F494418

General Info

Members Datasets Scaffolds Average Seq Length
1502 405 1502 256

Family's Representative Sequence

Representative Sequence 3300061734|Ga0530510_0158472|Ga0530510_0158472_514_1341
Length 275
Sequence LVLLWHRPESTIARVDAKGLIAAGGEATRLGELTRVANKHLLPVGRWPMIYYPLQLLQLAGVREVLIVTGQGHAGQLIDLLGDGRMAARGGDEPLFELDLTYKVQTEPGGIAQVVGMAEAFAAGGKLVVCLGDNLFEFAEVSAIRSWADAGNGAQIFVKEVPDPERFGVVVYGEDGRVADVVEKAGVVDTRYDAPPTADAVVGLYCYDATVYEIIRGLEPSSRGELEITDVNRRYAENGRLSVARVQGWWHDAGAHEALAELGARVEETGANKLA

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
189 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
190 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
191 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
192 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
193 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
194 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
195 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
196 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
214 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
215 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
216 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
219 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
220 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
225 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
233 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
240 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
241 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
242 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
243 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
244 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
245 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
246 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
247 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
248 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
249 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
250 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
251 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
252 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
253 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
254 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
255 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
256 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
257 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
258 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
259 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
260 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
261 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
262 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
263 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
264 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
265 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
266 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
267 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
268 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
269 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
270 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
271 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
272 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
273 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
274 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
275 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
276 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
277 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
278 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
279 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
280 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
281 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
288 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
294 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
295 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
296 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
299 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
300 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
301 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
305 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
306 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
307 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
308 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
309 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
310 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
311 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
312 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
313 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
314 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
315 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
319 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
320 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
321 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
322 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
323 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
324 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
325 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
331 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
336 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
369 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
370 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
371 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
372 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
373 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
374 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
375 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
376 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
379 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
380 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
381 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
382 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
386 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
387 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
388 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
389 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
390 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
391 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
392 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
393 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
394 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
395 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
396 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
397 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
398 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
399 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
400 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
401 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
402 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
403 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
404 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
405 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 8.72
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c003182 3300000041 Bacteria 1468
2 JGI24739J22299_10032072 3300001989 Bacteria 1811
3 JGI24743J22301_10004088 3300001991 Bacteria 2352
4 JGI24738J21930_10013484 3300002075 Bacteria 1766
5 JGI24744J21845_10010742 3300002077 Bacteria 1874
6 JGI24744J21845_10015692 3300002077 Bacteria 1512
7 JGI24033J26618_1009698 3300002155 Bacteria 1125
8 JGI24751J29686_10002390 3300002459 Bacteria 3782
9 JGI25407J50210_10002200 3300003373 Bacteria 4565
10 JGI25407J50210_10012870 3300003373 Bacteria 2146
11 JGI25407J50210_10019135 3300003373 Unclassified 1780
12 JGI25407J50210_10040997 3300003373 Bacteria 1186
13 JGI25407J50210_10070894 3300003373 Bacteria 870
14 Ga0070658_10177926 3300005327 Bacteria 1789
15 Ga0070658_10227673 3300005327 Bacteria 1578
16 Ga0070658_10555359 3300005327 Bacteria 994
17 Ga0070658_10601447 3300005327 Bacteria 953
18 Ga0070676_10105811 3300005328 Bacteria 1745
19 Ga0070683_100022112 3300005329 Bacteria 5681
20 Ga0070683_100040560 3300005329 Bacteria 4281
21 Ga0070683_100048201 3300005329 Bacteria 3938
22 Ga0070683_100057210 3300005329 Bacteria 3622
23 Ga0070683_100082560 3300005329 Bacteria 3010
24 Ga0070683_100135504 3300005329 Bacteria 2332
25 Ga0070683_100144012 3300005329 Bacteria 2258
26 Ga0070683_100200893 3300005329 Unclassified 1893
27 Ga0070683_100270508 3300005329 Bacteria 1616
28 Ga0070683_100344858 3300005329 Bacteria 1418
29 Ga0070683_100463967 3300005329 Bacteria 1209
30 Ga0070683_100485687 3300005329 Bacteria 1179
31 Ga0070683_100500406 3300005329 Bacteria 1161
32 Ga0070683_100649423 3300005329 Bacteria 1010
33 Ga0070690_100131236 3300005330 Bacteria 1692
34 Ga0068869_100088600 3300005334 Bacteria 2323
35 Ga0068869_100473325 3300005334 Bacteria 1042
36 Ga0070680_100010968 3300005336 Bacteria 7006
37 Ga0070680_100018239 3300005336 Bacteria 5543
38 Ga0070680_100022628 3300005336 Bacteria 5008
39 Ga0070680_100028601 3300005336 Bacteria 4472
40 Ga0070680_100071442 3300005336 Bacteria 2852
41 Ga0070680_100073686 3300005336 Bacteria 2809
42 Ga0070680_100136047 3300005336 Bacteria 2058
43 Ga0070680_100242924 3300005336 Bacteria 1522
44 Ga0070682_100002171 3300005337 Bacteria 10885
45 Ga0070682_100039904 3300005337 Bacteria 2887
46 Ga0070682_100101682 3300005337 Bacteria 1898
47 Ga0068868_100320480 3300005338 Bacteria 1320
48 Ga0070660_100008471 3300005339 Bacteria 7194
49 Ga0070660_100012212 3300005339 Bacteria 6132
50 Ga0070660_100025299 3300005339 Bacteria 4411
51 Ga0070660_100050415 3300005339 Bacteria 3203
52 Ga0070660_100356088 3300005339 Bacteria 1206
53 Ga0070689_100004845 3300005340 Bacteria 9132
54 Ga0070689_100014058 3300005340 Bacteria 5807
55 Ga0070691_10072689 3300005341 Bacteria 1671
56 Ga0070687_100023730 3300005343 Bacteria 2918
57 Ga0070687_100026372 3300005343 Bacteria 2797
58 Ga0070661_100008990 3300005344 Bacteria 6914
59 Ga0070661_100012209 3300005344 Bacteria 6006
60 Ga0070661_100038149 3300005344 Bacteria 3497
61 Ga0070661_100130048 3300005344 Bacteria 1890
62 Ga0070661_100289621 3300005344 Bacteria 1272
63 Ga0070692_10109838 3300005345 Bacteria 1523
64 Ga0070692_10172581 3300005345 Bacteria 1247
65 Ga0070668_100053773 3300005347 Bacteria 3105
66 Ga0070668_100123057 3300005347 Bacteria 2075
67 Ga0070669_100151931 3300005353 Bacteria 1793
68 Ga0070669_100472114 3300005353 Bacteria 1037
69 Ga0070675_100006745 3300005354 Bacteria 8828
70 Ga0070671_100029577 3300005355 Bacteria 4517
71 Ga0070671_100395684 3300005355 Bacteria 1181
72 Ga0070674_100000969 3300005356 Bacteria 14961
73 Ga0070674_100055510 3300005356 Bacteria 2743
74 Ga0070674_100279038 3300005356 Bacteria 1323
75 Ga0070673_100036778 3300005364 Bacteria 3725
76 Ga0070673_100093932 3300005364 Bacteria 2457
77 Ga0070688_100000622 3300005365 Bacteria 17675
78 Ga0070688_100051855 3300005365 Bacteria 2560
79 Ga0070688_100139138 3300005365 Bacteria 1647
80 Ga0070659_100013748 3300005366 Bacteria 6034
81 Ga0070659_100069700 3300005366 Bacteria 2792
82 Ga0070659_100185037 3300005366 Bacteria 1710
83 Ga0070659_100196653 3300005366 Bacteria 1658
84 Ga0070659_100483586 3300005366 Bacteria 1054
85 Ga0070667_100034742 3300005367 Bacteria 4220
86 Ga0070667_100158702 3300005367 Bacteria 1991
87 Ga0070714_100526522 3300005435 Bacteria 1129
88 Ga0070714_100654449 3300005435 Bacteria 1012
89 Ga0070714_100683297 3300005435 Bacteria 990
90 Ga0070713_100106004 3300005436 Bacteria 2443
91 Ga0070713_100345254 3300005436 Bacteria 1380
92 Ga0070710_10275368 3300005437 Bacteria 1090
93 Ga0070701_10030345 3300005438 Bacteria 2674
94 Ga0070711_100478100 3300005439 Bacteria 1024
95 Ga0070705_100048881 3300005440 Bacteria 2453
96 Ga0070700_100346796 3300005441 Bacteria 1099
97 Ga0070694_100079502 3300005444 Bacteria 2276
98 Ga0070708_100033117 3300005445 Bacteria 4489
99 Ga0070663_100079585 3300005455 Bacteria 2405
100 Ga0070663_100250382 3300005455 Bacteria 1402
101 Ga0070663_100471652 3300005455 Bacteria 1038
102 Ga0070678_100008743 3300005456 Bacteria 6084
103 Ga0070678_100028711 3300005456 Bacteria 3798
104 Ga0070678_100112538 3300005456 Bacteria 2132
105 Ga0070678_100238729 3300005456 Bacteria 1519
106 Ga0070662_100226865 3300005457 Bacteria 1493
107 Ga0070681_10011373 3300005458 Bacteria 8806
108 Ga0070681_10029668 3300005458 Bacteria 5492
109 Ga0070681_10041815 3300005458 Bacteria 4594
110 Ga0070681_10070401 3300005458 Bacteria 3463
111 Ga0070681_10077344 3300005458 Bacteria 3285
112 Ga0070681_10119786 3300005458 Bacteria 2568
113 Ga0070681_10206450 3300005458 Bacteria 1881
114 Ga0070681_10575848 3300005458 Bacteria 1040
115 Ga0070681_10634043 3300005458 Bacteria 983
116 Ga0068867_100033342 3300005459 Bacteria 3728
117 Ga0068867_100337881 3300005459 Bacteria 1253
118 Ga0070685_10003403 3300005466 Bacteria 8092
119 Ga0070685_10038539 3300005466 Bacteria 2710
120 Ga0070685_10124066 3300005466 Bacteria 1607
121 Ga0070706_100136916 3300005467 Bacteria 2285
122 Ga0070707_100230738 3300005468 Bacteria 1802
123 Ga0070699_100021930 3300005518 Bacteria 5504
124 Ga0070699_100213351 3300005518 Bacteria 1719
125 Ga0070679_100007114 3300005530 Bacteria 10444
126 Ga0070679_100028797 3300005530 Bacteria 5478
127 Ga0070679_100089177 3300005530 Bacteria 3071
128 Ga0070679_100125137 3300005530 Bacteria 2553
129 Ga0070679_100169820 3300005530 Bacteria 2154
130 Ga0070679_100308073 3300005530 Bacteria 1534
131 Ga0070684_100005407 3300005535 Bacteria 9783
132 Ga0070684_100038137 3300005535 Bacteria 4126
133 Ga0070684_100058574 3300005535 Bacteria 3366
134 Ga0070684_100073569 3300005535 Bacteria 3011
135 Ga0070684_100126605 3300005535 Bacteria 2301
136 Ga0070684_100148844 3300005535 Bacteria 2120
137 Ga0070684_100307441 3300005535 Bacteria 1455
138 Ga0068853_100163039 3300005539 Bacteria 2013
139 Ga0068853_100648900 3300005539 Bacteria 1004
140 Ga0070672_100024810 3300005543 Bacteria 4438
141 Ga0070672_100025873 3300005543 Bacteria 4359
142 Ga0070672_100387186 3300005543 Bacteria 1197
143 Ga0070686_100287035 3300005544 Bacteria 1216
144 Ga0070696_100011676 3300005546 Bacteria 5886
145 Ga0070696_100176186 3300005546 Bacteria 1584
146 Ga0070696_100328704 3300005546 Bacteria 1178
147 Ga0070693_100006766 3300005547 Bacteria 5566
148 Ga0070693_100019512 3300005547 Bacteria 3556
149 Ga0070693_100106005 3300005547 Bacteria 1720
150 Ga0070665_100051711 3300005548 Bacteria 4120
151 Ga0070665_100125332 3300005548 Bacteria 2571
152 Ga0070665_100211417 3300005548 Bacteria 1940
153 Ga0070665_100327537 3300005548 Bacteria 1536
154 Ga0070704_100069436 3300005549 Unclassified 2553
155 Ga0070704_100124352 3300005549 Bacteria 1987
156 Ga0070704_100294432 3300005549 Bacteria 1350
157 Ga0068855_100012841 3300005563 Bacteria 10106
158 Ga0068855_100016655 3300005563 Bacteria 8837
159 Ga0068855_100022296 3300005563 Bacteria 7589
160 Ga0068855_100052137 3300005563 Bacteria 4817
161 Ga0068855_100094434 3300005563 Bacteria 3448
162 Ga0068855_100462295 3300005563 Bacteria 1384
163 Ga0070664_100044302 3300005564 Bacteria 3757
164 Ga0070664_100106665 3300005564 Bacteria 2441
165 Ga0070664_100182154 3300005564 Bacteria 1867
166 Ga0068857_100104689 3300005577 Bacteria 2541
167 Ga0068857_100110034 3300005577 Bacteria 2476
168 Ga0068857_100118887 3300005577 Bacteria 2378
169 Ga0068854_100062975 3300005578 Bacteria 2691
170 Ga0068854_100074946 3300005578 Bacteria 2483
171 Ga0068854_100239290 3300005578 Bacteria 1445
172 Ga0068856_100024369 3300005614 Bacteria 5889
173 Ga0068856_100028748 3300005614 Bacteria 5431
174 Ga0068856_100053236 3300005614 Bacteria 3991
175 Ga0068856_100077021 3300005614 Bacteria 3304
176 Ga0068856_100135503 3300005614 Bacteria 2468
177 Ga0068856_100288193 3300005614 Bacteria 1659
178 Ga0070702_100006091 3300005615 Bacteria 5683
179 Ga0070702_100077838 3300005615 Bacteria 1978
180 Ga0070702_100137638 3300005615 Bacteria 1551
181 Ga0070702_100336654 3300005615 Bacteria 1057
182 Ga0068852_100112165 3300005616 Bacteria 2481
183 Ga0068852_100270468 3300005616 Bacteria 1635
184 Ga0068852_100281862 3300005616 Bacteria 1602
185 Ga0068852_100353875 3300005616 Bacteria 1435
186 Ga0068859_100178859 3300005617 Bacteria 2203
187 Ga0068864_100063292 3300005618 Bacteria 3206
188 Ga0068864_100138952 3300005618 Unclassified 2190
189 Ga0068866_10034383 3300005718 Bacteria 2468
190 Ga0068866_10046914 3300005718 Bacteria 2175
191 Ga0068861_100077911 3300005719 Bacteria 2587
192 Ga0068870_10001168 3300005840 Bacteria 10510
193 Ga0068870_10038143 3300005840 Bacteria 2480
194 Ga0068870_10055386 3300005840 Bacteria 2113
195 Ga0068870_10185515 3300005840 Bacteria 1252
196 Ga0068863_100079276 3300005841 Bacteria 3110
197 Ga0068858_100035180 3300005842 Bacteria 4645
198 Ga0068858_100128811 3300005842 Bacteria 2372
199 Ga0068860_100145206 3300005843 Bacteria 2282
200 Ga0068862_100067992 3300005844 Bacteria 3072
201 Ga0068862_100390387 3300005844 Bacteria 1300
202 Ga0081455_10020460 3300005937 Bacteria 6227
203 Ga0081455_10029851 3300005937 Bacteria 4966
204 Ga0081455_10053591 3300005937 Unclassified 3445
205 Ga0081455_10075419 3300005937 Bacteria 2782
206 Ga0081455_10099399 3300005937 Bacteria 2340
207 Ga0081455_10135191 3300005937 Bacteria 1922
208 Ga0081538_10000053 3300005981 Bacteria 109213
209 Ga0081538_10000060 3300005981 Bacteria 101190
210 Ga0081538_10001619 3300005981 Bacteria 23088
211 Ga0081538_10003876 3300005981 Bacteria 13974
212 Ga0081538_10023525 3300005981 Bacteria 4425
213 Ga0081538_10085773 3300005981 Bacteria 1652
214 Ga0081540_1028563 3300005983 Bacteria 3129
215 Ga0081539_10005173 3300005985 Bacteria 13558
216 Ga0081539_10008003 3300005985 Bacteria 9383
217 Ga0081539_10133518 3300005985 Bacteria 1216
218 Ga0070717_10036916 3300006028 Bacteria 3965
219 Ga0070717_10381332 3300006028 Unclassified 1264
220 Ga0075365_10083266 3300006038 Bacteria 2170
221 Ga0075365_10267487 3300006038 Bacteria 1202
222 Ga0075432_10001371 3300006058 Bacteria 7915
223 Ga0075432_10046483 3300006058 Bacteria 1524
224 Ga0070712_100168162 3300006175 Bacteria 1699
225 Ga0070712_100441537 3300006175 Bacteria 1082
226 Ga0097621_100335256 3300006237 Bacteria 1342
227 Ga0097621_100474716 3300006237 Bacteria 1130
228 Ga0068871_100369116 3300006358 Bacteria 1272
229 Ga0075428_100000411 3300006844 Bacteria 42585
230 Ga0075428_100005096 3300006844 Bacteria 14600
231 Ga0075428_100019492 3300006844 Bacteria 7507
232 Ga0075428_100165773 3300006844 Bacteria 2397
233 Ga0075428_100242679 3300006844 Bacteria 1943
234 Ga0075428_100535860 3300006844 Bacteria 1252
235 Ga0075430_100001646 3300006846 Bacteria 18226
236 Ga0075430_100188785 3300006846 Bacteria 1713
237 Ga0075431_100008014 3300006847 Bacteria 10540
238 Ga0075433_10079022 3300006852 Bacteria 2899
239 Ga0075429_100011938 3300006880 Bacteria 7531
240 Ga0075429_100084993 3300006880 Bacteria 2758
241 Ga0068865_100005904 3300006881 Bacteria 7448
242 Ga0068865_100086753 3300006881 Bacteria 2260
243 Ga0068865_100188934 3300006881 Bacteria 1591
244 Ga0097620_100178855 3300006931 Bacteria 2203
245 Ga0075435_100057728 3300007076 Bacteria 3141
246 Ga0075435_100189228 3300007076 Bacteria 1741
247 Ga0105244_10164476 3300009036 Bacteria 1058
248 Ga0105240_10055251 3300009093 Bacteria 4972
249 Ga0105240_10130250 3300009093 Bacteria 3018
250 Ga0105240_10158454 3300009093 Bacteria 2690
251 Ga0105240_10217139 3300009093 Bacteria 2230
252 Ga0111539_10005465 3300009094 Bacteria 16438
253 Ga0111539_10006234 3300009094 Bacteria 15391
254 Ga0111539_10026000 3300009094 Bacteria 7164
255 Ga0111539_10076732 3300009094 Bacteria 3934
256 Ga0111539_10087612 3300009094 Bacteria 3657
257 Ga0111539_10213355 3300009094 Bacteria 2249
258 Ga0111539_10259796 3300009094 Bacteria 2022
259 Ga0111539_10894264 3300009094 Unclassified 1033
260 Ga0105245_10036788 3300009098 Bacteria 4350
261 Ga0105245_10059563 3300009098 Bacteria 3438
262 Ga0105245_10191049 3300009098 Bacteria 1961
263 Ga0105245_10414208 3300009098 Bacteria 1349
264 Ga0105245_10726400 3300009098 Bacteria 1028
265 Ga0105245_10868041 3300009098 Bacteria 943
266 Ga0105247_10031890 3300009101 Bacteria 3199
267 Ga0105247_10130276 3300009101 Bacteria 1639
268 Ga0114129_10006651 3300009147 Bacteria 16412
269 Ga0114129_10035068 3300009147 Bacteria 7088
270 Ga0114129_10041736 3300009147 Bacteria 6461
271 Ga0114129_10059915 3300009147 Bacteria 5323
272 Ga0114129_10241534 3300009147 Bacteria 2428
273 Ga0114129_10670477 3300009147 Bacteria 1336
274 Ga0114129_10710552 3300009147 Bacteria 1291
275 Ga0105243_10007699 3300009148 Bacteria 8280
276 Ga0105243_10021955 3300009148 Bacteria 4848
277 Ga0105243_10028908 3300009148 Bacteria 4260
278 Ga0105243_10118470 3300009148 Bacteria 2228
279 Ga0105241_10162076 3300009174 Bacteria 1839
280 Ga0105241_10399936 3300009174 Bacteria 1204
281 Ga0105241_10600437 3300009174 Bacteria 994
282 Ga0105242_10019197 3300009176 Bacteria 5355
283 Ga0105242_10038091 3300009176 Bacteria 3864
284 Ga0105242_10038126 3300009176 Bacteria 3863
285 Ga0105242_10236841 3300009176 Bacteria 1639
286 Ga0105242_10334705 3300009176 Bacteria 1393
287 Ga0105242_10533360 3300009176 Bacteria 1122
288 Ga0105242_11035516 3300009176 Bacteria 831
289 Ga0105248_10117333 3300009177 Bacteria 3002
290 Ga0105248_10446221 3300009177 Bacteria 1458
291 Ga0105248_10481304 3300009177 Bacteria 1399
292 Ga0105248_11146134 3300009177 Bacteria 879
293 Ga0105237_10396537 3300009545 Bacteria 1385
294 Ga0105238_10013751 3300009551 Bacteria 8179
295 Ga0105238_10094488 3300009551 Bacteria 2978
296 Ga0105249_10104608 3300009553 Bacteria 2668
297 Ga0105249_10349009 3300009553 Bacteria 1498
298 Ga0105239_10023094 3300010375 Bacteria 6854
299 Ga0105239_10025839 3300010375 Bacteria 6467
300 Ga0105239_10060540 3300010375 Bacteria 4155
301 Ga0105239_10308615 3300010375 Bacteria 1783
302 Ga0105239_10891531 3300010375 Bacteria 1021
303 Ga0105239_10962387 3300010375 Bacteria 981
304 Ga0105246_10015487 3300011119 Bacteria 4819
305 Ga0105246_10080467 3300011119 Bacteria 2319
306 Ga0105246_10092536 3300011119 Bacteria 2182
307 Ga0105246_11081543 3300011119 Unclassified 731
308 Ga0157371_10030301 3300013102 Bacteria 3903
309 Ga0157371_10159266 3300013102 Bacteria 1612
310 Ga0157371_10165057 3300013102 Bacteria 1582
311 Ga0157370_10016119 3300013104 Bacteria 7575
312 Ga0157370_10045044 3300013104 Bacteria 4235
313 Ga0157370_10055018 3300013104 Bacteria 3793
314 Ga0157370_10076769 3300013104 Bacteria 3147
315 Ga0157370_10095728 3300013104 Bacteria 2785
316 Ga0157370_10189639 3300013104 Bacteria 1908
317 Ga0157370_10451684 3300013104 Bacteria 1181
318 Ga0157369_10002303 3300013105 Bacteria 22963
319 Ga0157369_10010556 3300013105 Bacteria 10509
320 Ga0157369_10015027 3300013105 Bacteria 8737
321 Ga0157369_10046905 3300013105 Bacteria 4694
322 Ga0157369_10403841 3300013105 Bacteria 1417
323 Ga0157374_10440189 3300013296 Bacteria 1304
324 Ga0157374_10486337 3300013296 Bacteria 1238
325 Ga0157374_10703585 3300013296 Bacteria 1023
326 Ga0157378_10572261 3300013297 Unclassified 1138
327 Ga0163162_10427020 3300013306 Bacteria 1457
328 Ga0157372_10152275 3300013307 Bacteria 2670
329 Ga0157372_10255136 3300013307 Bacteria 2036
330 Ga0157372_10318912 3300013307 Bacteria 1809
331 Ga0157372_10345417 3300013307 Bacteria 1734
332 Ga0157372_10463449 3300013307 Bacteria 1477
333 Ga0157372_10797499 3300013307 Bacteria 1097
334 Ga0157375_10014615 3300013308 Bacteria 7011
335 Ga0157375_10080878 3300013308 Bacteria 3288
336 Ga0157375_10117242 3300013308 Bacteria 2768
337 Ga0157375_10143581 3300013308 Bacteria 2516
338 Ga0157375_10467082 3300013308 Bacteria 1427
339 Ga0157375_10575488 3300013308 Bacteria 1287
340 Ga0163163_10003920 3300014325 Bacteria 12691
341 Ga0163163_10013038 3300014325 Bacteria 7589
342 Ga0163163_10041946 3300014325 Bacteria 4478
343 Ga0163163_10116876 3300014325 Bacteria 2698
344 Ga0163163_10439331 3300014325 Bacteria 1364
345 Ga0157380_10014017 3300014326 Bacteria 5856
346 Ga0157380_10034055 3300014326 Bacteria 3927
347 Ga0157380_10080696 3300014326 Bacteria 2659
348 Ga0157380_10118739 3300014326 Bacteria 2236
349 Ga0157377_10044381 3300014745 Bacteria 2478
350 Ga0157377_10064623 3300014745 Bacteria 2099
351 Ga0157377_10144168 3300014745 Bacteria 1466
352 Ga0157379_10068549 3300014968 Bacteria 3171
353 Ga0157376_10099591 3300014969 Bacteria 2536
354 Ga0157376_10253723 3300014969 Bacteria 1644
355 Ga0157376_10556644 3300014969 Bacteria 1136
356 Ga0163161_10040750 3300017792 Bacteria 3336
357 Ga0197907_10409808 3300020069 Bacteria 2016
358 Ga0197907_10896525 3300020069 Bacteria 1296
359 Ga0206356_10031764 3300020070 Bacteria 2218
360 Ga0206356_10355467 3300020070 Bacteria 2086
361 Ga0206356_10456913 3300020070 Bacteria 1774
362 Ga0206354_10030587 3300020081 Bacteria 2211
363 Ga0206354_11649605 3300020081 Bacteria 1912
364 Ga0206353_11455507 3300020082 Bacteria 4366
365 Ga0206353_11548455 3300020082 Bacteria 5480
366 Ga0207653_10030307 3300025885 Bacteria 1745
367 Ga0207642_10082910 3300025899 Bacteria 1562
368 Ga0207642_10083670 3300025899 Bacteria 1556
369 Ga0207642_10205794 3300025899 Bacteria 1090
370 Ga0207710_10034316 3300025900 Bacteria 2229
371 Ga0207688_10058305 3300025901 Bacteria 2173
372 Ga0207645_10042757 3300025907 Bacteria 2899
373 Ga0207645_10308411 3300025907 Bacteria 1054
374 Ga0207643_10001394 3300025908 Bacteria 13872
375 Ga0207643_10011125 3300025908 Bacteria 4857
376 Ga0207643_10019487 3300025908 Bacteria 3718
377 Ga0207643_10053201 3300025908 Bacteria 2300
378 Ga0207643_10089647 3300025908 Bacteria 1791
379 Ga0207705_10022323 3300025909 Bacteria 4513
380 Ga0207705_10045636 3300025909 Bacteria 3149
381 Ga0207705_10143292 3300025909 Bacteria 1786
382 Ga0207705_10217262 3300025909 Bacteria 1451
383 Ga0207684_10099042 3300025910 Bacteria 2490
384 Ga0207684_10112907 3300025910 Bacteria 2326
385 Ga0207654_10056324 3300025911 Bacteria 2280
386 Ga0207654_10082553 3300025911 Bacteria 1938
387 Ga0207707_10003519 3300025912 Bacteria 13867
388 Ga0207707_10009500 3300025912 Bacteria 8438
389 Ga0207707_10010456 3300025912 Bacteria 8052
390 Ga0207707_10048497 3300025912 Bacteria 3699
391 Ga0207707_10060472 3300025912 Bacteria 3296
392 Ga0207707_10232339 3300025912 Bacteria 1604
393 Ga0207707_10237107 3300025912 Bacteria 1587
394 Ga0207695_10445632 3300025913 Unclassified 1178
395 Ga0207695_10588678 3300025913 Bacteria 994
396 Ga0207671_10098486 3300025914 Bacteria 2212
397 Ga0207693_10029592 3300025915 Bacteria 4324
398 Ga0207693_10367469 3300025915 Bacteria 1125
399 Ga0207663_10079884 3300025916 Bacteria 2137
400 Ga0207663_10297435 3300025916 Bacteria 1205
401 Ga0207660_10006022 3300025917 Bacteria 7872
402 Ga0207660_10006989 3300025917 Bacteria 7309
403 Ga0207660_10055775 3300025917 Bacteria 2825
404 Ga0207660_10136576 3300025917 Bacteria 1871
405 Ga0207660_10350383 3300025917 Bacteria 1183
406 Ga0207662_10046335 3300025918 Bacteria 2572
407 Ga0207662_10049628 3300025918 Bacteria 2490
408 Ga0207657_10000964 3300025919 Bacteria 30488
409 Ga0207657_10005129 3300025919 Bacteria 13727
410 Ga0207657_10006273 3300025919 Bacteria 12358
411 Ga0207657_10015819 3300025919 Bacteria 7292
412 Ga0207657_10019162 3300025919 Bacteria 6507
413 Ga0207657_10037998 3300025919 Bacteria 4292
414 Ga0207649_10026660 3300025920 Bacteria 3383
415 Ga0207649_10111901 3300025920 Bacteria 1826
416 Ga0207649_10125261 3300025920 Bacteria 1738
417 Ga0207649_10256595 3300025920 Bacteria 1262
418 Ga0207649_10275813 3300025920 Bacteria 1221
419 Ga0207652_10004108 3300025921 Bacteria 11877
420 Ga0207652_10016334 3300025921 Bacteria 6059
421 Ga0207652_10023280 3300025921 Bacteria 5130
422 Ga0207652_10104857 3300025921 Bacteria 2501
423 Ga0207652_10142354 3300025921 Bacteria 2145
424 Ga0207652_10192852 3300025921 Unclassified 1832
425 Ga0207652_10329969 3300025921 Bacteria 1377
426 Ga0207646_10443255 3300025922 Bacteria 1172
427 Ga0207681_10093155 3300025923 Bacteria 2156
428 Ga0207681_10163446 3300025923 Bacteria 1681
429 Ga0207681_10212534 3300025923 Bacteria 1492
430 Ga0207681_10424348 3300025923 Bacteria 1078
431 Ga0207694_10157213 3300025924 Bacteria 1834
432 Ga0207650_10086636 3300025925 Bacteria 2384
433 Ga0207659_10109256 3300025926 Bacteria 2099
434 Ga0207687_10028420 3300025927 Bacteria 3756
435 Ga0207687_10144978 3300025927 Bacteria 1806
436 Ga0207687_10162881 3300025927 Bacteria 1713
437 Ga0207687_10169103 3300025927 Bacteria 1684
438 Ga0207687_10345717 3300025927 Bacteria 1210
439 Ga0207700_10066710 3300025928 Bacteria 2751
440 Ga0207664_10305579 3300025929 Bacteria 1400
441 Ga0207664_10731049 3300025929 Bacteria 890
442 Ga0207664_10825459 3300025929 Bacteria 834
443 Ga0207644_10097090 3300025931 Bacteria 2207
444 Ga0207644_10266247 3300025931 Bacteria 1372
445 Ga0207690_10026511 3300025932 Bacteria 3649
446 Ga0207690_10038356 3300025932 Bacteria 3117
447 Ga0207690_10116671 3300025932 Bacteria 1931
448 Ga0207690_10185241 3300025932 Bacteria 1570
449 Ga0207706_10009052 3300025933 Bacteria 9160
450 Ga0207706_10028469 3300025933 Bacteria 4989
451 Ga0207686_10087634 3300025934 Bacteria 2048
452 Ga0207686_10120860 3300025934 Bacteria 1783
453 Ga0207686_10208494 3300025934 Bacteria 1404
454 Ga0207709_10015116 3300025935 Bacteria 4276
455 Ga0207709_10201683 3300025935 Bacteria 1421
456 Ga0207670_10048334 3300025936 Bacteria 2838
457 Ga0207670_10099191 3300025936 Bacteria 2077
458 Ga0207669_10074747 3300025937 Bacteria 2144
459 Ga0207669_10105227 3300025937 Bacteria 1876
460 Ga0207669_10165568 3300025937 Bacteria 1567
461 Ga0207704_10032534 3300025938 Bacteria 2953
462 Ga0207704_10033752 3300025938 Bacteria 2914
463 Ga0207704_10122465 3300025938 Bacteria 1783
464 Ga0207691_10014782 3300025940 Bacteria 7440
465 Ga0207691_10037730 3300025940 Bacteria 4473
466 Ga0207691_10047204 3300025940 Bacteria 3954
467 Ga0207691_10481241 3300025940 Bacteria 1055
468 Ga0207711_10084135 3300025941 Bacteria 2784
469 Ga0207711_10198323 3300025941 Bacteria 1831
470 Ga0207711_10273676 3300025941 Bacteria 1554
471 Ga0207689_10146634 3300025942 Bacteria 1944
472 Ga0207689_10215945 3300025942 Bacteria 1585
473 Ga0207661_10000504 3300025944 Bacteria 25223
474 Ga0207661_10030216 3300025944 Bacteria 4171
475 Ga0207661_10078061 3300025944 Bacteria 2724
476 Ga0207661_10180837 3300025944 Bacteria 1842
477 Ga0207661_10207740 3300025944 Unclassified 1724
478 Ga0207661_10288065 3300025944 Bacteria 1469
479 Ga0207661_10339606 3300025944 Bacteria 1353
480 Ga0207661_10421831 3300025944 Bacteria 1212
481 Ga0207661_10517096 3300025944 Bacteria 1091
482 Ga0207679_10001100 3300025945 Bacteria 17213
483 Ga0207679_10087018 3300025945 Bacteria 2405
484 Ga0207667_10037484 3300025949 Bacteria 5181
485 Ga0207667_10136180 3300025949 Bacteria 2529
486 Ga0207667_10243197 3300025949 Bacteria 1841
487 Ga0207667_10378071 3300025949 Bacteria 1443
488 Ga0207651_10127222 3300025960 Bacteria 1944
489 Ga0207651_10238499 3300025960 Bacteria 1480
490 Ga0207651_10293315 3300025960 Bacteria 1349
491 Ga0207712_10379298 3300025961 Bacteria 1183
492 Ga0207668_10027746 3300025972 Bacteria 3692
493 Ga0207668_10110569 3300025972 Bacteria 2061
494 Ga0207668_10612357 3300025972 Bacteria 950
495 Ga0207640_10014605 3300025981 Bacteria 4525
496 Ga0207640_10033043 3300025981 Bacteria 3214
497 Ga0207640_10092949 3300025981 Bacteria 2094
498 Ga0207640_10184494 3300025981 Bacteria 1567
499 Ga0207658_10017741 3300025986 Bacteria 4905
500 Ga0207658_10126294 3300025986 Bacteria 2048
501 Ga0207677_10212035 3300026023 Bacteria 1547
502 Ga0207677_10675882 3300026023 Bacteria 914
503 Ga0207639_10205217 3300026041 Bacteria 1693
504 Ga0207639_10256476 3300026041 Bacteria 1527
505 Ga0207678_10081335 3300026067 Bacteria 2773
506 Ga0207678_10280944 3300026067 Bacteria 1429
507 Ga0207678_10365984 3300026067 Bacteria 1245
508 Ga0207708_10007756 3300026075 Bacteria 7948
509 Ga0207708_10023543 3300026075 Bacteria 4657
510 Ga0207702_10103209 3300026078 Bacteria 2521
511 Ga0207702_10169536 3300026078 Bacteria 2000
512 Ga0207702_10717734 3300026078 Bacteria 985
513 Ga0207641_10054555 3300026088 Bacteria 3392
514 Ga0207648_10002280 3300026089 Bacteria 20731
515 Ga0207648_10026183 3300026089 Bacteria 5185
516 Ga0207648_10065063 3300026089 Bacteria 3179
517 Ga0207648_10329420 3300026089 Bacteria 1373
518 Ga0207676_10016301 3300026095 Bacteria 5380
519 Ga0207676_10029559 3300026095 Bacteria 4105
520 Ga0207676_10178285 3300026095 Bacteria 1858
521 Ga0207674_10013923 3300026116 Bacteria 8898
522 Ga0207674_10041497 3300026116 Bacteria 4759
523 Ga0207674_10049525 3300026116 Bacteria 4296
524 Ga0207674_10064950 3300026116 Bacteria 3680
525 Ga0207674_10178378 3300026116 Bacteria 2076
526 Ga0207674_10369253 3300026116 Bacteria 1387
527 Ga0207675_100011398 3300026118 Bacteria 8319
528 Ga0207675_100061290 3300026118 Bacteria 3512
529 Ga0207675_100150180 3300026118 Bacteria 2217
530 Ga0207683_10037573 3300026121 Bacteria 4217
531 Ga0207683_10037902 3300026121 Bacteria 4199
532 Ga0207683_10097515 3300026121 Bacteria 2622
533 Ga0207683_10227005 3300026121 Bacteria 1702
534 Ga0207683_10285353 3300026121 Bacteria 1509
535 Ga0207698_10077666 3300026142 Bacteria 2663
536 Ga0207698_10368561 3300026142 Bacteria 1362
537 Ga0207428_10000108 3300027907 Bacteria 115378
538 Ga0207428_10007111 3300027907 Bacteria 10243
539 Ga0207428_10022197 3300027907 Bacteria 5359
540 Ga0207428_10028411 3300027907 Bacteria 4647
541 Ga0207428_10289215 3300027907 Bacteria 1215
542 Ga0268266_10022553 3300028379 Bacteria 5363
543 Ga0268266_10041268 3300028379 Bacteria 3937
544 Ga0268266_10363091 3300028379 Bacteria 1363
545 Ga0268266_10481416 3300028379 Bacteria 1183
546 Ga0268266_10577510 3300028379 Bacteria 1079
547 Ga0268265_10202773 3300028380 Bacteria 1722
548 Ga0268264_10096268 3300028381 Bacteria 2563
549 Ga0268264_10192627 3300028381 Bacteria 1859
550 Ga0268264_11036588 3300028381 Bacteria 828
551 Ga0265326_10010724 3300028558 Bacteria 2716
552 Ga0265319_1021414 3300028563 Bacteria 2374
553 Ga0265318_10037910 3300028577 Bacteria 1844
554 Ga0265338_10030316 3300028800 Bacteria 5331
555 Ga0265338_10035415 3300028800 Bacteria 4799
556 Ga0265338_10126744 3300028800 Bacteria 2024
557 Ga0265328_10024366 3300031239 Bacteria 2287
558 Ga0265320_10052353 3300031240 Bacteria 1977
559 Ga0265325_10010118 3300031241 Bacteria 5477
560 Ga0265329_10023878 3300031242 Bacteria 2032
561 Ga0265339_10016391 3300031249 Bacteria 4418
562 Ga0265331_10052052 3300031250 Bacteria 1957
563 Ga0265327_10030796 3300031251 Bacteria 3026
564 Ga0265327_10033181 3300031251 Bacteria 2880
565 Ga0265327_10041907 3300031251 Bacteria 2462
566 Ga0265316_10072474 3300031344 Bacteria 2653
567 Ga0307408_100194268 3300031548 Bacteria 1638
568 Ga0307408_100346381 3300031548 Bacteria 1259
569 Ga0265313_10015452 3300031595 Bacteria 4441
570 Ga0265313_10024998 3300031595 Bacteria 3176
571 Ga0265314_10008957 3300031711 Bacteria 8517
572 Ga0265314_10045410 3300031711 Bacteria 3107
573 Ga0265342_10025929 3300031712 Bacteria 3679
574 Ga0307410_10296863 3300031852 Bacteria 1273
575 Ga0307407_10260407 3300031903 Bacteria 1193
576 Ga0307412_10165365 3300031911 Bacteria 1649
577 Ga0307412_10171630 3300031911 Bacteria 1622
578 Ga0307409_100035699 3300031995 Bacteria 3645
579 Ga0307416_100332500 3300032002 Bacteria 1528
580 Ga0307416_100359604 3300032002 Bacteria 1477
581 Ga0307414_10244955 3300032004 Bacteria 1486
582 Ga0307415_100266713 3300032126 Bacteria 1400
583 Ga0373938_0012473 3300034957 Bacteria 1595
584 Ga0373926_0026260 3300035083 Bacteria 2036
585 Ga0373926_0037205 3300035083 Bacteria 1731
586 Ga0373934_0032538 3300035086 Unclassified 2046
587 Ga0373944_0007465 3300035089 Bacteria 2933
588 Ga0373944_0025593 3300035089 Bacteria 1738
589 Ga0373951_0009786 3300035091 Bacteria 2156
590 Ga0373952_0010306 3300035092 Bacteria 1804
591 Ga0373936_0015074 3300035113 Bacteria 2960
592 Ga0373939_0235164 3300035114 Bacteria 707
593 Ga0373941_0112181 3300035115 Bacteria 962
594 Ga0373945_0002007 3300035116 Bacteria 6328
595 Ga0373956_0076238 3300035119 Unclassified 1534
596 Ga0373960_0012535 3300035121 Bacteria 2109
597 Ga0373943_0000968 3300035170 Bacteria 12761
598 Ga0373943_0005277 3300035170 Bacteria 5814
599 Ga0373943_0009624 3300035170 Bacteria 4330
600 Ga0373943_0026802 3300035170 Bacteria 2703
601 Ga0373946_0000950 3300035171 Bacteria 9916
602 Ga0373946_0030674 3300035171 Bacteria 2148
603 Ga0373946_0084228 3300035171 Bacteria 1398
604 Ga0373961_0014308 3300035241 Bacteria 2014
605 Ga0373931_0147565 3300035691 Bacteria 1368
606 Ga0373935_0035080 3300035692 Bacteria 3130
607 Ga0373935_0046128 3300035692 Bacteria 2752
608 Ga0373935_0079007 3300035692 Bacteria 2135
609 Ga0373935_0184417 3300035692 Bacteria 1434
610 Ga0373927_0211566 3300035695 Bacteria 1274
611 Ga0373947_0001964 3300035725 Bacteria 12587
612 Ga0373947_0010758 3300035725 Bacteria 5250
613 Ga0373947_0037586 3300035725 Bacteria 2873
614 Ga0373947_0056406 3300035725 Bacteria 2374
615 Ga0373947_0123861 3300035725 Bacteria 1644
616 Ga0373947_0280159 3300035725 Bacteria 1108
617 Ga0373937_0222149 3300036401 Bacteria 1778
618 Ga0373925_0037531 3300037068 Bacteria 3577
619 Ga0373925_0038325 3300037068 Bacteria 3543
620 Ga0373925_0082725 3300037068 Bacteria 2444
621 Ga0373925_0191575 3300037068 Bacteria 1622
622 Ga0395899_0039928 3300037312 Bacteria 3511
623 Ga0395899_0209533 3300037312 Bacteria 1355
624 Ga0395900_0001643 3300037418 Bacteria 26244
625 Ga0395900_0005467 3300037418 Bacteria 13302
626 Ga0395900_0039238 3300037418 Bacteria 4879
627 Ga0395900_0078466 3300037418 Bacteria 3393
628 Ga0395900_0146606 3300037418 Bacteria 2413
629 Ga0395900_0236231 3300037418 Bacteria 1836
630 Ga0395900_0243407 3300037418 Bacteria 1803
631 Ga0395900_0263495 3300037418 Bacteria 1720
632 Ga0395900_0361778 3300037418 Bacteria 1422
633 Ga0395898_0013457 3300037466 Bacteria 8425
634 Ga0395898_0013908 3300037466 Bacteria 8270
635 Ga0395898_0039522 3300037466 Bacteria 4670
636 Ga0395898_0041036 3300037466 Bacteria 4573
637 Ga0395898_0064476 3300037466 Bacteria 3553
638 Ga0395898_0076771 3300037466 Bacteria 3225
639 Ga0395898_0310855 3300037466 Bacteria 1503
640 Ga0395898_0506189 3300037466 Bacteria 1148
641 Ga0395905_0003232 3300037471 Bacteria 17522
642 Ga0395905_0030084 3300037471 Bacteria 5118
643 Ga0395905_0041418 3300037471 Bacteria 4322
644 Ga0395905_0130549 3300037471 Bacteria 2363
645 Ga0395905_0367028 3300037471 Unclassified 1333
646 Ga0395905_0711909 3300037471 Bacteria 906
647 Ga0395901_0003358 3300038443 Bacteria 16123
648 Ga0395901_0009655 3300038443 Bacteria 9787
649 Ga0395901_0010984 3300038443 Bacteria 9176
650 Ga0395901_0018859 3300038443 Bacteria 7052
651 Ga0395901_0020099 3300038443 Bacteria 6834
652 Ga0395901_0064283 3300038443 Bacteria 3819
653 Ga0395901_0082007 3300038443 Bacteria 3369
654 Ga0395901_0084454 3300038443 Bacteria 3318
655 Ga0395901_0178005 3300038443 Bacteria 2230
656 Ga0395901_0270350 3300038443 Bacteria 1768
657 Ga0395901_0293067 3300038443 Bacteria 1688
658 Ga0395901_0872780 3300038443 Bacteria 883
659 Ga0395901_1011125 3300038443 Bacteria 807
660 Ga0436365_0347461 3300039437 Bacteria 4435
661 Ga0436365_1709962 3300039437 Bacteria 4870
662 Ga0436363_0108127 3300039450 Bacteria 4441
663 Ga0436362_0004195 3300039453 Bacteria 1583
664 Ga0436362_0693060 3300039453 Bacteria 2856
665 Ga0439436_0033515 3300041404 Bacteria 1487
666 Ga0439439_0005760 3300041406 Bacteria 2843
667 Ga0439453_0007744 3300041408 Unclassified 1712
668 Ga0439461_0011302 3300041410 Bacteria 1654
669 Ga0439461_0011825 3300041410 Bacteria 1625
670 Ga0439466_0026205 3300041411 Bacteria 2029
671 Ga0451789_0814888 3300041443 Bacteria 2852
672 Ga0451802_0785545 3300041460 Bacteria 1329
673 Ga0451804_0467915 3300041463 Bacteria 1517
674 Ga0451839_0279640 3300041496 Bacteria 3481
675 Ga0451845_0652193 3300041501 Bacteria 1631
676 Ga0451849_0359582 3300041505 Bacteria 3925
677 Ga0451851_1288862 3300041507 Bacteria 1801
678 Ga0451853_0484657 3300041512 Bacteria 2603
679 Ga0439431_0012423 3300041997 Bacteria 1957
680 Ga0439433_0000829 3300041999 Bacteria 6105
681 Ga0439437_002296 3300042000 Bacteria 2044
682 Ga0439442_027457 3300042002 Bacteria 1186
683 Ga0439432_037000 3300042006 Bacteria 1560
684 Ga0439449_0004389 3300042007 Bacteria 5442
685 Ga0439449_0121727 3300042007 Bacteria 969
686 Ga0439451_003997 3300042009 Bacteria 2998
687 Ga0439454_008517 3300042011 Bacteria 1312
688 Ga0439457_028472 3300042014 Bacteria 1237
689 Ga0439462_0003956 3300042015 Bacteria 3588
690 Ga0450920_001378 3300042122 Bacteria 4013
691 Ga0450920_005942 3300042122 Bacteria 2182
692 Ga0450920_021838 3300042122 Bacteria 1238
693 Ga0450895_004009 3300042132 Bacteria 1152
694 Ga0450906_003482 3300042145 Bacteria 3382
695 Ga0450907_011561 3300042146 Bacteria 1466
696 Ga0450907_017666 3300042146 Bacteria 1190
697 Ga0439446_0000082 3300042156 Bacteria 15673
698 Ga0439446_0001079 3300042156 Bacteria 6017
699 Ga0439435_0055827 3300042436 Bacteria 1140
700 Ga0439460_0042868 3300042461 Bacteria 1335
701 Ga0466969_0040665 3300044656 Bacteria 2329
702 Ga0466972_0078918 3300044658 Bacteria 1568
703 Ga0466965_0298431 3300044683 Bacteria 874
704 Ga0466966_0030501 3300044684 Bacteria 3501
705 Ga0466966_0056180 3300044684 Bacteria 2491
706 Ga0466966_0071103 3300044684 Bacteria 2180
707 Ga0466966_0197436 3300044684 Bacteria 1218
708 Ga0466961_0003168 3300044693 Bacteria 10245
709 Ga0466961_0036972 3300044693 Bacteria 3133
710 Ga0466961_0093418 3300044693 Bacteria 1898
711 Ga0466963_0001137 3300044694 Bacteria 13906
712 Ga0466963_0001659 3300044694 Bacteria 12142
713 Ga0466963_0002621 3300044694 Bacteria 10100
714 Ga0466963_0018971 3300044694 Bacteria 4306
715 Ga0466963_0028319 3300044694 Bacteria 3596
716 Ga0466963_0037365 3300044694 Bacteria 3170
717 Ga0466963_0045465 3300044694 Bacteria 2892
718 Ga0466963_0630872 3300044694 Bacteria 756
719 Ga0466964_0003114 3300044706 Bacteria 6030
720 Ga0466964_0008335 3300044706 Bacteria 3889
721 Ga0466964_0015865 3300044706 Bacteria 2869
722 Ga0466964_0043269 3300044706 Bacteria 1826
723 Ga0466964_0081548 3300044706 Bacteria 1389
724 Ga0466964_0092323 3300044706 Bacteria 1320
725 Ga0466964_0098955 3300044706 Bacteria 1282
726 Ga0466971_0000469 3300044719 Bacteria 15840
727 Ga0466971_0011900 3300044719 Bacteria 3812
728 Ga0466971_0040769 3300044719 Bacteria 2085
729 Ga0466968_0017299 3300044735 Bacteria 2880
730 Ga0466968_0044664 3300044735 Bacteria 1878
731 Ga0466968_0102435 3300044735 Bacteria 1279
732 Ga0466970_0008011 3300044765 Bacteria 5305
733 Ga0466970_0292598 3300044765 Bacteria 917
734 Ga0466957_0004662 3300044842 Bacteria 7662
735 Ga0466957_0020684 3300044842 Bacteria 3873
736 Ga0466957_0597860 3300044842 Bacteria 772
737 Ga0466960_0003090 3300044901 Bacteria 6372
738 Ga0466960_0040112 3300044901 Bacteria 2212
739 Ga0466959_0016687 3300045049 Bacteria 5371
740 Ga0466959_0021004 3300045049 Bacteria 4814
741 Ga0466959_0074413 3300045049 Bacteria 2456
742 Ga0466959_0082890 3300045049 Unclassified 2310
743 Ga0466959_0137323 3300045049 Bacteria 1730
744 Ga0466959_0345112 3300045049 Bacteria 1015
745 Ga0466958_0001601 3300045836 Bacteria 10877
746 Ga0466958_0020678 3300045836 Bacteria 3840
747 Ga0466958_0069479 3300045836 Bacteria 2153
748 Ga0466967_0006178 3300045976 Bacteria 8438
749 Ga0466967_0012646 3300045976 Bacteria 6472
750 Ga0466967_0014726 3300045976 Bacteria 6107
751 Ga0466967_0018416 3300045976 Bacteria 5579
752 Ga0466967_0019241 3300045976 Bacteria 5486
753 Ga0466967_0022820 3300045976 Bacteria 5116
754 Ga0466967_0029693 3300045976 Bacteria 4579
755 Ga0466967_0032572 3300045976 Bacteria 4402
756 Ga0466967_0040809 3300045976 Bacteria 3997
757 Ga0466967_0042790 3300045976 Bacteria 3916
758 Ga0466967_0042853 3300045976 Bacteria 3914
759 Ga0466967_0044056 3300045976 Bacteria 3868
760 Ga0466967_0047797 3300045976 Bacteria 3732
761 Ga0466967_0052120 3300045976 Bacteria 3589
762 Ga0466967_0064391 3300045976 Bacteria 3260
763 Ga0466967_0172629 3300045976 Bacteria 2035
764 Ga0466967_0222782 3300045976 Unclassified 1793
765 Ga0466967_0237212 3300045976 Bacteria 1738
766 Ga0466967_0310406 3300045976 Bacteria 1519
767 Ga0466967_0315663 3300045976 Bacteria 1506
768 Ga0466967_0335753 3300045976 Bacteria 1460
769 Ga0466967_0450899 3300045976 Bacteria 1257
770 Ga0466967_0896138 3300045976 Bacteria 882
771 Ga0495592_0027463 3300046454 Bacteria 4316
772 Ga0495592_0056012 3300046454 Bacteria 2915
773 Ga0495592_0199531 3300046454 Bacteria 1351
774 Ga0495603_0000315 3300046455 Bacteria 25931
775 Ga0495629_0001172 3300046459 Bacteria 20684
776 Ga0495629_0072043 3300046459 Bacteria 2412
777 Ga0495629_0123992 3300046459 Unclassified 1800
778 Ga0495641_0001392 3300046461 Bacteria 20624
779 Ga0495641_0009942 3300046461 Bacteria 5590
780 Ga0495641_0020369 3300046461 Bacteria 3364
781 Ga0495641_0028381 3300046461 Bacteria 2709
782 Ga0495641_0039218 3300046461 Bacteria 2210
783 Ga0495641_0124567 3300046461 Bacteria 1150
784 Ga0495651_0119261 3300046462 Unclassified 1940
785 Ga0495653_0088926 3300046463 Bacteria 2264
786 Ga0495653_0089196 3300046463 Bacteria 2260
787 Ga0495653_0157782 3300046463 Unclassified 1578
788 Ga0495580_0077909 3300046472 Bacteria 2312
789 Ga0495580_0272061 3300046472 Bacteria 1157
790 Ga0495582_0004758 3300046473 Bacteria 7633
791 Ga0495582_0014796 3300046473 Bacteria 4286
792 Ga0495605_0117263 3300046474 Bacteria 1210
793 Ga0495639_0160703 3300046475 Bacteria 1087
794 Ga0495662_0002670 3300046476 Bacteria 9011
795 Ga0495662_0038842 3300046476 Bacteria 2300
796 Ga0495664_0196550 3300046477 Bacteria 1222
797 Ga0495664_0234035 3300046477 Bacteria 1111
798 Ga0495594_0008752 3300046499 Bacteria 5217
799 Ga0495596_0049541 3300046500 Bacteria 1647
800 Ga0495608_0003235 3300046511 Bacteria 11652
801 Ga0495608_0046549 3300046511 Bacteria 2886
802 Ga0495608_0125067 3300046511 Unclassified 1647
803 Ga0495618_0161813 3300046514 Bacteria 1427
804 Ga0495618_0419350 3300046514 Bacteria 816
805 Ga0495620_0132920 3300046515 Bacteria 976
806 Ga0495628_0014360 3300046516 Bacteria 6640
807 Ga0495628_0061184 3300046516 Unclassified 2953
808 Ga0495630_0010760 3300046517 Bacteria 6607
809 Ga0495630_0044810 3300046517 Bacteria 3306
810 Ga0495630_0062675 3300046517 Bacteria 2793
811 Ga0495630_0104481 3300046517 Bacteria 2144
812 Ga0495630_0158058 3300046517 Bacteria 1725
813 Ga0495630_0362948 3300046517 Unclassified 1109
814 Ga0495631_0123808 3300046518 Bacteria 1112
815 Ga0495666_0026315 3300046526 Bacteria 2869
816 Ga0495652_0031157 3300046529 Bacteria 4672
817 Ga0495652_0093133 3300046529 Bacteria 2461
818 Ga0495652_0133909 3300046529 Bacteria 1958
819 Ga0495652_0171428 3300046529 Unclassified 1674
820 Ga0495665_0000572 3300046531 Bacteria 18699
821 Ga0495640_0004895 3300046533 Bacteria 10659
822 Ga0495587_0034460 3300046536 Bacteria 3053
823 Ga0495587_0092126 3300046536 Bacteria 1750
824 Ga0495587_0136055 3300046536 Bacteria 1404
825 Ga0495587_0219547 3300046536 Bacteria 1072
826 Ga0495598_0164334 3300046537 Bacteria 783
827 Ga0495645_0215829 3300046543 Bacteria 1293
828 Ga0495622_0027533 3300046557 Bacteria 2653
829 Ga0495667_0023106 3300046559 Bacteria 4190
830 Ga0495667_0057285 3300046559 Unclassified 2561
831 Ga0495667_0080279 3300046559 Bacteria 2120
832 Ga0495667_0162027 3300046559 Unclassified 1439
833 Ga0495656_0058447 3300046615 Bacteria 1674
834 Ga0495668_0285209 3300046616 Bacteria 905
835 Ga0495634_0007352 3300046642 Bacteria 8288
836 Ga0495634_0120903 3300046642 Bacteria 1677
837 Ga0495635_0017186 3300046663 Bacteria 5051
838 Ga0495635_0086325 3300046663 Unclassified 2147
839 Ga0495657_0049866 3300046675 Unclassified 2817
840 Ga0495657_0094425 3300046675 Bacteria 1913
841 Ga0495657_0133657 3300046675 Bacteria 1552
842 Ga0495599_0065381 3300046678 Unclassified 2272
843 Ga0495599_0070330 3300046678 Bacteria 2184
844 Ga0495599_0129731 3300046678 Bacteria 1566
845 Ga0495599_0198107 3300046678 Bacteria 1234
846 Ga0495623_0075178 3300046679 Unclassified 2098
847 Ga0495623_0075328 3300046679 Bacteria 2096
848 Ga0495623_0130720 3300046679 Bacteria 1504
849 Ga0495623_0349677 3300046679 Bacteria 805
850 Ga0495646_0073701 3300046680 Unclassified 2005
851 Ga0495658_0002818 3300046683 Bacteria 8732
852 Ga0495658_0004955 3300046683 Bacteria 6534
853 Ga0495658_0077825 3300046683 Bacteria 1940
854 Ga0495658_0233716 3300046683 Bacteria 1153
855 Ga0495658_0414159 3300046683 Bacteria 860
856 Ga0495613_0002807 3300046689 Bacteria 13069
857 Ga0495613_0012232 3300046689 Bacteria 6379
858 Ga0495613_0122236 3300046689 Unclassified 1869
859 Ga0495613_0244944 3300046689 Bacteria 1252
860 Ga0495624_0003083 3300046690 Bacteria 12472
861 Ga0495624_0178912 3300046690 Bacteria 1293
862 Ga0495670_0294500 3300046691 Unclassified 869
863 Ga0495600_0172365 3300046809 Unclassified 1396
864 Ga0495581_0001629 3300047315 Bacteria 12517
865 Ga0495581_0069125 3300047315 Bacteria 2042
866 Ga0495581_0202315 3300047315 Bacteria 1162
867 Ga0495604_0096905 3300047317 Bacteria 2176
868 Ga0495604_0188325 3300047317 Unclassified 1439
869 Ga0495674_0000604 3300047319 Bacteria 33665
870 Ga0495674_0014819 3300047319 Bacteria 7294
871 Ga0495674_0071641 3300047319 Bacteria 2990
872 Ga0495674_0099515 3300047319 Bacteria 2475
873 Ga0495674_0128421 3300047319 Bacteria 2137
874 Ga0495674_0193304 3300047319 Bacteria 1690
875 Ga0495676_0005988 3300047321 Bacteria 11171
876 Ga0495676_0033632 3300047321 Bacteria 4314
877 Ga0495676_0140388 3300047321 Bacteria 1732
878 Ga0495676_0465998 3300047321 Bacteria 832
879 Ga0495680_0001294 3300047322 Bacteria 27286
880 Ga0495680_0045915 3300047322 Bacteria 3447
881 Ga0495680_0092680 3300047322 Bacteria 2262
882 Ga0495675_0053040 3300047444 Unclassified 2574
883 Ga0495675_0236048 3300047444 Bacteria 1102
884 Ga0495677_0171790 3300047445 Bacteria 839
885 Ga0495684_0003459 3300047471 Bacteria 12362
886 Ga0495684_0005729 3300047471 Bacteria 9663
887 Ga0495684_0014928 3300047471 Bacteria 5983
888 Ga0495684_0113633 3300047471 Unclassified 2042
889 Ga0495602_0089556 3300048088 Unclassified 2558
890 Ga0495602_0093372 3300048088 Bacteria 2490
891 Ga0495602_0237503 3300048088 Bacteria 1365
892 Ga0495602_0272659 3300048088 Bacteria 1250
893 Ga0495614_0053543 3300048089 Bacteria 1730
894 Ga0496100_0006166 3300048903 Bacteria 6521
895 Ga0496100_0045937 3300048903 Bacteria 2805
896 Ga0496100_0161348 3300048903 Bacteria 1607
897 Ga0496100_0251467 3300048903 Bacteria 1307
898 Ga0496100_0272999 3300048903 Bacteria 1258
899 Ga0496100_0343499 3300048903 Bacteria 1126
900 Ga0496101_0001648 3300048904 Bacteria 13382
901 Ga0496101_0002848 3300048904 Bacteria 10634
902 Ga0496101_0009732 3300048904 Bacteria 6327
903 Ga0496101_0013967 3300048904 Bacteria 5393
904 Ga0496101_0060791 3300048904 Bacteria 2742
905 Ga0496101_0081773 3300048904 Bacteria 2390
906 Ga0496101_0201592 3300048904 Bacteria 1538
907 Ga0496102_0013692 3300048905 Bacteria 7032
908 Ga0496102_0074671 3300048905 Bacteria 3117
909 Ga0496102_0145755 3300048905 Bacteria 2222
910 Ga0496102_0209630 3300048905 Bacteria 1837
911 Ga0496102_0396914 3300048905 Bacteria 1297
912 Ga0496103_0003789 3300048906 Bacteria 9197
913 Ga0496103_0015518 3300048906 Bacteria 4535
914 Ga0496103_0057042 3300048906 Bacteria 2425
915 Ga0496103_0149993 3300048906 Bacteria 1493
916 Ga0496104_0000188 3300048907 Bacteria 55678
917 Ga0496104_0003035 3300048907 Bacteria 14462
918 Ga0496104_0005264 3300048907 Bacteria 11308
919 Ga0496104_0014260 3300048907 Bacteria 7175
920 Ga0496104_0018343 3300048907 Bacteria 6385
921 Ga0496104_0071653 3300048907 Bacteria 3295
922 Ga0496104_0084751 3300048907 Bacteria 3024
923 Ga0496104_0106996 3300048907 Bacteria 2680
924 Ga0496104_0142746 3300048907 Bacteria 2300
925 Ga0496104_0459205 3300048907 Bacteria 1185
926 Ga0496105_0000413 3300048908 Bacteria 28035
927 Ga0496105_0005539 3300048908 Bacteria 9585
928 Ga0496105_0020137 3300048908 Bacteria 5387
929 Ga0496105_0029849 3300048908 Bacteria 4464
930 Ga0496105_0042692 3300048908 Bacteria 3739
931 Ga0496105_0055302 3300048908 Bacteria 3277
932 Ga0496105_0065099 3300048908 Bacteria 3009
933 Ga0496105_0081376 3300048908 Bacteria 2675
934 Ga0496105_0365581 3300048908 Bacteria 1150
935 Ga0496105_0423328 3300048908 Bacteria 1054
936 Ga0496105_0477182 3300048908 Bacteria 982
937 Ga0496106_0000380 3300048909 Bacteria 31592
938 Ga0496106_0020230 3300048909 Bacteria 4938
939 Ga0496106_0109377 3300048909 Bacteria 2151
940 Ga0496106_0113327 3300048909 Bacteria 2113
941 Ga0496106_0173779 3300048909 Bacteria 1708
942 Ga0496106_0206411 3300048909 Unclassified 1564
943 Ga0496106_0356618 3300048909 Bacteria 1175
944 Ga0496106_0801938 3300048909 Bacteria 747
945 Ga0496107_0002348 3300048910 Bacteria 12224
946 Ga0496107_0018083 3300048910 Bacteria 4958
947 Ga0496107_0023614 3300048910 Bacteria 4348
948 Ga0496107_0034518 3300048910 Bacteria 3623
949 Ga0496107_0058994 3300048910 Bacteria 2776
950 Ga0496107_0061268 3300048910 Bacteria 2724
951 Ga0496107_0328701 3300048910 Bacteria 1138
952 Ga0496107_0543176 3300048910 Bacteria 861
953 Ga0496108_0002556 3300048911 Bacteria 14570
954 Ga0496108_0003631 3300048911 Bacteria 12368
955 Ga0496108_0009595 3300048911 Bacteria 7844
956 Ga0496108_0014113 3300048911 Bacteria 6516
957 Ga0496108_0014117 3300048911 Bacteria 6515
958 Ga0496108_0042016 3300048911 Bacteria 3815
959 Ga0496108_0121679 3300048911 Bacteria 2239
960 Ga0496108_0235031 3300048911 Bacteria 1594
961 Ga0496108_0407882 3300048911 Bacteria 1187
962 Ga0496108_0844752 3300048911 Bacteria 788
963 Ga0496109_0001947 3300048912 Bacteria 17152
964 Ga0496109_0002346 3300048912 Bacteria 15791
965 Ga0496109_0020416 3300048912 Bacteria 5851
966 Ga0496109_0024899 3300048912 Bacteria 5327
967 Ga0496109_0029868 3300048912 Bacteria 4884
968 Ga0496109_0059690 3300048912 Bacteria 3485
969 Ga0496109_0148976 3300048912 Bacteria 2190
970 Ga0496109_0359621 3300048912 Bacteria 1375
971 Ga0496109_0443251 3300048912 Bacteria 1227
972 Ga0496109_0533740 3300048912 Bacteria 1107
973 Ga0496109_0645325 3300048912 Bacteria 995
974 Ga0496110_0005633 3300048913 Bacteria 9826
975 Ga0496110_0011527 3300048913 Bacteria 7241
976 Ga0496110_0011939 3300048913 Bacteria 7136
977 Ga0496110_0038121 3300048913 Bacteria 4180
978 Ga0496110_0041928 3300048913 Bacteria 3995
979 Ga0496110_0090392 3300048913 Bacteria 2737
980 Ga0496110_0102504 3300048913 Bacteria 2567
981 Ga0496110_0115522 3300048913 Unclassified 2416
982 Ga0496110_0120683 3300048913 Bacteria 2361
983 Ga0496110_0283619 3300048913 Bacteria 1508
984 Ga0496110_0352549 3300048913 Bacteria 1340
985 Ga0496110_0752129 3300048913 Bacteria 878
986 Ga0496111_0000288 3300048914 Bacteria 24472
987 Ga0496111_0001194 3300048914 Bacteria 14492
988 Ga0496111_0003824 3300048914 Bacteria 9396
989 Ga0496111_0035054 3300048914 Bacteria 3585
990 Ga0496111_0059001 3300048914 Bacteria 2779
991 Ga0496111_0182958 3300048914 Bacteria 1558
992 Ga0496112_0000307 3300048915 Bacteria 31590
993 Ga0496112_0002174 3300048915 Bacteria 15585
994 Ga0496112_0014425 3300048915 Bacteria 7330
995 Ga0496112_0133008 3300048915 Bacteria 2458
996 Ga0496112_0147006 3300048915 Bacteria 2325
997 Ga0496112_0171753 3300048915 Bacteria 2133
998 Ga0496112_0180594 3300048915 Bacteria 2074
999 Ga0496112_0355812 3300048915 Bacteria 1406
1000 Ga0496112_0589703 3300048915 Bacteria 1044
1001 Ga0496113_0000192 3300048916 Bacteria 27861
1002 Ga0496113_0026625 3300048916 Bacteria 4137
1003 Ga0496113_0028359 3300048916 Bacteria 4026
1004 Ga0496113_0540332 3300048916 Bacteria 935
1005 Ga0496114_0001026 3300048917 Bacteria 20985
1006 Ga0496114_0003757 3300048917 Bacteria 11703
1007 Ga0496114_0004276 3300048917 Bacteria 11055
1008 Ga0496114_0008425 3300048917 Bacteria 8165
1009 Ga0496114_0013129 3300048917 Bacteria 6637
1010 Ga0496114_0194178 3300048917 Bacteria 1777
1011 Ga0496114_0211269 3300048917 Bacteria 1702
1012 Ga0496114_0389575 3300048917 Bacteria 1234
1013 Ga0496114_0400800 3300048917 Bacteria 1215
1014 Ga0496114_0907380 3300048917 Bacteria 762
1015 Ga0496115_0000307 3300048918 Bacteria 41675
1016 Ga0496115_0002915 3300048918 Bacteria 12347
1017 Ga0496115_0037455 3300048918 Bacteria 3843
1018 Ga0496115_0079838 3300048918 Bacteria 2663
1019 Ga0496115_0082496 3300048918 Bacteria 2619
1020 Ga0496115_0398865 3300048918 Bacteria 1116
1021 Ga0496115_0402829 3300048918 Bacteria 1110
1022 Ga0501031_0004061 3300049568 Bacteria 9440
1023 Ga0501031_0007219 3300049568 Bacteria 7250
1024 Ga0501031_0023359 3300049568 Bacteria 4032
1025 Ga0501031_0089642 3300049568 Bacteria 2006
1026 Ga0501031_0094238 3300049568 Bacteria 1954
1027 Ga0501031_0131442 3300049568 Bacteria 1635
1028 Ga0501031_0252695 3300049568 Bacteria 1146
1029 Ga0501032_0001182 3300049569 Bacteria 20907
1030 Ga0501032_0006448 3300049569 Bacteria 8631
1031 Ga0501032_0032342 3300049569 Bacteria 3585
1032 Ga0501032_0110688 3300049569 Bacteria 1817
1033 Ga0501033_0001160 3300049570 Bacteria 23837
1034 Ga0501033_0013301 3300049570 Bacteria 6270
1035 Ga0501033_0130903 3300049570 Bacteria 1817
1036 Ga0501034_0028186 3300049571 Bacteria 5714
1037 Ga0501034_0032710 3300049571 Bacteria 5282
1038 Ga0501034_0109772 3300049571 Bacteria 2750
1039 Ga0501034_0257213 3300049571 Bacteria 1689
1040 Ga0501034_0471040 3300049571 Bacteria 1172
1041 Ga0501034_0714841 3300049571 Bacteria 899
1042 Ga0501034_0728698 3300049571 Bacteria 888
1043 Ga0501036_0000750 3300049572 Bacteria 24049
1044 Ga0501036_0000982 3300049572 Bacteria 21538
1045 Ga0501036_0004190 3300049572 Bacteria 11619
1046 Ga0501036_0004891 3300049572 Bacteria 10821
1047 Ga0501036_0006322 3300049572 Bacteria 9611
1048 Ga0501036_0022582 3300049572 Bacteria 5293
1049 Ga0501036_0023919 3300049572 Bacteria 5149
1050 Ga0501036_0036586 3300049572 Bacteria 4154
1051 Ga0501036_0041161 3300049572 Bacteria 3910
1052 Ga0501036_0044479 3300049572 Bacteria 3761
1053 Ga0501036_0106066 3300049572 Bacteria 2376
1054 Ga0501036_0106315 3300049572 Bacteria 2373
1055 Ga0501036_0133474 3300049572 Bacteria 2095
1056 Ga0501037_0009265 3300049573 Bacteria 7217
1057 Ga0501037_0019670 3300049573 Bacteria 4981
1058 Ga0501037_0022874 3300049573 Bacteria 4622
1059 Ga0501037_0026977 3300049573 Bacteria 4243
1060 Ga0501037_0065311 3300049573 Bacteria 2651
1061 Ga0501037_0224500 3300049573 Bacteria 1320
1062 Ga0501037_0547932 3300049573 Bacteria 781
1063 Ga0501038_0000446 3300049574 Bacteria 36005
1064 Ga0501038_0001935 3300049574 Bacteria 19107
1065 Ga0501038_0002315 3300049574 Bacteria 17712
1066 Ga0501038_0007078 3300049574 Bacteria 10361
1067 Ga0501038_0033734 3300049574 Bacteria 4506
1068 Ga0501038_0051573 3300049574 Bacteria 3549
1069 Ga0501038_0063560 3300049574 Bacteria 3150
1070 Ga0501038_0076331 3300049574 Bacteria 2830
1071 Ga0501038_0081299 3300049574 Bacteria 2730
1072 Ga0501038_0123872 3300049574 Bacteria 2129
1073 Ga0501038_0216183 3300049574 Bacteria 1531
1074 Ga0501039_0000317 3300049575 Bacteria 34072
1075 Ga0501039_0000364 3300049575 Bacteria 32385
1076 Ga0501039_0006406 3300049575 Bacteria 8943
1077 Ga0501039_0007361 3300049575 Bacteria 8391
1078 Ga0501039_0008152 3300049575 Bacteria 7982
1079 Ga0501039_0013728 3300049575 Bacteria 6196
1080 Ga0501039_0023521 3300049575 Bacteria 4728
1081 Ga0501039_0048603 3300049575 Bacteria 3279
1082 Ga0501039_0049631 3300049575 Bacteria 3244
1083 Ga0501039_0071027 3300049575 Bacteria 2704
1084 Ga0501039_0168599 3300049575 Bacteria 1721
1085 Ga0501039_0255567 3300049575 Bacteria 1377
1086 Ga0501039_0426672 3300049575 Bacteria 1041
1087 Ga0501040_0000039 3300049576 Bacteria 59106
1088 Ga0501040_0000524 3300049576 Bacteria 23062
1089 Ga0501040_0001948 3300049576 Bacteria 13284
1090 Ga0501040_0004381 3300049576 Bacteria 9178
1091 Ga0501040_0005940 3300049576 Bacteria 7904
1092 Ga0501040_0007266 3300049576 Bacteria 7177
1093 Ga0501040_0008593 3300049576 Bacteria 6630
1094 Ga0501040_0010689 3300049576 Bacteria 6004
1095 Ga0501040_0010719 3300049576 Bacteria 5994
1096 Ga0501040_0019296 3300049576 Bacteria 4535
1097 Ga0501040_0024024 3300049576 Bacteria 4089
1098 Ga0501040_0028099 3300049576 Bacteria 3790
1099 Ga0501040_0042231 3300049576 Bacteria 3105
1100 Ga0501040_0054781 3300049576 Bacteria 2734
1101 Ga0501040_0063978 3300049576 Bacteria 2532
1102 Ga0501040_0123217 3300049576 Bacteria 1820
1103 Ga0501040_0225990 3300049576 Bacteria 1332
1104 Ga0501040_0287193 3300049576 Bacteria 1175
1105 Ga0501041_0000291 3300049577 Bacteria 24200
1106 Ga0501041_0001974 3300049577 Bacteria 11523
1107 Ga0501041_0002802 3300049577 Bacteria 9958
1108 Ga0501041_0003315 3300049577 Bacteria 9261
1109 Ga0501041_0007727 3300049577 Bacteria 6312
1110 Ga0501041_0009316 3300049577 Bacteria 5782
1111 Ga0501041_0017134 3300049577 Bacteria 4310
1112 Ga0501041_0026890 3300049577 Bacteria 3464
1113 Ga0501041_0030942 3300049577 Bacteria 3230
1114 Ga0501041_0091007 3300049577 Bacteria 1883
1115 Ga0501041_0165773 3300049577 Bacteria 1382
1116 Ga0501041_0245350 3300049577 Bacteria 1125
1117 Ga0501042_0000258 3300049578 Bacteria 25888
1118 Ga0501042_0000894 3300049578 Bacteria 16677
1119 Ga0501042_0002492 3300049578 Bacteria 11325
1120 Ga0501042_0005192 3300049578 Bacteria 8371
1121 Ga0501042_0011682 3300049578 Bacteria 5933
1122 Ga0501042_0014135 3300049578 Bacteria 5443
1123 Ga0501042_0020651 3300049578 Bacteria 4584
1124 Ga0501042_0045673 3300049578 Bacteria 3122
1125 Ga0501042_0060267 3300049578 Bacteria 2710
1126 Ga0501042_0110691 3300049578 Bacteria 1977
1127 Ga0501042_0115515 3300049578 Bacteria 1932
1128 Ga0501042_0124007 3300049578 Bacteria 1860
1129 Ga0501042_0124081 3300049578 Bacteria 1859
1130 Ga0501042_0174112 3300049578 Bacteria 1553
1131 Ga0501042_0178963 3300049578 Bacteria 1530
1132 Ga0501042_0222692 3300049578 Bacteria 1361
1133 Ga0501042_0285936 3300049578 Bacteria 1191
1134 Ga0501042_0295804 3300049578 Bacteria 1169
1135 Ga0501042_0382013 3300049578 Bacteria 1020
1136 Ga0501043_0003344 3300049579 Bacteria 13212
1137 Ga0501043_0006109 3300049579 Bacteria 9675
1138 Ga0501043_0021905 3300049579 Bacteria 5012
1139 Ga0501043_0028534 3300049579 Bacteria 4381
1140 Ga0501043_0100014 3300049579 Bacteria 2279
1141 Ga0501043_0103426 3300049579 Bacteria 2238
1142 Ga0501043_0152466 3300049579 Bacteria 1808
1143 Ga0501043_0239699 3300049579 Bacteria 1399
1144 Ga0501043_0390522 3300049579 Bacteria 1052
1145 Ga0501046_0004525 3300049580 Bacteria 12599
1146 Ga0501046_0006475 3300049580 Bacteria 10358
1147 Ga0501046_0007866 3300049580 Bacteria 9351
1148 Ga0501046_0008764 3300049580 Bacteria 8786
1149 Ga0501046_0012843 3300049580 Bacteria 7122
1150 Ga0501046_0013629 3300049580 Bacteria 6875
1151 Ga0501046_0038072 3300049580 Bacteria 3862
1152 Ga0501046_0049648 3300049580 Bacteria 3318
1153 Ga0501046_0053855 3300049580 Bacteria 3167
1154 Ga0501046_0150718 3300049580 Bacteria 1754
1155 Ga0501046_0167311 3300049580 Bacteria 1651
1156 Ga0501046_0252201 3300049580 Bacteria 1298
1157 Ga0501047_0025018 3300049581 Bacteria 5735
1158 Ga0501047_0046030 3300049581 Bacteria 4217
1159 Ga0501047_0106833 3300049581 Bacteria 2680
1160 Ga0501047_0117116 3300049581 Bacteria 2545
1161 Ga0501048_0001067 3300049582 Bacteria 20543
1162 Ga0501048_0002786 3300049582 Bacteria 13352
1163 Ga0501048_0004532 3300049582 Bacteria 10576
1164 Ga0501048_0005882 3300049582 Bacteria 9337
1165 Ga0501048_0011653 3300049582 Bacteria 6557
1166 Ga0501048_0012860 3300049582 Bacteria 6217
1167 Ga0501048_0018685 3300049582 Bacteria 5095
1168 Ga0501048_0023252 3300049582 Bacteria 4532
1169 Ga0501048_0040337 3300049582 Bacteria 3346
1170 Ga0501048_0054022 3300049582 Bacteria 2854
1171 Ga0501048_0107743 3300049582 Bacteria 1967
1172 Ga0501048_0135138 3300049582 Bacteria 1743
1173 Ga0501048_0435783 3300049582 Bacteria 938
1174 Ga0501067_0001127 3300049583 Bacteria 14464
1175 Ga0501067_0015833 3300049583 Bacteria 4171
1176 Ga0501067_0031503 3300049583 Bacteria 2942
1177 Ga0501067_0075356 3300049583 Bacteria 1869
1178 Ga0501067_0104658 3300049583 Bacteria 1572
1179 Ga0501067_0178915 3300049583 Bacteria 1181
1180 Ga0501068_0001596 3300049584 Bacteria 12071
1181 Ga0501068_0002939 3300049584 Bacteria 9078
1182 Ga0501068_0005404 3300049584 Bacteria 6989
1183 Ga0501068_0011225 3300049584 Bacteria 5051
1184 Ga0501068_0011823 3300049584 Bacteria 4934
1185 Ga0501068_0033330 3300049584 Bacteria 3067
1186 Ga0501068_0038221 3300049584 Bacteria 2875
1187 Ga0501068_0039534 3300049584 Bacteria 2828
1188 Ga0501068_0049046 3300049584 Bacteria 2550
1189 Ga0501068_0049209 3300049584 Bacteria 2545
1190 Ga0501068_0224488 3300049584 Bacteria 1194
1191 Ga0501068_0416139 3300049584 Bacteria 868
1192 Ga0501069_0001903 3300049585 Bacteria 10415
1193 Ga0501069_0003627 3300049585 Bacteria 7947
1194 Ga0501069_0013701 3300049585 Bacteria 4326
1195 Ga0501069_0016558 3300049585 Bacteria 3961
1196 Ga0501069_0020235 3300049585 Bacteria 3604
1197 Ga0501069_0022274 3300049585 Bacteria 3444
1198 Ga0501069_0031400 3300049585 Bacteria 2921
1199 Ga0501069_0081977 3300049585 Bacteria 1817
1200 Ga0501069_0123768 3300049585 Bacteria 1478
1201 Ga0501069_0143064 3300049585 Bacteria 1372
1202 Ga0501069_0174459 3300049585 Bacteria 1241
1203 Ga0501070_0036445 3300049586 Bacteria 4107
1204 Ga0501070_0038771 3300049586 Bacteria 3975
1205 Ga0501070_0044821 3300049586 Bacteria 3679
1206 Ga0501070_0086461 3300049586 Bacteria 2596
1207 Ga0501070_0124503 3300049586 Bacteria 2130
1208 Ga0501070_0269133 3300049586 Bacteria 1392
1209 Ga0501070_0613952 3300049586 Bacteria 866
1210 Ga0501070_0668289 3300049586 Unclassified 824
1211 Ga0501071_0000033 3300049587 Bacteria 45630
1212 Ga0501071_0002214 3300049587 Bacteria 11691
1213 Ga0501071_0002277 3300049587 Bacteria 11562
1214 Ga0501071_0003153 3300049587 Bacteria 10252
1215 Ga0501071_0005857 3300049587 Bacteria 7942
1216 Ga0501071_0026212 3300049587 Bacteria 4089
1217 Ga0501071_0028624 3300049587 Bacteria 3928
1218 Ga0501071_0035549 3300049587 Bacteria 3549
1219 Ga0501071_0050230 3300049587 Bacteria 3004
1220 Ga0501071_0058780 3300049587 Bacteria 2780
1221 Ga0501071_0072992 3300049587 Bacteria 2502
1222 Ga0501071_0130074 3300049587 Bacteria 1869
1223 Ga0501071_0148176 3300049587 Bacteria 1749
1224 Ga0501071_0182424 3300049587 Bacteria 1573
1225 Ga0501072_0000837 3300049588 Bacteria 22627
1226 Ga0501072_0001260 3300049588 Bacteria 18907
1227 Ga0501072_0001414 3300049588 Bacteria 18022
1228 Ga0501072_0001579 3300049588 Bacteria 17015
1229 Ga0501072_0003808 3300049588 Bacteria 11391
1230 Ga0501072_0005441 3300049588 Bacteria 9696
1231 Ga0501072_0007502 3300049588 Bacteria 8278
1232 Ga0501072_0035670 3300049588 Bacteria 3896
1233 Ga0501072_0045353 3300049588 Bacteria 3456
1234 Ga0501072_0051258 3300049588 Bacteria 3250
1235 Ga0501072_0078873 3300049588 Bacteria 2607
1236 Ga0501072_0081590 3300049588 Bacteria 2563
1237 Ga0501072_0085185 3300049588 Bacteria 2506
1238 Ga0501072_0093659 3300049588 Bacteria 2386
1239 Ga0501072_0128313 3300049588 Bacteria 2021
1240 Ga0501072_0232257 3300049588 Bacteria 1469
1241 Ga0501072_0269483 3300049588 Bacteria 1355
1242 Ga0501072_0337423 3300049588 Bacteria 1197
1243 Ga0501072_0339803 3300049588 Bacteria 1192
1244 Ga0501072_0560674 3300049588 Bacteria 902
1245 Ga0501073_0009166 3300049589 Bacteria 7300
1246 Ga0501073_0011499 3300049589 Bacteria 6471
1247 Ga0501073_0022682 3300049589 Bacteria 4516
1248 Ga0501073_0073553 3300049589 Bacteria 2379
1249 Ga0501073_0222779 3300049589 Bacteria 1303
1250 Ga0501073_0267647 3300049589 Unclassified 1179
1251 Ga0501073_0308242 3300049589 Bacteria 1092
1252 Ga0501073_0444456 3300049589 Bacteria 896
1253 Ga0501074_0000235 3300049590 Bacteria 30883
1254 Ga0501074_0001738 3300049590 Bacteria 14891
1255 Ga0501074_0012633 3300049590 Bacteria 6141
1256 Ga0501074_0013730 3300049590 Bacteria 5887
1257 Ga0501074_0016469 3300049590 Bacteria 5367
1258 Ga0501074_0016954 3300049590 Bacteria 5285
1259 Ga0501074_0018260 3300049590 Bacteria 5096
1260 Ga0501074_0029829 3300049590 Bacteria 3953
1261 Ga0501074_0098357 3300049590 Bacteria 2094
1262 Ga0501074_0117793 3300049590 Bacteria 1900
1263 Ga0501074_0121577 3300049590 Bacteria 1867
1264 Ga0501074_0134276 3300049590 Bacteria 1770
1265 Ga0501074_0149905 3300049590 Bacteria 1668
1266 Ga0501074_0284672 3300049590 Bacteria 1175
1267 Ga0501074_0456125 3300049590 Unclassified 906
1268 Ga0501075_0000893 3300049591 Bacteria 18824
1269 Ga0501075_0006562 3300049591 Bacteria 8012
1270 Ga0501075_0012322 3300049591 Bacteria 6074
1271 Ga0501075_0015474 3300049591 Bacteria 5475
1272 Ga0501075_0017158 3300049591 Bacteria 5225
1273 Ga0501075_0018610 3300049591 Bacteria 5030
1274 Ga0501075_0024351 3300049591 Bacteria 4437
1275 Ga0501075_0038508 3300049591 Bacteria 3574
1276 Ga0501075_0044871 3300049591 Bacteria 3316
1277 Ga0501075_0061712 3300049591 Bacteria 2825
1278 Ga0501075_0073283 3300049591 Bacteria 2589
1279 Ga0501075_0089938 3300049591 Bacteria 2328
1280 Ga0501075_0256608 3300049591 Bacteria 1332
1281 Ga0501075_0258299 3300049591 Bacteria 1328
1282 Ga0501075_0292716 3300049591 Bacteria 1240
1283 Ga0501075_0565501 3300049591 Bacteria 867
1284 Ga0501076_0001738 3300049592 Bacteria 14736
1285 Ga0501076_0002834 3300049592 Bacteria 11989
1286 Ga0501076_0004808 3300049592 Bacteria 9642
1287 Ga0501076_0010423 3300049592 Bacteria 6900
1288 Ga0501076_0016033 3300049592 Bacteria 5671
1289 Ga0501076_0045490 3300049592 Bacteria 3465
1290 Ga0501076_0049222 3300049592 Bacteria 3332
1291 Ga0501076_0056608 3300049592 Bacteria 3112
1292 Ga0501076_0058149 3300049592 Bacteria 3072
1293 Ga0501076_0071667 3300049592 Bacteria 2772
1294 Ga0501076_0100404 3300049592 Bacteria 2331
1295 Ga0501076_0117512 3300049592 Bacteria 2152
1296 Ga0501076_0132895 3300049592 Bacteria 2019
1297 Ga0501076_0171173 3300049592 Bacteria 1770
1298 Ga0501076_0184625 3300049592 Bacteria 1701
1299 Ga0501076_0207385 3300049592 Bacteria 1601
1300 Ga0501076_0311650 3300049592 Unclassified 1291
1301 Ga0501076_0493106 3300049592 Bacteria 1009
1302 Ga0501076_0577694 3300049592 Bacteria 927
1303 Ga0501077_0003176 3300049593 Bacteria 9893
1304 Ga0501077_0003831 3300049593 Bacteria 9060
1305 Ga0501077_0006263 3300049593 Bacteria 7278
1306 Ga0501077_0006855 3300049593 Bacteria 7010
1307 Ga0501077_0007221 3300049593 Bacteria 6853
1308 Ga0501077_0013641 3300049593 Bacteria 5094
1309 Ga0501077_0014691 3300049593 Bacteria 4920
1310 Ga0501077_0018134 3300049593 Bacteria 4450
1311 Ga0501077_0022735 3300049593 Bacteria 3973
1312 Ga0501077_0023533 3300049593 Bacteria 3906
1313 Ga0501077_0024871 3300049593 Bacteria 3802
1314 Ga0501077_0029189 3300049593 Bacteria 3506
1315 Ga0501077_0047200 3300049593 Bacteria 2736
1316 Ga0501077_0066364 3300049593 Bacteria 2289
1317 Ga0501077_0071464 3300049593 Bacteria 2200
1318 Ga0501077_0113433 3300049593 Bacteria 1718
1319 Ga0501077_0163919 3300049593 Bacteria 1411
1320 Ga0501077_0186567 3300049593 Bacteria 1318
1321 Ga0501077_0253531 3300049593 Bacteria 1119
1322 Ga0501077_0422966 3300049593 Bacteria 852
1323 Ga0501079_0000130 3300049741 Bacteria 40553
1324 Ga0501079_0001508 3300049741 Bacteria 16495
1325 Ga0501079_0003750 3300049741 Bacteria 11216
1326 Ga0501079_0004138 3300049741 Bacteria 10742
1327 Ga0501079_0005359 3300049741 Bacteria 9552
1328 Ga0501079_0005449 3300049741 Bacteria 9483
1329 Ga0501079_0008306 3300049741 Bacteria 7867
1330 Ga0501079_0036298 3300049741 Bacteria 3797
1331 Ga0501079_0041273 3300049741 Bacteria 3561
1332 Ga0501079_0043045 3300049741 Bacteria 3485
1333 Ga0501079_0049423 3300049741 Bacteria 3245
1334 Ga0501079_0057012 3300049741 Bacteria 3014
1335 Ga0501079_0073837 3300049741 Bacteria 2636
1336 Ga0501079_0078772 3300049741 Bacteria 2549
1337 Ga0501079_0160792 3300049741 Bacteria 1751
1338 Ga0501079_0551389 3300049741 Unclassified 906
1339 Ga0501080_0005311 3300049742 Bacteria 11480
1340 Ga0501080_0006151 3300049742 Bacteria 10771
1341 Ga0501080_0027447 3300049742 Bacteria 5293
1342 Ga0501080_0034997 3300049742 Bacteria 4689
1343 Ga0501080_0044862 3300049742 Bacteria 4114
1344 Ga0501080_0097169 3300049742 Bacteria 2734
1345 Ga0501080_0254688 3300049742 Unclassified 1600
1346 Ga0501080_0435148 3300049742 Bacteria 1177
1347 Ga0501080_0640491 3300049742 Bacteria 941
1348 Ga0501081_0000313 3300049743 Bacteria 26016
1349 Ga0501081_0019483 3300049743 Bacteria 4518
1350 Ga0501081_0026522 3300049743 Bacteria 3908
1351 Ga0501081_0028312 3300049743 Bacteria 3781
1352 Ga0501081_0031393 3300049743 Bacteria 3600
1353 Ga0501081_0049954 3300049743 Bacteria 2881
1354 Ga0501081_0051817 3300049743 Bacteria 2830
1355 Ga0501081_0052240 3300049743 Bacteria 2819
1356 Ga0501081_0054448 3300049743 Bacteria 2764
1357 Ga0501081_0069304 3300049743 Bacteria 2457
1358 Ga0501081_0114333 3300049743 Bacteria 1917
1359 Ga0501081_0285355 3300049743 Bacteria 1209
1360 Ga0501081_0378957 3300049743 Bacteria 1045
1361 Ga0501081_0493967 3300049743 Bacteria 912
1362 Ga0501083_0000058 3300049744 Bacteria 78835
1363 Ga0501083_0007751 3300049744 Bacteria 7606
1364 Ga0501083_0011370 3300049744 Bacteria 6244
1365 Ga0501083_0031791 3300049744 Bacteria 3622
1366 Ga0501083_0036231 3300049744 Bacteria 3366
1367 Ga0501083_0133777 3300049744 Bacteria 1625
1368 Ga0501083_0187185 3300049744 Bacteria 1351
1369 Ga0501083_0281683 3300049744 Bacteria 1081
1370 Ga0501035_0002449 3300049822 Bacteria 18130
1371 Ga0501035_0005704 3300049822 Bacteria 11744
1372 Ga0501035_0007774 3300049822 Bacteria 10016
1373 Ga0501035_0014714 3300049822 Bacteria 7222
1374 Ga0501035_0016047 3300049822 Bacteria 6910
1375 Ga0501035_0048080 3300049822 Bacteria 3826
1376 Ga0501035_0057549 3300049822 Bacteria 3466
1377 Ga0501035_0108471 3300049822 Bacteria 2434
1378 Ga0501035_0118208 3300049822 Bacteria 2319
1379 Ga0501035_0158037 3300049822 Bacteria 1964
1380 Ga0501035_0160066 3300049822 Bacteria 1949
1381 Ga0501044_0017898 3300049823 Bacteria 7600
1382 Ga0501044_0021418 3300049823 Bacteria 6896
1383 Ga0501044_0034640 3300049823 Bacteria 5293
1384 Ga0501044_0040304 3300049823 Bacteria 4868
1385 Ga0501044_0372247 3300049823 Bacteria 1345
1386 Ga0501045_0000191 3300049824 Bacteria 34468
1387 Ga0501045_0000429 3300049824 Bacteria 25701
1388 Ga0501045_0005703 3300049824 Bacteria 8614
1389 Ga0501045_0007997 3300049824 Bacteria 7367
1390 Ga0501045_0008558 3300049824 Bacteria 7130
1391 Ga0501045_0018931 3300049824 Bacteria 4903
1392 Ga0501045_0024331 3300049824 Bacteria 4347
1393 Ga0501045_0026426 3300049824 Bacteria 4176
1394 Ga0501045_0030872 3300049824 Bacteria 3880
1395 Ga0501045_0040167 3300049824 Bacteria 3405
1396 Ga0501045_0044419 3300049824 Bacteria 3237
1397 Ga0501045_0047217 3300049824 Bacteria 3136
1398 Ga0501045_0049686 3300049824 Bacteria 3058
1399 Ga0501045_0072788 3300049824 Bacteria 2530
1400 Ga0501045_0217930 3300049824 Bacteria 1421
1401 nmdc:mga0yw44_353131_c1 3300050492 Bacteria 990
1402 nmdc:mga0yw44_82810_c1 3300050492 Unclassified 2014
1403 nmdc:mga05p37_105727_c1 3300050507 Bacteria 3462
1404 nmdc:mga05p37_240730_c1 3300050507 Bacteria 2176
1405 nmdc:mga05p37_2477_c1 3300050507 Bacteria 21478
1406 nmdc:mga05p37_26964_c1 3300050507 Bacteria 6991
1407 nmdc:mga05p37_436500_c1 3300050507 Bacteria 1520
1408 nmdc:mga05p37_57579_c1 3300050507 Bacteria 4787
1409 nmdc:mga05p37_589693_c1 3300050507 Bacteria 1257
1410 nmdc:mga05p37_830768_c1 3300050507 Bacteria 1006
1411 nmdc:mga09592_27201_c1 3300050508 Bacteria 4747
1412 nmdc:mga09592_519923_c1 3300050508 Bacteria 1024
1413 nmdc:mga0qj67_100111_c1 3300050509 Bacteria 2336
1414 nmdc:mga0qj67_151928_c1 3300050509 Bacteria 1879
1415 nmdc:mga0qj67_8087_c1 3300050509 Bacteria 7783
1416 nmdc:mga06r32_10854_c1 3300050510 Bacteria 8202
1417 nmdc:mga08y16_118864_c1 3300050511 Bacteria 2751
1418 nmdc:mga08y16_171617_c1 3300050511 Bacteria 2253
1419 nmdc:mga08y16_17740_c1 3300050511 Bacteria 7496
1420 nmdc:mga08y16_218367_c1 3300050511 Bacteria 1974
1421 nmdc:mga08y16_251706_c1 3300050511 Bacteria 1825
1422 nmdc:mga08y16_56389_c1 3300050511 Bacteria 4107
1423 nmdc:mga08y16_7118_c1 3300050511 Bacteria 11738
1424 nmdc:mga08y16_79430_c1 3300050511 Bacteria 3419
1425 nmdc:mga0n895_116841_c1 3300050512 Bacteria 2686
1426 nmdc:mga0n895_464058_c1 3300050512 Bacteria 1278
1427 nmdc:mga0rr50_40874_c1 3300050513 Bacteria 3374
1428 nmdc:mga0rr50_56179_c1 3300050513 Bacteria 2940
1429 nmdc:mga0a205_27721_c1 3300050515 Bacteria 1399
1430 nmdc:mga0a205_28420_c1 3300050515 Bacteria 5347
1431 nmdc:mga0a205_672020_c1 3300050515 Bacteria 886
1432 Ga0495601_0024608 3300053077 Bacteria 3709
1433 Ga0495601_0144163 3300053077 Bacteria 1554
1434 Ga0495612_0065026 3300053078 Bacteria 1515
1435 Ga0495655_0000926 3300053083 Bacteria 4564
1436 Ga0495655_0001216 3300053083 Bacteria 3975
1437 Ga0495595_0005011 3300053084 Bacteria 5348
1438 Ga0495595_0040034 3300053084 Bacteria 2141
1439 Ga0495595_0122088 3300053084 Unclassified 1269
1440 Ga0495619_0003130 3300053085 Bacteria 10733
1441 Ga0495619_0230677 3300053085 Unclassified 1282
1442 Ga0501084_0000824 3300054114 Bacteria 23857
1443 Ga0501084_0000882 3300054114 Bacteria 23193
1444 Ga0501084_0002015 3300054114 Bacteria 16226
1445 Ga0501084_0003386 3300054114 Bacteria 12920
1446 Ga0501084_0011466 3300054114 Bacteria 7339
1447 Ga0501084_0014312 3300054114 Bacteria 6572
1448 Ga0501084_0017115 3300054114 Bacteria 6022
1449 Ga0501084_0027966 3300054114 Bacteria 4711
1450 Ga0501084_0033649 3300054114 Bacteria 4287
1451 Ga0501084_0041808 3300054114 Bacteria 3834
1452 Ga0501084_0044543 3300054114 Bacteria 3714
1453 Ga0501084_0052643 3300054114 Bacteria 3405
1454 Ga0501084_0065561 3300054114 Bacteria 3039
1455 Ga0501084_0079544 3300054114 Bacteria 2748
1456 Ga0501084_0103261 3300054114 Bacteria 2394
1457 Ga0501084_0107193 3300054114 Bacteria 2347
1458 Ga0501084_0145219 3300054114 Bacteria 1998
1459 Ga0501084_0290502 3300054114 Bacteria 1381
1460 Ga0501084_0349834 3300054114 Bacteria 1248
1461 Ga0501084_0469525 3300054114 Bacteria 1064
1462 Ga0590071_008552 3300059421 Bacteria 2407
1463 Ga0590075_013707 3300059424 Bacteria 1978
1464 Ga0501082_0001300 3300060353 Bacteria 21901
1465 Ga0501082_0008205 3300060353 Bacteria 9011
1466 Ga0501082_0015071 3300060353 Bacteria 6658
1467 Ga0501082_0016418 3300060353 Bacteria 6371
1468 Ga0501082_0025059 3300060353 Bacteria 5139
1469 Ga0501082_0026383 3300060353 Bacteria 5005
1470 Ga0501082_0027469 3300060353 Bacteria 4899
1471 Ga0501082_0031802 3300060353 Bacteria 4551
1472 Ga0501082_0038077 3300060353 Bacteria 4148
1473 Ga0501082_0052677 3300060353 Bacteria 3507
1474 Ga0501082_0067700 3300060353 Bacteria 3075
1475 Ga0501082_0086816 3300060353 Bacteria 2698
1476 Ga0501082_0141421 3300060353 Unclassified 2089
1477 Ga0501082_0152317 3300060353 Bacteria 2009
1478 Ga0501082_0191475 3300060353 Bacteria 1779
1479 Ga0501082_0306002 3300060353 Bacteria 1384
1480 Ga0501082_0449647 3300060353 Bacteria 1126
1481 Ga0501082_0501195 3300060353 Bacteria 1061
1482 Ga0501082_0538202 3300060353 Bacteria 1021
1483 Ga0501082_0776418 3300060353 Bacteria 838
1484 Ga0466962_0004873 3300061719 Bacteria 6454
1485 Ga0466962_0012256 3300061719 Bacteria 4121
1486 Ga0466962_0182991 3300061719 Bacteria 1022
1487 Ga0530510_0000865 3300061734 Bacteria 19956
1488 Ga0530510_0001330 3300061734 Bacteria 16535
1489 Ga0530510_0004226 3300061734 Bacteria 9931
1490 Ga0530510_0005976 3300061734 Bacteria 8443
1491 Ga0530510_0013738 3300061734 Bacteria 5699
1492 Ga0530510_0016178 3300061734 Bacteria 5275
1493 Ga0530510_0027309 3300061734 Bacteria 4089
1494 Ga0530510_0042956 3300061734 Bacteria 3265
1495 Ga0530510_0045203 3300061734 Bacteria 3182
1496 Ga0530510_0071984 3300061734 Bacteria 2509
1497 Ga0530510_0075426 3300061734 Bacteria 2449
1498 Ga0530510_0080206 3300061734 Bacteria 2374
1499 Ga0530510_0131194 3300061734 Bacteria 1843
1500 Ga0530510_0158472 3300061734 Bacteria 1674
1501 Ga0530510_0201021 3300061734 Bacteria 1480
1502 Ga0530510_0614790 3300061734 Unclassified 827

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046500 Ga0495596_0049541 Ga0495596_0049541_20_613 197
2 3300042436 Ga0439435_0055827 Ga0439435_0055827_10_648 212
3 3300045976 Ga0466967_0896138 Ga0466967_0896138_159_830 215
4 3300039453 Ga0436362_0004195 Ga0436362_0004195_737_1399 220
5 3300005327 Ga0070658_10601447 Ga0070658_106014472 223
6 3300011119 Ga0105246_11081543 Ga0105246_110815431 223
7 3300013296 Ga0157374_10703585 Ga0157374_107035852 223
8 3300035114 Ga0373939_0235164 Ga0373939_0235164_17_688 223
9 3300035725 Ga0373947_0280159 Ga0373947_0280159_23_694 223
10 3300044694 Ga0466963_0630872 Ga0466963_0630872_10_681 223
11 3300044735 Ga0466968_0102435 Ga0466968_0102435_542_1213 223
12 3300044842 Ga0466957_0597860 Ga0466957_0597860_82_753 223
13 3300046461 Ga0495641_0009942 Ga0495641_0009942_16_687 223
14 3300046679 Ga0495623_0349677 Ga0495623_0349677_111_782 223
15 3300047471 Ga0495684_0005729 Ga0495684_0005729_16_687 223
16 3300048903 Ga0496100_0251467 Ga0496100_0251467_19_690 223
17 3300048908 Ga0496105_0477182 Ga0496105_0477182_13_684 223
18 3300048910 Ga0496107_0034518 Ga0496107_0034518_1959_2630 223
19 3300049583 Ga0501067_0001127 Ga0501067_0001127_12689_13360 223
20 3300049584 Ga0501068_0049046 Ga0501068_0049046_1074_1745 223
21 3300049585 Ga0501069_0003627 Ga0501069_0003627_6378_7049 223
22 3300049586 Ga0501070_0613952 Ga0501070_0613952_48_719 223
23 3300049571 Ga0501034_0714841 Ga0501034_0714841_20_718 224
24 3300009176 Ga0105242_11035516 Ga0105242_110355162 225
25 3300032126 Ga0307415_100266713 Ga0307415_1002667133 225
26 3300041408 Ga0439453_0007744 Ga0439453_0007744_21_698 225
27 3300046537 Ga0495598_0164334 Ga0495598_0164334_82_759 225
28 3300046615 Ga0495656_0058447 Ga0495656_0058447_77_754 225
29 3300046616 Ga0495668_0285209 Ga0495668_0285209_141_818 225
30 3300046691 Ga0495670_0294500 Ga0495670_0294500_161_844 225
31 3300047445 Ga0495677_0171790 Ga0495677_0171790_138_821 225
32 3300048912 Ga0496109_0533740 Ga0496109_0533740_92_769 225
33 3300048912 Ga0496109_0645325 Ga0496109_0645325_24_701 225
34 3300049568 Ga0501031_0023359 Ga0501031_0023359_35_718 225
35 3300049571 Ga0501034_0032710 Ga0501034_0032710_80_763 225
36 3300049574 Ga0501038_0216183 Ga0501038_0216183_28_711 225
37 3300049575 Ga0501039_0426672 Ga0501039_0426672_316_999 225
38 3300049577 Ga0501041_0017134 Ga0501041_0017134_3518_4204 225
39 3300049580 Ga0501046_0252201 Ga0501046_0252201_594_1277 225
40 3300049586 Ga0501070_0124503 Ga0501070_0124503_1338_2024 225
41 3300049588 Ga0501072_0339803 Ga0501072_0339803_477_1160 225
42 3300049589 Ga0501073_0073553 Ga0501073_0073553_1587_2273 225
43 3300049589 Ga0501073_0267647 Ga0501073_0267647_74_751 225
44 3300049591 Ga0501075_0565501 Ga0501075_0565501_13_690 225
45 3300049593 Ga0501077_0163919 Ga0501077_0163919_107_793 225
46 3300049824 Ga0501045_0024331 Ga0501045_0024331_107_793 225
47 3300060353 Ga0501082_0538202 Ga0501082_0538202_20_703 225
48 3300006038 Ga0075365_10083266 Ga0075365_100832662 226
49 3300048909 Ga0496106_0801938 Ga0496106_0801938_22_702 226
50 3300048911 Ga0496108_0844752 Ga0496108_0844752_48_740 226
51 3300048914 Ga0496111_0182958 Ga0496111_0182958_104_796 226
52 3300048917 Ga0496114_0194178 Ga0496114_0194178_553_1245 226
53 3300048917 Ga0496114_0907380 Ga0496114_0907380_11_691 226
54 3300049572 Ga0501036_0133474 Ga0501036_0133474_1390_2070 226
55 3300049576 Ga0501040_0042231 Ga0501040_0042231_2386_3066 226
56 3300049583 Ga0501067_0178915 Ga0501067_0178915_49_729 226
57 3300049588 Ga0501072_0003808 Ga0501072_0003808_40_720 226
58 3300049588 Ga0501072_0560674 Ga0501072_0560674_174_872 226
59 3300049589 Ga0501073_0308242 Ga0501073_0308242_389_1075 226
60 3300049591 Ga0501075_0258299 Ga0501075_0258299_610_1299 226
61 3300049592 Ga0501076_0577694 Ga0501076_0577694_189_881 226
62 3300050492 nmdc:mga0yw44_353131_c1 nmdc:mga0yw44_353131_c1_16_696 226
63 3300061734 Ga0530510_0614790 Ga0530510_0614790_94_786 226
64 3300006852 Ga0075433_10079022 Ga0075433_100790221 228
65 3300042006 Ga0439432_037000 Ga0439432_037000_11_730 228
66 3300005329 Ga0070683_100463967 Ga0070683_1004639672 230
67 3300005367 Ga0070667_100034742 Ga0070667_1000347422 236
68 3300005535 Ga0070684_100126605 Ga0070684_1001266052 236
69 3300005563 Ga0068855_100094434 Ga0068855_1000944342 236
70 3300005614 Ga0068856_100024369 Ga0068856_1000243696 236
71 3300025909 Ga0207705_10022323 Ga0207705_100223233 236
72 3300025949 Ga0207667_10037484 Ga0207667_100374846 236
73 3300026078 Ga0207702_10717734 Ga0207702_107177342 236
74 3300049823 Ga0501044_0372247 Ga0501044_0372247_623_1333 236
75 3300005985 Ga0081539_10005173 Ga0081539_1000517312 238
76 3300049588 Ga0501072_0269483 Ga0501072_0269483_578_1306 238
77 3300049573 Ga0501037_0547932 Ga0501037_0547932_35_754 239
78 3300049576 Ga0501040_0063978 Ga0501040_0063978_1426_2145 239
79 3300049578 Ga0501042_0124007 Ga0501042_0124007_123_842 239
80 3300049584 Ga0501068_0416139 Ga0501068_0416139_27_755 239
81 3300049588 Ga0501072_0093659 Ga0501072_0093659_787_1506 239
82 3300049591 Ga0501075_0292716 Ga0501075_0292716_348_1067 239
83 3300049592 Ga0501076_0058149 Ga0501076_0058149_2197_2916 239
84 3300049743 Ga0501081_0378957 Ga0501081_0378957_196_915 239
85 3300049822 Ga0501035_0158037 Ga0501035_0158037_1170_1889 239
86 3300049824 Ga0501045_0044419 Ga0501045_0044419_223_942 239
87 3300054114 Ga0501084_0349834 Ga0501084_0349834_61_780 239
88 3300061734 Ga0530510_0201021 Ga0530510_0201021_447_1166 239
89 3300006844 Ga0075428_100165773 Ga0075428_1001657732 240
90 3300006846 Ga0075430_100188785 Ga0075430_1001887853 240
91 3300006880 Ga0075429_100084993 Ga0075429_1000849933 240
92 3300009147 Ga0114129_10035068 Ga0114129_100350686 240
93 3300050507 nmdc:mga05p37_57579_c1 nmdc:mga05p37_57579_c1_1849_2649 240
94 3300050509 nmdc:mga0qj67_100111_c1 nmdc:mga0qj67_100111_c1_920_1720 240
95 3300044684 Ga0466966_0197436 Ga0466966_0197436_43_810 242
96 3300003373 JGI25407J50210_10040997 JGI25407J50210_100409971 243
97 3300005981 Ga0081538_10023525 Ga0081538_100235253 243
98 3300044694 Ga0466963_0002621 Ga0466963_0002621_4385_5152 244
99 3300037418 Ga0395900_0361778 Ga0395900_0361778_233_1000 245
100 3300038443 Ga0395901_0082007 Ga0395901_0082007_1776_2543 245
101 3300049743 Ga0501081_0028312 Ga0501081_0028312_946_1731 246
102 3300041404 Ga0439436_0033515 Ga0439436_0033515_535_1320 247
103 3300041406 Ga0439439_0005760 Ga0439439_0005760_1063_1848 247
104 3300041410 Ga0439461_0011302 Ga0439461_0011302_556_1341 247
105 3300041997 Ga0439431_0012423 Ga0439431_0012423_1142_1927 247
106 3300041999 Ga0439433_0000829 Ga0439433_0000829_4673_5458 247
107 3300042002 Ga0439442_027457 Ga0439442_027457_342_1127 247
108 3300042007 Ga0439449_0004389 Ga0439449_0004389_3493_4278 247
109 3300042014 Ga0439457_028472 Ga0439457_028472_184_969 247
110 3300042015 Ga0439462_0003956 Ga0439462_0003956_448_1233 247
111 3300042156 Ga0439446_0000082 Ga0439446_0000082_12791_13576 247
112 3300049568 Ga0501031_0004061 Ga0501031_0004061_3489_4277 247
113 3300049569 Ga0501032_0006448 Ga0501032_0006448_3294_4082 247
114 3300049570 Ga0501033_0013301 Ga0501033_0013301_3644_4432 247
115 3300049571 Ga0501034_0028186 Ga0501034_0028186_4383_5171 247
116 3300049572 Ga0501036_0044479 Ga0501036_0044479_1362_2150 247
117 3300049573 Ga0501037_0009265 Ga0501037_0009265_5946_6734 247
118 3300049574 Ga0501038_0007078 Ga0501038_0007078_856_1644 247
119 3300049575 Ga0501039_0049631 Ga0501039_0049631_1601_2389 247
120 3300049576 Ga0501040_0005940 Ga0501040_0005940_5359_6147 247
121 3300049577 Ga0501041_0026890 Ga0501041_0026890_1289_2077 247
122 3300049578 Ga0501042_0060267 Ga0501042_0060267_939_1727 247
123 3300049579 Ga0501043_0028534 Ga0501043_0028534_2050_2838 247
124 3300049580 Ga0501046_0012843 Ga0501046_0012843_5127_5915 247
125 3300049582 Ga0501048_0005882 Ga0501048_0005882_7669_8457 247
126 3300049584 Ga0501068_0005404 Ga0501068_0005404_1016_1804 247
127 3300049585 Ga0501069_0020235 Ga0501069_0020235_1531_2319 247
128 3300049586 Ga0501070_0038771 Ga0501070_0038771_1181_1969 247
129 3300049587 Ga0501071_0072992 Ga0501071_0072992_984_1772 247
130 3300049588 Ga0501072_0035670 Ga0501072_0035670_1497_2285 247
131 3300049589 Ga0501073_0011499 Ga0501073_0011499_4258_5046 247
132 3300049590 Ga0501074_0013730 Ga0501074_0013730_1806_2594 247
133 3300049591 Ga0501075_0038508 Ga0501075_0038508_903_1691 247
134 3300049592 Ga0501076_0016033 Ga0501076_0016033_754_1542 247
135 3300049593 Ga0501077_0029189 Ga0501077_0029189_1765_2553 247
136 3300049741 Ga0501079_0057012 Ga0501079_0057012_856_1644 247
137 3300049742 Ga0501080_0027447 Ga0501080_0027447_1516_2304 247
138 3300049743 Ga0501081_0052240 Ga0501081_0052240_1176_1964 247
139 3300049744 Ga0501083_0007751 Ga0501083_0007751_5612_6400 247
140 3300049822 Ga0501035_0007774 Ga0501035_0007774_3636_4424 247
141 3300049823 Ga0501044_0021418 Ga0501044_0021418_4331_5119 247
142 3300049824 Ga0501045_0008558 Ga0501045_0008558_5361_6149 247
143 3300050512 nmdc:mga0n895_116841_c1 nmdc:mga0n895_116841_c1_20_763 247
144 3300054114 Ga0501084_0041808 Ga0501084_0041808_1531_2319 247
145 3300060353 Ga0501082_0052677 Ga0501082_0052677_837_1625 247
146 3300061734 Ga0530510_0080206 Ga0530510_0080206_731_1519 247
147 3300003373 JGI25407J50210_10002200 JGI25407J50210_100022005 248
148 3300005981 Ga0081538_10000060 Ga0081538_1000006068 248
149 3300031911 Ga0307412_10165365 Ga0307412_101653652 248
150 3300013105 Ga0157369_10010556 Ga0157369_100105569 249
151 3300020081 Ga0206354_10030587 Ga0206354_100305873 249
152 3300037418 Ga0395900_0078466 Ga0395900_0078466_2581_3348 249
153 3300038443 Ga0395901_0020099 Ga0395901_0020099_5173_5940 249
154 3300045976 Ga0466967_0019241 Ga0466967_0019241_2528_3319 249
155 3300046517 Ga0495630_0362948 Ga0495630_0362948_291_1058 249
156 3300046559 Ga0495667_0162027 Ga0495667_0162027_43_810 249
157 3300046690 Ga0495624_0178912 Ga0495624_0178912_221_988 249
158 3300048915 Ga0496112_0147006 Ga0496112_0147006_1441_2208 249
159 3300005336 Ga0070680_100073686 Ga0070680_1000736862 250
160 3300005341 Ga0070691_10072689 Ga0070691_100726892 250
161 3300005455 Ga0070663_100250382 Ga0070663_1002503822 250
162 3300005458 Ga0070681_10575848 Ga0070681_105758482 250
163 3300005530 Ga0070679_100308073 Ga0070679_1003080732 250
164 3300005544 Ga0070686_100287035 Ga0070686_1002870352 250
165 3300005547 Ga0070693_100106005 Ga0070693_1001060052 250
166 3300005578 Ga0068854_100239290 Ga0068854_1002392902 250
167 3300005614 Ga0068856_100135503 Ga0068856_1001355032 250
168 3300009098 Ga0105245_10059563 Ga0105245_100595634 250
169 3300009174 Ga0105241_10162076 Ga0105241_101620762 250
170 3300025911 Ga0207654_10082553 Ga0207654_100825533 250
171 3300025912 Ga0207707_10237107 Ga0207707_102371072 250
172 3300025921 Ga0207652_10142354 Ga0207652_101423542 250
173 3300025981 Ga0207640_10184494 Ga0207640_101844942 250
174 3300026067 Ga0207678_10280944 Ga0207678_102809442 250
175 3300026078 Ga0207702_10103209 Ga0207702_101032092 250
176 3300048905 Ga0496102_0145755 Ga0496102_0145755_243_1010 250
177 3300005327 Ga0070658_10227673 Ga0070658_102276732 254
178 3300005355 Ga0070671_100029577 Ga0070671_1000295773 254
179 3300005435 Ga0070714_100683297 Ga0070714_1006832972 254
180 3300005456 Ga0070678_100028711 Ga0070678_1000287113 254
181 3300009176 Ga0105242_10038091 Ga0105242_100380915 254
182 3300013105 Ga0157369_10015027 Ga0157369_100150274 254
183 3300025909 Ga0207705_10217262 Ga0207705_102172622 254
184 3300026121 Ga0207683_10037902 Ga0207683_100379023 254
185 3300035083 Ga0373926_0037205 Ga0373926_0037205_856_1620 254
186 3300035089 Ga0373944_0025593 Ga0373944_0025593_33_797 254
187 3300035113 Ga0373936_0015074 Ga0373936_0015074_1339_2103 254
188 3300035116 Ga0373945_0002007 Ga0373945_0002007_43_807 254
189 3300035170 Ga0373943_0005277 Ga0373943_0005277_2804_3568 254
190 3300035171 Ga0373946_0084228 Ga0373946_0084228_533_1297 254
191 3300035692 Ga0373935_0046128 Ga0373935_0046128_497_1261 254
192 3300035725 Ga0373947_0001964 Ga0373947_0001964_7261_8025 254
193 3300037068 Ga0373925_0191575 Ga0373925_0191575_564_1328 254
194 3300046461 Ga0495641_0028381 Ga0495641_0028381_788_1552 254
195 3300046517 Ga0495630_0044810 Ga0495630_0044810_2094_2858 254
196 3300048904 Ga0496101_0009732 Ga0496101_0009732_5469_6233 254
197 3300048906 Ga0496103_0015518 Ga0496103_0015518_1194_1958 254
198 3300048909 Ga0496106_0020230 Ga0496106_0020230_1063_1827 254
199 3300048910 Ga0496107_0018083 Ga0496107_0018083_3621_4385 254
200 3300048917 Ga0496114_0008425 Ga0496114_0008425_5076_5840 254
201 3300048917 Ga0496114_0389575 Ga0496114_0389575_285_1049 254
202 3300005327 Ga0070658_10177926 Ga0070658_101779262 255
203 3300005329 Ga0070683_100040560 Ga0070683_1000405603 255
204 3300005329 Ga0070683_100057210 Ga0070683_1000572103 255
205 3300005329 Ga0070683_100082560 Ga0070683_1000825602 255
206 3300005329 Ga0070683_100144012 Ga0070683_1001440122 255
207 3300005329 Ga0070683_100485687 Ga0070683_1004856872 255
208 3300005329 Ga0070683_100649423 Ga0070683_1006494232 255
209 3300005336 Ga0070680_100018239 Ga0070680_1000182395 255
210 3300005336 Ga0070680_100022628 Ga0070680_1000226284 255
211 3300005336 Ga0070680_100028601 Ga0070680_1000286016 255
212 3300005336 Ga0070680_100071442 Ga0070680_1000714422 255
213 3300005336 Ga0070680_100136047 Ga0070680_1001360471 255
214 3300005336 Ga0070680_100242924 Ga0070680_1002429242 255
215 3300005337 Ga0070682_100039904 Ga0070682_1000399043 255
216 3300005337 Ga0070682_100101682 Ga0070682_1001016822 255
217 3300005338 Ga0068868_100320480 Ga0068868_1003204802 255
218 3300005339 Ga0070660_100008471 Ga0070660_1000084715 255
219 3300005339 Ga0070660_100012212 Ga0070660_1000122123 255
220 3300005339 Ga0070660_100025299 Ga0070660_1000252993 255
221 3300005339 Ga0070660_100356088 Ga0070660_1003560882 255
222 3300005344 Ga0070661_100008990 Ga0070661_1000089906 255
223 3300005344 Ga0070661_100012209 Ga0070661_1000122097 255
224 3300005344 Ga0070661_100130048 Ga0070661_1001300482 255
225 3300005345 Ga0070692_10172581 Ga0070692_101725812 255
226 3300005365 Ga0070688_100139138 Ga0070688_1001391382 255
227 3300005366 Ga0070659_100069700 Ga0070659_1000697002 255
228 3300005367 Ga0070667_100158702 Ga0070667_1001587023 255
229 3300005435 Ga0070714_100526522 Ga0070714_1005265222 255
230 3300005435 Ga0070714_100654449 Ga0070714_1006544491 255
231 3300005436 Ga0070713_100106004 Ga0070713_1001060042 255
232 3300005436 Ga0070713_100345254 Ga0070713_1003452542 255
233 3300005437 Ga0070710_10275368 Ga0070710_102753681 255
234 3300005439 Ga0070711_100478100 Ga0070711_1004781001 255
235 3300005441 Ga0070700_100346796 Ga0070700_1003467962 255
236 3300005444 Ga0070694_100079502 Ga0070694_1000795021 255
237 3300005445 Ga0070708_100033117 Ga0070708_1000331173 255
238 3300005455 Ga0070663_100471652 Ga0070663_1004716522 255
239 3300005456 Ga0070678_100238729 Ga0070678_1002387291 255
240 3300005458 Ga0070681_10011373 Ga0070681_100113734 255
241 3300005458 Ga0070681_10041815 Ga0070681_100418154 255
242 3300005458 Ga0070681_10077344 Ga0070681_100773444 255
243 3300005458 Ga0070681_10119786 Ga0070681_101197862 255
244 3300005458 Ga0070681_10206450 Ga0070681_102064501 255
245 3300005458 Ga0070681_10634043 Ga0070681_106340432 255
246 3300005467 Ga0070706_100136916 Ga0070706_1001369163 255
247 3300005468 Ga0070707_100230738 Ga0070707_1002307382 255
248 3300005518 Ga0070699_100213351 Ga0070699_1002133513 255
249 3300005530 Ga0070679_100007114 Ga0070679_1000071141 255
250 3300005530 Ga0070679_100125137 Ga0070679_1001251374 255
251 3300005530 Ga0070679_100169820 Ga0070679_1001698202 255
252 3300005535 Ga0070684_100005407 Ga0070684_1000054077 255
253 3300005535 Ga0070684_100038137 Ga0070684_1000381374 255
254 3300005535 Ga0070684_100148844 Ga0070684_1001488442 255
255 3300005539 Ga0068853_100648900 Ga0068853_1006489002 255
256 3300005543 Ga0070672_100387186 Ga0070672_1003871862 255
257 3300005546 Ga0070696_100011676 Ga0070696_1000116764 255
258 3300005548 Ga0070665_100051711 Ga0070665_1000517114 255
259 3300005548 Ga0070665_100327537 Ga0070665_1003275372 255
260 3300005563 Ga0068855_100012841 Ga0068855_1000128417 255
261 3300005563 Ga0068855_100016655 Ga0068855_1000166552 255
262 3300005563 Ga0068855_100022296 Ga0068855_1000222963 255
263 3300005563 Ga0068855_100052137 Ga0068855_1000521374 255
264 3300005563 Ga0068855_100462295 Ga0068855_1004622952 255
265 3300005578 Ga0068854_100074946 Ga0068854_1000749463 255
266 3300005614 Ga0068856_100077021 Ga0068856_1000770214 255
267 3300005614 Ga0068856_100288193 Ga0068856_1002881932 255
268 3300005615 Ga0070702_100336654 Ga0070702_1003366541 255
269 3300005616 Ga0068852_100112165 Ga0068852_1001121653 255
270 3300005618 Ga0068864_100138952 Ga0068864_1001389522 255
271 3300005719 Ga0068861_100077911 Ga0068861_1000779113 255
272 3300005844 Ga0068862_100067992 Ga0068862_1000679923 255
273 3300005937 Ga0081455_10075419 Ga0081455_100754192 255
274 3300005983 Ga0081540_1028563 Ga0081540_10285632 255
275 3300006028 Ga0070717_10036916 Ga0070717_100369163 255
276 3300006028 Ga0070717_10381332 Ga0070717_103813321 255
277 3300006175 Ga0070712_100168162 Ga0070712_1001681622 255
278 3300006175 Ga0070712_100441537 Ga0070712_1004415372 255
279 3300007076 Ga0075435_100189228 Ga0075435_1001892282 255
280 3300009093 Ga0105240_10055251 Ga0105240_100552514 255
281 3300009093 Ga0105240_10130250 Ga0105240_101302502 255
282 3300009093 Ga0105240_10158454 Ga0105240_101584544 255
283 3300009093 Ga0105240_10217139 Ga0105240_102171392 255
284 3300009148 Ga0105243_10118470 Ga0105243_101184702 255
285 3300009174 Ga0105241_10600437 Ga0105241_106004372 255
286 3300009176 Ga0105242_10019197 Ga0105242_100191975 255
287 3300009176 Ga0105242_10334705 Ga0105242_103347052 255
288 3300009177 Ga0105248_10446221 Ga0105248_104462212 255
289 3300009177 Ga0105248_11146134 Ga0105248_111461341 255
290 3300009545 Ga0105237_10396537 Ga0105237_103965372 255
291 3300009551 Ga0105238_10013751 Ga0105238_100137514 255
292 3300009551 Ga0105238_10094488 Ga0105238_100944884 255
293 3300009553 Ga0105249_10104608 Ga0105249_101046082 255
294 3300010375 Ga0105239_10308615 Ga0105239_103086152 255
295 3300010375 Ga0105239_10891531 Ga0105239_108915312 255
296 3300010375 Ga0105239_10962387 Ga0105239_109623871 255
297 3300013102 Ga0157371_10030301 Ga0157371_100303013 255
298 3300013102 Ga0157371_10165057 Ga0157371_101650572 255
299 3300013104 Ga0157370_10016119 Ga0157370_100161192 255
300 3300013104 Ga0157370_10045044 Ga0157370_100450444 255
301 3300013104 Ga0157370_10076769 Ga0157370_100767694 255
302 3300013104 Ga0157370_10095728 Ga0157370_100957282 255
303 3300013104 Ga0157370_10189639 Ga0157370_101896393 255
304 3300013104 Ga0157370_10451684 Ga0157370_104516842 255
305 3300013105 Ga0157369_10002303 Ga0157369_1000230322 255
306 3300013105 Ga0157369_10403841 Ga0157369_104038412 255
307 3300013296 Ga0157374_10440189 Ga0157374_104401892 255
308 3300013297 Ga0157378_10572261 Ga0157378_105722612 255
309 3300013307 Ga0157372_10318912 Ga0157372_103189123 255
310 3300013307 Ga0157372_10345417 Ga0157372_103454172 255
311 3300013307 Ga0157372_10797499 Ga0157372_107974992 255
312 3300013308 Ga0157375_10143581 Ga0157375_101435813 255
313 3300014325 Ga0163163_10013038 Ga0163163_100130389 255
314 3300014969 Ga0157376_10253723 Ga0157376_102537231 255
315 3300014969 Ga0157376_10556644 Ga0157376_105566441 255
316 3300020069 Ga0197907_10409808 Ga0197907_104098082 255
317 3300020069 Ga0197907_10896525 Ga0197907_108965251 255
318 3300020070 Ga0206356_10031764 Ga0206356_100317642 255
319 3300020070 Ga0206356_10456913 Ga0206356_104569132 255
320 3300020081 Ga0206354_11649605 Ga0206354_116496052 255
321 3300020082 Ga0206353_11455507 Ga0206353_114555072 255
322 3300020082 Ga0206353_11548455 Ga0206353_115484555 255
323 3300025885 Ga0207653_10030307 Ga0207653_100303073 255
324 3300025899 Ga0207642_10205794 Ga0207642_102057942 255
325 3300025909 Ga0207705_10045636 Ga0207705_100456363 255
326 3300025910 Ga0207684_10099042 Ga0207684_100990423 255
327 3300025910 Ga0207684_10112907 Ga0207684_101129074 255
328 3300025912 Ga0207707_10003519 Ga0207707_100035198 255
329 3300025912 Ga0207707_10009500 Ga0207707_100095006 255
330 3300025912 Ga0207707_10048497 Ga0207707_100484972 255
331 3300025912 Ga0207707_10060472 Ga0207707_100604722 255
332 3300025913 Ga0207695_10445632 Ga0207695_104456322 255
333 3300025913 Ga0207695_10588678 Ga0207695_105886781 255
334 3300025914 Ga0207671_10098486 Ga0207671_100984863 255
335 3300025915 Ga0207693_10029592 Ga0207693_100295921 255
336 3300025915 Ga0207693_10367469 Ga0207693_103674691 255
337 3300025916 Ga0207663_10079884 Ga0207663_100798842 255
338 3300025916 Ga0207663_10297435 Ga0207663_102974352 255
339 3300025917 Ga0207660_10006022 Ga0207660_100060224 255
340 3300025917 Ga0207660_10006989 Ga0207660_100069897 255
341 3300025917 Ga0207660_10055775 Ga0207660_100557752 255
342 3300025917 Ga0207660_10136576 Ga0207660_101365762 255
343 3300025918 Ga0207662_10049628 Ga0207662_100496283 255
344 3300025919 Ga0207657_10000964 Ga0207657_1000096426 255
345 3300025919 Ga0207657_10005129 Ga0207657_1000512913 255
346 3300025919 Ga0207657_10006273 Ga0207657_100062737 255
347 3300025919 Ga0207657_10019162 Ga0207657_100191622 255
348 3300025919 Ga0207657_10037998 Ga0207657_100379981 255
349 3300025920 Ga0207649_10256595 Ga0207649_102565952 255
350 3300025920 Ga0207649_10275813 Ga0207649_102758132 255
351 3300025921 Ga0207652_10016334 Ga0207652_100163344 255
352 3300025921 Ga0207652_10104857 Ga0207652_101048572 255
353 3300025921 Ga0207652_10192852 Ga0207652_101928522 255
354 3300025922 Ga0207646_10443255 Ga0207646_104432552 255
355 3300025923 Ga0207681_10163446 Ga0207681_101634462 255
356 3300025927 Ga0207687_10144978 Ga0207687_101449783 255
357 3300025928 Ga0207700_10066710 Ga0207700_100667101 255
358 3300025929 Ga0207664_10305579 Ga0207664_103055792 255
359 3300025929 Ga0207664_10731049 Ga0207664_107310491 255
360 3300025929 Ga0207664_10825459 Ga0207664_108254591 255
361 3300025932 Ga0207690_10185241 Ga0207690_101852412 255
362 3300025933 Ga0207706_10009052 Ga0207706_100090528 255
363 3300025934 Ga0207686_10208494 Ga0207686_102084942 255
364 3300025935 Ga0207709_10201683 Ga0207709_102016832 255
365 3300025940 Ga0207691_10481241 Ga0207691_104812412 255
366 3300025941 Ga0207711_10198323 Ga0207711_101983232 255
367 3300025941 Ga0207711_10273676 Ga0207711_102736762 255
368 3300025944 Ga0207661_10078061 Ga0207661_100780613 255
369 3300025944 Ga0207661_10180837 Ga0207661_101808372 255
370 3300025944 Ga0207661_10288065 Ga0207661_102880651 255
371 3300025944 Ga0207661_10339606 Ga0207661_103396062 255
372 3300025949 Ga0207667_10136180 Ga0207667_101361803 255
373 3300025949 Ga0207667_10243197 Ga0207667_102431972 255
374 3300025949 Ga0207667_10378071 Ga0207667_103780712 255
375 3300025960 Ga0207651_10127222 Ga0207651_101272222 255
376 3300025981 Ga0207640_10092949 Ga0207640_100929493 255
377 3300025986 Ga0207658_10017741 Ga0207658_100177415 255
378 3300026041 Ga0207639_10205217 Ga0207639_102052172 255
379 3300026067 Ga0207678_10081335 Ga0207678_100813351 255
380 3300026075 Ga0207708_10007756 Ga0207708_100077566 255
381 3300026089 Ga0207648_10002280 Ga0207648_1000228016 255
382 3300026095 Ga0207676_10029559 Ga0207676_100295593 255
383 3300026116 Ga0207674_10041497 Ga0207674_100414973 255
384 3300026118 Ga0207675_100061290 Ga0207675_1000612903 255
385 3300026142 Ga0207698_10077666 Ga0207698_100776662 255
386 3300026142 Ga0207698_10368561 Ga0207698_103685612 255
387 3300028379 Ga0268266_10022553 Ga0268266_100225533 255
388 3300028379 Ga0268266_10363091 Ga0268266_103630912 255
389 3300028381 Ga0268264_10096268 Ga0268264_100962683 255
390 3300028381 Ga0268264_11036588 Ga0268264_110365881 255
391 3300028558 Ga0265326_10010724 Ga0265326_100107242 255
392 3300028563 Ga0265319_1021414 Ga0265319_10214143 255
393 3300028577 Ga0265318_10037910 Ga0265318_100379102 255
394 3300028800 Ga0265338_10030316 Ga0265338_100303164 255
395 3300028800 Ga0265338_10035415 Ga0265338_100354155 255
396 3300028800 Ga0265338_10126744 Ga0265338_101267442 255
397 3300031239 Ga0265328_10024366 Ga0265328_100243662 255
398 3300031240 Ga0265320_10052353 Ga0265320_100523533 255
399 3300031241 Ga0265325_10010118 Ga0265325_100101185 255
400 3300031242 Ga0265329_10023878 Ga0265329_100238783 255
401 3300031249 Ga0265339_10016391 Ga0265339_100163913 255
402 3300031250 Ga0265331_10052052 Ga0265331_100520522 255
403 3300031251 Ga0265327_10030796 Ga0265327_100307962 255
404 3300031251 Ga0265327_10033181 Ga0265327_100331813 255
405 3300031251 Ga0265327_10041907 Ga0265327_100419073 255
406 3300031344 Ga0265316_10072474 Ga0265316_100724742 255
407 3300031595 Ga0265313_10015452 Ga0265313_100154524 255
408 3300031595 Ga0265313_10024998 Ga0265313_100249982 255
409 3300031711 Ga0265314_10008957 Ga0265314_100089578 255
410 3300031711 Ga0265314_10045410 Ga0265314_100454104 255
411 3300031712 Ga0265342_10025929 Ga0265342_100259294 255
412 3300035083 Ga0373926_0026260 Ga0373926_0026260_1243_2010 255
413 3300035086 Ga0373934_0032538 Ga0373934_0032538_353_1120 255
414 3300035089 Ga0373944_0007465 Ga0373944_0007465_1547_2314 255
415 3300035119 Ga0373956_0076238 Ga0373956_0076238_451_1218 255
416 3300035170 Ga0373943_0000968 Ga0373943_0000968_7680_8447 255
417 3300035170 Ga0373943_0009624 Ga0373943_0009624_2818_3585 255
418 3300035170 Ga0373943_0026802 Ga0373943_0026802_479_1246 255
419 3300035171 Ga0373946_0000950 Ga0373946_0000950_8884_9651 255
420 3300035171 Ga0373946_0030674 Ga0373946_0030674_417_1184 255
421 3300035692 Ga0373935_0035080 Ga0373935_0035080_747_1514 255
422 3300035692 Ga0373935_0079007 Ga0373935_0079007_282_1049 255
423 3300035692 Ga0373935_0184417 Ga0373935_0184417_242_1009 255
424 3300035695 Ga0373927_0211566 Ga0373927_0211566_224_991 255
425 3300035725 Ga0373947_0010758 Ga0373947_0010758_472_1239 255
426 3300035725 Ga0373947_0037586 Ga0373947_0037586_423_1190 255
427 3300035725 Ga0373947_0056406 Ga0373947_0056406_877_1644 255
428 3300035725 Ga0373947_0123861 Ga0373947_0123861_702_1469 255
429 3300036401 Ga0373937_0222149 Ga0373937_0222149_701_1468 255
430 3300037068 Ga0373925_0037531 Ga0373925_0037531_2741_3508 255
431 3300037068 Ga0373925_0038325 Ga0373925_0038325_861_1628 255
432 3300037068 Ga0373925_0082725 Ga0373925_0082725_1093_1860 255
433 3300037312 Ga0395899_0209533 Ga0395899_0209533_20_787 255
434 3300037418 Ga0395900_0005467 Ga0395900_0005467_2713_3480 255
435 3300037418 Ga0395900_0146606 Ga0395900_0146606_1567_2334 255
436 3300037418 Ga0395900_0236231 Ga0395900_0236231_826_1593 255
437 3300037418 Ga0395900_0263495 Ga0395900_0263495_902_1669 255
438 3300037466 Ga0395898_0013908 Ga0395898_0013908_5644_6411 255
439 3300037466 Ga0395898_0039522 Ga0395898_0039522_2774_3541 255
440 3300037466 Ga0395898_0064476 Ga0395898_0064476_1072_1839 255
441 3300037466 Ga0395898_0076771 Ga0395898_0076771_2447_3214 255
442 3300037466 Ga0395898_0310855 Ga0395898_0310855_162_929 255
443 3300037466 Ga0395898_0506189 Ga0395898_0506189_45_812 255
444 3300037471 Ga0395905_0030084 Ga0395905_0030084_1232_1999 255
445 3300037471 Ga0395905_0041418 Ga0395905_0041418_2031_2798 255
446 3300037471 Ga0395905_0130549 Ga0395905_0130549_1247_2014 255
447 3300037471 Ga0395905_0711909 Ga0395905_0711909_65_832 255
448 3300038443 Ga0395901_0009655 Ga0395901_0009655_6350_7117 255
449 3300038443 Ga0395901_0064283 Ga0395901_0064283_175_942 255
450 3300038443 Ga0395901_0178005 Ga0395901_0178005_521_1288 255
451 3300038443 Ga0395901_0293067 Ga0395901_0293067_420_1187 255
452 3300038443 Ga0395901_0872780 Ga0395901_0872780_10_777 255
453 3300038443 Ga0395901_1011125 Ga0395901_1011125_17_784 255
454 3300039437 Ga0436365_0347461 Ga0436365_0347461_359_1126 255
455 3300039437 Ga0436365_1709962 Ga0436365_1709962_3135_3902 255
456 3300039450 Ga0436363_0108127 Ga0436363_0108127_645_1412 255
457 3300039453 Ga0436362_0693060 Ga0436362_0693060_176_943 255
458 3300041443 Ga0451789_0814888 Ga0451789_0814888_335_1102 255
459 3300041460 Ga0451802_0785545 Ga0451802_0785545_411_1178 255
460 3300041463 Ga0451804_0467915 Ga0451804_0467915_588_1355 255
461 3300041496 Ga0451839_0279640 Ga0451839_0279640_2386_3153 255
462 3300041501 Ga0451845_0652193 Ga0451845_0652193_398_1165 255
463 3300041505 Ga0451849_0359582 Ga0451849_0359582_2746_3513 255
464 3300041507 Ga0451851_1288862 Ga0451851_1288862_782_1549 255
465 3300041512 Ga0451853_0484657 Ga0451853_0484657_630_1397 255
466 3300044656 Ga0466969_0040665 Ga0466969_0040665_570_1376 255
467 3300044658 Ga0466972_0078918 Ga0466972_0078918_520_1287 255
468 3300044683 Ga0466965_0298431 Ga0466965_0298431_74_841 255
469 3300044684 Ga0466966_0030501 Ga0466966_0030501_1933_2700 255
470 3300044684 Ga0466966_0056180 Ga0466966_0056180_738_1505 255
471 3300044684 Ga0466966_0071103 Ga0466966_0071103_1088_1855 255
472 3300044693 Ga0466961_0003168 Ga0466961_0003168_556_1323 255
473 3300044693 Ga0466961_0036972 Ga0466961_0036972_790_1557 255
474 3300044693 Ga0466961_0093418 Ga0466961_0093418_362_1168 255
475 3300044694 Ga0466963_0001137 Ga0466963_0001137_8560_9327 255
476 3300044694 Ga0466963_0001659 Ga0466963_0001659_645_1412 255
477 3300044694 Ga0466963_0018971 Ga0466963_0018971_2558_3325 255
478 3300044694 Ga0466963_0028319 Ga0466963_0028319_403_1170 255
479 3300044694 Ga0466963_0037365 Ga0466963_0037365_1839_2606 255
480 3300044694 Ga0466963_0045465 Ga0466963_0045465_1235_2002 255
481 3300044706 Ga0466964_0003114 Ga0466964_0003114_1713_2480 255
482 3300044706 Ga0466964_0008335 Ga0466964_0008335_88_855 255
483 3300044706 Ga0466964_0015865 Ga0466964_0015865_357_1124 255
484 3300044706 Ga0466964_0043269 Ga0466964_0043269_343_1110 255
485 3300044706 Ga0466964_0081548 Ga0466964_0081548_506_1273 255
486 3300044706 Ga0466964_0092323 Ga0466964_0092323_284_1051 255
487 3300044706 Ga0466964_0098955 Ga0466964_0098955_396_1163 255
488 3300044719 Ga0466971_0000469 Ga0466971_0000469_6220_6987 255
489 3300044719 Ga0466971_0011900 Ga0466971_0011900_1107_1874 255
490 3300044719 Ga0466971_0040769 Ga0466971_0040769_1225_1992 255
491 3300044735 Ga0466968_0017299 Ga0466968_0017299_997_1803 255
492 3300044735 Ga0466968_0044664 Ga0466968_0044664_511_1278 255
493 3300044765 Ga0466970_0008011 Ga0466970_0008011_1948_2715 255
494 3300044765 Ga0466970_0292598 Ga0466970_0292598_39_806 255
495 3300044842 Ga0466957_0004662 Ga0466957_0004662_6166_6933 255
496 3300044842 Ga0466957_0020684 Ga0466957_0020684_545_1312 255
497 3300044901 Ga0466960_0003090 Ga0466960_0003090_2784_3551 255
498 3300044901 Ga0466960_0040112 Ga0466960_0040112_304_1071 255
499 3300045049 Ga0466959_0016687 Ga0466959_0016687_712_1518 255
500 3300045049 Ga0466959_0021004 Ga0466959_0021004_1621_2388 255
501 3300045049 Ga0466959_0074413 Ga0466959_0074413_101_868 255
502 3300045049 Ga0466959_0082890 Ga0466959_0082890_737_1504 255
503 3300045049 Ga0466959_0137323 Ga0466959_0137323_771_1538 255
504 3300045049 Ga0466959_0345112 Ga0466959_0345112_27_794 255
505 3300045836 Ga0466958_0001601 Ga0466958_0001601_6039_6806 255
506 3300045836 Ga0466958_0020678 Ga0466958_0020678_817_1584 255
507 3300045836 Ga0466958_0069479 Ga0466958_0069479_633_1400 255
508 3300045976 Ga0466967_0006178 Ga0466967_0006178_848_1615 255
509 3300045976 Ga0466967_0012646 Ga0466967_0012646_347_1114 255
510 3300045976 Ga0466967_0014726 Ga0466967_0014726_2350_3117 255
511 3300045976 Ga0466967_0018416 Ga0466967_0018416_1929_2696 255
512 3300045976 Ga0466967_0022820 Ga0466967_0022820_1851_2618 255
513 3300045976 Ga0466967_0029693 Ga0466967_0029693_1375_2142 255
514 3300045976 Ga0466967_0032572 Ga0466967_0032572_3472_4239 255
515 3300045976 Ga0466967_0040809 Ga0466967_0040809_972_1739 255
516 3300045976 Ga0466967_0042790 Ga0466967_0042790_923_1690 255
517 3300045976 Ga0466967_0042853 Ga0466967_0042853_1091_1858 255
518 3300045976 Ga0466967_0044056 Ga0466967_0044056_2855_3622 255
519 3300045976 Ga0466967_0047797 Ga0466967_0047797_1312_2079 255
520 3300045976 Ga0466967_0052120 Ga0466967_0052120_2200_2967 255
521 3300045976 Ga0466967_0064391 Ga0466967_0064391_886_1653 255
522 3300045976 Ga0466967_0172629 Ga0466967_0172629_370_1137 255
523 3300045976 Ga0466967_0222782 Ga0466967_0222782_843_1610 255
524 3300045976 Ga0466967_0237212 Ga0466967_0237212_335_1102 255
525 3300045976 Ga0466967_0310406 Ga0466967_0310406_571_1338 255
526 3300045976 Ga0466967_0315663 Ga0466967_0315663_178_945 255
527 3300045976 Ga0466967_0335753 Ga0466967_0335753_600_1367 255
528 3300045976 Ga0466967_0450899 Ga0466967_0450899_287_1054 255
529 3300046454 Ga0495592_0027463 Ga0495592_0027463_2999_3766 255
530 3300046454 Ga0495592_0056012 Ga0495592_0056012_1819_2586 255
531 3300046454 Ga0495592_0199531 Ga0495592_0199531_356_1123 255
532 3300046455 Ga0495603_0000315 Ga0495603_0000315_14906_15673 255
533 3300046459 Ga0495629_0001172 Ga0495629_0001172_8905_9672 255
534 3300046459 Ga0495629_0072043 Ga0495629_0072043_22_789 255
535 3300046459 Ga0495629_0123992 Ga0495629_0123992_509_1276 255
536 3300046461 Ga0495641_0001392 Ga0495641_0001392_19564_20331 255
537 3300046461 Ga0495641_0020369 Ga0495641_0020369_2149_2916 255
538 3300046462 Ga0495651_0119261 Ga0495651_0119261_296_1063 255
539 3300046463 Ga0495653_0088926 Ga0495653_0088926_1437_2204 255
540 3300046463 Ga0495653_0089196 Ga0495653_0089196_1187_1954 255
541 3300046463 Ga0495653_0157782 Ga0495653_0157782_167_934 255
542 3300046472 Ga0495580_0077909 Ga0495580_0077909_957_1724 255
543 3300046472 Ga0495580_0272061 Ga0495580_0272061_37_804 255
544 3300046473 Ga0495582_0004758 Ga0495582_0004758_2633_3400 255
545 3300046473 Ga0495582_0014796 Ga0495582_0014796_2777_3544 255
546 3300046476 Ga0495662_0002670 Ga0495662_0002670_1858_2625 255
547 3300046476 Ga0495662_0038842 Ga0495662_0038842_1396_2163 255
548 3300046477 Ga0495664_0196550 Ga0495664_0196550_147_914 255
549 3300046477 Ga0495664_0234035 Ga0495664_0234035_82_849 255
550 3300046499 Ga0495594_0008752 Ga0495594_0008752_1376_2143 255
551 3300046511 Ga0495608_0003235 Ga0495608_0003235_6955_7722 255
552 3300046511 Ga0495608_0046549 Ga0495608_0046549_825_1592 255
553 3300046511 Ga0495608_0125067 Ga0495608_0125067_653_1420 255
554 3300046514 Ga0495618_0161813 Ga0495618_0161813_190_957 255
555 3300046514 Ga0495618_0419350 Ga0495618_0419350_28_795 255
556 3300046516 Ga0495628_0014360 Ga0495628_0014360_5063_5830 255
557 3300046516 Ga0495628_0061184 Ga0495628_0061184_1222_1989 255
558 3300046517 Ga0495630_0010760 Ga0495630_0010760_1102_1869 255
559 3300046517 Ga0495630_0062675 Ga0495630_0062675_143_910 255
560 3300046517 Ga0495630_0158058 Ga0495630_0158058_423_1190 255
561 3300046526 Ga0495666_0026315 Ga0495666_0026315_422_1189 255
562 3300046529 Ga0495652_0031157 Ga0495652_0031157_776_1543 255
563 3300046529 Ga0495652_0093133 Ga0495652_0093133_1136_1903 255
564 3300046529 Ga0495652_0133909 Ga0495652_0133909_492_1259 255
565 3300046529 Ga0495652_0171428 Ga0495652_0171428_237_1004 255
566 3300046531 Ga0495665_0000572 Ga0495665_0000572_682_1449 255
567 3300046533 Ga0495640_0004895 Ga0495640_0004895_6779_7546 255
568 3300046536 Ga0495587_0034460 Ga0495587_0034460_1976_2743 255
569 3300046536 Ga0495587_0092126 Ga0495587_0092126_723_1490 255
570 3300046536 Ga0495587_0219547 Ga0495587_0219547_250_1017 255
571 3300046543 Ga0495645_0215829 Ga0495645_0215829_369_1136 255
572 3300046557 Ga0495622_0027533 Ga0495622_0027533_1043_1810 255
573 3300046559 Ga0495667_0023106 Ga0495667_0023106_2768_3535 255
574 3300046559 Ga0495667_0057285 Ga0495667_0057285_907_1674 255
575 3300046559 Ga0495667_0080279 Ga0495667_0080279_826_1593 255
576 3300046642 Ga0495634_0007352 Ga0495634_0007352_2303_3070 255
577 3300046642 Ga0495634_0120903 Ga0495634_0120903_471_1238 255
578 3300046663 Ga0495635_0017186 Ga0495635_0017186_3420_4187 255
579 3300046663 Ga0495635_0086325 Ga0495635_0086325_845_1612 255
580 3300046675 Ga0495657_0049866 Ga0495657_0049866_1024_1791 255
581 3300046675 Ga0495657_0094425 Ga0495657_0094425_260_1027 255
582 3300046675 Ga0495657_0133657 Ga0495657_0133657_715_1482 255
583 3300046678 Ga0495599_0065381 Ga0495599_0065381_709_1476 255
584 3300046678 Ga0495599_0070330 Ga0495599_0070330_356_1123 255
585 3300046678 Ga0495599_0129731 Ga0495599_0129731_315_1082 255
586 3300046678 Ga0495599_0198107 Ga0495599_0198107_127_894 255
587 3300046679 Ga0495623_0075178 Ga0495623_0075178_853_1620 255
588 3300046679 Ga0495623_0075328 Ga0495623_0075328_864_1631 255
589 3300046679 Ga0495623_0130720 Ga0495623_0130720_77_844 255
590 3300046680 Ga0495646_0073701 Ga0495646_0073701_327_1094 255
591 3300046683 Ga0495658_0002818 Ga0495658_0002818_2239_3006 255
592 3300046683 Ga0495658_0004955 Ga0495658_0004955_3813_4580 255
593 3300046683 Ga0495658_0077825 Ga0495658_0077825_742_1509 255
594 3300046683 Ga0495658_0233716 Ga0495658_0233716_66_833 255
595 3300046689 Ga0495613_0002807 Ga0495613_0002807_2611_3378 255
596 3300046689 Ga0495613_0012232 Ga0495613_0012232_4170_4937 255
597 3300046689 Ga0495613_0122236 Ga0495613_0122236_944_1711 255
598 3300046689 Ga0495613_0244944 Ga0495613_0244944_228_995 255
599 3300046690 Ga0495624_0003083 Ga0495624_0003083_1181_1948 255
600 3300046809 Ga0495600_0172365 Ga0495600_0172365_159_926 255
601 3300047315 Ga0495581_0001629 Ga0495581_0001629_9511_10278 255
602 3300047315 Ga0495581_0069125 Ga0495581_0069125_833_1600 255
603 3300047317 Ga0495604_0188325 Ga0495604_0188325_407_1174 255
604 3300047319 Ga0495674_0000604 Ga0495674_0000604_8081_8848 255
605 3300047319 Ga0495674_0014819 Ga0495674_0014819_5465_6232 255
606 3300047319 Ga0495674_0071641 Ga0495674_0071641_2195_2962 255
607 3300047319 Ga0495674_0099515 Ga0495674_0099515_703_1470 255
608 3300047319 Ga0495674_0193304 Ga0495674_0193304_176_943 255
609 3300047321 Ga0495676_0005988 Ga0495676_0005988_6864_7631 255
610 3300047321 Ga0495676_0033632 Ga0495676_0033632_768_1535 255
611 3300047322 Ga0495680_0001294 Ga0495680_0001294_24836_25603 255
612 3300047322 Ga0495680_0045915 Ga0495680_0045915_1212_1979 255
613 3300047322 Ga0495680_0092680 Ga0495680_0092680_998_1765 255
614 3300047444 Ga0495675_0053040 Ga0495675_0053040_1044_1811 255
615 3300047444 Ga0495675_0236048 Ga0495675_0236048_302_1069 255
616 3300047471 Ga0495684_0003459 Ga0495684_0003459_680_1447 255
617 3300047471 Ga0495684_0014928 Ga0495684_0014928_3539_4306 255
618 3300047471 Ga0495684_0113633 Ga0495684_0113633_1083_1850 255
619 3300048088 Ga0495602_0089556 Ga0495602_0089556_615_1382 255
620 3300048088 Ga0495602_0093372 Ga0495602_0093372_956_1723 255
621 3300048088 Ga0495602_0237503 Ga0495602_0237503_261_1028 255
622 3300048088 Ga0495602_0272659 Ga0495602_0272659_453_1220 255
623 3300048089 Ga0495614_0053543 Ga0495614_0053543_422_1189 255
624 3300048903 Ga0496100_0006166 Ga0496100_0006166_1684_2451 255
625 3300048903 Ga0496100_0045937 Ga0496100_0045937_555_1322 255
626 3300048903 Ga0496100_0161348 Ga0496100_0161348_759_1526 255
627 3300048904 Ga0496101_0001648 Ga0496101_0001648_8350_9117 255
628 3300048904 Ga0496101_0002848 Ga0496101_0002848_7141_7908 255
629 3300048904 Ga0496101_0060791 Ga0496101_0060791_914_1681 255
630 3300048904 Ga0496101_0081773 Ga0496101_0081773_1603_2370 255
631 3300048905 Ga0496102_0013692 Ga0496102_0013692_5672_6439 255
632 3300048905 Ga0496102_0074671 Ga0496102_0074671_80_847 255
633 3300048905 Ga0496102_0209630 Ga0496102_0209630_651_1418 255
634 3300048906 Ga0496103_0003789 Ga0496103_0003789_4002_4769 255
635 3300048906 Ga0496103_0057042 Ga0496103_0057042_606_1373 255
636 3300048906 Ga0496103_0149993 Ga0496103_0149993_115_882 255
637 3300048907 Ga0496104_0000188 Ga0496104_0000188_5459_6226 255
638 3300048907 Ga0496104_0003035 Ga0496104_0003035_7998_8765 255
639 3300048907 Ga0496104_0005264 Ga0496104_0005264_1410_2177 255
640 3300048907 Ga0496104_0014260 Ga0496104_0014260_2733_3512 255
641 3300048907 Ga0496104_0018343 Ga0496104_0018343_3300_4067 255
642 3300048907 Ga0496104_0071653 Ga0496104_0071653_119_886 255
643 3300048907 Ga0496104_0084751 Ga0496104_0084751_1167_1934 255
644 3300048908 Ga0496105_0000413 Ga0496105_0000413_10833_11600 255
645 3300048908 Ga0496105_0005539 Ga0496105_0005539_8240_9007 255
646 3300048908 Ga0496105_0029849 Ga0496105_0029849_1902_2669 255
647 3300048908 Ga0496105_0042692 Ga0496105_0042692_2519_3286 255
648 3300048908 Ga0496105_0081376 Ga0496105_0081376_70_837 255
649 3300048908 Ga0496105_0365581 Ga0496105_0365581_325_1092 255
650 3300048908 Ga0496105_0423328 Ga0496105_0423328_260_1027 255
651 3300048909 Ga0496106_0000380 Ga0496106_0000380_1155_1922 255
652 3300048909 Ga0496106_0109377 Ga0496106_0109377_1193_1960 255
653 3300048909 Ga0496106_0113327 Ga0496106_0113327_606_1373 255
654 3300048909 Ga0496106_0206411 Ga0496106_0206411_620_1387 255
655 3300048910 Ga0496107_0002348 Ga0496107_0002348_7727_8494 255
656 3300048910 Ga0496107_0023614 Ga0496107_0023614_956_1723 255
657 3300048910 Ga0496107_0061268 Ga0496107_0061268_1395_2162 255
658 3300048910 Ga0496107_0328701 Ga0496107_0328701_58_825 255
659 3300048911 Ga0496108_0002556 Ga0496108_0002556_8294_9061 255
660 3300048911 Ga0496108_0009595 Ga0496108_0009595_788_1555 255
661 3300048911 Ga0496108_0042016 Ga0496108_0042016_1047_1814 255
662 3300048911 Ga0496108_0235031 Ga0496108_0235031_166_933 255
663 3300048911 Ga0496108_0407882 Ga0496108_0407882_115_882 255
664 3300048912 Ga0496109_0002346 Ga0496109_0002346_8408_9175 255
665 3300048912 Ga0496109_0020416 Ga0496109_0020416_2446_3213 255
666 3300048912 Ga0496109_0029868 Ga0496109_0029868_2187_2954 255
667 3300048912 Ga0496109_0148976 Ga0496109_0148976_785_1552 255
668 3300048913 Ga0496110_0005633 Ga0496110_0005633_8735_9502 255
669 3300048913 Ga0496110_0011527 Ga0496110_0011527_2600_3367 255
670 3300048913 Ga0496110_0038121 Ga0496110_0038121_684_1451 255
671 3300048913 Ga0496110_0115522 Ga0496110_0115522_999_1766 255
672 3300048913 Ga0496110_0120683 Ga0496110_0120683_1533_2300 255
673 3300048914 Ga0496111_0001194 Ga0496111_0001194_6573_7340 255
674 3300048914 Ga0496111_0035054 Ga0496111_0035054_1717_2484 255
675 3300048914 Ga0496111_0059001 Ga0496111_0059001_1470_2237 255
676 3300048915 Ga0496112_0000307 Ga0496112_0000307_11645_12412 255
677 3300048915 Ga0496112_0002174 Ga0496112_0002174_1099_1866 255
678 3300048915 Ga0496112_0014425 Ga0496112_0014425_5704_6471 255
679 3300048915 Ga0496112_0180594 Ga0496112_0180594_660_1427 255
680 3300048915 Ga0496112_0355812 Ga0496112_0355812_417_1184 255
681 3300048915 Ga0496112_0589703 Ga0496112_0589703_234_1007 255
682 3300048916 Ga0496113_0000192 Ga0496113_0000192_17777_18544 255
683 3300048916 Ga0496113_0026625 Ga0496113_0026625_2609_3376 255
684 3300048916 Ga0496113_0540332 Ga0496113_0540332_94_861 255
685 3300048917 Ga0496114_0001026 Ga0496114_0001026_7636_8403 255
686 3300048917 Ga0496114_0003757 Ga0496114_0003757_5018_5785 255
687 3300048917 Ga0496114_0013129 Ga0496114_0013129_1010_1777 255
688 3300048918 Ga0496115_0000307 Ga0496115_0000307_16798_17565 255
689 3300048918 Ga0496115_0002915 Ga0496115_0002915_5959_6726 255
690 3300048918 Ga0496115_0037455 Ga0496115_0037455_2445_3212 255
691 3300048918 Ga0496115_0079838 Ga0496115_0079838_1016_1783 255
692 3300048918 Ga0496115_0082496 Ga0496115_0082496_560_1327 255
693 3300048918 Ga0496115_0398865 Ga0496115_0398865_56_823 255
694 3300048918 Ga0496115_0402829 Ga0496115_0402829_123_890 255
695 3300049571 Ga0501034_0109772 Ga0501034_0109772_574_1341 255
696 3300049578 Ga0501042_0382013 Ga0501042_0382013_145_912 255
697 3300049581 Ga0501047_0025018 Ga0501047_0025018_423_1190 255
698 3300049581 Ga0501047_0106833 Ga0501047_0106833_1857_2624 255
699 3300049582 Ga0501048_0435783 Ga0501048_0435783_124_891 255
700 3300049585 Ga0501069_0031400 Ga0501069_0031400_297_1064 255
701 3300049585 Ga0501069_0123768 Ga0501069_0123768_228_995 255
702 3300049585 Ga0501069_0143064 Ga0501069_0143064_298_1065 255
703 3300049586 Ga0501070_0668289 Ga0501070_0668289_29_796 255
704 3300049589 Ga0501073_0222779 Ga0501073_0222779_509_1276 255
705 3300049589 Ga0501073_0444456 Ga0501073_0444456_43_810 255
706 3300049590 Ga0501074_0098357 Ga0501074_0098357_1257_2024 255
707 3300049590 Ga0501074_0117793 Ga0501074_0117793_373_1140 255
708 3300049590 Ga0501074_0149905 Ga0501074_0149905_803_1570 255
709 3300049593 Ga0501077_0113433 Ga0501077_0113433_313_1080 255
710 3300049741 Ga0501079_0078772 Ga0501079_0078772_440_1207 255
711 3300049742 Ga0501080_0097169 Ga0501080_0097169_198_965 255
712 3300049742 Ga0501080_0435148 Ga0501080_0435148_377_1144 255
713 3300050512 nmdc:mga0n895_464058_c1 nmdc:mga0n895_464058_c1_406_1173 255
714 3300050513 nmdc:mga0rr50_40874_c1 nmdc:mga0rr50_40874_c1_18_785 255
715 3300050515 nmdc:mga0a205_27721_c1 nmdc:mga0a205_27721_c1_16_783 255
716 3300053077 Ga0495601_0024608 Ga0495601_0024608_2200_2967 255
717 3300053077 Ga0495601_0144163 Ga0495601_0144163_205_972 255
718 3300053078 Ga0495612_0065026 Ga0495612_0065026_415_1182 255
719 3300053083 Ga0495655_0000926 Ga0495655_0000926_2167_2934 255
720 3300053083 Ga0495655_0001216 Ga0495655_0001216_1219_1986 255
721 3300053084 Ga0495595_0005011 Ga0495595_0005011_1744_2511 255
722 3300053084 Ga0495595_0122088 Ga0495595_0122088_202_969 255
723 3300053085 Ga0495619_0003130 Ga0495619_0003130_7492_8259 255
724 3300053085 Ga0495619_0230677 Ga0495619_0230677_153_920 255
725 3300054114 Ga0501084_0065561 Ga0501084_0065561_1561_2328 255
726 3300061719 Ga0466962_0004873 Ga0466962_0004873_663_1430 255
727 3300061719 Ga0466962_0012256 Ga0466962_0012256_1659_2426 255
728 3300061719 Ga0466962_0182991 Ga0466962_0182991_204_1010 255
729 3300048913 Ga0496110_0283619 Ga0496110_0283619_159_947 256
730 3300001989 JGI24739J22299_10032072 JGI24739J22299_100320723 257
731 3300001991 JGI24743J22301_10004088 JGI24743J22301_100040884 257
732 3300002075 JGI24738J21930_10013484 JGI24738J21930_100134843 257
733 3300002077 JGI24744J21845_10010742 JGI24744J21845_100107421 257
734 3300002077 JGI24744J21845_10015692 JGI24744J21845_100156921 257
735 3300002155 JGI24033J26618_1009698 JGI24033J26618_10096981 257
736 3300003373 JGI25407J50210_10012870 JGI25407J50210_100128702 257
737 3300003373 JGI25407J50210_10019135 JGI25407J50210_100191353 257
738 3300003373 JGI25407J50210_10070894 JGI25407J50210_100708941 257
739 3300005329 Ga0070683_100135504 Ga0070683_1001355044 257
740 3300005329 Ga0070683_100200893 Ga0070683_1002008933 257
741 3300005329 Ga0070683_100270508 Ga0070683_1002705082 257
742 3300005334 Ga0068869_100473325 Ga0068869_1004733252 257
743 3300005339 Ga0070660_100050415 Ga0070660_1000504153 257
744 3300005340 Ga0070689_100004845 Ga0070689_1000048454 257
745 3300005343 Ga0070687_100026372 Ga0070687_1000263723 257
746 3300005345 Ga0070692_10109838 Ga0070692_101098382 257
747 3300005347 Ga0070668_100123057 Ga0070668_1001230572 257
748 3300005353 Ga0070669_100472114 Ga0070669_1004721142 257
749 3300005355 Ga0070671_100395684 Ga0070671_1003956842 257
750 3300005356 Ga0070674_100279038 Ga0070674_1002790382 257
751 3300005364 Ga0070673_100093932 Ga0070673_1000939322 257
752 3300005365 Ga0070688_100000622 Ga0070688_10000062213 257
753 3300005366 Ga0070659_100185037 Ga0070659_1001850372 257
754 3300005455 Ga0070663_100079585 Ga0070663_1000795854 257
755 3300005456 Ga0070678_100112538 Ga0070678_1001125383 257
756 3300005457 Ga0070662_100226865 Ga0070662_1002268652 257
757 3300005459 Ga0068867_100033342 Ga0068867_1000333424 257
758 3300005466 Ga0070685_10003403 Ga0070685_100034038 257
759 3300005466 Ga0070685_10124066 Ga0070685_101240661 257
760 3300005535 Ga0070684_100058574 Ga0070684_1000585745 257
761 3300005535 Ga0070684_100307441 Ga0070684_1003074413 257
762 3300005543 Ga0070672_100024810 Ga0070672_1000248102 257
763 3300005543 Ga0070672_100025873 Ga0070672_1000258736 257
764 3300005546 Ga0070696_100328704 Ga0070696_1003287042 257
765 3300005547 Ga0070693_100006766 Ga0070693_1000067666 257
766 3300005548 Ga0070665_100125332 Ga0070665_1001253324 257
767 3300005549 Ga0070704_100069436 Ga0070704_1000694362 257
768 3300005549 Ga0070704_100124352 Ga0070704_1001243523 257
769 3300005564 Ga0070664_100106665 Ga0070664_1001066653 257
770 3300005564 Ga0070664_100182154 Ga0070664_1001821542 257
771 3300005577 Ga0068857_100118887 Ga0068857_1001188872 257
772 3300005578 Ga0068854_100062975 Ga0068854_1000629754 257
773 3300005614 Ga0068856_100028748 Ga0068856_1000287484 257
774 3300005615 Ga0070702_100006091 Ga0070702_1000060913 257
775 3300005616 Ga0068852_100281862 Ga0068852_1002818623 257
776 3300005718 Ga0068866_10046914 Ga0068866_100469144 257
777 3300005840 Ga0068870_10038143 Ga0068870_100381433 257
778 3300005841 Ga0068863_100079276 Ga0068863_1000792764 257
779 3300005842 Ga0068858_100035180 Ga0068858_1000351804 257
780 3300005843 Ga0068860_100145206 Ga0068860_1001452062 257
781 3300005937 Ga0081455_10099399 Ga0081455_100993993 257
782 3300005937 Ga0081455_10135191 Ga0081455_101351912 257
783 3300005981 Ga0081538_10000053 Ga0081538_100000537 257
784 3300005981 Ga0081538_10001619 Ga0081538_1000161913 257
785 3300005981 Ga0081538_10003876 Ga0081538_100038765 257
786 3300005981 Ga0081538_10085773 Ga0081538_100857732 257
787 3300006058 Ga0075432_10046483 Ga0075432_100464833 257
788 3300006358 Ga0068871_100369116 Ga0068871_1003691162 257
789 3300006844 Ga0075428_100005096 Ga0075428_10000509614 257
790 3300006844 Ga0075428_100019492 Ga0075428_1000194922 257
791 3300006844 Ga0075428_100535860 Ga0075428_1005358602 257
792 3300006846 Ga0075430_100001646 Ga0075430_10000164617 257
793 3300006847 Ga0075431_100008014 Ga0075431_1000080146 257
794 3300006880 Ga0075429_100011938 Ga0075429_1000119388 257
795 3300006881 Ga0068865_100005904 Ga0068865_10000590410 257
796 3300009036 Ga0105244_10164476 Ga0105244_101644761 257
797 3300009094 Ga0111539_10006234 Ga0111539_1000623417 257
798 3300009094 Ga0111539_10026000 Ga0111539_100260005 257
799 3300009094 Ga0111539_10259796 Ga0111539_102597963 257
800 3300009094 Ga0111539_10894264 Ga0111539_108942642 257
801 3300009098 Ga0105245_10414208 Ga0105245_104142083 257
802 3300009098 Ga0105245_10726400 Ga0105245_107264002 257
803 3300009098 Ga0105245_10868041 Ga0105245_108680411 257
804 3300009101 Ga0105247_10031890 Ga0105247_100318903 257
805 3300009101 Ga0105247_10130276 Ga0105247_101302763 257
806 3300009147 Ga0114129_10041736 Ga0114129_100417365 257
807 3300009147 Ga0114129_10059915 Ga0114129_100599155 257
808 3300009147 Ga0114129_10710552 Ga0114129_107105522 257
809 3300009174 Ga0105241_10399936 Ga0105241_103999361 257
810 3300009176 Ga0105242_10038126 Ga0105242_100381264 257
811 3300009176 Ga0105242_10533360 Ga0105242_105333602 257
812 3300009177 Ga0105248_10481304 Ga0105248_104813042 257
813 3300010375 Ga0105239_10023094 Ga0105239_100230946 257
814 3300010375 Ga0105239_10060540 Ga0105239_100605404 257
815 3300011119 Ga0105246_10015487 Ga0105246_100154872 257
816 3300013105 Ga0157369_10046905 Ga0157369_100469054 257
817 3300013306 Ga0163162_10427020 Ga0163162_104270201 257
818 3300013307 Ga0157372_10255136 Ga0157372_102551362 257
819 3300013307 Ga0157372_10463449 Ga0157372_104634492 257
820 3300013308 Ga0157375_10014615 Ga0157375_100146155 257
821 3300013308 Ga0157375_10575488 Ga0157375_105754881 257
822 3300014325 Ga0163163_10041946 Ga0163163_100419465 257
823 3300014325 Ga0163163_10116876 Ga0163163_101168763 257
824 3300014326 Ga0157380_10014017 Ga0157380_100140176 257
825 3300014326 Ga0157380_10034055 Ga0157380_100340557 257
826 3300014326 Ga0157380_10080696 Ga0157380_100806962 257
827 3300014968 Ga0157379_10068549 Ga0157379_100685494 257
828 3300017792 Ga0163161_10040750 Ga0163161_100407504 257
829 3300025899 Ga0207642_10082910 Ga0207642_100829102 257
830 3300025899 Ga0207642_10083670 Ga0207642_100836703 257
831 3300025900 Ga0207710_10034316 Ga0207710_100343163 257
832 3300025907 Ga0207645_10042757 Ga0207645_100427573 257
833 3300025908 Ga0207643_10011125 Ga0207643_100111254 257
834 3300025908 Ga0207643_10053201 Ga0207643_100532013 257
835 3300025911 Ga0207654_10056324 Ga0207654_100563244 257
836 3300025912 Ga0207707_10232339 Ga0207707_102323392 257
837 3300025919 Ga0207657_10015819 Ga0207657_100158192 257
838 3300025920 Ga0207649_10026660 Ga0207649_100266605 257
839 3300025921 Ga0207652_10329969 Ga0207652_103299692 257
840 3300025923 Ga0207681_10424348 Ga0207681_104243482 257
841 3300025924 Ga0207694_10157213 Ga0207694_101572134 257
842 3300025927 Ga0207687_10169103 Ga0207687_101691032 257
843 3300025931 Ga0207644_10266247 Ga0207644_102662472 257
844 3300025932 Ga0207690_10038356 Ga0207690_100383562 257
845 3300025934 Ga0207686_10087634 Ga0207686_100876342 257
846 3300025936 Ga0207670_10099191 Ga0207670_100991911 257
847 3300025937 Ga0207669_10165568 Ga0207669_101655683 257
848 3300025938 Ga0207704_10032534 Ga0207704_100325344 257
849 3300025940 Ga0207691_10037730 Ga0207691_100377306 257
850 3300025941 Ga0207711_10084135 Ga0207711_100841352 257
851 3300025942 Ga0207689_10146634 Ga0207689_101466342 257
852 3300025944 Ga0207661_10207740 Ga0207661_102077403 257
853 3300025945 Ga0207679_10087018 Ga0207679_100870183 257
854 3300025960 Ga0207651_10238499 Ga0207651_102384992 257
855 3300025961 Ga0207712_10379298 Ga0207712_103792982 257
856 3300025972 Ga0207668_10612357 Ga0207668_106123572 257
857 3300025981 Ga0207640_10014605 Ga0207640_100146054 257
858 3300025981 Ga0207640_10033043 Ga0207640_100330434 257
859 3300025986 Ga0207658_10126294 Ga0207658_101262943 257
860 3300026067 Ga0207678_10365984 Ga0207678_103659843 257
861 3300026088 Ga0207641_10054555 Ga0207641_100545552 257
862 3300026089 Ga0207648_10065063 Ga0207648_100650633 257
863 3300026095 Ga0207676_10016301 Ga0207676_100163019 257
864 3300026116 Ga0207674_10049525 Ga0207674_100495254 257
865 3300026118 Ga0207675_100011398 Ga0207675_1000113983 257
866 3300026118 Ga0207675_100150180 Ga0207675_1001501802 257
867 3300026121 Ga0207683_10037573 Ga0207683_100375736 257
868 3300026121 Ga0207683_10097515 Ga0207683_100975154 257
869 3300027907 Ga0207428_10007111 Ga0207428_100071116 257
870 3300027907 Ga0207428_10022197 Ga0207428_100221975 257
871 3300027907 Ga0207428_10289215 Ga0207428_102892152 257
872 3300028379 Ga0268266_10041268 Ga0268266_100412683 257
873 3300028380 Ga0268265_10202773 Ga0268265_102027732 257
874 3300028381 Ga0268264_10192627 Ga0268264_101926271 257
875 3300031548 Ga0307408_100194268 Ga0307408_1001942683 257
876 3300031903 Ga0307407_10260407 Ga0307407_102604072 257
877 3300032002 Ga0307416_100332500 Ga0307416_1003325002 257
878 3300032002 Ga0307416_100359604 Ga0307416_1003596043 257
879 3300034957 Ga0373938_0012473 Ga0373938_0012473_47_820 257
880 3300035091 Ga0373951_0009786 Ga0373951_0009786_553_1326 257
881 3300035092 Ga0373952_0010306 Ga0373952_0010306_750_1523 257
882 3300035115 Ga0373941_0112181 Ga0373941_0112181_157_930 257
883 3300035121 Ga0373960_0012535 Ga0373960_0012535_98_871 257
884 3300035241 Ga0373961_0014308 Ga0373961_0014308_240_1013 257
885 3300037312 Ga0395899_0039928 Ga0395899_0039928_577_1362 257
886 3300037418 Ga0395900_0001643 Ga0395900_0001643_5995_6780 257
887 3300037418 Ga0395900_0039238 Ga0395900_0039238_1207_1992 257
888 3300037466 Ga0395898_0013457 Ga0395898_0013457_4874_5659 257
889 3300037471 Ga0395905_0003232 Ga0395905_0003232_796_1581 257
890 3300037471 Ga0395905_0367028 Ga0395905_0367028_43_828 257
891 3300038443 Ga0395901_0003358 Ga0395901_0003358_8744_9529 257
892 3300038443 Ga0395901_0018859 Ga0395901_0018859_2804_3589 257
893 3300038443 Ga0395901_0270350 Ga0395901_0270350_330_1124 257
894 3300041410 Ga0439461_0011825 Ga0439461_0011825_288_1073 257
895 3300041411 Ga0439466_0026205 Ga0439466_0026205_575_1360 257
896 3300042000 Ga0439437_002296 Ga0439437_002296_824_1609 257
897 3300042007 Ga0439449_0121727 Ga0439449_0121727_167_952 257
898 3300042009 Ga0439451_003997 Ga0439451_003997_27_803 257
899 3300042011 Ga0439454_008517 Ga0439454_008517_223_1008 257
900 3300042122 Ga0450920_005942 Ga0450920_005942_1005_1790 257
901 3300042122 Ga0450920_021838 Ga0450920_021838_281_1066 257
902 3300042146 Ga0450907_011561 Ga0450907_011561_221_1006 257
903 3300042156 Ga0439446_0001079 Ga0439446_0001079_920_1705 257
904 3300046474 Ga0495605_0117263 Ga0495605_0117263_43_816 257
905 3300046475 Ga0495639_0160703 Ga0495639_0160703_19_792 257
906 3300046515 Ga0495620_0132920 Ga0495620_0132920_125_910 257
907 3300046518 Ga0495631_0123808 Ga0495631_0123808_262_1050 257
908 3300048903 Ga0496100_0272999 Ga0496100_0272999_468_1241 257
909 3300048904 Ga0496101_0201592 Ga0496101_0201592_652_1425 257
910 3300048905 Ga0496102_0396914 Ga0496102_0396914_159_932 257
911 3300048907 Ga0496104_0106996 Ga0496104_0106996_1078_1851 257
912 3300048907 Ga0496104_0142746 Ga0496104_0142746_491_1264 257
913 3300048908 Ga0496105_0020137 Ga0496105_0020137_2902_3675 257
914 3300048909 Ga0496106_0173779 Ga0496106_0173779_902_1675 257
915 3300048910 Ga0496107_0058994 Ga0496107_0058994_789_1562 257
916 3300048911 Ga0496108_0014113 Ga0496108_0014113_3723_4496 257
917 3300048911 Ga0496108_0121679 Ga0496108_0121679_766_1539 257
918 3300048913 Ga0496110_0041928 Ga0496110_0041928_2540_3313 257
919 3300048913 Ga0496110_0090392 Ga0496110_0090392_527_1300 257
920 3300048913 Ga0496110_0102504 Ga0496110_0102504_983_1798 257
921 3300048914 Ga0496111_0003824 Ga0496111_0003824_5214_5987 257
922 3300048915 Ga0496112_0171753 Ga0496112_0171753_1047_1820 257
923 3300048917 Ga0496114_0004276 Ga0496114_0004276_6062_6835 257
924 3300049568 Ga0501031_0007219 Ga0501031_0007219_1787_2587 257
925 3300049568 Ga0501031_0089642 Ga0501031_0089642_1023_1808 257
926 3300049568 Ga0501031_0131442 Ga0501031_0131442_307_1098 257
927 3300049569 Ga0501032_0001182 Ga0501032_0001182_13888_14688 257
928 3300049569 Ga0501032_0032342 Ga0501032_0032342_1726_2499 257
929 3300049569 Ga0501032_0110688 Ga0501032_0110688_619_1422 257
930 3300049570 Ga0501033_0001160 Ga0501033_0001160_2089_2889 257
931 3300049570 Ga0501033_0130903 Ga0501033_0130903_396_1199 257
932 3300049571 Ga0501034_0257213 Ga0501034_0257213_225_1028 257
933 3300049571 Ga0501034_0471040 Ga0501034_0471040_250_1035 257
934 3300049571 Ga0501034_0728698 Ga0501034_0728698_36_836 257
935 3300049572 Ga0501036_0000750 Ga0501036_0000750_11138_11923 257
936 3300049572 Ga0501036_0000982 Ga0501036_0000982_5044_5844 257
937 3300049572 Ga0501036_0004190 Ga0501036_0004190_9846_10619 257
938 3300049572 Ga0501036_0006322 Ga0501036_0006322_1758_2561 257
939 3300049572 Ga0501036_0023919 Ga0501036_0023919_3589_4389 257
940 3300049572 Ga0501036_0036586 Ga0501036_0036586_481_1254 257
941 3300049572 Ga0501036_0041161 Ga0501036_0041161_1970_2761 257
942 3300049572 Ga0501036_0106066 Ga0501036_0106066_167_967 257
943 3300049572 Ga0501036_0106315 Ga0501036_0106315_1507_2292 257
944 3300049573 Ga0501037_0019670 Ga0501037_0019670_2845_3645 257
945 3300049573 Ga0501037_0026977 Ga0501037_0026977_642_1445 257
946 3300049573 Ga0501037_0065311 Ga0501037_0065311_1735_2535 257
947 3300049574 Ga0501038_0001935 Ga0501038_0001935_15108_15893 257
948 3300049574 Ga0501038_0002315 Ga0501038_0002315_14063_14863 257
949 3300049574 Ga0501038_0033734 Ga0501038_0033734_2858_3658 257
950 3300049574 Ga0501038_0051573 Ga0501038_0051573_1843_2616 257
951 3300049574 Ga0501038_0063560 Ga0501038_0063560_916_1707 257
952 3300049574 Ga0501038_0076331 Ga0501038_0076331_722_1525 257
953 3300049574 Ga0501038_0081299 Ga0501038_0081299_1447_2232 257
954 3300049575 Ga0501039_0000317 Ga0501039_0000317_5053_5853 257
955 3300049575 Ga0501039_0000364 Ga0501039_0000364_5621_6406 257
956 3300049575 Ga0501039_0006406 Ga0501039_0006406_2698_3471 257
957 3300049575 Ga0501039_0007361 Ga0501039_0007361_5336_6136 257
958 3300049575 Ga0501039_0008152 Ga0501039_0008152_5157_5957 257
959 3300049575 Ga0501039_0023521 Ga0501039_0023521_3823_4614 257
960 3300049575 Ga0501039_0048603 Ga0501039_0048603_1566_2339 257
961 3300049575 Ga0501039_0071027 Ga0501039_0071027_392_1195 257
962 3300049575 Ga0501039_0168599 Ga0501039_0168599_282_1082 257
963 3300049576 Ga0501040_0000039 Ga0501040_0000039_53717_54517 257
964 3300049576 Ga0501040_0000524 Ga0501040_0000524_8080_8865 257
965 3300049576 Ga0501040_0001948 Ga0501040_0001948_1692_2492 257
966 3300049576 Ga0501040_0004381 Ga0501040_0004381_8139_8924 257
967 3300049576 Ga0501040_0007266 Ga0501040_0007266_6229_7002 257
968 3300049576 Ga0501040_0010719 Ga0501040_0010719_4666_5466 257
969 3300049576 Ga0501040_0019296 Ga0501040_0019296_710_1510 257
970 3300049576 Ga0501040_0024024 Ga0501040_0024024_1306_2109 257
971 3300049576 Ga0501040_0028099 Ga0501040_0028099_919_1710 257
972 3300049576 Ga0501040_0054781 Ga0501040_0054781_1882_2655 257
973 3300049576 Ga0501040_0225990 Ga0501040_0225990_265_1065 257
974 3300049576 Ga0501040_0287193 Ga0501040_0287193_99_899 257
975 3300049577 Ga0501041_0000291 Ga0501041_0000291_17188_17988 257
976 3300049577 Ga0501041_0001974 Ga0501041_0001974_8053_8838 257
977 3300049577 Ga0501041_0002802 Ga0501041_0002802_1053_1838 257
978 3300049577 Ga0501041_0003315 Ga0501041_0003315_7970_8770 257
979 3300049577 Ga0501041_0007727 Ga0501041_0007727_4675_5475 257
980 3300049577 Ga0501041_0009316 Ga0501041_0009316_4043_4816 257
981 3300049577 Ga0501041_0091007 Ga0501041_0091007_847_1620 257
982 3300049577 Ga0501041_0165773 Ga0501041_0165773_85_885 257
983 3300049577 Ga0501041_0245350 Ga0501041_0245350_179_979 257
984 3300049578 Ga0501042_0000258 Ga0501042_0000258_21114_21914 257
985 3300049578 Ga0501042_0000894 Ga0501042_0000894_8458_9243 257
986 3300049578 Ga0501042_0005192 Ga0501042_0005192_392_1195 257
987 3300049578 Ga0501042_0014135 Ga0501042_0014135_1110_1883 257
988 3300049578 Ga0501042_0020651 Ga0501042_0020651_1736_2536 257
989 3300049578 Ga0501042_0045673 Ga0501042_0045673_1337_2137 257
990 3300049578 Ga0501042_0110691 Ga0501042_0110691_937_1722 257
991 3300049578 Ga0501042_0115515 Ga0501042_0115515_729_1529 257
992 3300049578 Ga0501042_0124081 Ga0501042_0124081_105_878 257
993 3300049578 Ga0501042_0174112 Ga0501042_0174112_633_1433 257
994 3300049578 Ga0501042_0285936 Ga0501042_0285936_44_829 257
995 3300049578 Ga0501042_0295804 Ga0501042_0295804_114_905 257
996 3300049579 Ga0501043_0003344 Ga0501043_0003344_3922_4722 257
997 3300049579 Ga0501043_0021905 Ga0501043_0021905_2541_3314 257
998 3300049579 Ga0501043_0100014 Ga0501043_0100014_660_1463 257
999 3300049579 Ga0501043_0103426 Ga0501043_0103426_252_1037 257
1000 3300049579 Ga0501043_0152466 Ga0501043_0152466_513_1313 257
1001 3300049579 Ga0501043_0239699 Ga0501043_0239699_31_822 257
1002 3300049579 Ga0501043_0390522 Ga0501043_0390522_226_1011 257
1003 3300049580 Ga0501046_0006475 Ga0501046_0006475_5051_5851 257
1004 3300049580 Ga0501046_0007866 Ga0501046_0007866_7146_7919 257
1005 3300049580 Ga0501046_0013629 Ga0501046_0013629_1319_2122 257
1006 3300049580 Ga0501046_0038072 Ga0501046_0038072_1378_2151 257
1007 3300049580 Ga0501046_0049648 Ga0501046_0049648_2289_3089 257
1008 3300049580 Ga0501046_0053855 Ga0501046_0053855_117_902 257
1009 3300049580 Ga0501046_0150718 Ga0501046_0150718_177_968 257
1010 3300049580 Ga0501046_0167311 Ga0501046_0167311_370_1170 257
1011 3300049581 Ga0501047_0046030 Ga0501047_0046030_2239_3039 257
1012 3300049581 Ga0501047_0117116 Ga0501047_0117116_1021_1824 257
1013 3300049582 Ga0501048_0001067 Ga0501048_0001067_7342_8127 257
1014 3300049582 Ga0501048_0002786 Ga0501048_0002786_5282_6085 257
1015 3300049582 Ga0501048_0004532 Ga0501048_0004532_9239_10012 257
1016 3300049582 Ga0501048_0011653 Ga0501048_0011653_5505_6278 257
1017 3300049582 Ga0501048_0012860 Ga0501048_0012860_1337_2137 257
1018 3300049582 Ga0501048_0018685 Ga0501048_0018685_3347_4132 257
1019 3300049582 Ga0501048_0023252 Ga0501048_0023252_3544_4344 257
1020 3300049582 Ga0501048_0040337 Ga0501048_0040337_1210_2010 257
1021 3300049582 Ga0501048_0054022 Ga0501048_0054022_275_1060 257
1022 3300049582 Ga0501048_0107743 Ga0501048_0107743_789_1580 257
1023 3300049582 Ga0501048_0135138 Ga0501048_0135138_701_1501 257
1024 3300049583 Ga0501067_0031503 Ga0501067_0031503_817_1620 257
1025 3300049583 Ga0501067_0075356 Ga0501067_0075356_689_1462 257
1026 3300049584 Ga0501068_0001596 Ga0501068_0001596_6210_7010 257
1027 3300049584 Ga0501068_0011225 Ga0501068_0011225_3654_4427 257
1028 3300049584 Ga0501068_0011823 Ga0501068_0011823_1851_2624 257
1029 3300049584 Ga0501068_0033330 Ga0501068_0033330_830_1630 257
1030 3300049584 Ga0501068_0038221 Ga0501068_0038221_1633_2418 257
1031 3300049584 Ga0501068_0039534 Ga0501068_0039534_1304_2107 257
1032 3300049584 Ga0501068_0224488 Ga0501068_0224488_63_848 257
1033 3300049585 Ga0501069_0001903 Ga0501069_0001903_3449_4249 257
1034 3300049585 Ga0501069_0016558 Ga0501069_0016558_1216_1989 257
1035 3300049585 Ga0501069_0081977 Ga0501069_0081977_396_1199 257
1036 3300049586 Ga0501070_0036445 Ga0501070_0036445_2290_3063 257
1037 3300049586 Ga0501070_0044821 Ga0501070_0044821_624_1409 257
1038 3300049586 Ga0501070_0269133 Ga0501070_0269133_67_852 257
1039 3300049587 Ga0501071_0000033 Ga0501071_0000033_23786_24571 257
1040 3300049587 Ga0501071_0002214 Ga0501071_0002214_6214_7014 257
1041 3300049587 Ga0501071_0003153 Ga0501071_0003153_3940_4740 257
1042 3300049587 Ga0501071_0026212 Ga0501071_0026212_1306_2109 257
1043 3300049587 Ga0501071_0028624 Ga0501071_0028624_1990_2790 257
1044 3300049587 Ga0501071_0035549 Ga0501071_0035549_1129_1914 257
1045 3300049587 Ga0501071_0050230 Ga0501071_0050230_494_1267 257
1046 3300049587 Ga0501071_0058780 Ga0501071_0058780_102_902 257
1047 3300049587 Ga0501071_0130074 Ga0501071_0130074_557_1357 257
1048 3300049588 Ga0501072_0000837 Ga0501072_0000837_17922_18722 257
1049 3300049588 Ga0501072_0001414 Ga0501072_0001414_11745_12530 257
1050 3300049588 Ga0501072_0001579 Ga0501072_0001579_12183_12983 257
1051 3300049588 Ga0501072_0005441 Ga0501072_0005441_5401_6201 257
1052 3300049588 Ga0501072_0007502 Ga0501072_0007502_509_1312 257
1053 3300049588 Ga0501072_0045353 Ga0501072_0045353_2618_3391 257
1054 3300049588 Ga0501072_0078873 Ga0501072_0078873_1505_2296 257
1055 3300049588 Ga0501072_0081590 Ga0501072_0081590_154_939 257
1056 3300049588 Ga0501072_0085185 Ga0501072_0085185_513_1313 257
1057 3300049588 Ga0501072_0128313 Ga0501072_0128313_398_1186 257
1058 3300049589 Ga0501073_0009166 Ga0501073_0009166_103_903 257
1059 3300049590 Ga0501074_0000235 Ga0501074_0000235_5045_5845 257
1060 3300049590 Ga0501074_0001738 Ga0501074_0001738_11353_12138 257
1061 3300049590 Ga0501074_0012633 Ga0501074_0012633_619_1422 257
1062 3300049590 Ga0501074_0018260 Ga0501074_0018260_824_1609 257
1063 3300049590 Ga0501074_0121577 Ga0501074_0121577_294_1067 257
1064 3300049590 Ga0501074_0456125 Ga0501074_0456125_21_821 257
1065 3300049591 Ga0501075_0000893 Ga0501075_0000893_14626_15411 257
1066 3300049591 Ga0501075_0006562 Ga0501075_0006562_1343_2143 257
1067 3300049591 Ga0501075_0012322 Ga0501075_0012322_3753_4538 257
1068 3300049591 Ga0501075_0015474 Ga0501075_0015474_728_1528 257
1069 3300049591 Ga0501075_0017158 Ga0501075_0017158_3789_4589 257
1070 3300049591 Ga0501075_0018610 Ga0501075_0018610_2491_3282 257
1071 3300049591 Ga0501075_0024351 Ga0501075_0024351_2316_3119 257
1072 3300049591 Ga0501075_0044871 Ga0501075_0044871_1261_2061 257
1073 3300049591 Ga0501075_0061712 Ga0501075_0061712_264_1037 257
1074 3300049592 Ga0501076_0002834 Ga0501076_0002834_4482_5267 257
1075 3300049592 Ga0501076_0004808 Ga0501076_0004808_4923_5723 257
1076 3300049592 Ga0501076_0010423 Ga0501076_0010423_3205_3978 257
1077 3300049592 Ga0501076_0045490 Ga0501076_0045490_2543_3343 257
1078 3300049592 Ga0501076_0049222 Ga0501076_0049222_1224_2027 257
1079 3300049592 Ga0501076_0056608 Ga0501076_0056608_1024_1809 257
1080 3300049592 Ga0501076_0071667 Ga0501076_0071667_1216_1989 257
1081 3300049592 Ga0501076_0100404 Ga0501076_0100404_1337_2137 257
1082 3300049592 Ga0501076_0117512 Ga0501076_0117512_996_1796 257
1083 3300049592 Ga0501076_0132895 Ga0501076_0132895_169_942 257
1084 3300049592 Ga0501076_0184625 Ga0501076_0184625_255_1055 257
1085 3300049592 Ga0501076_0207385 Ga0501076_0207385_360_1160 257
1086 3300049592 Ga0501076_0493106 Ga0501076_0493106_195_995 257
1087 3300049593 Ga0501077_0003176 Ga0501077_0003176_1127_1912 257
1088 3300049593 Ga0501077_0006263 Ga0501077_0006263_5311_6111 257
1089 3300049593 Ga0501077_0006855 Ga0501077_0006855_5540_6340 257
1090 3300049593 Ga0501077_0013641 Ga0501077_0013641_3909_4694 257
1091 3300049593 Ga0501077_0014691 Ga0501077_0014691_1680_2480 257
1092 3300049593 Ga0501077_0022735 Ga0501077_0022735_1759_2532 257
1093 3300049593 Ga0501077_0024871 Ga0501077_0024871_2048_2821 257
1094 3300049593 Ga0501077_0047200 Ga0501077_0047200_628_1428 257
1095 3300049593 Ga0501077_0066364 Ga0501077_0066364_432_1205 257
1096 3300049593 Ga0501077_0071464 Ga0501077_0071464_641_1441 257
1097 3300049741 Ga0501079_0000130 Ga0501079_0000130_29152_29937 257
1098 3300049741 Ga0501079_0001508 Ga0501079_0001508_6124_6909 257
1099 3300049741 Ga0501079_0003750 Ga0501079_0003750_15_815 257
1100 3300049741 Ga0501079_0005359 Ga0501079_0005359_968_1768 257
1101 3300049741 Ga0501079_0005449 Ga0501079_0005449_1319_2122 257
1102 3300049741 Ga0501079_0008306 Ga0501079_0008306_1420_2193 257
1103 3300049741 Ga0501079_0036298 Ga0501079_0036298_2397_3197 257
1104 3300049741 Ga0501079_0041273 Ga0501079_0041273_15_815 257
1105 3300049741 Ga0501079_0043045 Ga0501079_0043045_2116_2889 257
1106 3300049741 Ga0501079_0049423 Ga0501079_0049423_74_865 257
1107 3300049741 Ga0501079_0160792 Ga0501079_0160792_284_1084 257
1108 3300049741 Ga0501079_0551389 Ga0501079_0551389_51_836 257
1109 3300049742 Ga0501080_0005311 Ga0501080_0005311_4875_5675 257
1110 3300049742 Ga0501080_0006151 Ga0501080_0006151_6469_7254 257
1111 3300049742 Ga0501080_0044862 Ga0501080_0044862_2357_3130 257
1112 3300049742 Ga0501080_0254688 Ga0501080_0254688_789_1589 257
1113 3300049743 Ga0501081_0000313 Ga0501081_0000313_3325_4125 257
1114 3300049743 Ga0501081_0026522 Ga0501081_0026522_255_1040 257
1115 3300049743 Ga0501081_0031393 Ga0501081_0031393_2073_2873 257
1116 3300049743 Ga0501081_0049954 Ga0501081_0049954_1028_1828 257
1117 3300049743 Ga0501081_0051817 Ga0501081_0051817_1306_2109 257
1118 3300049743 Ga0501081_0054448 Ga0501081_0054448_1976_2749 257
1119 3300049743 Ga0501081_0114333 Ga0501081_0114333_827_1627 257
1120 3300049743 Ga0501081_0285355 Ga0501081_0285355_225_1025 257
1121 3300049743 Ga0501081_0493967 Ga0501081_0493967_61_861 257
1122 3300049744 Ga0501083_0000058 Ga0501083_0000058_38189_38989 257
1123 3300049744 Ga0501083_0011370 Ga0501083_0011370_1624_2397 257
1124 3300049744 Ga0501083_0133777 Ga0501083_0133777_618_1418 257
1125 3300049744 Ga0501083_0187185 Ga0501083_0187185_307_1107 257
1126 3300049744 Ga0501083_0281683 Ga0501083_0281683_179_952 257
1127 3300049822 Ga0501035_0002449 Ga0501035_0002449_6169_6954 257
1128 3300049822 Ga0501035_0014714 Ga0501035_0014714_6252_7025 257
1129 3300049822 Ga0501035_0016047 Ga0501035_0016047_5062_5862 257
1130 3300049822 Ga0501035_0048080 Ga0501035_0048080_257_1060 257
1131 3300049822 Ga0501035_0057549 Ga0501035_0057549_833_1633 257
1132 3300049822 Ga0501035_0108471 Ga0501035_0108471_152_925 257
1133 3300049822 Ga0501035_0118208 Ga0501035_0118208_597_1382 257
1134 3300049822 Ga0501035_0160066 Ga0501035_0160066_916_1716 257
1135 3300049823 Ga0501044_0017898 Ga0501044_0017898_3990_4790 257
1136 3300049823 Ga0501044_0034640 Ga0501044_0034640_1021_1824 257
1137 3300049823 Ga0501044_0040304 Ga0501044_0040304_1661_2434 257
1138 3300049824 Ga0501045_0000191 Ga0501045_0000191_26977_27762 257
1139 3300049824 Ga0501045_0000429 Ga0501045_0000429_8318_9103 257
1140 3300049824 Ga0501045_0005703 Ga0501045_0005703_4093_4893 257
1141 3300049824 Ga0501045_0007997 Ga0501045_0007997_1485_2285 257
1142 3300049824 Ga0501045_0018931 Ga0501045_0018931_543_1343 257
1143 3300049824 Ga0501045_0040167 Ga0501045_0040167_1423_2223 257
1144 3300049824 Ga0501045_0047217 Ga0501045_0047217_1102_1875 257
1145 3300049824 Ga0501045_0049686 Ga0501045_0049686_1068_1841 257
1146 3300049824 Ga0501045_0072788 Ga0501045_0072788_329_1120 257
1147 3300049824 Ga0501045_0217930 Ga0501045_0217930_52_852 257
1148 3300050507 nmdc:mga05p37_2477_c1 nmdc:mga05p37_2477_c1_6151_6951 257
1149 3300050507 nmdc:mga05p37_26964_c1 nmdc:mga05p37_26964_c1_1467_2258 257
1150 3300050507 nmdc:mga05p37_830768_c1 nmdc:mga05p37_830768_c1_19_804 257
1151 3300050508 nmdc:mga09592_27201_c1 nmdc:mga09592_27201_c1_3238_4038 257
1152 3300050508 nmdc:mga09592_519923_c1 nmdc:mga09592_519923_c1_33_833 257
1153 3300050509 nmdc:mga0qj67_151928_c1 nmdc:mga0qj67_151928_c1_869_1669 257
1154 3300050509 nmdc:mga0qj67_8087_c1 nmdc:mga0qj67_8087_c1_1524_2315 257
1155 3300050510 nmdc:mga06r32_10854_c1 nmdc:mga06r32_10854_c1_3555_4346 257
1156 3300050511 nmdc:mga08y16_118864_c1 nmdc:mga08y16_118864_c1_848_1633 257
1157 3300050511 nmdc:mga08y16_17740_c1 nmdc:mga08y16_17740_c1_3732_4505 257
1158 3300050511 nmdc:mga08y16_56389_c1 nmdc:mga08y16_56389_c1_3275_4066 257
1159 3300050511 nmdc:mga08y16_79430_c1 nmdc:mga08y16_79430_c1_1352_2125 257
1160 3300054114 Ga0501084_0000824 Ga0501084_0000824_5870_6670 257
1161 3300054114 Ga0501084_0002015 Ga0501084_0002015_8152_8937 257
1162 3300054114 Ga0501084_0011466 Ga0501084_0011466_6136_6921 257
1163 3300054114 Ga0501084_0014312 Ga0501084_0014312_2045_2845 257
1164 3300054114 Ga0501084_0017115 Ga0501084_0017115_114_914 257
1165 3300054114 Ga0501084_0027966 Ga0501084_0027966_2383_3174 257
1166 3300054114 Ga0501084_0033649 Ga0501084_0033649_1482_2255 257
1167 3300054114 Ga0501084_0044543 Ga0501084_0044543_1267_2040 257
1168 3300054114 Ga0501084_0052643 Ga0501084_0052643_975_1775 257
1169 3300054114 Ga0501084_0079544 Ga0501084_0079544_1319_2122 257
1170 3300054114 Ga0501084_0103261 Ga0501084_0103261_242_1042 257
1171 3300054114 Ga0501084_0290502 Ga0501084_0290502_519_1292 257
1172 3300059421 Ga0590071_008552 Ga0590071_008552_484_1269 257
1173 3300059424 Ga0590075_013707 Ga0590075_013707_892_1677 257
1174 3300060353 Ga0501082_0001300 Ga0501082_0001300_13174_13959 257
1175 3300060353 Ga0501082_0008205 Ga0501082_0008205_6718_7503 257
1176 3300060353 Ga0501082_0015071 Ga0501082_0015071_2534_3334 257
1177 3300060353 Ga0501082_0016418 Ga0501082_0016418_2300_3073 257
1178 3300060353 Ga0501082_0025059 Ga0501082_0025059_2758_3531 257
1179 3300060353 Ga0501082_0038077 Ga0501082_0038077_1281_2081 257
1180 3300060353 Ga0501082_0067700 Ga0501082_0067700_954_1757 257
1181 3300060353 Ga0501082_0141421 Ga0501082_0141421_1269_2054 257
1182 3300060353 Ga0501082_0306002 Ga0501082_0306002_233_1033 257
1183 3300060353 Ga0501082_0449647 Ga0501082_0449647_282_1070 257
1184 3300061734 Ga0530510_0001330 Ga0530510_0001330_3802_4602 257
1185 3300061734 Ga0530510_0004226 Ga0530510_0004226_3262_4047 257
1186 3300061734 Ga0530510_0005976 Ga0530510_0005976_1899_2699 257
1187 3300061734 Ga0530510_0013738 Ga0530510_0013738_1482_2255 257
1188 3300061734 Ga0530510_0016178 Ga0530510_0016178_2830_3621 257
1189 3300061734 Ga0530510_0027309 Ga0530510_0027309_1981_2784 257
1190 3300061734 Ga0530510_0042956 Ga0530510_0042956_1359_2132 257
1191 3300061734 Ga0530510_0071984 Ga0530510_0071984_1069_1854 257
1192 3300061734 Ga0530510_0131194 Ga0530510_0131194_928_1728 257
1193 3300061734 Ga0530510_0158472 Ga0530510_0158472_514_1341 257
1194 3300000041 ARcpr5oldR_c003182 ARcpr5oldR_0031823 258
1195 3300002459 JGI24751J29686_10002390 JGI24751J29686_100023906 258
1196 3300005327 Ga0070658_10555359 Ga0070658_105553591 258
1197 3300005328 Ga0070676_10105811 Ga0070676_101058112 258
1198 3300005329 Ga0070683_100022112 Ga0070683_1000221123 258
1199 3300005329 Ga0070683_100048201 Ga0070683_1000482013 258
1200 3300005329 Ga0070683_100344858 Ga0070683_1003448581 258
1201 3300005329 Ga0070683_100500406 Ga0070683_1005004062 258
1202 3300005330 Ga0070690_100131236 Ga0070690_1001312363 258
1203 3300005334 Ga0068869_100088600 Ga0068869_1000886002 258
1204 3300005336 Ga0070680_100010968 Ga0070680_1000109686 258
1205 3300005337 Ga0070682_100002171 Ga0070682_10000217110 258
1206 3300005340 Ga0070689_100014058 Ga0070689_1000140584 258
1207 3300005343 Ga0070687_100023730 Ga0070687_1000237304 258
1208 3300005344 Ga0070661_100038149 Ga0070661_1000381493 258
1209 3300005344 Ga0070661_100289621 Ga0070661_1002896211 258
1210 3300005347 Ga0070668_100053773 Ga0070668_1000537734 258
1211 3300005353 Ga0070669_100151931 Ga0070669_1001519313 258
1212 3300005354 Ga0070675_100006745 Ga0070675_1000067454 258
1213 3300005356 Ga0070674_100000969 Ga0070674_10000096918 258
1214 3300005356 Ga0070674_100055510 Ga0070674_1000555103 258
1215 3300005364 Ga0070673_100036778 Ga0070673_1000367784 258
1216 3300005365 Ga0070688_100051855 Ga0070688_1000518554 258
1217 3300005366 Ga0070659_100013748 Ga0070659_1000137488 258
1218 3300005366 Ga0070659_100196653 Ga0070659_1001966532 258
1219 3300005366 Ga0070659_100483586 Ga0070659_1004835861 258
1220 3300005438 Ga0070701_10030345 Ga0070701_100303453 258
1221 3300005440 Ga0070705_100048881 Ga0070705_1000488814 258
1222 3300005456 Ga0070678_100008743 Ga0070678_1000087438 258
1223 3300005458 Ga0070681_10029668 Ga0070681_100296684 258
1224 3300005458 Ga0070681_10070401 Ga0070681_100704014 258
1225 3300005459 Ga0068867_100337881 Ga0068867_1003378812 258
1226 3300005466 Ga0070685_10038539 Ga0070685_100385393 258
1227 3300005518 Ga0070699_100021930 Ga0070699_1000219306 258
1228 3300005530 Ga0070679_100028797 Ga0070679_1000287974 258
1229 3300005530 Ga0070679_100089177 Ga0070679_1000891774 258
1230 3300005535 Ga0070684_100073569 Ga0070684_1000735693 258
1231 3300005539 Ga0068853_100163039 Ga0068853_1001630392 258
1232 3300005546 Ga0070696_100176186 Ga0070696_1001761862 258
1233 3300005547 Ga0070693_100019512 Ga0070693_1000195122 258
1234 3300005548 Ga0070665_100211417 Ga0070665_1002114172 258
1235 3300005549 Ga0070704_100294432 Ga0070704_1002944323 258
1236 3300005564 Ga0070664_100044302 Ga0070664_1000443023 258
1237 3300005577 Ga0068857_100104689 Ga0068857_1001046894 258
1238 3300005577 Ga0068857_100110034 Ga0068857_1001100344 258
1239 3300005614 Ga0068856_100053236 Ga0068856_1000532363 258
1240 3300005615 Ga0070702_100077838 Ga0070702_1000778382 258
1241 3300005615 Ga0070702_100137638 Ga0070702_1001376383 258
1242 3300005616 Ga0068852_100270468 Ga0068852_1002704682 258
1243 3300005616 Ga0068852_100353875 Ga0068852_1003538752 258
1244 3300005617 Ga0068859_100178859 Ga0068859_1001788593 258
1245 3300005618 Ga0068864_100063292 Ga0068864_1000632921 258
1246 3300005718 Ga0068866_10034383 Ga0068866_100343833 258
1247 3300005840 Ga0068870_10001168 Ga0068870_100011686 258
1248 3300005840 Ga0068870_10055386 Ga0068870_100553863 258
1249 3300005840 Ga0068870_10185515 Ga0068870_101855152 258
1250 3300005842 Ga0068858_100128811 Ga0068858_1001288113 258
1251 3300005844 Ga0068862_100390387 Ga0068862_1003903873 258
1252 3300005937 Ga0081455_10020460 Ga0081455_100204605 258
1253 3300005937 Ga0081455_10029851 Ga0081455_100298513 258
1254 3300005937 Ga0081455_10053591 Ga0081455_100535914 258
1255 3300005985 Ga0081539_10008003 Ga0081539_100080033 258
1256 3300005985 Ga0081539_10133518 Ga0081539_101335182 258
1257 3300006038 Ga0075365_10267487 Ga0075365_102674871 258
1258 3300006058 Ga0075432_10001371 Ga0075432_100013717 258
1259 3300006237 Ga0097621_100335256 Ga0097621_1003352562 258
1260 3300006237 Ga0097621_100474716 Ga0097621_1004747161 258
1261 3300006844 Ga0075428_100000411 Ga0075428_10000041119 258
1262 3300006844 Ga0075428_100242679 Ga0075428_1002426792 258
1263 3300006881 Ga0068865_100086753 Ga0068865_1000867533 258
1264 3300006881 Ga0068865_100188934 Ga0068865_1001889341 258
1265 3300006931 Ga0097620_100178855 Ga0097620_1001788553 258
1266 3300007076 Ga0075435_100057728 Ga0075435_1000577284 258
1267 3300009094 Ga0111539_10005465 Ga0111539_100054656 258
1268 3300009094 Ga0111539_10076732 Ga0111539_100767325 258
1269 3300009094 Ga0111539_10087612 Ga0111539_100876124 258
1270 3300009094 Ga0111539_10213355 Ga0111539_102133552 258
1271 3300009098 Ga0105245_10036788 Ga0105245_100367885 258
1272 3300009098 Ga0105245_10191049 Ga0105245_101910492 258
1273 3300009147 Ga0114129_10006651 Ga0114129_100066515 258
1274 3300009147 Ga0114129_10241534 Ga0114129_102415344 258
1275 3300009147 Ga0114129_10670477 Ga0114129_106704771 258
1276 3300009148 Ga0105243_10007699 Ga0105243_100076999 258
1277 3300009148 Ga0105243_10021955 Ga0105243_100219554 258
1278 3300009148 Ga0105243_10028908 Ga0105243_100289084 258
1279 3300009176 Ga0105242_10236841 Ga0105242_102368412 258
1280 3300009177 Ga0105248_10117333 Ga0105248_101173334 258
1281 3300009553 Ga0105249_10349009 Ga0105249_103490092 258
1282 3300010375 Ga0105239_10025839 Ga0105239_100258397 258
1283 3300011119 Ga0105246_10080467 Ga0105246_100804673 258
1284 3300011119 Ga0105246_10092536 Ga0105246_100925363 258
1285 3300013102 Ga0157371_10159266 Ga0157371_101592663 258
1286 3300013104 Ga0157370_10055018 Ga0157370_100550183 258
1287 3300013296 Ga0157374_10486337 Ga0157374_104863372 258
1288 3300013307 Ga0157372_10152275 Ga0157372_101522753 258
1289 3300013308 Ga0157375_10080878 Ga0157375_100808783 258
1290 3300013308 Ga0157375_10117242 Ga0157375_101172424 258
1291 3300013308 Ga0157375_10467082 Ga0157375_104670822 258
1292 3300014325 Ga0163163_10003920 Ga0163163_100039207 258
1293 3300014325 Ga0163163_10439331 Ga0163163_104393311 258
1294 3300014326 Ga0157380_10118739 Ga0157380_101187393 258
1295 3300014745 Ga0157377_10044381 Ga0157377_100443814 258
1296 3300014745 Ga0157377_10064623 Ga0157377_100646232 258
1297 3300014745 Ga0157377_10144168 Ga0157377_101441682 258
1298 3300014969 Ga0157376_10099591 Ga0157376_100995913 258
1299 3300020070 Ga0206356_10355467 Ga0206356_103554673 258
1300 3300025901 Ga0207688_10058305 Ga0207688_100583052 258
1301 3300025907 Ga0207645_10308411 Ga0207645_103084112 258
1302 3300025908 Ga0207643_10001394 Ga0207643_1000139410 258
1303 3300025908 Ga0207643_10019487 Ga0207643_100194874 258
1304 3300025908 Ga0207643_10089647 Ga0207643_100896472 258
1305 3300025909 Ga0207705_10143292 Ga0207705_101432923 258
1306 3300025912 Ga0207707_10010456 Ga0207707_100104568 258
1307 3300025917 Ga0207660_10350383 Ga0207660_103503832 258
1308 3300025918 Ga0207662_10046335 Ga0207662_100463354 258
1309 3300025920 Ga0207649_10111901 Ga0207649_101119011 258
1310 3300025920 Ga0207649_10125261 Ga0207649_101252613 258
1311 3300025921 Ga0207652_10004108 Ga0207652_1000410810 258
1312 3300025921 Ga0207652_10023280 Ga0207652_100232804 258
1313 3300025923 Ga0207681_10093155 Ga0207681_100931553 258
1314 3300025923 Ga0207681_10212534 Ga0207681_102125343 258
1315 3300025925 Ga0207650_10086636 Ga0207650_100866364 258
1316 3300025926 Ga0207659_10109256 Ga0207659_101092562 258
1317 3300025927 Ga0207687_10028420 Ga0207687_100284204 258
1318 3300025927 Ga0207687_10162881 Ga0207687_101628813 258
1319 3300025927 Ga0207687_10345717 Ga0207687_103457172 258
1320 3300025931 Ga0207644_10097090 Ga0207644_100970902 258
1321 3300025932 Ga0207690_10026511 Ga0207690_100265112 258
1322 3300025932 Ga0207690_10116671 Ga0207690_101166712 258
1323 3300025933 Ga0207706_10028469 Ga0207706_100284694 258
1324 3300025934 Ga0207686_10120860 Ga0207686_101208603 258
1325 3300025935 Ga0207709_10015116 Ga0207709_100151166 258
1326 3300025936 Ga0207670_10048334 Ga0207670_100483344 258
1327 3300025937 Ga0207669_10074747 Ga0207669_100747472 258
1328 3300025937 Ga0207669_10105227 Ga0207669_101052274 258
1329 3300025938 Ga0207704_10033752 Ga0207704_100337523 258
1330 3300025938 Ga0207704_10122465 Ga0207704_101224652 258
1331 3300025940 Ga0207691_10014782 Ga0207691_100147829 258
1332 3300025940 Ga0207691_10047204 Ga0207691_100472045 258
1333 3300025942 Ga0207689_10215945 Ga0207689_102159453 258
1334 3300025944 Ga0207661_10000504 Ga0207661_100005045 258
1335 3300025944 Ga0207661_10030216 Ga0207661_100302166 258
1336 3300025944 Ga0207661_10421831 Ga0207661_104218312 258
1337 3300025944 Ga0207661_10517096 Ga0207661_105170962 258
1338 3300025945 Ga0207679_10001100 Ga0207679_100011009 258
1339 3300025960 Ga0207651_10293315 Ga0207651_102933152 258
1340 3300025972 Ga0207668_10027746 Ga0207668_100277464 258
1341 3300025972 Ga0207668_10110569 Ga0207668_101105692 258
1342 3300026023 Ga0207677_10212035 Ga0207677_102120352 258
1343 3300026023 Ga0207677_10675882 Ga0207677_106758821 258
1344 3300026041 Ga0207639_10256476 Ga0207639_102564763 258
1345 3300026075 Ga0207708_10023543 Ga0207708_100235432 258
1346 3300026078 Ga0207702_10169536 Ga0207702_101695362 258
1347 3300026089 Ga0207648_10026183 Ga0207648_100261836 258
1348 3300026089 Ga0207648_10329420 Ga0207648_103294203 258
1349 3300026095 Ga0207676_10178285 Ga0207676_101782853 258
1350 3300026116 Ga0207674_10013923 Ga0207674_100139233 258
1351 3300026116 Ga0207674_10064950 Ga0207674_100649503 258
1352 3300026116 Ga0207674_10178378 Ga0207674_101783784 258
1353 3300026116 Ga0207674_10369253 Ga0207674_103692531 258
1354 3300026121 Ga0207683_10227005 Ga0207683_102270051 258
1355 3300026121 Ga0207683_10285353 Ga0207683_102853532 258
1356 3300027907 Ga0207428_10000108 Ga0207428_1000010837 258
1357 3300027907 Ga0207428_10028411 Ga0207428_100284115 258
1358 3300028379 Ga0268266_10481416 Ga0268266_104814161 258
1359 3300028379 Ga0268266_10577510 Ga0268266_105775102 258
1360 3300031548 Ga0307408_100346381 Ga0307408_1003463812 258
1361 3300031852 Ga0307410_10296863 Ga0307410_102968632 258
1362 3300031911 Ga0307412_10171630 Ga0307412_101716303 258
1363 3300031995 Ga0307409_100035699 Ga0307409_1000356992 258
1364 3300032004 Ga0307414_10244955 Ga0307414_102449552 258
1365 3300035691 Ga0373931_0147565 Ga0373931_0147565_471_1247 258
1366 3300037418 Ga0395900_0243407 Ga0395900_0243407_980_1762 258
1367 3300037466 Ga0395898_0041036 Ga0395898_0041036_286_1068 258
1368 3300038443 Ga0395901_0010984 Ga0395901_0010984_4005_4787 258
1369 3300038443 Ga0395901_0084454 Ga0395901_0084454_1390_2169 258
1370 3300042122 Ga0450920_001378 Ga0450920_001378_377_1153 258
1371 3300042132 Ga0450895_004009 Ga0450895_004009_13_789 258
1372 3300042145 Ga0450906_003482 Ga0450906_003482_1849_2625 258
1373 3300042146 Ga0450907_017666 Ga0450907_017666_363_1157 258
1374 3300042461 Ga0439460_0042868 Ga0439460_0042868_469_1245 258
1375 3300046461 Ga0495641_0039218 Ga0495641_0039218_1043_1819 258
1376 3300046461 Ga0495641_0124567 Ga0495641_0124567_82_858 258
1377 3300046517 Ga0495630_0104481 Ga0495630_0104481_1238_2014 258
1378 3300046536 Ga0495587_0136055 Ga0495587_0136055_195_971 258
1379 3300046683 Ga0495658_0414159 Ga0495658_0414159_31_807 258
1380 3300047315 Ga0495581_0202315 Ga0495581_0202315_48_824 258
1381 3300047317 Ga0495604_0096905 Ga0495604_0096905_961_1737 258
1382 3300047319 Ga0495674_0128421 Ga0495674_0128421_236_1012 258
1383 3300047321 Ga0495676_0140388 Ga0495676_0140388_290_1066 258
1384 3300047321 Ga0495676_0465998 Ga0495676_0465998_16_792 258
1385 3300048903 Ga0496100_0343499 Ga0496100_0343499_110_886 258
1386 3300048904 Ga0496101_0013967 Ga0496101_0013967_4192_4968 258
1387 3300048907 Ga0496104_0459205 Ga0496104_0459205_64_840 258
1388 3300048908 Ga0496105_0055302 Ga0496105_0055302_1236_2012 258
1389 3300048908 Ga0496105_0065099 Ga0496105_0065099_1264_2040 258
1390 3300048909 Ga0496106_0356618 Ga0496106_0356618_20_814 258
1391 3300048910 Ga0496107_0543176 Ga0496107_0543176_49_825 258
1392 3300048911 Ga0496108_0003631 Ga0496108_0003631_3220_3996 258
1393 3300048911 Ga0496108_0014117 Ga0496108_0014117_4198_4992 258
1394 3300048912 Ga0496109_0001947 Ga0496109_0001947_5313_6089 258
1395 3300048912 Ga0496109_0024899 Ga0496109_0024899_2158_2952 258
1396 3300048912 Ga0496109_0059690 Ga0496109_0059690_1029_1805 258
1397 3300048912 Ga0496109_0359621 Ga0496109_0359621_125_901 258
1398 3300048912 Ga0496109_0443251 Ga0496109_0443251_405_1181 258
1399 3300048913 Ga0496110_0011939 Ga0496110_0011939_521_1297 258
1400 3300048913 Ga0496110_0352549 Ga0496110_0352549_85_879 258
1401 3300048913 Ga0496110_0752129 Ga0496110_0752129_79_855 258
1402 3300048914 Ga0496111_0000288 Ga0496111_0000288_14686_15462 258
1403 3300048915 Ga0496112_0133008 Ga0496112_0133008_386_1162 258
1404 3300048916 Ga0496113_0028359 Ga0496113_0028359_2445_3221 258
1405 3300048917 Ga0496114_0211269 Ga0496114_0211269_67_843 258
1406 3300048917 Ga0496114_0400800 Ga0496114_0400800_179_955 258
1407 3300049568 Ga0501031_0094238 Ga0501031_0094238_1136_1912 258
1408 3300049568 Ga0501031_0252695 Ga0501031_0252695_126_917 258
1409 3300049572 Ga0501036_0004891 Ga0501036_0004891_1912_2694 258
1410 3300049572 Ga0501036_0022582 Ga0501036_0022582_3349_4128 258
1411 3300049573 Ga0501037_0022874 Ga0501037_0022874_321_1103 258
1412 3300049573 Ga0501037_0224500 Ga0501037_0224500_352_1128 258
1413 3300049574 Ga0501038_0000446 Ga0501038_0000446_22273_23055 258
1414 3300049574 Ga0501038_0123872 Ga0501038_0123872_881_1660 258
1415 3300049575 Ga0501039_0013728 Ga0501039_0013728_4590_5372 258
1416 3300049575 Ga0501039_0255567 Ga0501039_0255567_542_1318 258
1417 3300049576 Ga0501040_0008593 Ga0501040_0008593_5162_5941 258
1418 3300049576 Ga0501040_0010689 Ga0501040_0010689_4147_4923 258
1419 3300049576 Ga0501040_0123217 Ga0501040_0123217_864_1646 258
1420 3300049577 Ga0501041_0030942 Ga0501041_0030942_2306_3088 258
1421 3300049578 Ga0501042_0002492 Ga0501042_0002492_9719_10501 258
1422 3300049578 Ga0501042_0011682 Ga0501042_0011682_1428_2204 258
1423 3300049578 Ga0501042_0178963 Ga0501042_0178963_471_1265 258
1424 3300049578 Ga0501042_0222692 Ga0501042_0222692_547_1329 258
1425 3300049579 Ga0501043_0006109 Ga0501043_0006109_2755_3537 258
1426 3300049580 Ga0501046_0004525 Ga0501046_0004525_8509_9291 258
1427 3300049580 Ga0501046_0008764 Ga0501046_0008764_4321_5097 258
1428 3300049583 Ga0501067_0015833 Ga0501067_0015833_259_1053 258
1429 3300049583 Ga0501067_0104658 Ga0501067_0104658_421_1215 258
1430 3300049584 Ga0501068_0002939 Ga0501068_0002939_914_1696 258
1431 3300049584 Ga0501068_0049209 Ga0501068_0049209_821_1615 258
1432 3300049585 Ga0501069_0013701 Ga0501069_0013701_124_900 258
1433 3300049585 Ga0501069_0022274 Ga0501069_0022274_1743_2537 258
1434 3300049585 Ga0501069_0174459 Ga0501069_0174459_347_1129 258
1435 3300049586 Ga0501070_0086461 Ga0501070_0086461_1524_2318 258
1436 3300049587 Ga0501071_0002277 Ga0501071_0002277_2106_2888 258
1437 3300049587 Ga0501071_0005857 Ga0501071_0005857_3284_4060 258
1438 3300049587 Ga0501071_0148176 Ga0501071_0148176_817_1596 258
1439 3300049587 Ga0501071_0182424 Ga0501071_0182424_286_1080 258
1440 3300049588 Ga0501072_0001260 Ga0501072_0001260_3742_4518 258
1441 3300049588 Ga0501072_0051258 Ga0501072_0051258_1196_1972 258
1442 3300049588 Ga0501072_0232257 Ga0501072_0232257_665_1441 258
1443 3300049588 Ga0501072_0337423 Ga0501072_0337423_256_1050 258
1444 3300049589 Ga0501073_0022682 Ga0501073_0022682_1402_2184 258
1445 3300049590 Ga0501074_0016469 Ga0501074_0016469_1919_2701 258
1446 3300049590 Ga0501074_0016954 Ga0501074_0016954_1497_2273 258
1447 3300049590 Ga0501074_0029829 Ga0501074_0029829_94_885 258
1448 3300049590 Ga0501074_0134276 Ga0501074_0134276_830_1609 258
1449 3300049590 Ga0501074_0284672 Ga0501074_0284672_72_848 258
1450 3300049591 Ga0501075_0073283 Ga0501075_0073283_1594_2376 258
1451 3300049591 Ga0501075_0089938 Ga0501075_0089938_53_829 258
1452 3300049591 Ga0501075_0256608 Ga0501075_0256608_461_1237 258
1453 3300049592 Ga0501076_0001738 Ga0501076_0001738_203_979 258
1454 3300049592 Ga0501076_0171173 Ga0501076_0171173_438_1217 258
1455 3300049592 Ga0501076_0311650 Ga0501076_0311650_349_1131 258
1456 3300049593 Ga0501077_0003831 Ga0501077_0003831_2878_3660 258
1457 3300049593 Ga0501077_0007221 Ga0501077_0007221_5065_5841 258
1458 3300049593 Ga0501077_0018134 Ga0501077_0018134_2630_3412 258
1459 3300049593 Ga0501077_0023533 Ga0501077_0023533_686_1462 258
1460 3300049593 Ga0501077_0186567 Ga0501077_0186567_240_1031 258
1461 3300049593 Ga0501077_0253531 Ga0501077_0253531_180_962 258
1462 3300049593 Ga0501077_0422966 Ga0501077_0422966_56_832 258
1463 3300049741 Ga0501079_0004138 Ga0501079_0004138_1467_2249 258
1464 3300049741 Ga0501079_0073837 Ga0501079_0073837_309_1085 258
1465 3300049742 Ga0501080_0034997 Ga0501080_0034997_3877_4653 258
1466 3300049742 Ga0501080_0640491 Ga0501080_0640491_86_862 258
1467 3300049743 Ga0501081_0019483 Ga0501081_0019483_1729_2505 258
1468 3300049743 Ga0501081_0069304 Ga0501081_0069304_238_1017 258
1469 3300049744 Ga0501083_0031791 Ga0501083_0031791_1261_2037 258
1470 3300049744 Ga0501083_0036231 Ga0501083_0036231_2479_3261 258
1471 3300049822 Ga0501035_0005704 Ga0501035_0005704_7899_8681 258
1472 3300049824 Ga0501045_0026426 Ga0501045_0026426_978_1757 258
1473 3300049824 Ga0501045_0030872 Ga0501045_0030872_460_1248 258
1474 3300050492 nmdc:mga0yw44_82810_c1 nmdc:mga0yw44_82810_c1_875_1651 258
1475 3300050507 nmdc:mga05p37_105727_c1 nmdc:mga05p37_105727_c1_1713_2489 258
1476 3300050507 nmdc:mga05p37_240730_c1 nmdc:mga05p37_240730_c1_1045_1839 258
1477 3300050507 nmdc:mga05p37_436500_c1 nmdc:mga05p37_436500_c1_232_1026 258
1478 3300050507 nmdc:mga05p37_589693_c1 nmdc:mga05p37_589693_c1_298_1092 258
1479 3300050511 nmdc:mga08y16_171617_c1 nmdc:mga08y16_171617_c1_661_1437 258
1480 3300050511 nmdc:mga08y16_218367_c1 nmdc:mga08y16_218367_c1_510_1304 258
1481 3300050511 nmdc:mga08y16_251706_c1 nmdc:mga08y16_251706_c1_317_1096 258
1482 3300050511 nmdc:mga08y16_7118_c1 nmdc:mga08y16_7118_c1_7029_7805 258
1483 3300050513 nmdc:mga0rr50_56179_c1 nmdc:mga0rr50_56179_c1_1436_2230 258
1484 3300050515 nmdc:mga0a205_28420_c1 nmdc:mga0a205_28420_c1_3432_4208 258
1485 3300050515 nmdc:mga0a205_672020_c1 nmdc:mga0a205_672020_c1_26_820 258
1486 3300053084 Ga0495595_0040034 Ga0495595_0040034_1288_2064 258
1487 3300054114 Ga0501084_0000882 Ga0501084_0000882_7778_8554 258
1488 3300054114 Ga0501084_0003386 Ga0501084_0003386_2049_2831 258
1489 3300054114 Ga0501084_0107193 Ga0501084_0107193_209_985 258
1490 3300054114 Ga0501084_0145219 Ga0501084_0145219_1140_1934 258
1491 3300054114 Ga0501084_0469525 Ga0501084_0469525_256_1038 258
1492 3300060353 Ga0501082_0026383 Ga0501082_0026383_215_997 258
1493 3300060353 Ga0501082_0027469 Ga0501082_0027469_242_1033 258
1494 3300060353 Ga0501082_0031802 Ga0501082_0031802_2558_3337 258
1495 3300060353 Ga0501082_0086816 Ga0501082_0086816_1743_2519 258
1496 3300060353 Ga0501082_0152317 Ga0501082_0152317_824_1600 258
1497 3300060353 Ga0501082_0191475 Ga0501082_0191475_61_837 258
1498 3300060353 Ga0501082_0501195 Ga0501082_0501195_175_957 258
1499 3300060353 Ga0501082_0776418 Ga0501082_0776418_19_801 258
1500 3300061734 Ga0530510_0000865 Ga0530510_0000865_9079_9861 258
1501 3300061734 Ga0530510_0045203 Ga0530510_0045203_2342_3121 258
1502 3300061734 Ga0530510_0075426 Ga0530510_0075426_164_940 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

18

269

0.94

PF12804

NTP_transf_3

MobA-like NTP transferase domain

19

186

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hl3-assembly1.cif.gz_A 2.76 angstrom crystal structure of a putative glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with a sucrose. 0.9304 1 253
3pkq-assembly2.cif.gz_A q83d variant of s. enterica rmla with dgtp 0.9252 2 253
6b5k-assembly1.cif.gz_A-2 mycobacterium tuberculosis rmla in complex with mg/dttp 0.9244 1 252
1mp3-assembly1.cif.gz_A l89t variant of s. enterica rmla 0.9226 2 253
1iim-assembly1.cif.gz_A thymidylyltransferase complexed with ttp 0.9225 2 253
ID Description Score Start End Superfamily
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9504 1 253 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9309 1 237 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9224 1 237 3.90.550.10
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9194 2 253 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.909 1 253 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7V9EG16-F1-model_v4 Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) (dTDP-glucose pyrophosphorylase) (dTDP-glucose synthase) 0.9848 137 258 GO:0008879
GO:0045226
AF-A0A7V9DIT3-F1-model_v4 Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) (dTDP-glucose pyrophosphorylase) (dTDP-glucose synthase) 0.9749 2 184 GO:0008879
GO:0045226
AF-A0A1Q7UBP0-F1-model_v4 Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) (dTDP-glucose pyrophosphorylase) (dTDP-glucose synthase) 0.9577 1 251 GO:0008830
GO:0008879
GO:0045226
AF-A0A3N5UV34-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.957 1 237 GO:0008879
GO:0045226
AF-A0A6L3A6Q4-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9569 1 258 GO:0008879
GO:0045226

Feature Viewer

pLDDT pTM Quality
91.9 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map