Bacteria 3098
905 Ga0268266_10128712 3300028379 Bacteria 2262
906 Ga0268266_10421255 3300028379 Bacteria 1265
907 Ga0268264_10004834 3300028381 Bacteria 11415
908 Ga0268264_10022048 3300028381 Bacteria 5197
909 Ga0268264_10037345 3300028381 Bacteria 4005
910 Ga0268264_10097863 3300028381 Bacteria 2544
911 Ga0268264_10228777 3300028381 Bacteria 1716
912 Ga0268264_10505854 3300028381 Bacteria 1179
913 Ga0307517_10000395 3300028786 Bacteria 74663
914 Ga0307517_10045823 3300028786 Bacteria 4582
915 Ga0307517_10148469 3300028786 Bacteria 1618
916 Ga0307515_10000463 3300028794 Bacteria 97084
917 Ga0307515_10000515 3300028794 Bacteria 92187
918 Ga0307515_10001074 3300028794 Bacteria 62572
919 Ga0307515_10027481 3300028794 Bacteria 9725
920 Ga0265338_10021924 3300028800 Bacteria 6637
921 Ga0268256_1000172 3300030500 Bacteria 78620
922 Ga0268256_1000191 3300030500 Bacteria 71516
923 Ga0268256_1001592 3300030500 Bacteria 13248
924 Ga0268256_1001905 3300030500 Bacteria 11504
925 Ga0268256_1024808 3300030500 Bacteria 1532
926 Ga0307512_10030754 3300030522 Bacteria 4665
927 Ga0307512_10200560 3300030522 Bacteria 1081
928 Ga0316180_1113847 3300030736 Bacteria 2599
929 Ga0316181_1060367 3300030744 Bacteria 8109
930 Ga0265330_10003359 3300031235 Bacteria 8391
931 Ga0265332_10000438 3300031238 Bacteria 29335
932 Ga0265328_10068599 3300031239 Bacteria 1303
933 Ga0265325_10078903 3300031241 Bacteria 1639
934 Ga0265327_10030070 3300031251 Bacteria 3077
935 Ga0265327_10046166 3300031251 Bacteria 2309
936 Ga0265316_10017701 3300031344 Bacteria 6145
937 Ga0307513_10002544 3300031456 Bacteria 25207
938 Ga0307513_10057955 3300031456 Bacteria 4121
939 Ga0307513_10145442 3300031456 Bacteria 2289
940 Ga0307513_10272959 3300031456 Bacteria 1473
941 Ga0307509_10004851 3300031507 Bacteria 19085
942 Ga0307509_10014070 3300031507 Bacteria 9434
943 Ga0307509_10040885 3300031507 Bacteria 5038
944 Ga0307509_10059845 3300031507 Bacteria 4029
945 Ga0307408_100003042 3300031548 Bacteria 11582
946 Ga0307408_100004174 3300031548 Bacteria 9846
947 Ga0307408_100012408 3300031548 Bacteria 5644
948 Ga0307508_10000130 3300031616 Bacteria 89085
949 Ga0307508_10003625 3300031616 Bacteria 15506
950 Ga0307508_10016910 3300031616 Bacteria 6638
951 Ga0307508_10059234 3300031616 Bacteria 3387
952 Ga0307508_10068121 3300031616 Bacteria 3129
953 Ga0307508_10076807 3300031616 Bacteria 2918
954 Ga0307514_10000529 3300031649 Bacteria 74752
955 Ga0307514_10068998 3300031649 Bacteria 2662
956 Ga0307514_10095226 3300031649 Bacteria 2155
957 Ga0265314_10079452 3300031711 Bacteria 2168
958 Ga0307516_10019556 3300031730 Bacteria 7012
959 Ga0307516_10029179 3300031730 Bacteria 5578
960 Ga0307516_10069305 3300031730 Bacteria 3393
961 Ga0307405_10004432 3300031731 Bacteria 6639
962 Ga0307413_10003848 3300031824 Bacteria 6409
963 Ga0307410_10052589 3300031852 Bacteria 2752
964 Ga0307406_10004110 3300031901 Bacteria 7925
965 Ga0307406_10020893 3300031901 Bacteria 3864
966 Ga0307406_10111223 3300031901 Bacteria 1886
967 Ga0307407_10328653 3300031903 Bacteria 1075
968 Ga0307412_10031403 3300031911 Bacteria 3354
969 Ga0307412_10074524 3300031911 Bacteria 2325
970 Ga0307409_100031965 3300031995 Bacteria 3807
971 Ga0307409_100035738 3300031995 Bacteria 3644
972 Ga0307409_100152169 3300031995 Bacteria 2010
973 Ga0307416_100002137 3300032002 Bacteria 11177
974 Ga0307416_100013476 3300032002 Bacteria 5559
975 Ga0307416_100019776 3300032002 Bacteria 4784
976 Ga0307416_100319239 3300032002 Bacteria 1554
977 Ga0307414_10019272 3300032004 Bacteria 4224
978 Ga0307414_10029101 3300032004 Bacteria 3592
979 Ga0307414_10174423 3300032004 Bacteria 1722
980 Ga0307411_10068599 3300032005 Bacteria 2391
981 Ga0307507_10070943 3300033179 Bacteria 3154
982 Ga0307510_10018668 3300033180 Bacteria 8153
983 Ga0307510_10064176 3300033180 Bacteria 3731
984 Ga0307510_10121617 3300033180 Bacteria 2313
985 Ga0373948_0009747 3300034817 Bacteria 1664
986 Ga0373944_0046992 3300035089 Bacteria 1351
987 Ga0373953_0003510 3300035117 Bacteria 4895
988 Ga0373954_0092908 3300035118 Bacteria 1450
989 Ga0373956_0012147 3300035119 Bacteria 3563
990 Ga0373943_0013632 3300035170 Bacteria 3674
991 Ga0373943_0095092 3300035170 Bacteria 1549
992 Ga0373946_0002067 3300035171 Bacteria 7047
993 Ga0373946_0035278 3300035171 Bacteria 2023
994 Ga0373955_0015896 3300035172 Bacteria 3693
995 Ga0373955_0025344 3300035172 Bacteria 3044
996 Ga0373955_0078877 3300035172 Bacteria 1857
997 Ga0373935_0054218 3300035692 Bacteria 2552
998 Ga0373935_0150850 3300035692 Bacteria 1577
999 Ga0373935_0240751 3300035692 Bacteria 1263
1000 Ga0373927_0041944 3300035695 Bacteria 2967
1001 Ga0373927_0085034 3300035695 Bacteria 2052
1002 Ga0373933_0094684 3300035724 Bacteria 1847
1003 Ga0373933_0141124 3300035724 Bacteria 1521
1004 Ga0373947_0026904 3300035725 Bacteria 3364
1005 Ga0373947_0037116 3300035725 Bacteria 2891
1006 Ga0373947_0057791 3300035725 Bacteria 2348
1007 Ga0373947_0302774 3300035725 Bacteria 1066
1008 Ga0373937_0030237 3300036401 Bacteria 4906
1009 Ga0373937_0050884 3300036401 Bacteria 3796
1010 Ga0373937_0067007 3300036401 Bacteria 3307
1011 Ga0373937_0408180 3300036401 Bacteria 1289
1012 Ga0373925_0003796 3300037068 Bacteria 11617
1013 Ga0373925_0018343 3300037068 Bacteria 5086
1014 Ga0373925_0069217 3300037068 Bacteria 2665
1015 Ga0373925_0083616 3300037068 Bacteria 2431
1016 Ga0373925_0091297 3300037068 Bacteria 2329
1017 Ga0373925_0091667 3300037068 Bacteria 2324
1018 Ga0395899_0036110 3300037312 Bacteria 3709
1019 Ga0395899_0110094 3300037312 Bacteria 1981
1020 Ga0395900_0021769 3300037418 Bacteria 6555
1021 Ga0395900_0085986 3300037418 Bacteria 3232
1022 Ga0395900_0117199 3300037418 Bacteria 2733
1023 Ga0395900_0123864 3300037418 Bacteria 2651
1024 Ga0395900_0159417 3300037418 Bacteria 2302
1025 Ga0395898_0068061 3300037466 Bacteria 3446
1026 Ga0395905_0000004 3300037471 Bacteria 674991
1027 Ga0395905_0242018 3300037471 Bacteria 1686
1028 Ga0395901_0000095 3300038443 Bacteria 119290
1029 Ga0395901_0029761 3300038443 Bacteria 5624
1030 Ga0395901_0116449 3300038443 Bacteria 2807
1031 Ga0395901_0671044 3300038443 Bacteria 1037
1032 Ga0436361_0097666 3300039447 Bacteria 18811
1033 Ga0436361_0371933 3300039447 Bacteria 1230
1034 Ga0436361_0767394 3300039447 Bacteria 56110
1035 Ga0439466_0065556 3300041411 Bacteria 1164
1036 Ga0451833_0434451 3300041491 Bacteria 1615
1037 Ga0451837_1483507 3300041494 Bacteria 1324
1038 Ga0451853_4081205 3300041512 Bacteria 1471
1039 Ga0439431_0001194 3300041997 Bacteria 5695
1040 Ga0439442_005272 3300042002 Bacteria 2592
1041 Ga0439432_008000 3300042006 Bacteria 3726
1042 Ga0439432_020234 3300042006 Bacteria 2214
1043 Ga0439452_000001 3300042010 Bacteria 1725439
1044 Ga0439452_023789 3300042010 Bacteria 1573
1045 Ga0450908_001364 3300042184 Bacteria 4732
1046 Ga0450918_000203 3300042531 Bacteria 13437
1047 Ga0466969_0034777 3300044656 Bacteria 2552
1048 Ga0466972_0156050 3300044658 Bacteria 1072
1049 Ga0466977_0007265 3300044666 Bacteria 6024
1050 Ga0466966_0000107 3300044684 Bacteria 51017
1051 Ga0466961_0000068 3300044693 Bacteria 62703
1052 Ga0466963_0004228 3300044694 Bacteria 8328
1053 Ga0451576_0122776 3300045051 Bacteria 2705
1054 Ga0466958_0062195 3300045836 Bacteria 2275
1055 Ga0466958_0151295 3300045836 Bacteria 1464
1056 Ga0466967_0537169 3300045976 Bacteria 1150
1057 Ga0495627_000018 3300046453 Bacteria 315125
1058 Ga0495627_011240 3300046453 Bacteria 3220
1059 Ga0495592_0002659 3300046454 Bacteria 12636
1060 Ga0495592_0015849 3300046454 Bacteria 5717
1061 Ga0495592_0048280 3300046454 Bacteria 3167
1062 Ga0495592_0060087 3300046454 Bacteria 2796
1063 Ga0495592_0080844 3300046454 Bacteria 2350
1064 Ga0495603_0000357 3300046455 Bacteria 24624
1065 Ga0495603_0010443 3300046455 Bacteria 5624
1066 Ga0495603_0143118 3300046455 Bacteria 1390
1067 Ga0495590_0001953 3300046457 Bacteria 8718
1068 Ga0495590_0064363 3300046457 Bacteria 1283
1069 Ga0495591_001746 3300046458 Bacteria 12954
1070 Ga0495629_0000019 3300046459 Bacteria 163652
1071 Ga0495629_0000324 3300046459 Bacteria 40913
1072 Ga0495629_0016801 3300046459 Bacteria 5251
1073 Ga0495629_0267931 3300046459 Bacteria 1174
1074 Ga0495638_0008187 3300046460 Bacteria 7433
1075 Ga0495651_0013765 3300046462 Bacteria 6254
1076 Ga0495651_0047323 3300046462 Bacteria 3326
1077 Ga0495653_0001772 3300046463 Bacteria 17027
1078 Ga0495653_0003919 3300046463 Bacteria 12035
1079 Ga0495653_0006411 3300046463 Bacteria 9648
1080 Ga0495653_0038033 3300046463 Bacteria 3777
1081 Ga0495653_0326251 3300046463 Bacteria 993
1082 Ga0495650_0020095 3300046471 Bacteria 3266
1083 Ga0495580_0001459 3300046472 Bacteria 20738
1084 Ga0495580_0002389 3300046472 Bacteria 16394
1085 Ga0495580_0015985 3300046472 Bacteria 5644
1086 Ga0495580_0027959 3300046472 Bacteria 4102
1087 Ga0495580_0043830 3300046472 Bacteria 3183
1088 Ga0495582_0001061 3300046473 Bacteria 15458
1089 Ga0495582_0011323 3300046473 Bacteria 4914
1090 Ga0495582_0021956 3300046473 Bacteria 3492
1091 Ga0495582_0024214 3300046473 Bacteria 3320
1092 Ga0495605_0004558 3300046474 Bacteria 8114
1093 Ga0495605_0007909 3300046474 Bacteria 6023
1094 Ga0495639_0121035 3300046475 Bacteria 1249
1095 Ga0495664_0002904 3300046477 Bacteria 9243
1096 Ga0495664_0007199 3300046477 Bacteria 6169
1097 Ga0495664_0010869 3300046477 Bacteria 5118
1098 Ga0495596_0003607 3300046500 Bacteria 7781
1099 Ga0495607_0000222 3300046501 Bacteria 60428
1100 Ga0495583_0001486 3300046506 Bacteria 23452
1101 Ga0495583_0010931 3300046506 Bacteria 5243
1102 Ga0495606_0053530 3300046507 Bacteria 2618
1103 Ga0495606_0128822 3300046507 Bacteria 1506
1104 Ga0495608_0026339 3300046511 Bacteria 3965
1105 Ga0495608_0069251 3300046511 Bacteria 2305
1106 Ga0495608_0141463 3300046511 Bacteria 1535
1107 Ga0495616_0020440 3300046513 Bacteria 3601
1108 Ga0495618_0027868 3300046514 Bacteria 3518
1109 Ga0495618_0036016 3300046514 Bacteria 3105
1110 Ga0495618_0062376 3300046514 Bacteria 2365
1111 Ga0495620_0005744 3300046515 Bacteria 6899
1112 Ga0495620_0020987 3300046515 Bacteria 3179
1113 Ga0495628_0001514 3300046516 Bacteria 21316
1114 Ga0495628_0016911 3300046516 Bacteria 6078
1115 Ga0495628_0026223 3300046516 Bacteria 4756
1116 Ga0495628_0057183 3300046516 Bacteria 3068
1117 Ga0495628_0147222 3300046516 Bacteria 1795
1118 Ga0495628_0372747 3300046516 Bacteria 1046
1119 Ga0495628_0406625 3300046516 Bacteria 993
1120 Ga0495630_0030909 3300046517 Bacteria 3986
1121 Ga0495630_0042170 3300046517 Bacteria 3408
1122 Ga0495630_0205007 3300046517 Bacteria 1505
1123 Ga0495630_0236657 3300046517 Bacteria 1395
1124 Ga0495631_0001000 3300046518 Bacteria 17547
1125 Ga0495632_0005609 3300046519 Bacteria 8259
1126 Ga0495632_0007553 3300046519 Bacteria 6809
1127 Ga0495643_0027689 3300046522 Bacteria 3183
1128 Ga0495648_0023429 3300046524 Bacteria 4227
1129 Ga0495648_0028656 3300046524 Bacteria 3705
1130 Ga0495648_0055020 3300046524 Bacteria 2400
1131 Ga0495666_0000226 3300046526 Bacteria 24003
1132 Ga0495666_0008250 3300046526 Bacteria 5220
1133 Ga0495666_0089437 3300046526 Bacteria 1453
1134 Ga0495652_0016659 3300046529 Bacteria 6568
1135 Ga0495652_0034597 3300046529 Bacteria 4403
1136 Ga0495652_0036332 3300046529 Bacteria 4285
1137 Ga0495652_0104348 3300046529 Bacteria 2292
1138 Ga0495652_0253880 3300046529 Bacteria 1301
1139 Ga0495654_0001734 3300046530 Bacteria 14624
1140 Ga0495654_0007676 3300046530 Bacteria 6002
1141 Ga0495654_0013733 3300046530 Bacteria 4328
1142 Ga0495654_0027712 3300046530 Bacteria 2901
1143 Ga0495654_0109599 3300046530 Bacteria 1261
1144 Ga0495665_0000719 3300046531 Bacteria 17106
1145 Ga0495665_0001886 3300046531 Bacteria 11322
1146 Ga0495665_0020567 3300046531 Bacteria 3543
1147 Ga0495665_0027050 3300046531 Bacteria 3079
1148 Ga0495665_0066714 3300046531 Bacteria 1899
1149 Ga0495640_0003354 3300046533 Bacteria 12890
1150 Ga0495640_0003716 3300046533 Bacteria 12259
1151 Ga0495640_0037582 3300046533 Bacteria 3415
1152 Ga0495586_0001072 3300046535 Bacteria 15448
1153 Ga0495587_0004090 3300046536 Bacteria 9659
1154 Ga0495587_0023429 3300046536 Bacteria 3793
1155 Ga0495587_0280687 3300046536 Bacteria 933
1156 Ga0495621_0010337 3300046539 Bacteria 2851
1157 Ga0495597_0000426 3300046542 Bacteria 36182
1158 Ga0495645_0002971 3300046543 Bacteria 11474
1159 Ga0495645_0013550 3300046543 Bacteria 5769
1160 Ga0495633_0001594 3300046558 Bacteria 17196
1161 Ga0495667_0010311 3300046559 Bacteria 6321
1162 Ga0495634_0007743 3300046642 Bacteria 8037
1163 Ga0495634_0029938 3300046642 Bacteria 3764
1164 Ga0495634_0096159 3300046642 Bacteria 1918
1165 Ga0495634_0114734 3300046642 Bacteria 1729
1166 Ga0495611_0021100 3300046648 Bacteria 2811
1167 Ga0495625_0000044 3300046660 Bacteria 203855
1168 Ga0495625_0005617 3300046660 Bacteria 11371
1169 Ga0495625_0017290 3300046660 Bacteria 5647
1170 Ga0495625_0045384 3300046660 Bacteria 3177
1171 Ga0495635_0001277 3300046663 Bacteria 16796
1172 Ga0495635_0030140 3300046663 Bacteria 3770
1173 Ga0495635_0034782 3300046663 Bacteria 3494
1174 Ga0495635_0091209 3300046663 Bacteria 2084
1175 Ga0495661_0001965 3300046665 Bacteria 16317
1176 Ga0495661_0044822 3300046665 Bacteria 2708
1177 Ga0495588_0007251 3300046674 Bacteria 5035
1178 Ga0495588_0114008 3300046674 Bacteria 1424
1179 Ga0495657_0117898 3300046675 Bacteria 1675
1180 Ga0495657_0131207 3300046675 Bacteria 1569
1181 Ga0495599_0021985 3300046678 Bacteria 3980
1182 Ga0495599_0076326 3300046678 Bacteria 2092
1183 Ga0495599_0087123 3300046678 Bacteria 1950
1184 Ga0495599_0102375 3300046678 Bacteria 1785
1185 Ga0495623_0006180 3300046679 Bacteria 7785
1186 Ga0495623_0016213 3300046679 Bacteria 4812
1187 Ga0495623_0209783 3300046679 Bacteria 1115
1188 Ga0495646_0000701 3300046680 Bacteria 18534
1189 Ga0495646_0009225 3300046680 Bacteria 6260
1190 Ga0495646_0015429 3300046680 Bacteria 4849
1191 Ga0495646_0068551 3300046680 Bacteria 2093
1192 Ga0495647_0010734 3300046681 Bacteria 3124
1193 Ga0495613_0001967 3300046689 Bacteria 15597
1194 Ga0495613_0003507 3300046689 Bacteria 11744
1195 Ga0495613_0172351 3300046689 Bacteria 1535
1196 Ga0495624_0012912 3300046690 Bacteria 5699
1197 Ga0495624_0024394 3300046690 Bacteria 3979
1198 Ga0495624_0039929 3300046690 Bacteria 3008
1199 Ga0495624_0041251 3300046690 Bacteria 2953
1200 Ga0495624_0211750 3300046690 Bacteria 1175
1201 Ga0495671_0000697 3300046692 Bacteria 24363
1202 Ga0495671_0010602 3300046692 Bacteria 5096
1203 Ga0495671_0017834 3300046692 Bacteria 3775
1204 Ga0495671_0027191 3300046692 Bacteria 2956
1205 Ga0495649_0003585 3300046694 Bacteria 10409
1206 Ga0495649_0016776 3300046694 Bacteria 4147
1207 Ga0495649_0051973 3300046694 Bacteria 2221
1208 Ga0495589_0008221 3300046794 Bacteria 5452
1209 Ga0495589_0053454 3300046794 Bacteria 1993
1210 Ga0495600_0006710 3300046809 Bacteria 7014
1211 Ga0495600_0052670 3300046809 Bacteria 2657
1212 Ga0495600_0089532 3300046809 Bacteria 2007
1213 Ga0495660_0141770 3300046810 Bacteria 1195
1214 Ga0495581_0000184 3300047315 Bacteria 28849
1215 Ga0495581_0030839 3300047315 Bacteria 3105
1216 Ga0495604_0049157 3300047317 Bacteria 3278
1217 Ga0495604_0049796 3300047317 Bacteria 3253
1218 Ga0495604_0059663 3300047317 Bacteria 2923
1219 Ga0495604_0077463 3300047317 Bacteria 2498
1220 Ga0495674_0016934 3300047319 Bacteria 6794
1221 Ga0495674_0033202 3300047319 Bacteria 4676
1222 Ga0495674_0116478 3300047319 Bacteria 2260
1223 Ga0495674_0239155 3300047319 Bacteria 1497
1224 Ga0495672_0000009 3300047320 Bacteria 557755
1225 Ga0495672_0005294 3300047320 Bacteria 10270
1226 Ga0495672_0074110 3300047320 Bacteria 1918
1227 Ga0495676_0009854 3300047321 Bacteria 8679
1228 Ga0495676_0068792 3300047321 Bacteria 2734
1229 Ga0495676_0072217 3300047321 Bacteria 2650
1230 Ga0495676_0093956 3300047321 Bacteria 2235
1231 Ga0495680_0001480 3300047322 Bacteria 25333
1232 Ga0495680_0006595 3300047322 Bacteria 10768
1233 Ga0495680_0019532 3300047322 Bacteria 5716
1234 Ga0495680_0111098 3300047322 Bacteria 2031
1235 Ga0495680_0197578 3300047322 Bacteria 1444
1236 Ga0495683_0003301 3300047323 Bacteria 9428
1237 Ga0495683_0012696 3300047323 Bacteria 4421
1238 Ga0495683_0033221 3300047323 Bacteria 2626
1239 Ga0495687_013333 3300047443 Bacteria 4300
1240 Ga0495687_060952 3300047443 Bacteria 1554
1241 Ga0495687_064028 3300047443 Bacteria 1503
1242 Ga0495675_0003511 3300047444 Bacteria 9445
1243 Ga0495675_0004372 3300047444 Bacteria 8553
1244 Ga0495675_0018518 3300047444 Bacteria 4420
1245 Ga0495675_0022944 3300047444 Bacteria 3977
1246 Ga0495679_000037 3300047446 Bacteria 158099
1247 Ga0495679_000177 3300047446 Bacteria 57800
1248 Ga0495679_000702 3300047446 Bacteria 21779
1249 Ga0495684_0041845 3300047471 Bacteria 3510
1250 Ga0495684_0137308 3300047471 Bacteria 1834
1251 Ga0495684_0284000 3300047471 Bacteria 1193
1252 Ga0495593_0000287 3300047673 Bacteria 27425
1253 Ga0495593_0002263 3300047673 Bacteria 11539
1254 Ga0495593_0005587 3300047673 Bacteria 7425
1255 Ga0495593_0045005 3300047673 Bacteria 2357
1256 Ga0495602_0000447 3300048088 Bacteria 38647
1257 Ga0495602_0026442 3300048088 Bacteria 5596
1258 Ga0495602_0040022 3300048088 Bacteria 4307
1259 Ga0495602_0055472 3300048088 Bacteria 3489
1260 Ga0495602_0126758 3300048088 Bacteria 2043
1261 Ga0495602_0167686 3300048088 Bacteria 1707
1262 Ga0495602_0168279 3300048088 Bacteria 1703
1263 Ga0495614_0000608 3300048089 Bacteria 15027
1264 Ga0495614_0007949 3300048089 Bacteria 4713
1265 Ga0495626_0011433 3300048091 Bacteria 4695
1266 Ga0496100_0000449 3300048903 Bacteria 19895
1267 Ga0496101_0000430 3300048904 Bacteria 26892
1268 Ga0496101_0241798 3300048904 Bacteria 1405
1269 Ga0496102_0000128 3300048905 Bacteria 104717
1270 Ga0496102_0001072 3300048905 Bacteria 25286
1271 Ga0496102_0155028 3300048905 Bacteria 2153
1272 Ga0496103_0000394 3300048906 Bacteria 38815
1273 Ga0496103_0038137 3300048906 Bacteria 2947
1274 Ga0496104_0029946 3300048907 Bacteria 5054
1275 Ga0496104_0049604 3300048907 Bacteria 3958
1276 Ga0496105_0042040 3300048908 Bacteria 3768
1277 Ga0496105_0051246 3300048908 Bacteria 3410
1278 Ga0496105_0113650 3300048908 Bacteria 2234
1279 Ga0496106_0000479 3300048909 Bacteria 28403
1280 Ga0496106_0409087 3300048909 Bacteria 1090
1281 Ga0496107_0009594 3300048910 Bacteria 6713
1282 Ga0496107_0100161 3300048910 Bacteria 2124
1283 Ga0496109_0188840 3300048912 Bacteria 1936
1284 Ga0496110_0139408 3300048913 Bacteria 2192
1285 Ga0496110_0301997 3300048913 Bacteria 1458
1286 Ga0496111_0098337 3300048914 Bacteria 2149
1287 Ga0496112_0030846 3300048915 Bacteria 5193
1288 Ga0496113_0004607 3300048916 Bacteria 8501
1289 Ga0496113_0053862 3300048916 Bacteria 3009
1290 Ga0496114_0005380 3300048917 Bacteria 10011
1291 Ga0496115_0000486 3300048918 Bacteria 31495
1292 Ga0496115_0016930 3300048918 Bacteria 5561
1293 Ga0496115_0427617 3300048918 Bacteria 1072
1294 Ga0496116_0000023 3300048919 Bacteria 475792
1295 Ga0496116_0000460 3300048919 Bacteria 56287
1296 Ga0496116_0013582 3300048919 Bacteria 6551
1297 Ga0496117_0000203 3300048920 Bacteria 117413
1298 Ga0496117_0000463 3300048920 Bacteria 67832
1299 Ga0496117_0005563 3300048920 Bacteria 13188
1300 Ga0496117_0071053 3300048920 Bacteria 2334
1301 Ga0496117_0150624 3300048920 Bacteria 1377
1302 Ga0496118_0000079 3300048921 Bacteria 190113
1303 Ga0496118_0003815 3300048921 Bacteria 18566
1304 Ga0496118_0005103 3300048921 Bacteria 15094
1305 Ga0496118_0005771 3300048921 Bacteria 13908
1306 Ga0496118_0036321 3300048921 Bacteria 3985
1307 Ga0496119_0000056 3300048922 Bacteria 174042
1308 Ga0496119_0001891 3300048922 Bacteria 24077
1309 Ga0496119_0004881 3300048922 Bacteria 13128
1310 Ga0496119_0092153 3300048922 Bacteria 1720
1311 Ga0496120_0000052 3300048923 Bacteria 186071
1312 Ga0496120_0000063 3300048923 Bacteria 170325
1313 Ga0496120_0000137 3300048923 Bacteria 123518
1314 Ga0496121_0000860 3300048924 Bacteria 54968
1315 Ga0496121_0001688 3300048924 Bacteria 36327
1316 Ga0496121_0006093 3300048924 Bacteria 15173
1317 Ga0496121_0029115 3300048924 Bacteria 5119
1318 Ga0496121_0032218 3300048924 Bacteria 4769
1319 Ga0496121_0043019 3300048924 Bacteria 3918
1320 Ga0496121_0065425 3300048924 Bacteria 2958
1321 Ga0496122_0000887 3300048925 Bacteria 55765
1322 Ga0496122_0015744 3300048925 Bacteria 7208
1323 Ga0496122_0031349 3300048925 Bacteria 4427
1324 Ga0496122_0047575 3300048925 Bacteria 3310
1325 Ga0496123_0000180 3300048926 Bacteria 127726
1326 Ga0496123_0004798 3300048926 Bacteria 13954
1327 Ga0496123_0017330 3300048926 Bacteria 5801
1328 Ga0496123_0096875 3300048926 Bacteria 1730
1329 Ga0496124_0000017 3300048927 Bacteria 444389
1330 Ga0496124_0000024 3300048927 Bacteria 414291
1331 Ga0496124_0000451 3300048927 Bacteria 72191
1332 Ga0496124_0047249 3300048927 Bacteria 3683
1333 Ga0496124_0102154 3300048927 Bacteria 2321
1334 Ga0496125_0000016 3300048928 Bacteria 512512
1335 Ga0496125_0003043 3300048928 Bacteria 20963
1336 Ga0496125_0052210 3300048928 Bacteria 3363
1337 Ga0496125_0056369 3300048928 Bacteria 3191
1338 Ga0496125_0138487 3300048928 Bacteria 1697
1339 Ga0496126_0000225 3300048929 Bacteria 122842
1340 Ga0496126_0002445 3300048929 Bacteria 25073
1341 Ga0496126_0009549 3300048929 Bacteria 10292
1342 Ga0501034_0360886 3300049571 Bacteria 1380
1343 Ga0501047_0036259 3300049581 Bacteria 4766
1344 Ga0501067_0040551 3300049583 Bacteria 2585
1345 Ga0501070_0278723 3300049586 Bacteria 1364
1346 Ga0501072_0016539 3300049588 Bacteria 5667
1347 Ga0501073_0023853 3300049589 Bacteria 4393
1348 Ga0501074_0030094 3300049590 Bacteria 3935
1349 Ga0501080_0008273 3300049742 Bacteria 9422
1350 Ga0501080_0178214 3300049742 Bacteria 1957
1351 Ga0501262_000239 3300049759 Bacteria 6781
1352 nmdc:mga03683_29708_c1 3300050489 Bacteria 2181
1353 nmdc:mga03683_3151_c1 3300050489 Bacteria 5259
1354 nmdc:mga00v17_27802_c1 3300050491 Bacteria 3306
1355 nmdc:mga00v17_7455_c1 3300050491 Bacteria 5839
1356 nmdc:mga00v17_9465_c1 3300050491 Bacteria 5275
1357 nmdc:mga0yw44_9423_c1 3300050492 Bacteria 4937
1358 nmdc:mga0k408_39416_c1 3300050493 Bacteria 2714
1359 nmdc:mga0k408_43487_c1 3300050493 Bacteria 2589
1360 nmdc:mga0k408_6138_c1 3300050493 Bacteria 6408
1361 nmdc:mga0k408_75692_c1 3300050493 Bacteria 1967
1362 nmdc:mga06z11_224376_c1 3300050494 Bacteria 1099
1363 nmdc:mga07m45_15935_c1 3300050496 Bacteria 4020
1364 nmdc:mga07m45_2254_c1 3300050496 Bacteria 9003
1365 nmdc:mga07m45_42983_c1 3300050496 Bacteria 2534
1366 nmdc:mga07m45_5807_c1 3300050496 Bacteria 6185
1367 nmdc:mga07m45_6577_c1 3300050496 Bacteria 5886
1368 nmdc:mga07m45_6685_c1 3300050496 Bacteria 5849
1369 nmdc:mga07m45_98480_c1 3300050496 Bacteria 1679
1370 nmdc:mga05p37_172807_c1 3300050507 Bacteria 2634
1371 nmdc:mga09592_313808_c1 3300050508 Bacteria 1358
1372 nmdc:mga0n895_601081_c1 3300050512 Bacteria 1102
1373 nmdc:mga0n895_602527_c1 3300050512 Bacteria 1101
1374 nmdc:mga0rr50_194203_c1 3300050513 Bacteria 1665
1375 nmdc:mga08x19_129164_c1 3300050514 Bacteria 1698
1376 Ga0495612_0059844 3300053078 Bacteria 1576
1377 Ga0500610_0009985 3300053079 Bacteria 4246
1378 Ga0500610_0024124 3300053079 Bacteria 3019
1379 Ga0495619_0008531 3300053085 Bacteria 6482
1380 Ga0495619_0031100 3300053085 Bacteria 3457
1381 Ga0495619_0130008 3300053085 Bacteria 1730
1382 Ga0495619_0160812 3300053085 Bacteria 1551
1383 Ga0495619_0305053 3300053085 Bacteria 1103
1384 Ga0500578_0000244 3300053086 Bacteria 67335
1385 Ga0500651_0000440 3300053093 Bacteria 22226
1386 Ga0500566_0119307 3300053094 Bacteria 1424
1387 Ga0500571_017194 3300053110 Bacteria 4048
1388 Ga0500593_001081 3300053117 Bacteria 9841
1389 Ga0500594_0002394 3300053118 Bacteria 4083
1390 Ga0500595_000507 3300053119 Bacteria 23504
1391 Ga0500607_002946 3300053121 Bacteria 12972
1392 Ga0500618_000376 3300053125 Bacteria 30780
1393 Ga0500642_0143056 3300053130 Bacteria 1122
1394 Ga0500655_001505 3300053133 Bacteria 4411
1395 Ga0500658_0009124 3300053134 Bacteria 3661
1396 Ga0500564_033255 3300053138 Bacteria 2379
1397 Ga0500568_0003041 3300053139 Bacteria 9587
1398 Ga0500574_000053 3300053141 Bacteria 13704
1399 Ga0500622_0000043 3300053156 Bacteria 161080
1400 Ga0500627_0012941 3300053158 Bacteria 3144
1401 Ga0500634_0008211 3300053161 Bacteria 5206
1402 Ga0500634_0042530 3300053161 Bacteria 2465
1403 Ga0501084_0076341 3300054114 Bacteria 2809
1404 2509076495 2508501114 Bacteria 7082538
1405 2511246598 2511231002 Bacteria 5042903
1406 2511383975 2511231026 Bacteria 5225445
1407 2512037037 2511231221 Bacteria 6846400
1408 2513232076 2513020051 Bacteria 6053213
1409 2521557795 2521172590 Bacteria 5047645
1410 2553002916 2551306416 Bacteria 6152985
1411 2555261438 2554235234 Bacteria 5762085
1412 2587727029 2585428057 Bacteria 6737412
1413 2587732031 2585428058 Bacteria 6853932
1414 2587756972 2585428062 Bacteria 6842168
1415 2588291456 2588253510 Bacteria 6901809
1416 2599623592 2599185214 Bacteria 8209958
1417 2599671790 2599185226 Bacteria 8233575
1418 2599681197 2599185227 Bacteria 8246414
1419 2599693399 2599185229 Bacteria 8216126
1420 2599927398 2599185299 Bacteria 4854625
1421 2600811292 2600255067 Bacteria 6795583
1422 2643970584 2643221592 Bacteria 6608788
1423 2644139135 2643221625 Bacteria 6512927
1424 2644163194 2643221628 Bacteria 5745828
1425 2644274745 2643221648 Bacteria 6521465
1426 2644327575 2643221658 Bacteria 6064537
1427 2644401531 2643221672 Bacteria 6322190
1428 2644468112 2643221683 Bacteria 5749203
1429 2650896746 2648501693 Bacteria 5069560
1430 2686352745 2684622997 Bacteria 4624240
1431 2738717667 2738541277 Bacteria 7458140
1432 2738879278 2738541307 Bacteria 8606193
1433 2739278353 2738543019 Bacteria 7459457
1434 2739611377 2739367655 Bacteria 4051151
1435 2746088370 2744054900 Bacteria 8399525
1436 2746096735 2744054901 Bacteria 8397047
1437 2765568899 2765235838 Bacteria 5445269
1438 2772438099 2772190666 Bacteria 5117644
1439 2808984562 2808606386 Bacteria 4471946
1440 2809127632 2808606414 Bacteria 4917181
1441 2809130608 2808606415 Bacteria 4576710
1442 2809149915 2808606419 Bacteria 4576925
1443 2819597153 2818991446 Bacteria 7757362
1444 2819615062 2818991449 Bacteria 5518009
1445 2831266278 2831265667 Bacteria 7184833
1446 2838057612 2838054893 Bacteria 7451788
1447 2839096219 2839094727 Bacteria 5534556
1448 2842681946 2842677519 Bacteria 5615038
1449 2847800575 2847797336 Bacteria 5176640
1450 2852619939 2852618963 Bacteria 4577824
1451 2857545267 2857542790 Bacteria 5326616
1452 2857578152 2857576091 Bacteria 5465855
1453 2858955682 2858950400 Bacteria 6783797
1454 2881928944 2881927736 Bacteria 3993927
1455 2885204392 2885198086 Bacteria 7212419
1456 2885218045 2885211737 Bacteria 7212420
1457 2888368114 2888366609 Bacteria 5155009
1458 2899924656 2899924645 Bacteria 7487985
1459 2904441443 2904439833 Bacteria 5931679
1460 2904455806 2904449895 Bacteria 6927402
1461 2904457763 2904456579 Bacteria 6819253
1462 2904481559 2904479285 Bacteria 5073931
1463 2904505327 2904504865 Bacteria 5152820
1464 2904531619 2904530477 Bacteria 5876334
1465 2904548096 2904541872 Bacteria 8915136
1466 2904586741 2904584206 Bacteria 6028872
1467 2904593226 2904589729 Bacteria 6113573
1468 2904602931 2904601388 Bacteria 5884906
1469 2919046259 2919046199 Bacteria 5567169
1470 2919084049 2919079590 Bacteria 5946433
1471 2919467558 2919462493 Bacteria 5817112
1472 2923511013 2923510766 Bacteria 5926163
1473 2928039217 2928037797 Bacteria 7273642
1474 2928045178 2928044640 Bacteria 7271509
1475 2928052983 2928051484 Bacteria 7773759
1476 2928064346 2928064002 Bacteria 7419480
1477 2928071794 2928070936 Bacteria 8062541
1478 2928084263 2928084124 Bacteria 7159212
1479 2928130975 2928130867 Bacteria 5467269
1480 2928511201 2928510474 Bacteria 4815308
1481 2929163027 2929160207 Bacteria 9075316
1482 2929522789 2929520902 Bacteria 6765052
1483 2932408458 2932406140 Bacteria 5134491
1484 2932423395 2932422444 Bacteria 4678430
1485 2939580119 2939577877 Bacteria 5132791
1486 2939608227 2939607340 Bacteria 4719256
1487 2945911534 2945909444 Bacteria 7065066
1488 2945947662 2945945610 Bacteria 5951079
1489 2945977474 2945972063 Bacteria 6086495
1490 2945986125 2945984333 Bacteria 7358892
1491 2954772492 2954767861 Bacteria 5535784
1492 2980127431 2980125574 Bacteria 5567337
1493 2984495971 2984494565 Bacteria 5000175
1494 2990262653 2990261002 Bacteria 4919493
1495 3000379832 3000376612 Bacteria 4705565
1496 8005662400 8005658619 Bacteria 4500593
1497 8048748982 8048746797 Bacteria 3557226
1498 8054846520 8054844752 Bacteria 4450330
1499 8054851854 8054849141 Bacteria 5232694
1500 8055432569 8055431914 Bacteria 4551896
1501 Ga0157375_10462182
1502 JGI24741J21665_1001323
1503 JGI24740J21852_10000707
1504 JGI24740J21852_10001478
1505 JGI24740J21852_10009017
1506 JGI24739J22299_10003562
1507 JGI24739J22299_10028661
1508 JGI25155J39150_1000009
1509 JGI25156J39149_1000009
1510 JGI25156J39149_1001288
1511 JGI25156J39149_1002086
1512 JGI25156J39149_1002833
1513 JGI25156J39149_1013563
1514 JGI25162J39368_1000040
1515 JGI25154J39366_1000024
1516 JGI25154J39366_1000362
1517 JGI25157J39369_1000007
1518 JGI25152J39213_1002358
1519 JGI25150J39212_1008224
1520 JGI25150J39212_1010444
1521 JGI25159J45721_1009054
1522 JGI25159J45721_1013251
1523 JGI25151J46595_10037152
1524 JGI25165J46597_1000051
1525 JGI25165J46597_1001429
1526 JGI25153J46596_10003022
1527 JGI25153J46596_10004243
1528 JGI25160J50197_1000240
1529 JGI25161J50226_1000009
1530 JGI25161J50226_1002517
1531 JGI25161J50226_1005364
1532 Ga0006562J51391_1103912
1533 Ga0006562J51391_1112229
1534 Ga0055538_1000002
1535 Ga0055538_1000025
1536 Ga0055538_1002535
1537 Ga0055539_1000002
1538 Ga0055539_1000032
1539 Ga0055539_1000100
1540 Ga0055533_1000004
1541 Ga0055533_1000042
1542 Ga0055533_1000257
1543 Ga0055532_1000012
1544 Ga0055532_1000029
1545 Ga0055532_1001367
1546 Ga0055532_1002326
1547 Ga0055525_1000002
1548 Ga0055525_1000050
1549 Ga0055525_1000444
1550 Ga0055525_1000505
1551 Ga0055527_1000011
1552 Ga0055535_1000009
1553 Ga0055535_1000093
1554 Ga0055535_1000689
1555 Ga0055542_1000015
1556 Ga0055542_1000039
1557 Ga0055542_1000106
1558 Ga0055542_1001376
1559 Ga0055529_1000011
1560 Ga0055529_1000124
1561 Ga0055529_1000376
1562 Ga0055526_1003692
1563 Ga0055526_1009131
1564 Ga0055526_1009501
1565 Ga0055537_1000020
1566 Ga0055537_1000491
1567 Ga0055537_1019921
1568 Ga0055524_1000047
1569 Ga0055524_1015136
1570 Ga0055536_1002265
1571 Ga0055536_1004266
1572 Ga0055536_1005338
1573 Ga0055536_1018976
1574 Ga0055536_1024865
1575 Ga0055536_1034695
1576 Ga0055534_1000450
1577 Ga0055534_1000633
1578 Ga0055534_1011996
1579 Ga0055528_1000934
1580 Ga0055528_1000973
1581 Ga0055528_1013206
1582 Ga0055530_10002364
1583 Ga0055530_10003258
1584 Ga0055540_1000027
1585 Ga0055540_1002734
1586 Ga0055540_1007848
1587 Ga0055540_1032478
1588 Ga0055531_10001909
1589 Ga0055541_1000023
1590 Ga0055541_1000043
1591 Ga0055541_1008584
1592 Ga0058692_1000297
1593 Ga0055543_1000199
1594 Ga0055543_1002895
1595 Ga0055543_1012484
1596 Ga0065165_1001969
1597 Ga0065704_10012722
1598 Ga0065715_10019317
1599 Ga0065715_10174718
1600 Ga0070658_10025574
1601 Ga0070658_10035798
1602 Ga0070658_10245085
1603 Ga0070676_10002706
1604 Ga0070676_10145652
1605 Ga0070676_10157451
1606 Ga0070683_100029745
1607 Ga0070683_100307344
1608 Ga0070683_100345721
1609 Ga0070683_100517215
1610 Ga0070690_100048399
1611 Ga0070670_100014778
1612 Ga0070670_100134363
1613 Ga0070677_10004255
1614 Ga0068869_100007462
1615 Ga0070680_100030518
1616 Ga0070680_100057278
1617 Ga0070680_100092804
1618 Ga0070682_100041859
1619 Ga0070682_100073205
1620 Ga0070682_100329487
1621 Ga0068868_100010083
1622 Ga0068868_100024239
1623 Ga0068868_100063202
1624 Ga0068868_100069739
1625 Ga0068868_100121194
1626 Ga0068868_100363261
1627 Ga0070660_100000161
1628 Ga0070660_100056004
1629 Ga0070660_100128362
1630 Ga0070660_100259956
1631 Ga0070689_100250730
1632 Ga0070687_100038283
1633 Ga0070687_100181501
1634 Ga0070661_100000057
1635 Ga0070661_100002317
1636 Ga0070661_100017237
1637 Ga0070661_100135331
1638 Ga0070692_10003401
1639 Ga0070692_10009557
1640 Ga0070668_100007630
1641 Ga0070668_100051229
1642 Ga0070668_100153842
1643 Ga0070669_100130830
1644 Ga0070675_100004084
1645 Ga0070671_100002197
1646 Ga0070671_100052121
1647 Ga0070671_100065336
1648 Ga0070671_100122510
1649 Ga0070671_100130067
1650 Ga0070674_100028680
1651 Ga0070674_100040580
1652 Ga0070673_100001432
1653 Ga0070673_100009049
1654 Ga0070673_100156678
1655 Ga0070673_100194814
1656 Ga0070673_100436178
1657 Ga0070688_100026504
1658 Ga0070659_100000510
1659 Ga0070659_100001591
1660 Ga0070659_100008091
1661 Ga0070659_100063640
1662 Ga0070659_100097024
1663 Ga0070667_100220317
1664 Ga0070667_100232366
1665 Ga0070667_100257670
1666 Ga0070667_100446390
1667 Ga0070709_10014488
1668 Ga0070709_10035545
1669 Ga0070709_10169964
1670 Ga0070714_100007945
1671 Ga0070714_100014020
1672 Ga0070714_100035131
1673 Ga0070714_100036382
1674 Ga0070713_100000032
1675 Ga0070713_100006613
1676 Ga0070713_100015987
1677 Ga0070713_100032725
1678 Ga0070713_100157445
1679 Ga0070711_100019144
1680 Ga0070711_100134686
1681 Ga0070711_100136673
1682 Ga0070705_100083040
1683 Ga0070700_100002762
1684 Ga0070694_100024359
1685 Ga0070708_100120354
1686 Ga0070663_100000105
1687 Ga0070663_100004364
1688 Ga0070663_100058982
1689 Ga0070663_100095971
1690 Ga0070678_100001542
1691 Ga0070678_100037327
1692 Ga0070678_100164074
1693 Ga0070662_100000149
1694 Ga0070662_100035491
1695 Ga0070662_100049985
1696 Ga0070662_100050379
1697 Ga0070662_100184225
1698 Ga0070662_100305005
1699 Ga0070681_10000229
1700 Ga0070681_10001327
1701 Ga0070681_10048539
1702 Ga0070681_10091627
1703 Ga0070681_10096433
1704 Ga0068867_100009953
1705 Ga0068867_100019344
1706 Ga0068867_100182185
1707 Ga0068867_100225741
1708 Ga0070685_10003742
1709 Ga0070706_100001663
1710 Ga0070707_100078247
1711 Ga0070707_100124488
1712 Ga0070698_100022134
1713 Ga0070698_100153853
1714 Ga0070698_100224844
1715 Ga0070698_100511636
1716 Ga0070699_100158833
1717 Ga0070699_100488578
1718 Ga0070679_100001752
1719 Ga0070679_100024796
1720 Ga0070679_100077570
1721 Ga0070679_100255296
1722 Ga0070679_100424606
1723 Ga0070684_100002568
1724 Ga0070684_100019630
1725 Ga0070684_100209007
1726 Ga0070697_100018068
1727 Ga0070697_100062705
1728 Ga0070697_100086262
1729 Ga0068853_100000618
1730 Ga0068853_100023163
1731 Ga0068853_100209951
1732 Ga0068853_100274010
1733 Ga0070672_100064046
1734 Ga0070672_100098129
1735 Ga0070672_100441018
1736 Ga0070686_100049895
1737 Ga0070695_100029763
1738 Ga0070696_100007257
1739 Ga0070696_100016969
1740 Ga0070696_100042617
1741 Ga0070693_100000701
1742 Ga0070665_100004456
1743 Ga0070665_100008740
1744 Ga0070665_100112939
1745 Ga0070665_100245041
1746 Ga0070704_100031792
1747 Ga0068855_100000065
1748 Ga0068855_100000814
1749 Ga0068855_100033827
1750 Ga0068855_100056314
1751 Ga0068855_100071755
1752 Ga0068855_100080702
1753 Ga0068855_100104458
1754 Ga0068855_100128650
1755 Ga0068855_100137688
1756 Ga0068855_100150705
1757 Ga0068855_100201491
1758 Ga0070664_100000008
1759 Ga0070664_100000371
1760 Ga0070664_100000976
1761 Ga0070664_100031961
1762 Ga0070664_100049121
1763 Ga0070664_100052409
1764 Ga0070664_100128177
1765 Ga0070664_100150055
1766 Ga0070664_100183183
1767 Ga0068857_100000964
1768 Ga0068857_100002479
1769 Ga0068857_100003440
1770 Ga0068857_100012910
1771 Ga0068857_100027691
1772 Ga0068857_100037434
1773 Ga0068857_100229773
1774 Ga0068854_100000072
1775 Ga0068854_100008004
1776 Ga0068854_100024239
1777 Ga0068854_100054874
1778 Ga0068854_100116812
1779 Ga0068854_100159925
1780 Ga0068854_100222229
1781 Ga0068856_100000009
1782 Ga0068856_100000381
1783 Ga0068856_100007513
1784 Ga0068856_100039316
1785 Ga0068856_100071796
1786 Ga0068856_100110111
1787 Ga0068856_100146549
1788 Ga0068856_100443537
1789 Ga0068856_100499001
1790 Ga0070702_100041952
1791 Ga0068852_100011015
1792 Ga0068852_100015740
1793 Ga0068852_100015760
1794 Ga0068852_100049214
1795 Ga0068852_100125474
1796 Ga0068852_100126895
1797 Ga0068852_100177080
1798 Ga0068852_100261300
1799 Ga0068852_100400755
1800 Ga0068859_100010089
1801 Ga0068859_100049387
1802 Ga0068859_100175084
1803 Ga0068864_100036132
1804 Ga0068864_100052039
1805 Ga0068864_100344725
1806 Ga0068866_10000875
1807 Ga0068866_10006393
1808 Ga0068861_100273431
1809 Ga0068851_10002246
1810 Ga0068851_10002598
1811 Ga0068851_10002993
1812 Ga0068851_10013339
1813 Ga0068870_10041982
1814 Ga0068870_10061792
1815 Ga0068863_100047814
1816 Ga0068863_100048955
1817 Ga0068863_100460484
1818 Ga0068858_100004190
1819 Ga0068858_100006956
1820 Ga0068858_100035327
1821 Ga0068858_100106299
1822 Ga0068860_100013479
1823 Ga0068860_100085295
1824 Ga0068862_100006988
1825 Ga0081539_10019130
1826 Ga0075365_10001116
1827 Ga0075363_100002525
1828 Ga0075364_10002412
1829 Ga0075364_10005636
1830 Ga0075364_10007917
1831 Ga0075432_10005289
1832 Ga0075432_10082882
1833 Ga0070715_10097676
1834 Ga0070715_10133470
1835 Ga0070712_100015039
1836 Ga0075362_10017034
1837 Ga0075366_10004606
1838 Ga0075366_10043213
1839 Ga0075366_10137234
1840 Ga0097621_100007071
1841 Ga0097621_100119038
1842 Ga0075370_10001052
1843 Ga0075370_10005993
1844 Ga0075370_10006478
1845 Ga0075370_10011878
1846 Ga0075370_10027724
1847 Ga0075370_10042864
1848 Ga0075370_10053563
1849 Ga0075370_10129466
1850 Ga0068871_100010132
1851 Ga0068871_100011438
1852 Ga0068871_100294527
1853 Ga0075434_100137774
1854 Ga0075434_100438060
1855 Ga0068865_100112171
1856 Ga0075436_100171298
1857 Ga0097620_100010089
1858 Ga0097620_100049385
1859 Ga0097620_100175085
1860 Ga0097620_100211476
1861 Ga0079104_1000231
1862 Ga0079104_1000864
1863 Ga0079104_1001566
1864 Ga0099826_10000238
1865 Ga0075435_100031847
1866 Ga0105251_10000128
1867 Ga0105251_10000280
1868 Ga0105251_10000892
1869 Ga0105251_10002010
1870 Ga0105251_10003742
1871 Ga0105251_10014555
1872 Ga0105251_10046774
1873 Ga0105244_10000836
1874 Ga0105244_10003234
1875 Ga0105244_10012661
1876 Ga0105244_10103412
1877 Ga0105250_10000003
1878 Ga0105250_10001728
1879 Ga0105250_10009475
1880 Ga0105250_10017251
1881 Ga0105240_10001226
1882 Ga0105240_10020181
1883 Ga0105240_10020537
1884 Ga0105240_10034137
1885 Ga0105240_10045681
1886 Ga0105240_10070546
1887 Ga0105240_10083821
1888 Ga0105240_10086744
1889 Ga0105240_10154485
1890 Ga0105240_10168533
1891 Ga0105245_10011793
1892 Ga0105245_10081881
1893 Ga0105245_10097490
1894 Ga0105247_10000025
1895 Ga0114129_10063689
1896 Ga0105243_10012776
1897 Ga0105243_10019159
1898 Ga0105243_10124092
1899 Ga0105243_10215976
1900 Ga0105241_10004859
1901 Ga0105241_10009081
1902 Ga0105241_10170548
1903 Ga0105242_10001479
1904 Ga0105242_10003609
1905 Ga0105248_10001100
1906 Ga0105248_10021561
1907 Ga0105248_10231464
1908 Ga0105248_10694320
1909 Ga0105248_10865413
1910 Ga0105237_10007380
1911 Ga0105237_10198579
1912 Ga0105237_10394179
1913 Ga0105237_10454371
1914 Ga0105238_10003854
1915 Ga0105238_10008692
1916 Ga0105238_10016180
1917 Ga0105238_10066930
1918 Ga0105238_10327290
1919 Ga0105249_10081230
1920 Ga0105239_10018646
1921 Ga0105239_10046798
1922 Ga0105239_10058381
1923 Ga0105239_10814223
1924 Ga0105246_10029427
1925 Ga0105246_10071635
1926 Ga0105246_10176018
1927 Ga0105246_10371569
1928 Ga0157373_10000246
1929 Ga0157373_10000690
1930 Ga0157373_10003596
1931 Ga0157373_10004570
1932 Ga0157373_10042899
1933 Ga0157373_10052705
1934 Ga0157371_10000068
1935 Ga0157371_10000403
1936 Ga0157371_10001844
1937 Ga0157371_10022773
1938 Ga0157371_10029347
1939 Ga0157371_10050004
1940 Ga0157371_10102698
1941 Ga0157370_10000588
1942 Ga0157370_10033262
1943 Ga0157370_10046640
1944 Ga0157370_10067702
1945 Ga0157370_10083102
1946 Ga0157370_10203762
1947 Ga0157369_10000806
1948 Ga0157369_10001198
1949 Ga0157369_10039686
1950 Ga0157369_10057748
1951 Ga0157369_10071126
1952 Ga0157369_10146496
1953 Ga0157369_10260040
1954 Ga0157369_10494501
1955 Ga0157374_10010415
1956 Ga0157378_10012484
1957 Ga0157378_10026369
1958 Ga0157378_10047254
1959 Ga0157378_10136045
1960 Ga0163162_10002664
1961 Ga0163162_10008020
1962 Ga0163162_10200481
1963 Ga0163162_10328247
1964 Ga0163162_10380477
1965 Ga0157372_10002109
1966 Ga0157372_10013717
1967 Ga0157372_10025209
1968 Ga0157372_10026577
1969 Ga0157372_10029945
1970 Ga0157372_10047958
1971 Ga0157372_10201638
1972 Ga0157372_10225700
1973 Ga0157372_10389608
1974 Ga0157372_10808244
1975 Ga0157375_10014030
1976 Ga0157375_10109466
1977 Ga0163163_10137043
1978 Ga0163163_10300795
1979 Ga0182008_10008606
1980 Ga0182008_10017906
1981 Ga0182008_10053551
1982 Ga0182008_10054352
1983 Ga0182008_10054448
1984 Ga0157377_10207867
1985 Ga0157379_10000822
1986 Ga0157379_10031635
1987 Ga0157379_10043114
1988 Ga0157379_10172638
1989 Ga0157376_10040111
1990 Ga0157376_10050364
1991 Ga0157376_10065990
1992 Ga0157376_10066190
1993 Ga0182006_1002752
1994 Ga0182006_1004738
1995 Ga0182006_1010306
1996 Ga0182006_1065386
1997 Ga0182007_10004564
1998 Ga0182005_1000072
1999 Ga0183361_11773
2000 Ga0163161_10000001
2001 Ga0163161_10000092
2002 Ga0163161_10040958
2003 Ga0163161_10052349
2004 Ga0206356_11752824
2005 Ga0206353_10213026
2006 Ga0213872_10028976
2007 Ga0213872_10032545
2008 Ga0209435_100008
2009 Ga0209760_100605
2010 Ga0209784_100002
2011 Ga0209784_100010
2012 Ga0209784_100815
2013 Ga0209784_101126
2014 Ga0209566_100003
2015 Ga0209566_100008
2016 Ga0209566_100421
2017 Ga0209674_100004
2018 Ga0209674_100013
2019 Ga0209674_100019
2020 Ga0209674_100188
2021 Ga0209674_100199
2022 Ga0209674_100267
2023 Ga0209672_100010
2024 Ga0209672_100031
2025 Ga0209672_100335
2026 Ga0209672_101072
2027 Ga0209147_100006
2028 Ga0209147_100040
2029 Ga0209563_100006
2030 Ga0209563_100021
2031 Ga0207427_100762
2032 Ga0207427_101758
2033 Ga0209437_100019
2034 Ga0209437_100045
2035 Ga0209258_100010
2036 Ga0209258_100061
2037 Ga0209258_100099
2038 Ga0207425_1000350
2039 Ga0207425_1003335
2040 Ga0209646_1000029
2041 Ga0209646_1000059
2042 Ga0209026_1000016
2043 Ga0209677_100003
2044 Ga0209677_100011
2045 Ga0209148_1000018
2046 Ga0209148_1000021
2047 Ga0209148_1000070
2048 Ga0209148_1000103
2049 Ga0209759_1000016
2050 Ga0209759_1000251
2051 Ga0209759_1000261
2052 Ga0209759_1000309
2053 Ga0209759_1013107
2054 Ga0209129_1000007
2055 Ga0209129_1000164
2056 Ga0209129_1023641
2057 Ga0209233_1000025
2058 Ga0209233_1000093
2059 Ga0209565_1000061
2060 Ga0209565_1000075
2061 Ga0209565_1000697
2062 Ga0209565_1003533
2063 Ga0209455_1000015
2064 Ga0209455_1000069
2065 Ga0209673_1000026
2066 Ga0209673_1000133
2067 Ga0209673_1000298
2068 Ga0209673_1000304
2069 Ga0209673_1001340
2070 Ga0209673_1002778
2071 Ga0209673_1017220
2072 Ga0209130_1000014
2073 Ga0209130_1002015
2074 Ga0209130_1003534
2075 Ga0209130_1003764
2076 Ga0209675_1000074
2077 Ga0209675_1000098
2078 Ga0209675_1000660
2079 Ga0209675_1000884
2080 Ga0209675_1007168
2081 Ga0209675_1014643
2082 Ga0209676_1000013
2083 Ga0209676_1000122
2084 Ga0209676_1000301
2085 Ga0209676_1005284
2086 Ga0209676_1027095
2087 Ga0209025_1000073
2088 Ga0209025_1000935
2089 Ga0209025_1001239
2090 Ga0209025_1006026
2091 Ga0209025_1017606
2092 Ga0209025_1022432
2093 Ga0209025_1023192
2094 Ga0209564_1000062
2095 Ga0209564_1000181
2096 Ga0209564_1000247
2097 Ga0209564_1000524
2098 Ga0209564_1000594
2099 Ga0209564_1007384
2100 Ga0209564_1028162
2101 Ga0209758_1000025
2102 Ga0209758_1000280
2103 Ga0209758_1000820
2104 Ga0209758_1032246
2105 Ga0209050_1000002
2106 Ga0209050_1000008
2107 Ga0209050_1000736
2108 Ga0209050_1004147
2109 Ga0209050_1020428
2110 Ga0209256_1000039
2111 Ga0209256_1000050
2112 Ga0209256_1000063
2113 Ga0209256_1000280
2114 Ga0207426_1000001
2115 Ga0207426_1000028
2116 Ga0207426_1000242
2117 Ga0207426_1001464
2118 Ga0209051_1000002
2119 Ga0209051_1000005
2120 Ga0209051_1000541
2121 Ga0209051_1000936
2122 Ga0209051_1006164
2123 Ga0209257_1000002
2124 Ga0209257_1000031
2125 Ga0209257_1007245
2126 Ga0209257_1017216
2127 Ga0209257_1023053
2128 Ga0207697_10003784
2129 Ga0207656_10002257
2130 Ga0207656_10026122
2131 Ga0207696_1000001
2132 Ga0207696_1000003
2133 Ga0207696_1000966
2134 Ga0207655_1007127
2135 Ga0207655_1016097
2136 Ga0207655_1064726
2137 Ga0207713_1000006
2138 Ga0207713_1000024
2139 Ga0207713_1000026
2140 Ga0207713_1000135
2141 Ga0207713_1003242
2142 Ga0207682_10016861
2143 Ga0207692_10175089
2144 Ga0207642_10010691
2145 Ga0207710_10000140
2146 Ga0207688_10033081
2147 Ga0207688_10119514
2148 Ga0207680_10072320
2149 Ga0207680_10159552
2150 Ga0207647_10007601
2151 Ga0207685_10075687
2152 Ga0207699_10009877
2153 Ga0207699_10027146
2154 Ga0207699_10222174
2155 Ga0207699_10352647
2156 Ga0207645_10000888
2157 Ga0207645_10005425
2158 Ga0207645_10044963
2159 Ga0207645_10112440
2160 Ga0207643_10000322
2161 Ga0207643_10029888
2162 Ga0207705_10079291
2163 Ga0207705_10288222
2164 Ga0207705_10382617
2165 Ga0207684_10011218
2166 Ga0207684_10076043
2167 Ga0207684_10360358
2168 Ga0207654_10000006
2169 Ga0207654_10006307
2170 Ga0207654_10057067
2171 Ga0207707_10000943
2172 Ga0207707_10003952
2173 Ga0207707_10008846
2174 Ga0207707_10015683
2175 Ga0207695_10000729
2176 Ga0207695_10001256
2177 Ga0207695_10003589
2178 Ga0207695_10018907
2179 Ga0207695_10158828
2180 Ga0207671_10061577
2181 Ga0207671_10225037
2182 Ga0207671_10401030
2183 Ga0207693_10003904
2184 Ga0207693_10020216
2185 Ga0207693_10022217
2186 Ga0207693_10191345
2187 Ga0207663_10008013
2188 Ga0207663_10053911
2189 Ga0207663_10088532
2190 Ga0207663_10192868
2191 Ga0207663_10201148
2192 Ga0207660_10009870
2193 Ga0207660_10018713
2194 Ga0207660_10101650
2195 Ga0207660_10131415
2196 Ga0207662_10046737
2197 Ga0207657_10000846
2198 Ga0207657_10001947
2199 Ga0207657_10005399
2200 Ga0207657_10016935
2201 Ga0207657_10136976
2202 Ga0207657_10149832
2203 Ga0207657_10331218
2204 Ga0207649_10007371
2205 Ga0207649_10009890
2206 Ga0207649_10018324
2207 Ga0207649_10151136
2208 Ga0207652_10005810
2209 Ga0207652_10006828
2210 Ga0207652_10011458
2211 Ga0207652_10014396
2212 Ga0207652_10032103
2213 Ga0207652_10039078
2214 Ga0207652_10194820
2215 Ga0207652_10287003
2216 Ga0207646_10050698
2217 Ga0207646_10077610
2218 Ga0207646_10226137
2219 Ga0207681_10010633
2220 Ga0207694_10002475
2221 Ga0207694_10004184
2222 Ga0207694_10005105
2223 Ga0207650_10001677
2224 Ga0207659_10028667
2225 Ga0207659_10199690
2226 Ga0207687_10002669
2227 Ga0207687_10012091
2228 Ga0207687_10149996
2229 Ga0207687_10396380
2230 Ga0207700_10000092
2231 Ga0207700_10030270
2232 Ga0207700_10039869
2233 Ga0207700_10148136
2234 Ga0207664_10001295
2235 Ga0207664_10017931
2236 Ga0207664_10075941
2237 Ga0207664_10320201
2238 Ga0207644_10016637
2239 Ga0207644_10032606
2240 Ga0207644_10034362
2241 Ga0207644_10036956
2242 Ga0207644_10066784
2243 Ga0207644_10112437
2244 Ga0207644_10143078
2245 Ga0207690_10001326
2246 Ga0207690_10013278
2247 Ga0207690_10013760
2248 Ga0207690_10077490
2249 Ga0207690_10089767
2250 Ga0207690_10123091
2251 Ga0207706_10000002
2252 Ga0207706_10000542
2253 Ga0207706_10001871
2254 Ga0207706_10011474
2255 Ga0207706_10021360
2256 Ga0207706_10049534
2257 Ga0207706_10083462
2258 Ga0207686_10000264
2259 Ga0207686_10010340
2260 Ga0207709_10000830
2261 Ga0207709_10017575
2262 Ga0207669_10012201
2263 Ga0207669_10097649
2264 Ga0207704_10064481
2265 Ga0207704_10104060
2266 Ga0207665_10295189
2267 Ga0207691_10012463
2268 Ga0207691_10033680
2269 Ga0207691_10062625
2270 Ga0207691_10064868
2271 Ga0207691_10438498
2272 Ga0207711_10011935
2273 Ga0207711_10090596
2274 Ga0207711_10096552
2275 Ga0207711_10125750
2276 Ga0207711_10136888
2277 Ga0207689_10000028
2278 Ga0207689_10010418
2279 Ga0207689_10047828
2280 Ga0207661_10016709
2281 Ga0207661_10387660
2282 Ga0207679_10001031
2283 Ga0207679_10019797
2284 Ga0207679_10038640
2285 Ga0207679_10046787
2286 Ga0207679_10052011
2287 Ga0207679_10086417
2288 Ga0207679_10143390
2289 Ga0207679_10250811
2290 Ga0207667_10000025
2291 Ga0207667_10000771
2292 Ga0207667_10003035
2293 Ga0207667_10023049
2294 Ga0207667_10043960
2295 Ga0207667_10083700
2296 Ga0207667_10121123
2297 Ga0207667_10180193
2298 Ga0207667_10273894
2299 Ga0207667_10344735
2300 Ga0207651_10000809
2301 Ga0207651_10010536
2302 Ga0207651_10047380
2303 Ga0207651_10128613
2304 Ga0207651_10171297
2305 Ga0207651_10217695
2306 Ga0207712_10071437
2307 Ga0207668_10011691
2308 Ga0207668_10280006
2309 Ga0207640_10000088
2310 Ga0207640_10008896
2311 Ga0207640_10037096
2312 Ga0207640_10043546
2313 Ga0207640_10431298
2314 Ga0207658_10011284
2315 Ga0207658_10079531
2316 Ga0207658_10168185
2317 Ga0207658_10264907
2318 Ga0207677_10000683
2319 Ga0207677_10008644
2320 Ga0207677_10020504
2321 Ga0207677_10099109
2322 Ga0207677_10245412
2323 Ga0207703_10014654
2324 Ga0207703_10018635
2325 Ga0207703_10065942
2326 Ga0207703_10166464
2327 Ga0207639_10001521
2328 Ga0207639_10008293
2329 Ga0207639_10337871
2330 Ga0207678_10007039
2331 Ga0207678_10053259
2332 Ga0207678_10061782
2333 Ga0207678_10079885
2334 Ga0207678_10113627
2335 Ga0207678_10161176
2336 Ga0207678_10209094
2337 Ga0207708_10000643
2338 Ga0207708_10153046
2339 Ga0207702_10000925
2340 Ga0207702_10053553
2341 Ga0207702_10088357
2342 Ga0207702_10096176
2343 Ga0207702_10170898
2344 Ga0207702_10407851
2345 Ga0207641_10012053
2346 Ga0207641_10040206
2347 Ga0207648_10000894
2348 Ga0207648_10001620
2349 Ga0207648_10001939
2350 Ga0207648_10022177
2351 Ga0207648_10027470
2352 Ga0207676_10001707
2353 Ga0207676_10016541
2354 Ga0207676_10018372
2355 Ga0207676_10024146
2356 Ga0207676_10228281
2357 Ga0207674_10000064
2358 Ga0207674_10000296
2359 Ga0207674_10001590
2360 Ga0207674_10002028
2361 Ga0207674_10002285
2362 Ga0207674_10018501
2363 Ga0207674_10026383
2364 Ga0207674_10026973
2365 Ga0207674_10033552
2366 Ga0207675_100000552
2367 Ga0207675_100128149
2368 Ga0207675_100154198
2369 Ga0207675_100179395
2370 Ga0207683_10000546
2371 Ga0207683_10000722
2372 Ga0207683_10002014
2373 Ga0207683_10085585
2374 Ga0207683_10134740
2375 Ga0207683_10248920
2376 Ga0207698_10006318
2377 Ga0207698_10008199
2378 Ga0207698_10027589
2379 Ga0207698_10046993
2380 Ga0207698_10081071
2381 Ga0207698_10128975
2382 Ga0207698_10147383
2383 Ga0207698_10186768
2384 Ga0207698_10197704
2385 Ga0207698_10311928
2386 Ga0209281_1000008
2387 Ga0209281_1000148
2388 Ga0209281_1000204
2389 Ga0209281_1000354
2390 Ga0209371_1000177
2391 Ga0209371_1000215
2392 Ga0209371_1001362
2393 Ga0209371_1003669
2394 Ga0209371_1022028
2395 Ga0209371_1022036
2396 Ga0209999_1010228
2397 Ga0209983_1012647
2398 Ga0209282_1000114
2399 Ga0209971_1003810
2400 Ga0209998_10008075
2401 Ga0209974_10003049
2402 Ga0268266_10010671
2403 Ga0268266_10058221
2404 Ga0268266_10067378
2405 Ga0268266_10128712
2406 Ga0268266_10421255
2407 Ga0268264_10004834
2408 Ga0268264_10022048
2409 Ga0268264_10037345
2410 Ga0268264_10097863
2411 Ga0268264_10228777
2412 Ga0268264_10505854
2413 Ga0307517_10000395
2414 Ga0307517_10045823
2415 Ga0307517_10148469
2416 Ga0307515_10000463
2417 Ga0307515_10000515
2418 Ga0307515_10001074
2419 Ga0307515_10027481
2420 Ga0265338_10021924
2421 Ga0268256_1000172
2422 Ga0268256_1000191
2423 Ga0268256_1001592
2424 Ga0268256_1001905
2425 Ga0268256_1024808
2426 Ga0307512_10030754
2427 Ga0307512_10200560
2428 Ga0316180_1113847
2429 Ga0316181_1060367
2430 Ga0265330_10003359
2431 Ga0265332_10000438
2432 Ga0265328_10068599
2433 Ga0265325_10078903
2434 Ga0265327_10030070
2435 Ga0265327_10046166
2436 Ga0265316_10017701
2437 Ga0307513_10002544
2438 Ga0307513_10057955
2439 Ga0307513_10145442
2440 Ga0307513_10272959
2441 Ga0307509_10004851
2442 Ga0307509_10014070
2443 Ga0307509_10040885
2444 Ga0307509_10059845
2445 Ga0307408_100003042
2446 Ga0307408_100004174
2447 Ga0307408_100012408
2448 Ga0307508_10000130
2449 Ga0307508_10003625
2450 Ga0307508_10016910
2451 Ga0307508_10059234
2452 Ga0307508_10068121
2453 Ga0307508_10076807
2454 Ga0307514_10000529
2455 Ga0307514_10068998
2456 Ga0307514_10095226
2457 Ga0265314_10079452
2458 Ga0307516_10019556
2459 Ga0307516_10029179
2460 Ga0307516_10069305
2461 Ga0307405_10004432
2462 Ga0307413_10003848
2463 Ga0307410_10052589
2464 Ga0307406_10004110
2465 Ga0307406_10020893
2466 Ga0307406_10111223
2467 Ga0307407_10328653
2468 Ga0307412_10031403
2469 Ga0307412_10074524
2470 Ga0307409_100031965
2471 Ga0307409_100035738
2472 Ga0307409_100152169
2473 Ga0307416_100002137
2474 Ga0307416_100013476
2475 Ga0307416_100019776
2476 Ga0307416_100319239
2477 Ga0307414_10019272
2478 Ga0307414_10029101
2479 Ga0307414_10174423
2480 Ga0307411_10068599
2481 Ga0307507_10070943
2482 Ga0307510_10018668
2483 Ga0307510_10064176
2484 Ga0307510_10121617
2485 Ga0373948_0009747
2486 Ga0373944_0046992
2487 Ga0373953_0003510
2488 Ga0373954_0092908
2489 Ga0373956_0012147
2490 Ga0373943_0013632
2491 Ga0373943_0095092
2492 Ga0373946_0002067
2493 Ga0373946_0035278
2494 Ga0373955_0015896
2495 Ga0373955_0025344
2496 Ga0373955_0078877
2497 Ga0373935_0054218
2498 Ga0373935_0150850
2499 Ga0373935_0240751
2500 Ga0373927_0041944
2501 Ga0373927_0085034
2502 Ga0373933_0094684
2503 Ga0373933_0141124
2504 Ga0373947_0026904
2505 Ga0373947_0037116
2506 Ga0373947_0057791
2507 Ga0373947_0302774
2508 Ga0373937_0030237
2509 Ga0373937_0050884
2510 Ga0373937_0067007
2511 Ga0373937_0408180
2512 Ga0373925_0003796
2513 Ga0373925_0018343
2514 Ga0373925_0069217
2515 Ga0373925_0083616
2516 Ga0373925_0091297
2517 Ga0373925_0091667
2518 Ga0395899_0036110
2519 Ga0395899_0110094
2520 Ga0395900_0021769
2521 Ga0395900_0085986
2522 Ga0395900_0117199
2523 Ga0395900_0123864
2524 Ga0395900_0159417
2525 Ga0395898_0068061
2526 Ga0395905_0000004
2527 Ga0395905_0242018
2528 Ga0395901_0000095
2529 Ga0395901_0029761
2530 Ga0395901_0116449
2531 Ga0395901_0671044
2532 Ga0436361_0097666
2533 Ga0436361_0371933
2534 Ga0436361_0767394
2535 Ga0439466_0065556
2536 Ga0451833_0434451
2537 Ga0451837_1483507
2538 Ga0451853_4081205
2539 Ga0439431_0001194
2540 Ga0439442_005272
2541 Ga0439432_008000
2542 Ga0439432_020234
2543 Ga0439452_000001
2544 Ga0439452_023789
2545 Ga0450908_001364
2546 Ga0450918_000203
2547 Ga0466969_0034777
2548 Ga0466972_0156050
2549 Ga0466977_0007265
2550 Ga0466966_0000107
2551 Ga0466961_0000068
2552 Ga0466963_0004228
2553 Ga0451576_0122776
2554 Ga0466958_0062195
2555 Ga0466958_0151295
2556 Ga0466967_0537169
2557 Ga0495627_000018
2558 Ga0495627_011240
2559 Ga0495592_0002659
2560 Ga0495592_0015849
2561 Ga0495592_0048280
2562 Ga0495592_0060087
2563 Ga0495592_0080844
2564 Ga0495603_0000357
2565 Ga0495603_0010443
2566 Ga0495603_0143118
2567 Ga0495590_0001953
2568 Ga0495590_0064363
2569 Ga0495591_001746
2570 Ga0495629_0000019
2571 Ga0495629_0000324
2572 Ga0495629_0016801
2573 Ga0495629_0267931
2574 Ga0495638_0008187
2575 Ga0495651_0013765
2576 Ga0495651_0047323
2577 Ga0495653_0001772
2578 Ga0495653_0003919
2579 Ga0495653_0006411
2580 Ga0495653_0038033
2581 Ga0495653_0326251
2582 Ga0495650_0020095
2583 Ga0495580_0001459
2584 Ga0495580_0002389
2585 Ga0495580_0015985
2586 Ga0495580_0027959
2587 Ga0495580_0043830
2588 Ga0495582_0001061
2589 Ga0495582_0011323
2590 Ga0495582_0021956
2591 Ga0495582_0024214
2592 Ga0495605_0004558
2593 Ga0495605_0007909
2594 Ga0495639_0121035
2595 Ga0495664_0002904
2596 Ga0495664_0007199
2597 Ga0495664_0010869
2598 Ga0495596_0003607
2599 Ga0495607_0000222
2600 Ga0495583_0001486
2601 Ga0495583_0010931
2602 Ga0495606_0053530
2603 Ga0495606_0128822
2604 Ga0495608_0026339
2605 Ga0495608_0069251
2606 Ga0495608_0141463
2607 Ga0495616_0020440
2608 Ga0495618_0027868
2609 Ga0495618_0036016
2610 Ga0495618_0062376
2611 Ga0495620_0005744
2612 Ga0495620_0020987
2613 Ga0495628_0001514
2614 Ga0495628_0016911
2615 Ga0495628_0026223
2616 Ga0495628_0057183
2617 Ga0495628_0147222
2618 Ga0495628_0372747
2619 Ga0495628_0406625
2620 Ga0495630_0030909
2621 Ga0495630_0042170
2622 Ga0495630_0205007
2623 Ga0495630_0236657
2624 Ga0495631_0001000
2625 Ga0495632_0005609
2626 Ga0495632_0007553
2627 Ga0495643_0027689
2628 Ga0495648_0023429
2629 Ga0495648_0028656
2630 Ga0495648_0055020
2631 Ga0495666_0000226
2632 Ga0495666_0008250
2633 Ga0495666_0089437
2634 Ga0495652_0016659
2635 Ga0495652_0034597
2636 Ga0495652_0036332
2637 Ga0495652_0104348
2638 Ga0495652_0253880
2639 Ga0495654_0001734
2640 Ga0495654_0007676
2641 Ga0495654_0013733
2642 Ga0495654_0027712
2643 Ga0495654_0109599
2644 Ga0495665_0000719
2645 Ga0495665_0001886
2646 Ga0495665_0020567
2647 Ga0495665_0027050
2648 Ga0495665_0066714
2649 Ga0495640_0003354
2650 Ga0495640_0003716
2651 Ga0495640_0037582
2652 Ga0495586_0001072
2653 Ga0495587_0004090
2654 Ga0495587_0023429
2655 Ga0495587_0280687
2656 Ga0495621_0010337
2657 Ga0495597_0000426
2658 Ga0495645_0002971
2659 Ga0495645_0013550
2660 Ga0495633_0001594
2661 Ga0495667_0010311
2662 Ga0495634_0007743
2663 Ga0495634_0029938
2664 Ga0495634_0096159
2665 Ga0495634_0114734
2666 Ga0495611_0021100
2667 Ga0495625_0000044
2668 Ga0495625_0005617
2669 Ga0495625_0017290
2670 Ga0495625_0045384
2671 Ga0495635_0001277
2672 Ga0495635_0030140
2673 Ga0495635_0034782
2674 Ga0495635_0091209
2675 Ga0495661_0001965
2676 Ga0495661_0044822
2677 Ga0495588_0007251
2678 Ga0495588_0114008
2679 Ga0495657_0117898
2680 Ga0495657_0131207
2681 Ga0495599_0021985
2682 Ga0495599_0076326
2683 Ga0495599_0087123
2684 Ga0495599_0102375
2685 Ga0495623_0006180
2686 Ga0495623_0016213
2687 Ga0495623_0209783
2688 Ga0495646_0000701
2689 Ga0495646_0009225
2690 Ga0495646_0015429
2691 Ga0495646_0068551
2692 Ga0495647_0010734
2693 Ga0495613_0001967
2694 Ga0495613_0003507
2695 Ga0495613_0172351
2696 Ga0495624_0012912
2697 Ga0495624_0024394
2698 Ga0495624_0039929
2699 Ga0495624_0041251
2700 Ga0495624_0211750
2701 Ga0495671_0000697
2702 Ga0495671_0010602
2703 Ga0495671_0017834
2704 Ga0495671_0027191
2705 Ga0495649_0003585
2706 Ga0495649_0016776
2707 Ga0495649_0051973
2708 Ga0495589_0008221
2709 Ga0495589_0053454
2710 Ga0495600_0006710
2711 Ga0495600_0052670
2712 Ga0495600_0089532
2713 Ga0495660_0141770
2714 Ga0495581_0000184
2715 Ga0495581_0030839
2716 Ga0495604_0049157
2717 Ga0495604_0049796
2718 Ga0495604_0059663
2719 Ga0495604_0077463
2720 Ga0495674_0016934
2721 Ga0495674_0033202
2722 Ga0495674_0116478
2723 Ga0495674_0239155
2724 Ga0495672_0000009
2725 Ga0495672_0005294
2726 Ga0495672_0074110
2727 Ga0495676_0009854
2728 Ga0495676_0068792
2729 Ga0495676_0072217
2730 Ga0495676_0093956
2731 Ga0495680_0001480
2732 Ga0495680_0006595
2733 Ga0495680_0019532
2734 Ga0495680_0111098
2735 Ga0495680_0197578
2736 Ga0495683_0003301
2737 Ga0495683_0012696
2738 Ga0495683_0033221
2739 Ga0495687_013333
2740 Ga0495687_060952
2741 Ga0495687_064028
2742 Ga0495675_0003511
2743 Ga0495675_0004372
2744 Ga0495675_0018518
2745 Ga0495675_0022944
2746 Ga0495679_000037
2747 Ga0495679_000177
2748 Ga0495679_000702
2749 Ga0495684_0041845
2750 Ga0495684_0137308
2751 Ga0495684_0284000
2752 Ga0495593_0000287
2753 Ga0495593_0002263
2754 Ga0495593_0005587
2755 Ga0495593_0045005
2756 Ga0495602_0000447
2757 Ga0495602_0026442
2758 Ga0495602_0040022
2759 Ga0495602_0055472
2760 Ga0495602_0126758
2761 Ga0495602_0167686
2762 Ga0495602_0168279
2763 Ga0495614_0000608
2764 Ga0495614_0007949
2765 Ga0495626_0011433
2766 Ga0496100_0000449
2767 Ga0496101_0000430
2768 Ga0496101_0241798
2769 Ga0496102_0000128
2770 Ga0496102_0001072
2771 Ga0496102_0155028
2772 Ga0496103_0000394
2773 Ga0496103_0038137
2774 Ga0496104_0029946
2775 Ga0496104_0049604
2776 Ga0496105_0042040
2777 Ga0496105_0051246
2778 Ga0496105_0113650
2779 Ga0496106_0000479
2780 Ga0496106_0409087
2781 Ga0496107_0009594
2782 Ga0496107_0100161
2783 Ga0496109_0188840
2784 Ga0496110_0139408
2785 Ga0496110_0301997
2786 Ga0496111_0098337
2787 Ga0496112_0030846
2788 Ga0496113_0004607
2789 Ga0496113_0053862
2790 Ga0496114_0005380
2791 Ga0496115_0000486
2792 Ga0496115_0016930
2793 Ga0496115_0427617
2794 Ga0496116_0000023
2795 Ga0496116_0000460
2796 Ga0496116_0013582
2797 Ga0496117_0000203
2798 Ga0496117_0000463
2799 Ga0496117_0005563
2800 Ga0496117_0071053
2801 Ga0496117_0150624
2802 Ga0496118_0000079
2803 Ga0496118_0003815
2804 Ga0496118_0005103
2805 Ga0496118_0005771
2806 Ga0496118_0036321
2807 Ga0496119_0000056
2808 Ga0496119_0001891
2809 Ga0496119_0004881
2810 Ga0496119_0092153
2811 Ga0496120_0000052
2812 Ga0496120_0000063
2813 Ga0496120_0000137
2814 Ga0496121_0000860
2815 Ga0496121_0001688
2816 Ga0496121_0006093
2817 Ga0496121_0029115
2818 Ga0496121_0032218
2819 Ga0496121_0043019
2820 Ga0496121_0065425
2821 Ga0496122_0000887
2822 Ga0496122_0015744
2823 Ga0496122_0031349
2824 Ga0496122_0047575
2825 Ga0496123_0000180
2826 Ga0496123_0004798
2827 Ga0496123_0017330
2828 Ga0496123_0096875
2829 Ga0496124_0000017
2830 Ga0496124_0000024
2831 Ga0496124_0000451
2832 Ga0496124_0047249
2833 Ga0496124_0102154
2834 Ga0496125_0000016
2835 Ga0496125_0003043
2836 Ga0496125_0052210
2837 Ga0496125_0056369
2838 Ga0496125_0138487
2839 Ga0496126_0000225
2840 Ga0496126_0002445
2841 Ga0496126_0009549
2842 Ga0501034_0360886
2843 Ga0501047_0036259
2844 Ga0501067_0040551
2845 Ga0501070_0278723
2846 Ga0501072_0016539
2847 Ga0501073_0023853
2848 Ga0501074_0030094
2849 Ga0501080_0008273
2850 Ga0501080_0178214
2851 Ga0501262_000239
2852 nmdc:mga03683_29708_c1
2853 nmdc:mga03683_3151_c1
2854 nmdc:mga00v17_27802_c1
2855 nmdc:mga00v17_7455_c1
2856 nmdc:mga00v17_9465_c1
2857 nmdc:mga0yw44_9423_c1
2858 nmdc:mga0k408_39416_c1
2859 nmdc:mga0k408_43487_c1
2860 nmdc:mga0k408_6138_c1
2861 nmdc:mga0k408_75692_c1
2862 nmdc:mga06z11_224376_c1
2863 nmdc:mga07m45_15935_c1
2864 nmdc:mga07m45_2254_c1
2865 nmdc:mga07m45_42983_c1
2866 nmdc:mga07m45_5807_c1
2867 nmdc:mga07m45_6577_c1
2868 nmdc:mga07m45_6685_c1
2869 nmdc:mga07m45_98480_c1
2870 nmdc:mga05p37_172807_c1
2871 nmdc:mga09592_313808_c1
2872 nmdc:mga0n895_601081_c1
2873 nmdc:mga0n895_602527_c1
2874 nmdc:mga0rr50_194203_c1
2875 nmdc:mga08x19_129164_c1
2876 Ga0495612_0059844
2877 Ga0500610_0009985
2878 Ga0500610_0024124
2879 Ga0495619_0008531
2880 Ga0495619_0031100
2881 Ga0495619_0130008
2882 Ga0495619_0160812
2883 Ga0495619_0305053
2884 Ga0500578_0000244
2885 Ga0500651_0000440
2886 Ga0500566_0119307
2887 Ga0500571_017194
2888 Ga0500593_001081
2889 Ga0500594_0002394
2890 Ga0500595_000507
2891 Ga0500607_002946
2892 Ga0500618_000376
2893 Ga0500642_0143056
2894 Ga0500655_001505
2895 Ga0500658_0009124
2896 Ga0500564_033255
2897 Ga0500568_0003041
2898 Ga0500574_000053
2899 Ga0500622_0000043
2900 Ga0500627_0012941
2901 Ga0500634_0008211
2902 Ga0500634_0042530
2903 Ga0501084_0076341
2904 2509076495
2905 2511246598
2906 2511383975
2907 2512037037
2908 2513232076
2909 2521557795
2910 2553002916
2911 2555261438
2912 2587727029
2913 2587732031
2914 2587756972
2915 2588291456
2916 2599623592
2917 2599671790
2918 2599681197
2919 2599693399
2920 2599927398
2921 2600811292
2922 2643970584
2923 2644139135
2924 2644163194
2925 2644274745
2926 2644327575
2927 2644401531
2928 2644468112
2929 2650896746
2930 2686352745
2931 2738717667
2932 2738879278
2933 2739278353
2934 2739611377
2935 2746088370
2936 2746096735
2937 2765568899
2938 2772438099
2939 2808984562
2940 2809127632
2941 2809130608
2942 2809149915
2943 2819597153
2944 2819615062
2945 2831266278
2946 2838057612
2947 2839096219
2948 2842681946
2949 2847800575
2950 2852619939
2951 2857545267
2952 2857578152
2953 2858955682
2954 2881928944
2955 2885204392
2956 2885218045
2957 2888368114
2958 2899924656
2959 2904441443
2960 2904455806
2961 2904457763
2962 2904481559
2963 2904505327
2964 2904531619
2965 2904548096
2966 2904586741
2967 2904593226
2968 2904602931
2969 2919046259
2970 2919084049
2971 2919467558
2972 2923511013
2973 2928039217
2974 2928045178
2975 2928052983
2976 2928064346
2977 2928071794
2978 2928084263
2979 2928130975
2980 2928511201
2981 2929163027
2982 2929522789
2983 2932408458
2984 2932423395
2985 2939580119
2986 2939608227
2987 2945911534
2988 2945947662
2989 2945977474
2990 2945986125
2991 2954772492
2992 2980127431
2993 2984495971
2994 2990262653
2995 3000379832
2996 8005662400
2997 8048748982
2998 8054846520
2999 8054851854
3000 8055432569

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

147

318

0.98

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

21

74

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.5977 81 249
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.5966 77 246
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.5843 87 246
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.5729 64 249
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.5651 97 248
ID Description Score Start End Superfamily
af_P0DP70_1_121_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6711 121 248 1.10.3720.10
af_P45767_178_390_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6707 114 249 1.10.3720.10
af_P9WFZ7_89_318_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.662 118 248 1.10.3720.10
af_P0DP70_1_121_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.659 121 248 1.10.3720.10
af_Q2FVL3_18_236_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6565 118 250 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7X6GP56-F1-model_v4 deleted 0.8446 129 253
AF-A0A6N9U5T1-F1-model_v4 ABC transporter permease subunit 0.8361 124 256 GO:0005886
GO:0055085
AF-A0A4Q3F9M9-F1-model_v4 ABC transporter permease 0.8281 113 256 GO:0005886
GO:0055085
AF-A0A1M3BMJ4-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8219 135 255 GO:0005886
GO:0055085
AF-A0A3D2SP41-F1-model_v4 Peptide ABC transporter permease 0.8174 127 255 GO:0005886
GO:0055085

Map