F494432
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1505 | 513 | 3010 | 245 |
Family's Representative Sequence
| Representative Sequence | 3300005466|Ga0070685_10210500|Ga0070685_102105002 |
| Length | 278 |
| Sequence | MSVPRPPEDTCTAVRKDGASTMSSSPRLRALVVDDEDLARHLIREYLQGHADVEVVGECENGLDAVKQIGALNPDLVFLDIQMPRLTGLEVLELTGRRAGVIFTTAYDEHAIKAFELHAVDYLLKPFSKARFDDALARARTLHASARASGGAGATPGPAQGVDALVARRGATLERILIRDREQVHVIPVEQVECIEAQGDYLAIEVDGKCHLKPQRISEIEEQLDPTRFLRVHRSFIINLAHLQAIERPGPDRHAARLRSGKRVPISRSGYEKLRELV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 72 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 96 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 114 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 115 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 116 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 117 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 122 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 123 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 155 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 238 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 243 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 244 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 246 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 247 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 248 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 251 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 252 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 253 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 254 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 255 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 256 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 257 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 258 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 259 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 260 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 261 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 262 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 263 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 264 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 265 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 266 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 267 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 268 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 270 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 276 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 277 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 278 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 281 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 282 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 285 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 286 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 287 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 288 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 289 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 290 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 291 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 292 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 293 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 294 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 295 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 297 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 298 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 299 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 300 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 301 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 302 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 303 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 304 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 305 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 306 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 307 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 308 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 309 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 310 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 311 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 312 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 313 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 314 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 315 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 316 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 317 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 318 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 319 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 320 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 321 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 322 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 323 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 324 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 325 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 326 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 327 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 328 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 329 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 413 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 414 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 415 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 416 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 417 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 419 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 420 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 421 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 422 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 423 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 424 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 425 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 426 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 427 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 430 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 450 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 451 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 452 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 453 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 454 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 459 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 460 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 461 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 462 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 463 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 464 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 468 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 469 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 470 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 471 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 472 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 480 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 481 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 482 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 483 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 484 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 485 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 486 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 487 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 488 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 489 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 490 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 491 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 492 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 495 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 496 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 497 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 498 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 499 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 500 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 501 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 502 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 503 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 504 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 505 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 506 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 507 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 508 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 509 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 510 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 511 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 512 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 513 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.34 |
| Metatranscriptomes | 0.2 |
| Isolates | 1.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.9 |
| Nodule | 0 |
| Rhizoplane | 2.39 |
| Rhizosphere | 82.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070685_10210500 | 3300005466 | Bacteria | 1269 |
| 2 | JGI25156J39149_1001159 | 3300002705 | Bacteria | 11792 |
| 3 | JGI25156J39149_1002068 | 3300002705 | Bacteria | 7625 |
| 4 | JGI25156J39149_1022654 | 3300002705 | Bacteria | 1062 |
| 5 | JGI25154J39366_1001049 | 3300002738 | Bacteria | 11003 |
| 6 | JGI25154J39366_1002964 | 3300002738 | Bacteria | 3891 |
| 7 | JGI25158J39367_1000226 | 3300002739 | Bacteria | 13227 |
| 8 | JGI25157J39369_1000029 | 3300002741 | Bacteria | 146928 |
| 9 | JGI25157J39369_1000312 | 3300002741 | Bacteria | 35057 |
| 10 | JGI25164J39214_1008298 | 3300002772 | Bacteria | 1041 |
| 11 | JGI25152J39213_1000433 | 3300002773 | Bacteria | 25094 |
| 12 | JGI25150J39212_1000749 | 3300002774 | Bacteria | 11402 |
| 13 | JGI25150J39212_1001006 | 3300002774 | Bacteria | 8743 |
| 14 | JGI25150J39212_1001467 | 3300002774 | Bacteria | 6565 |
| 15 | JGI25150J39212_1002524 | 3300002774 | Bacteria | 4520 |
| 16 | JGI25159J45721_1000365 | 3300002987 | Bacteria | 21057 |
| 17 | JGI25153J46596_10013424 | 3300003215 | Bacteria | 3459 |
| 18 | rootH1_10004599 | 3300003316 | Bacteria | 4465 |
| 19 | rootH1_10007951 | 3300003316 | Bacteria | 4827 |
| 20 | rootH1_10017383 | 3300003316 | Bacteria | 20136 |
| 21 | rootH1_10034050 | 3300003316 | Bacteria | 2320 |
| 22 | rootH1_10037656 | 3300003316 | Bacteria | 1573 |
| 23 | rootH2_10006249 | 3300003320 | Bacteria | 9881 |
| 24 | rootL2_10002470 | 3300003322 | Bacteria | 7787 |
| 25 | rootL2_10016318 | 3300003322 | Bacteria | 5312 |
| 26 | rootL2_10208757 | 3300003322 | Bacteria | 4122 |
| 27 | rootH1_10006598 | 3300003323 | Bacteria | 4161 |
| 28 | rootH1_10015852 | 3300003323 | Bacteria | 11750 |
| 29 | rootH1_10020381 | 3300003323 | Bacteria | 15790 |
| 30 | rootH1_10027575 | 3300003323 | Bacteria | 5176 |
| 31 | rootH1_10030329 | 3300003323 | Bacteria | 1393 |
| 32 | rootH1_10030355 | 3300003323 | Bacteria | 8033 |
| 33 | rootH1_10116314 | 3300003323 | Bacteria | 4099 |
| 34 | JGI25161J50226_1000407 | 3300003374 | Bacteria | 21057 |
| 35 | Ga0055539_1000282 | 3300003752 | Bacteria | 29273 |
| 36 | Ga0055539_1000902 | 3300003752 | Bacteria | 6739 |
| 37 | Ga0055539_1008226 | 3300003752 | Bacteria | 1309 |
| 38 | Ga0055539_1015032 | 3300003752 | Bacteria | 941 |
| 39 | Ga0055533_1000010 | 3300003756 | Bacteria | 491196 |
| 40 | Ga0055533_1000024 | 3300003756 | Bacteria | 338067 |
| 41 | Ga0055525_1000081 | 3300003759 | Bacteria | 161329 |
| 42 | Ga0055525_1000222 | 3300003759 | Bacteria | 61500 |
| 43 | Ga0055525_1001459 | 3300003759 | Bacteria | 4222 |
| 44 | Ga0055535_1000292 | 3300003761 | Bacteria | 52350 |
| 45 | Ga0055535_1001112 | 3300003761 | Bacteria | 16330 |
| 46 | Ga0055542_1007406 | 3300003762 | Bacteria | 2229 |
| 47 | Ga0055529_1000130 | 3300003763 | Bacteria | 105654 |
| 48 | Ga0055529_1000382 | 3300003763 | Bacteria | 48005 |
| 49 | Ga0055526_1013614 | 3300003771 | Bacteria | 3423 |
| 50 | Ga0055537_1012667 | 3300003773 | Bacteria | 1630 |
| 51 | Ga0055537_1014154 | 3300003773 | Bacteria | 1461 |
| 52 | Ga0055537_1019391 | 3300003773 | Bacteria | 1058 |
| 53 | Ga0055524_1001532 | 3300003775 | Bacteria | 13066 |
| 54 | Ga0055524_1006527 | 3300003775 | Bacteria | 5049 |
| 55 | Ga0055534_1013048 | 3300003784 | Bacteria | 1612 |
| 56 | Ga0055530_10002964 | 3300003791 | Bacteria | 10220 |
| 57 | Ga0055530_10013336 | 3300003791 | Bacteria | 2811 |
| 58 | Ga0055530_10045433 | 3300003791 | Bacteria | 1048 |
| 59 | Ga0055540_1017899 | 3300003792 | Bacteria | 1960 |
| 60 | Ga0055540_1039891 | 3300003792 | Bacteria | 1020 |
| 61 | Ga0055531_10000024 | 3300003794 | Bacteria | 164239 |
| 62 | Ga0055531_10000700 | 3300003794 | Bacteria | 28529 |
| 63 | Ga0055531_10000818 | 3300003794 | Bacteria | 25805 |
| 64 | Ga0055531_10032869 | 3300003794 | Bacteria | 1685 |
| 65 | Ga0055543_1000546 | 3300004625 | Bacteria | 21095 |
| 66 | Ga0065165_1001129 | 3300005262 | Bacteria | 31369 |
| 67 | Ga0065165_1002224 | 3300005262 | Bacteria | 17321 |
| 68 | Ga0065165_1007878 | 3300005262 | Bacteria | 5118 |
| 69 | Ga0065165_1027495 | 3300005262 | Bacteria | 1854 |
| 70 | Ga0065714_10107373 | 3300005288 | Bacteria | 1532 |
| 71 | Ga0065715_10241007 | 3300005293 | Bacteria | 1199 |
| 72 | Ga0070658_10004794 | 3300005327 | Bacteria | 11007 |
| 73 | Ga0070658_10027232 | 3300005327 | Bacteria | 4588 |
| 74 | Ga0070658_10039977 | 3300005327 | Unclassified | 3784 |
| 75 | Ga0070658_10058732 | 3300005327 | Bacteria | 3131 |
| 76 | Ga0070658_10070757 | 3300005327 | Bacteria | 2857 |
| 77 | Ga0070658_10247280 | 3300005327 | Bacteria | 1513 |
| 78 | Ga0070683_100031998 | 3300005329 | Bacteria | 4787 |
| 79 | Ga0070690_100003915 | 3300005330 | Bacteria | 8211 |
| 80 | Ga0070690_100014227 | 3300005330 | Bacteria | 4717 |
| 81 | Ga0070690_100056280 | 3300005330 | Bacteria | 2521 |
| 82 | Ga0070690_100161861 | 3300005330 | Bacteria | 1534 |
| 83 | Ga0070670_100004747 | 3300005331 | Bacteria | 11410 |
| 84 | Ga0070677_10001503 | 3300005333 | Bacteria | 7376 |
| 85 | Ga0070677_10004919 | 3300005333 | Bacteria | 4387 |
| 86 | Ga0068869_100004218 | 3300005334 | Bacteria | 8917 |
| 87 | Ga0068869_100036764 | 3300005334 | Bacteria | 3478 |
| 88 | Ga0068869_100043150 | 3300005334 | Bacteria | 3238 |
| 89 | Ga0068869_100059558 | 3300005334 | Bacteria | 2796 |
| 90 | Ga0068869_100118707 | 3300005334 | Bacteria | 2020 |
| 91 | Ga0070666_10009513 | 3300005335 | Bacteria | 6061 |
| 92 | Ga0070680_100068066 | 3300005336 | Bacteria | 2922 |
| 93 | Ga0070680_100096809 | 3300005336 | Bacteria | 2447 |
| 94 | Ga0070680_100127601 | 3300005336 | Bacteria | 2126 |
| 95 | Ga0070680_100342567 | 3300005336 | Bacteria | 1270 |
| 96 | Ga0070682_100094761 | 3300005337 | Bacteria | 1959 |
| 97 | Ga0070682_100225857 | 3300005337 | Bacteria | 1336 |
| 98 | Ga0068868_100000628 | 3300005338 | Bacteria | 23749 |
| 99 | Ga0068868_100001502 | 3300005338 | Bacteria | 16064 |
| 100 | Ga0068868_100006264 | 3300005338 | Bacteria | 8416 |
| 101 | Ga0068868_100065246 | 3300005338 | Bacteria | 2892 |
| 102 | Ga0068868_100607628 | 3300005338 | Bacteria | 969 |
| 103 | Ga0070660_100006633 | 3300005339 | Bacteria | 8030 |
| 104 | Ga0070660_100033625 | 3300005339 | Bacteria | 3866 |
| 105 | Ga0070660_100106926 | 3300005339 | Bacteria | 2222 |
| 106 | Ga0070660_100206391 | 3300005339 | Bacteria | 1594 |
| 107 | Ga0070660_100302787 | 3300005339 | Bacteria | 1311 |
| 108 | Ga0070689_100052275 | 3300005340 | Bacteria | 3160 |
| 109 | Ga0070689_100471686 | 3300005340 | Bacteria | 1071 |
| 110 | Ga0070691_10008161 | 3300005341 | Bacteria | 4797 |
| 111 | Ga0070691_10038091 | 3300005341 | Unclassified | 2270 |
| 112 | Ga0070691_10191062 | 3300005341 | Bacteria | 1071 |
| 113 | Ga0070687_100026461 | 3300005343 | Bacteria | 2794 |
| 114 | Ga0070661_100103129 | 3300005344 | Bacteria | 2124 |
| 115 | Ga0070692_10004149 | 3300005345 | Bacteria | 5997 |
| 116 | Ga0070668_100042991 | 3300005347 | Bacteria | 3464 |
| 117 | Ga0070668_100046957 | 3300005347 | Bacteria | 3319 |
| 118 | Ga0070668_100161621 | 3300005347 | Bacteria | 1818 |
| 119 | Ga0070669_100017692 | 3300005353 | Bacteria | 5085 |
| 120 | Ga0070669_100041956 | 3300005353 | Bacteria | 3329 |
| 121 | Ga0070669_100256465 | 3300005353 | Bacteria | 1394 |
| 122 | Ga0070675_100002597 | 3300005354 | Bacteria | 13545 |
| 123 | Ga0070675_100088059 | 3300005354 | Bacteria | 2597 |
| 124 | Ga0070671_100002077 | 3300005355 | Bacteria | 15425 |
| 125 | Ga0070671_100024204 | 3300005355 | Bacteria | 4970 |
| 126 | Ga0070671_100038221 | 3300005355 | Bacteria | 3984 |
| 127 | Ga0070674_100009585 | 3300005356 | Bacteria | 5802 |
| 128 | Ga0070674_100138972 | 3300005356 | Bacteria | 1821 |
| 129 | Ga0070674_100202734 | 3300005356 | Bacteria | 1533 |
| 130 | Ga0070673_100006268 | 3300005364 | Bacteria | 7715 |
| 131 | Ga0070673_100014919 | 3300005364 | Bacteria | 5437 |
| 132 | Ga0070673_100017763 | 3300005364 | Bacteria | 5067 |
| 133 | Ga0070673_100021054 | 3300005364 | Bacteria | 4718 |
| 134 | Ga0070673_100091002 | 3300005364 | Bacteria | 2493 |
| 135 | Ga0070673_100165829 | 3300005364 | Bacteria | 1882 |
| 136 | Ga0070688_100088032 | 3300005365 | Bacteria | 2024 |
| 137 | Ga0070659_100075936 | 3300005366 | Bacteria | 2679 |
| 138 | Ga0070667_100005385 | 3300005367 | Bacteria | 10689 |
| 139 | Ga0070667_100005638 | 3300005367 | Bacteria | 10455 |
| 140 | Ga0070703_10003938 | 3300005406 | Bacteria | 4206 |
| 141 | Ga0070709_10023806 | 3300005434 | Bacteria | 3601 |
| 142 | Ga0070709_10182104 | 3300005434 | Bacteria | 1476 |
| 143 | Ga0070709_10626057 | 3300005434 | Bacteria | 831 |
| 144 | Ga0070714_100015390 | 3300005435 | Bacteria | 6155 |
| 145 | Ga0070713_100002097 | 3300005436 | Bacteria | 12891 |
| 146 | Ga0070713_100016508 | 3300005436 | Bacteria | 5552 |
| 147 | Ga0070713_100151540 | 3300005436 | Bacteria | 2063 |
| 148 | Ga0070713_100374624 | 3300005436 | Bacteria | 1325 |
| 149 | Ga0070710_10043138 | 3300005437 | Bacteria | 2497 |
| 150 | Ga0070701_10047380 | 3300005438 | Bacteria | 2214 |
| 151 | Ga0070711_100368019 | 3300005439 | Bacteria | 1159 |
| 152 | Ga0070705_100007516 | 3300005440 | Bacteria | 5365 |
| 153 | Ga0070705_100010423 | 3300005440 | Bacteria | 4652 |
| 154 | Ga0070694_100014445 | 3300005444 | Bacteria | 4944 |
| 155 | Ga0070708_100000634 | 3300005445 | Bacteria | 26540 |
| 156 | Ga0070708_100001048 | 3300005445 | Bacteria | 21050 |
| 157 | Ga0070708_100106259 | 3300005445 | Bacteria | 2576 |
| 158 | Ga0070678_100002016 | 3300005456 | Bacteria | 10981 |
| 159 | Ga0070678_100007398 | 3300005456 | Bacteria | 6509 |
| 160 | Ga0070678_100023958 | 3300005456 | Bacteria | 4077 |
| 161 | Ga0070662_100062526 | 3300005457 | Bacteria | 2720 |
| 162 | Ga0070662_100224756 | 3300005457 | Bacteria | 1499 |
| 163 | Ga0070662_100331361 | 3300005457 | Bacteria | 1244 |
| 164 | Ga0070681_10000506 | 3300005458 | Bacteria | 31860 |
| 165 | Ga0070681_10002815 | 3300005458 | Bacteria | 16054 |
| 166 | Ga0070681_10114861 | 3300005458 | Bacteria | 2630 |
| 167 | Ga0068867_100001168 | 3300005459 | Bacteria | 17958 |
| 168 | Ga0068867_100023799 | 3300005459 | Bacteria | 4387 |
| 169 | Ga0068867_100035860 | 3300005459 | Unclassified | 3599 |
| 170 | Ga0068867_100118543 | 3300005459 | Bacteria | 2042 |
| 171 | Ga0070706_100000597 | 3300005467 | Bacteria | 41802 |
| 172 | Ga0070706_100011207 | 3300005467 | Bacteria | 8325 |
| 173 | Ga0070706_100012084 | 3300005467 | Bacteria | 8014 |
| 174 | Ga0070706_100417622 | 3300005467 | Bacteria | 1249 |
| 175 | Ga0070707_100001822 | 3300005468 | Bacteria | 20514 |
| 176 | Ga0070707_100099618 | 3300005468 | Bacteria | 2815 |
| 177 | Ga0070707_100149782 | 3300005468 | Bacteria | 2272 |
| 178 | Ga0070698_100072447 | 3300005471 | Bacteria | 3453 |
| 179 | Ga0070699_100014523 | 3300005518 | Bacteria | 6774 |
| 180 | Ga0070699_100026220 | 3300005518 | Bacteria | 5027 |
| 181 | Ga0070679_100014489 | 3300005530 | Bacteria | 7574 |
| 182 | Ga0070679_100221886 | 3300005530 | Bacteria | 1851 |
| 183 | Ga0070684_100008480 | 3300005535 | Bacteria | 8038 |
| 184 | Ga0070684_100109925 | 3300005535 | Bacteria | 2471 |
| 185 | Ga0070684_100124185 | 3300005535 | Bacteria | 2324 |
| 186 | Ga0070697_100000634 | 3300005536 | Bacteria | 26650 |
| 187 | Ga0070697_100100673 | 3300005536 | Bacteria | 2400 |
| 188 | Ga0070697_100106997 | 3300005536 | Bacteria | 2327 |
| 189 | Ga0070697_100234742 | 3300005536 | Bacteria | 1565 |
| 190 | Ga0070697_100241516 | 3300005536 | Unclassified | 1543 |
| 191 | Ga0068853_100301234 | 3300005539 | Bacteria | 1482 |
| 192 | Ga0068853_100333558 | 3300005539 | Bacteria | 1408 |
| 193 | Ga0070672_100000699 | 3300005543 | Bacteria | 19860 |
| 194 | Ga0070672_100077922 | 3300005543 | Bacteria | 2651 |
| 195 | Ga0070695_100119262 | 3300005545 | Bacteria | 1802 |
| 196 | Ga0070696_100000745 | 3300005546 | Bacteria | 20783 |
| 197 | Ga0070693_100000089 | 3300005547 | Bacteria | 38952 |
| 198 | Ga0070693_100012559 | 3300005547 | Bacteria | 4288 |
| 199 | Ga0070665_100063355 | 3300005548 | Bacteria | 3707 |
| 200 | Ga0070665_100086806 | 3300005548 | Bacteria | 3134 |
| 201 | Ga0070665_100266167 | 3300005548 | Bacteria | 1715 |
| 202 | Ga0070704_100003995 | 3300005549 | Bacteria | 8507 |
| 203 | Ga0070704_100219995 | 3300005549 | Unclassified | 1543 |
| 204 | Ga0068855_100000212 | 3300005563 | Bacteria | 73927 |
| 205 | Ga0068855_100005033 | 3300005563 | Bacteria | 16129 |
| 206 | Ga0068855_100006540 | 3300005563 | Bacteria | 14172 |
| 207 | Ga0068855_100007637 | 3300005563 | Bacteria | 13080 |
| 208 | Ga0068855_100008176 | 3300005563 | Bacteria | 12649 |
| 209 | Ga0068855_100131047 | 3300005563 | Unclassified | 2864 |
| 210 | Ga0068855_100180228 | 3300005563 | Bacteria | 2389 |
| 211 | Ga0068855_100242476 | 3300005563 | Bacteria | 2013 |
| 212 | Ga0068855_100399924 | 3300005563 | Bacteria | 1505 |
| 213 | Ga0068855_100689010 | 3300005563 | Bacteria | 1094 |
| 214 | Ga0070664_100002091 | 3300005564 | Bacteria | 15967 |
| 215 | Ga0070664_100450176 | 3300005564 | Bacteria | 1182 |
| 216 | Ga0068857_100000097 | 3300005577 | Bacteria | 51356 |
| 217 | Ga0068857_100000164 | 3300005577 | Bacteria | 41522 |
| 218 | Ga0068857_100008343 | 3300005577 | Bacteria | 8948 |
| 219 | Ga0068854_100009674 | 3300005578 | Bacteria | 6229 |
| 220 | Ga0068854_100015311 | 3300005578 | Bacteria | 5078 |
| 221 | Ga0068854_100024684 | 3300005578 | Bacteria | 4119 |
| 222 | Ga0068854_100046522 | 3300005578 | Unclassified | 3089 |
| 223 | Ga0068856_100001671 | 3300005614 | Bacteria | 23232 |
| 224 | Ga0068856_100001677 | 3300005614 | Bacteria | 23200 |
| 225 | Ga0068856_100019882 | 3300005614 | Bacteria | 6519 |
| 226 | Ga0068856_100027769 | 3300005614 | Bacteria | 5521 |
| 227 | Ga0068856_100027810 | 3300005614 | Bacteria | 5517 |
| 228 | Ga0068856_100108933 | 3300005614 | Bacteria | 2766 |
| 229 | Ga0068856_100362753 | 3300005614 | Unclassified | 1467 |
| 230 | Ga0068856_100474657 | 3300005614 | Bacteria | 1271 |
| 231 | Ga0070702_100206729 | 3300005615 | Bacteria | 1303 |
| 232 | Ga0070702_100290374 | 3300005615 | Bacteria | 1127 |
| 233 | Ga0068852_100009747 | 3300005616 | Bacteria | 7141 |
| 234 | Ga0068852_100036308 | 3300005616 | Unclassified | 4122 |
| 235 | Ga0068852_100117826 | 3300005616 | Bacteria | 2426 |
| 236 | Ga0068852_100352391 | 3300005616 | Bacteria | 1438 |
| 237 | Ga0068852_100388659 | 3300005616 | Bacteria | 1370 |
| 238 | Ga0068859_100000780 | 3300005617 | Bacteria | 32169 |
| 239 | Ga0068859_100018677 | 3300005617 | Bacteria | 6967 |
| 240 | Ga0068864_100000242 | 3300005618 | Bacteria | 48756 |
| 241 | Ga0068864_100006501 | 3300005618 | Bacteria | 9577 |
| 242 | Ga0068864_100036884 | 3300005618 | Bacteria | 4168 |
| 243 | Ga0068866_10002395 | 3300005718 | Bacteria | 7765 |
| 244 | Ga0068866_10222692 | 3300005718 | Bacteria | 1139 |
| 245 | Ga0068861_100073761 | 3300005719 | Bacteria | 2652 |
| 246 | Ga0068861_100079741 | 3300005719 | Bacteria | 2560 |
| 247 | Ga0068861_100093682 | 3300005719 | Bacteria | 2375 |
| 248 | Ga0068861_100152207 | 3300005719 | Bacteria | 1899 |
| 249 | Ga0068851_10226320 | 3300005834 | Bacteria | 1053 |
| 250 | Ga0068870_10022504 | 3300005840 | Bacteria | 3097 |
| 251 | Ga0068870_10092064 | 3300005840 | Unclassified | 1697 |
| 252 | Ga0068863_100007429 | 3300005841 | Bacteria | 10726 |
| 253 | Ga0068863_100007901 | 3300005841 | Bacteria | 10401 |
| 254 | Ga0068863_100116135 | 3300005841 | Bacteria | 2550 |
| 255 | Ga0068863_100606456 | 3300005841 | Bacteria | 1084 |
| 256 | Ga0068858_100001038 | 3300005842 | Bacteria | 28685 |
| 257 | Ga0068858_100001331 | 3300005842 | Bacteria | 25503 |
| 258 | Ga0068858_100046025 | 3300005842 | Bacteria | 4045 |
| 259 | Ga0068860_100012630 | 3300005843 | Bacteria | 8311 |
| 260 | Ga0068860_100044011 | 3300005843 | Bacteria | 4256 |
| 261 | Ga0068860_100210325 | 3300005843 | Bacteria | 1887 |
| 262 | Ga0068860_100277814 | 3300005843 | Bacteria | 1636 |
| 263 | Ga0068862_100009673 | 3300005844 | Bacteria | 7968 |
| 264 | Ga0068862_100306889 | 3300005844 | Bacteria | 1461 |
| 265 | Ga0068862_100378326 | 3300005844 | Bacteria | 1320 |
| 266 | Ga0081455_10269275 | 3300005937 | Bacteria | 1236 |
| 267 | Ga0070717_10026203 | 3300006028 | Bacteria | 4649 |
| 268 | Ga0070717_10379596 | 3300006028 | Bacteria | 1267 |
| 269 | Ga0075364_10055611 | 3300006051 | Bacteria | 2589 |
| 270 | Ga0070712_100311527 | 3300006175 | Bacteria | 1277 |
| 271 | Ga0075362_10003601 | 3300006177 | Bacteria | 5447 |
| 272 | Ga0075367_10011581 | 3300006178 | Bacteria | 4674 |
| 273 | Ga0075366_10000209 | 3300006195 | Bacteria | 25751 |
| 274 | Ga0075366_10009229 | 3300006195 | Bacteria | 5505 |
| 275 | Ga0075366_10062293 | 3300006195 | Bacteria | 2217 |
| 276 | Ga0075366_10085110 | 3300006195 | Bacteria | 1891 |
| 277 | Ga0097621_100000314 | 3300006237 | Bacteria | 32871 |
| 278 | Ga0097621_100007716 | 3300006237 | Bacteria | 7714 |
| 279 | Ga0097621_100016282 | 3300006237 | Bacteria | 5616 |
| 280 | Ga0097621_100024590 | 3300006237 | Bacteria | 4705 |
| 281 | Ga0097621_100328348 | 3300006237 | Bacteria | 1356 |
| 282 | Ga0075370_10000798 | 3300006353 | Bacteria | 12604 |
| 283 | Ga0075370_10021340 | 3300006353 | Bacteria | 3548 |
| 284 | Ga0075370_10025236 | 3300006353 | Bacteria | 3286 |
| 285 | Ga0075370_10034151 | 3300006353 | Bacteria | 2851 |
| 286 | Ga0075370_10074951 | 3300006353 | Bacteria | 1939 |
| 287 | Ga0068871_100009452 | 3300006358 | Bacteria | 7067 |
| 288 | Ga0068871_100040452 | 3300006358 | Bacteria | 3734 |
| 289 | Ga0068871_100070667 | 3300006358 | Bacteria | 2869 |
| 290 | Ga0075428_100103519 | 3300006844 | Bacteria | 3104 |
| 291 | Ga0075431_100262127 | 3300006847 | Bacteria | 1754 |
| 292 | Ga0075433_10490402 | 3300006852 | Bacteria | 1082 |
| 293 | Ga0075434_100092796 | 3300006871 | Bacteria | 3022 |
| 294 | Ga0075434_100263519 | 3300006871 | Bacteria | 1742 |
| 295 | Ga0075434_100318442 | 3300006871 | Bacteria | 1576 |
| 296 | Ga0075429_100067405 | 3300006880 | Bacteria | 3114 |
| 297 | Ga0068865_100057940 | 3300006881 | Bacteria | 2704 |
| 298 | Ga0075436_100088124 | 3300006914 | Bacteria | 2156 |
| 299 | Ga0075436_100241914 | 3300006914 | Bacteria | 1284 |
| 300 | Ga0097620_100000780 | 3300006931 | Bacteria | 32169 |
| 301 | Ga0097620_100018677 | 3300006931 | Bacteria | 6967 |
| 302 | Ga0075435_100003402 | 3300007076 | Bacteria | 10788 |
| 303 | Ga0099794_10005413 | 3300007265 | Bacteria | 5115 |
| 304 | Ga0099795_10030697 | 3300007788 | Bacteria | 1847 |
| 305 | Ga0099795_10089526 | 3300007788 | Bacteria | 1191 |
| 306 | Ga0105240_10002073 | 3300009093 | Bacteria | 32845 |
| 307 | Ga0105240_10002125 | 3300009093 | Bacteria | 32374 |
| 308 | Ga0105240_10008664 | 3300009093 | Bacteria | 14523 |
| 309 | Ga0105240_10021828 | 3300009093 | Bacteria | 8508 |
| 310 | Ga0105240_10108762 | 3300009093 | Bacteria | 3358 |
| 311 | Ga0105240_10204579 | 3300009093 | Bacteria | 2312 |
| 312 | Ga0105240_10338636 | 3300009093 | Bacteria | 1709 |
| 313 | Ga0105240_10352982 | 3300009093 | Bacteria | 1668 |
| 314 | Ga0105240_10618140 | 3300009093 | Bacteria | 1191 |
| 315 | Ga0111539_10003952 | 3300009094 | Bacteria | 19471 |
| 316 | Ga0105245_10009192 | 3300009098 | Bacteria | 8617 |
| 317 | Ga0105245_10448816 | 3300009098 | Bacteria | 1298 |
| 318 | Ga0114129_10001813 | 3300009147 | Bacteria | 29131 |
| 319 | Ga0114129_10105052 | 3300009147 | Bacteria | 3903 |
| 320 | Ga0114129_10870557 | 3300009147 | Bacteria | 1144 |
| 321 | Ga0114129_11078406 | 3300009147 | Bacteria | 1007 |
| 322 | Ga0105243_10077587 | 3300009148 | Bacteria | 2702 |
| 323 | Ga0105243_10131023 | 3300009148 | Bacteria | 2127 |
| 324 | Ga0105243_10151416 | 3300009148 | Bacteria | 1990 |
| 325 | Ga0105243_10208365 | 3300009148 | Bacteria | 1720 |
| 326 | Ga0105243_10547898 | 3300009148 | Bacteria | 1105 |
| 327 | Ga0105241_10033445 | 3300009174 | Bacteria | 3860 |
| 328 | Ga0105241_10151395 | 3300009174 | Bacteria | 1898 |
| 329 | Ga0105241_10160747 | 3300009174 | Bacteria | 1846 |
| 330 | Ga0105241_10178272 | 3300009174 | Bacteria | 1761 |
| 331 | Ga0105241_10201131 | 3300009174 | Bacteria | 1664 |
| 332 | Ga0105242_10074656 | 3300009176 | Bacteria | 2822 |
| 333 | Ga0105242_10218114 | 3300009176 | Unclassified | 1703 |
| 334 | Ga0105248_10035730 | 3300009177 | Bacteria | 5559 |
| 335 | Ga0105248_10109410 | 3300009177 | Bacteria | 3116 |
| 336 | Ga0105248_10125452 | 3300009177 | Bacteria | 2896 |
| 337 | Ga0105248_10317774 | 3300009177 | Bacteria | 1754 |
| 338 | Ga0105248_11060566 | 3300009177 | Bacteria | 916 |
| 339 | Ga0105237_10010975 | 3300009545 | Bacteria | 9613 |
| 340 | Ga0105237_10024770 | 3300009545 | Bacteria | 6139 |
| 341 | Ga0105237_10131925 | 3300009545 | Bacteria | 2493 |
| 342 | Ga0105238_10000064 | 3300009551 | Bacteria | 122380 |
| 343 | Ga0105238_10026318 | 3300009551 | Bacteria | 5929 |
| 344 | Ga0105238_10061388 | 3300009551 | Bacteria | 3762 |
| 345 | Ga0105238_10786052 | 3300009551 | Bacteria | 967 |
| 346 | Ga0105249_10065798 | 3300009553 | Bacteria | 3335 |
| 347 | Ga0105239_10335314 | 3300010375 | Bacteria | 1706 |
| 348 | Ga0105246_10061266 | 3300011119 | Bacteria | 2617 |
| 349 | Ga0105246_10209092 | 3300011119 | Bacteria | 1522 |
| 350 | Ga0105246_10254815 | 3300011119 | Bacteria | 1395 |
| 351 | Ga0157373_10086388 | 3300013100 | Bacteria | 2211 |
| 352 | Ga0157373_10174784 | 3300013100 | Bacteria | 1511 |
| 353 | Ga0157371_10000013 | 3300013102 | Bacteria | 352631 |
| 354 | Ga0157371_10000064 | 3300013102 | Bacteria | 169056 |
| 355 | Ga0157371_10046815 | 3300013102 | Bacteria | 3075 |
| 356 | Ga0157371_10077462 | 3300013102 | Bacteria | 2354 |
| 357 | Ga0157371_10096657 | 3300013102 | Unclassified | 2093 |
| 358 | Ga0157370_10361540 | 3300013104 | Bacteria | 1337 |
| 359 | Ga0157370_10669722 | 3300013104 | Bacteria | 948 |
| 360 | Ga0157369_10000522 | 3300013105 | Bacteria | 50647 |
| 361 | Ga0157369_10027164 | 3300013105 | Bacteria | 6347 |
| 362 | Ga0157369_10032556 | 3300013105 | Bacteria | 5732 |
| 363 | Ga0157369_10048151 | 3300013105 | Bacteria | 4626 |
| 364 | Ga0157369_10187677 | 3300013105 | Bacteria | 2173 |
| 365 | Ga0157369_10245648 | 3300013105 | Bacteria | 1869 |
| 366 | Ga0157369_10971128 | 3300013105 | Bacteria | 870 |
| 367 | Ga0157374_10000245 | 3300013296 | Bacteria | 50434 |
| 368 | Ga0157374_10000577 | 3300013296 | Bacteria | 32518 |
| 369 | Ga0157374_10078751 | 3300013296 | Bacteria | 3122 |
| 370 | Ga0157374_10313883 | 3300013296 | Bacteria | 1552 |
| 371 | Ga0157378_10000172 | 3300013297 | Bacteria | 61182 |
| 372 | Ga0157378_10123834 | 3300013297 | Bacteria | 2386 |
| 373 | Ga0157378_10150386 | 3300013297 | Bacteria | 2169 |
| 374 | Ga0157378_10228616 | 3300013297 | Bacteria | 1771 |
| 375 | Ga0157378_10353735 | 3300013297 | Bacteria | 1436 |
| 376 | Ga0163162_10775537 | 3300013306 | Bacteria | 1077 |
| 377 | Ga0157372_10000450 | 3300013307 | Bacteria | 45152 |
| 378 | Ga0157372_10011617 | 3300013307 | Bacteria | 9375 |
| 379 | Ga0157372_10024161 | 3300013307 | Bacteria | 6596 |
| 380 | Ga0157372_10025639 | 3300013307 | Bacteria | 6412 |
| 381 | Ga0157372_10090823 | 3300013307 | Bacteria | 3473 |
| 382 | Ga0157372_10175298 | 3300013307 | Bacteria | 2482 |
| 383 | Ga0157372_10418765 | 3300013307 | Bacteria | 1561 |
| 384 | Ga0157372_10629303 | 3300013307 | Bacteria | 1250 |
| 385 | Ga0157375_10053089 | 3300013308 | Bacteria | 3987 |
| 386 | Ga0163163_10018823 | 3300014325 | Bacteria | 6475 |
| 387 | Ga0163163_10262780 | 3300014325 | Bacteria | 1777 |
| 388 | Ga0157380_10259725 | 3300014326 | Bacteria | 1577 |
| 389 | Ga0182008_10024693 | 3300014497 | Bacteria | 3057 |
| 390 | Ga0157379_10012032 | 3300014968 | Bacteria | 7559 |
| 391 | Ga0157376_10077607 | 3300014969 | Bacteria | 2841 |
| 392 | Ga0157376_10194314 | 3300014969 | Bacteria | 1863 |
| 393 | Ga0157376_10385259 | 3300014969 | Bacteria | 1352 |
| 394 | Ga0157376_11132777 | 3300014969 | Bacteria | 809 |
| 395 | Ga0182006_1032583 | 3300015261 | Bacteria | 2093 |
| 396 | Ga0182007_10022545 | 3300015262 | Bacteria | 2223 |
| 397 | Ga0182007_10066331 | 3300015262 | Bacteria | 1182 |
| 398 | Ga0163161_10091476 | 3300017792 | Bacteria | 2252 |
| 399 | Ga0213872_10000115 | 3300021361 | Bacteria | 74334 |
| 400 | Ga0213872_10004364 | 3300021361 | Bacteria | 7531 |
| 401 | Ga0213872_10057539 | 3300021361 | Bacteria | 1760 |
| 402 | Ga0209436_100218 | 3300025208 | Bacteria | 26371 |
| 403 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 404 | Ga0209674_100007 | 3300025226 | Bacteria | 1077082 |
| 405 | Ga0209672_102656 | 3300025228 | Bacteria | 4191 |
| 406 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 407 | Ga0209563_100049 | 3300025230 | Bacteria | 358472 |
| 408 | Ga0209563_100060 | 3300025230 | Bacteria | 284876 |
| 409 | Ga0209563_100088 | 3300025230 | Bacteria | 175375 |
| 410 | Ga0209563_105947 | 3300025230 | Bacteria | 2147 |
| 411 | Ga0207427_100282 | 3300025231 | Bacteria | 37116 |
| 412 | Ga0207427_100623 | 3300025231 | Bacteria | 17397 |
| 413 | Ga0209258_100128 | 3300025242 | Bacteria | 177216 |
| 414 | Ga0209258_100683 | 3300025242 | Bacteria | 23569 |
| 415 | Ga0209258_102459 | 3300025242 | Bacteria | 4763 |
| 416 | Ga0207425_1000109 | 3300025245 | Bacteria | 77611 |
| 417 | Ga0207425_1000122 | 3300025245 | Bacteria | 73381 |
| 418 | Ga0207425_1000482 | 3300025245 | Bacteria | 25150 |
| 419 | Ga0207425_1002022 | 3300025245 | Bacteria | 7559 |
| 420 | Ga0207425_1007654 | 3300025245 | Bacteria | 2830 |
| 421 | Ga0209646_1000056 | 3300025246 | Bacteria | 269860 |
| 422 | Ga0209646_1000111 | 3300025246 | Bacteria | 155786 |
| 423 | Ga0209026_1000009 | 3300025250 | Bacteria | 531812 |
| 424 | Ga0209026_1000054 | 3300025250 | Bacteria | 242508 |
| 425 | Ga0209677_100050 | 3300025253 | Bacteria | 176828 |
| 426 | Ga0209677_100129 | 3300025253 | Bacteria | 73193 |
| 427 | Ga0209677_100514 | 3300025253 | Bacteria | 21584 |
| 428 | Ga0209677_101079 | 3300025253 | Bacteria | 12880 |
| 429 | Ga0209677_101420 | 3300025253 | Bacteria | 10367 |
| 430 | Ga0209677_112089 | 3300025253 | Bacteria | 1302 |
| 431 | Ga0209148_1000272 | 3300025254 | Bacteria | 81330 |
| 432 | Ga0209759_1000035 | 3300025256 | Bacteria | 264254 |
| 433 | Ga0209759_1000043 | 3300025256 | Bacteria | 242513 |
| 434 | Ga0209759_1000666 | 3300025256 | Bacteria | 31844 |
| 435 | Ga0209759_1001454 | 3300025256 | Bacteria | 13344 |
| 436 | Ga0209759_1004314 | 3300025256 | Bacteria | 5351 |
| 437 | Ga0209759_1006725 | 3300025256 | Bacteria | 3815 |
| 438 | Ga0209759_1009204 | 3300025256 | Bacteria | 3003 |
| 439 | Ga0209129_1000582 | 3300025258 | Bacteria | 25150 |
| 440 | Ga0209129_1002417 | 3300025258 | Bacteria | 9177 |
| 441 | Ga0209565_1000600 | 3300025263 | Bacteria | 24200 |
| 442 | Ga0209565_1005953 | 3300025263 | Bacteria | 3489 |
| 443 | Ga0209565_1015548 | 3300025263 | Bacteria | 1714 |
| 444 | Ga0209455_1000108 | 3300025272 | Bacteria | 193021 |
| 445 | Ga0209455_1000116 | 3300025272 | Bacteria | 177216 |
| 446 | Ga0209130_1000171 | 3300025284 | Bacteria | 94371 |
| 447 | Ga0209130_1001410 | 3300025284 | Bacteria | 16030 |
| 448 | Ga0209675_1000739 | 3300025291 | Bacteria | 22095 |
| 449 | Ga0209675_1001493 | 3300025291 | Bacteria | 13414 |
| 450 | Ga0209675_1005760 | 3300025291 | Bacteria | 5110 |
| 451 | Ga0209564_1000095 | 3300025295 | Bacteria | 237896 |
| 452 | Ga0209564_1003896 | 3300025295 | Bacteria | 9588 |
| 453 | Ga0209564_1004713 | 3300025295 | Bacteria | 8176 |
| 454 | Ga0209758_1001664 | 3300025297 | Bacteria | 25150 |
| 455 | Ga0209050_1000011 | 3300025298 | Bacteria | 914037 |
| 456 | Ga0209050_1000547 | 3300025298 | Bacteria | 62265 |
| 457 | Ga0209050_1001381 | 3300025298 | Bacteria | 26455 |
| 458 | Ga0209050_1004051 | 3300025298 | Bacteria | 10279 |
| 459 | Ga0209050_1006205 | 3300025298 | Bacteria | 7171 |
| 460 | Ga0209256_1000987 | 3300025299 | Bacteria | 34068 |
| 461 | Ga0209256_1001062 | 3300025299 | Bacteria | 31871 |
| 462 | Ga0209256_1059981 | 3300025299 | Bacteria | 889 |
| 463 | Ga0209051_1003873 | 3300025303 | Bacteria | 9559 |
| 464 | Ga0209051_1008357 | 3300025303 | Bacteria | 5489 |
| 465 | Ga0209051_1018162 | 3300025303 | Bacteria | 3120 |
| 466 | Ga0209051_1026335 | 3300025303 | Bacteria | 2345 |
| 467 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 468 | Ga0209257_1000017 | 3300025304 | Bacteria | 866287 |
| 469 | Ga0209257_1000117 | 3300025304 | Bacteria | 227328 |
| 470 | Ga0209257_1014465 | 3300025304 | Bacteria | 3388 |
| 471 | Ga0209257_1030252 | 3300025304 | Bacteria | 1751 |
| 472 | Ga0207656_10087765 | 3300025321 | Bacteria | 1407 |
| 473 | Ga0207682_10003095 | 3300025893 | Bacteria | 7289 |
| 474 | Ga0207682_10048403 | 3300025893 | Bacteria | 1752 |
| 475 | Ga0207642_10004420 | 3300025899 | Bacteria | 4533 |
| 476 | Ga0207688_10016962 | 3300025901 | Bacteria | 3957 |
| 477 | Ga0207680_10274907 | 3300025903 | Bacteria | 1169 |
| 478 | Ga0207680_10330494 | 3300025903 | Bacteria | 1067 |
| 479 | Ga0207699_10087189 | 3300025906 | Bacteria | 1951 |
| 480 | Ga0207699_10276793 | 3300025906 | Bacteria | 1165 |
| 481 | Ga0207645_10073735 | 3300025907 | Bacteria | 2185 |
| 482 | Ga0207645_10235079 | 3300025907 | Bacteria | 1210 |
| 483 | Ga0207643_10007445 | 3300025908 | Bacteria | 5874 |
| 484 | Ga0207705_10000922 | 3300025909 | Bacteria | 24029 |
| 485 | Ga0207705_10014081 | 3300025909 | Bacteria | 5763 |
| 486 | Ga0207705_10023899 | 3300025909 | Bacteria | 4361 |
| 487 | Ga0207705_10052182 | 3300025909 | Bacteria | 2944 |
| 488 | Ga0207705_10064246 | 3300025909 | Bacteria | 2652 |
| 489 | Ga0207705_10202375 | 3300025909 | Bacteria | 1505 |
| 490 | Ga0207684_10000125 | 3300025910 | Bacteria | 141210 |
| 491 | Ga0207684_10013608 | 3300025910 | Bacteria | 7032 |
| 492 | Ga0207684_10226178 | 3300025910 | Bacteria | 1614 |
| 493 | Ga0207654_10021970 | 3300025911 | Bacteria | 3399 |
| 494 | Ga0207654_10080747 | 3300025911 | Unclassified | 1956 |
| 495 | Ga0207654_10183518 | 3300025911 | Bacteria | 1366 |
| 496 | Ga0207654_10231662 | 3300025911 | Bacteria | 1230 |
| 497 | Ga0207707_10001125 | 3300025912 | Bacteria | 25351 |
| 498 | Ga0207707_10060943 | 3300025912 | Bacteria | 3283 |
| 499 | Ga0207707_10226090 | 3300025912 | Bacteria | 1628 |
| 500 | Ga0207695_10001924 | 3300025913 | Bacteria | 32293 |
| 501 | Ga0207695_10008820 | 3300025913 | Bacteria | 12557 |
| 502 | Ga0207695_10018362 | 3300025913 | Bacteria | 8091 |
| 503 | Ga0207695_10035278 | 3300025913 | Bacteria | 5427 |
| 504 | Ga0207695_10049321 | 3300025913 | Bacteria | 4440 |
| 505 | Ga0207695_10084876 | 3300025913 | Bacteria | 3196 |
| 506 | Ga0207695_10093813 | 3300025913 | Bacteria | 3010 |
| 507 | Ga0207695_10128664 | 3300025913 | Bacteria | 2492 |
| 508 | Ga0207671_10240263 | 3300025914 | Bacteria | 1423 |
| 509 | Ga0207693_10305720 | 3300025915 | Bacteria | 1245 |
| 510 | Ga0207693_10585282 | 3300025915 | Bacteria | 869 |
| 511 | Ga0207663_10435488 | 3300025916 | Bacteria | 1009 |
| 512 | Ga0207663_10449168 | 3300025916 | Bacteria | 994 |
| 513 | Ga0207660_10033710 | 3300025917 | Bacteria | 3545 |
| 514 | Ga0207660_10104439 | 3300025917 | Bacteria | 2122 |
| 515 | Ga0207660_10358913 | 3300025917 | Bacteria | 1169 |
| 516 | Ga0207657_10000491 | 3300025919 | Bacteria | 41762 |
| 517 | Ga0207657_10010663 | 3300025919 | Bacteria | 9153 |
| 518 | Ga0207657_10016061 | 3300025919 | Bacteria | 7227 |
| 519 | Ga0207649_10047767 | 3300025920 | Bacteria | 2636 |
| 520 | Ga0207649_10076573 | 3300025920 | Bacteria | 2153 |
| 521 | Ga0207649_10387357 | 3300025920 | Bacteria | 1043 |
| 522 | Ga0207652_10048726 | 3300025921 | Bacteria | 3623 |
| 523 | Ga0207652_10080300 | 3300025921 | Bacteria | 2851 |
| 524 | Ga0207652_10237251 | 3300025921 | Bacteria | 1644 |
| 525 | Ga0207652_10299749 | 3300025921 | Unclassified | 1451 |
| 526 | Ga0207646_10045253 | 3300025922 | Bacteria | 3951 |
| 527 | Ga0207646_10054214 | 3300025922 | Bacteria | 3587 |
| 528 | Ga0207681_10028871 | 3300025923 | Bacteria | 3596 |
| 529 | Ga0207681_10178304 | 3300025923 | Bacteria | 1616 |
| 530 | Ga0207694_10000892 | 3300025924 | Bacteria | 26471 |
| 531 | Ga0207694_10025695 | 3300025924 | Bacteria | 4477 |
| 532 | Ga0207694_10053670 | 3300025924 | Bacteria | 3126 |
| 533 | Ga0207694_10135566 | 3300025924 | Bacteria | 1977 |
| 534 | Ga0207694_10189339 | 3300025924 | Bacteria | 1671 |
| 535 | Ga0207694_10306341 | 3300025924 | Bacteria | 1309 |
| 536 | Ga0207650_10008943 | 3300025925 | Bacteria | 6845 |
| 537 | Ga0207650_10013039 | 3300025925 | Bacteria | 5749 |
| 538 | Ga0207659_10000312 | 3300025926 | Bacteria | 29506 |
| 539 | Ga0207659_10379040 | 3300025926 | Unclassified | 1179 |
| 540 | Ga0207659_10875022 | 3300025926 | Bacteria | 772 |
| 541 | Ga0207687_10020028 | 3300025927 | Bacteria | 4436 |
| 542 | Ga0207700_10012386 | 3300025928 | Bacteria | 5498 |
| 543 | Ga0207700_10118923 | 3300025928 | Bacteria | 2139 |
| 544 | Ga0207664_10009316 | 3300025929 | Bacteria | 6884 |
| 545 | Ga0207644_10000437 | 3300025931 | Bacteria | 26946 |
| 546 | Ga0207690_10003250 | 3300025932 | Bacteria | 9750 |
| 547 | Ga0207690_10027464 | 3300025932 | Bacteria | 3596 |
| 548 | Ga0207690_10266177 | 3300025932 | Unclassified | 1330 |
| 549 | Ga0207690_10308267 | 3300025932 | Bacteria | 1241 |
| 550 | Ga0207690_10346723 | 3300025932 | Bacteria | 1173 |
| 551 | Ga0207690_10367811 | 3300025932 | Bacteria | 1140 |
| 552 | Ga0207706_10021959 | 3300025933 | Bacteria | 5729 |
| 553 | Ga0207706_10077498 | 3300025933 | Bacteria | 2923 |
| 554 | Ga0207706_10144285 | 3300025933 | Bacteria | 2094 |
| 555 | Ga0207706_10255393 | 3300025933 | Bacteria | 1530 |
| 556 | Ga0207686_10200975 | 3300025934 | Bacteria | 1427 |
| 557 | Ga0207709_10019410 | 3300025935 | Bacteria | 3821 |
| 558 | Ga0207709_10073088 | 3300025935 | Bacteria | 2183 |
| 559 | Ga0207709_10086867 | 3300025935 | Bacteria | 2032 |
| 560 | Ga0207670_10005757 | 3300025936 | Bacteria | 6837 |
| 561 | Ga0207669_10002447 | 3300025937 | Bacteria | 7920 |
| 562 | Ga0207669_10125155 | 3300025937 | Bacteria | 1754 |
| 563 | Ga0207669_10230185 | 3300025937 | Bacteria | 1367 |
| 564 | Ga0207704_10048448 | 3300025938 | Unclassified | 2548 |
| 565 | Ga0207704_10409649 | 3300025938 | Bacteria | 1072 |
| 566 | Ga0207665_10041537 | 3300025939 | Bacteria | 3072 |
| 567 | Ga0207691_10006654 | 3300025940 | Bacteria | 11153 |
| 568 | Ga0207691_10011341 | 3300025940 | Bacteria | 8551 |
| 569 | Ga0207691_10059505 | 3300025940 | Bacteria | 3473 |
| 570 | Ga0207711_10001682 | 3300025941 | Bacteria | 20373 |
| 571 | Ga0207711_10167602 | 3300025941 | Bacteria | 1991 |
| 572 | Ga0207711_10416745 | 3300025941 | Bacteria | 1249 |
| 573 | Ga0207711_10743858 | 3300025941 | Bacteria | 914 |
| 574 | Ga0207689_10008999 | 3300025942 | Bacteria | 8648 |
| 575 | Ga0207689_10015618 | 3300025942 | Bacteria | 6431 |
| 576 | Ga0207689_10035478 | 3300025942 | Bacteria | 4143 |
| 577 | Ga0207689_10043834 | 3300025942 | Bacteria | 3698 |
| 578 | Ga0207689_10076344 | 3300025942 | Bacteria | 2755 |
| 579 | Ga0207689_10132622 | 3300025942 | Bacteria | 2050 |
| 580 | Ga0207689_10145775 | 3300025942 | Bacteria | 1951 |
| 581 | Ga0207679_10010631 | 3300025945 | Bacteria | 5931 |
| 582 | Ga0207679_10089918 | 3300025945 | Bacteria | 2371 |
| 583 | Ga0207679_10264748 | 3300025945 | Bacteria | 1468 |
| 584 | Ga0207667_10000370 | 3300025949 | Bacteria | 60796 |
| 585 | Ga0207667_10001781 | 3300025949 | Bacteria | 27113 |
| 586 | Ga0207667_10002286 | 3300025949 | Bacteria | 24079 |
| 587 | Ga0207667_10005671 | 3300025949 | Bacteria | 15220 |
| 588 | Ga0207667_10009062 | 3300025949 | Bacteria | 11765 |
| 589 | Ga0207667_10027546 | 3300025949 | Bacteria | 6183 |
| 590 | Ga0207667_10030004 | 3300025949 | Bacteria | 5889 |
| 591 | Ga0207667_10071942 | 3300025949 | Bacteria | 3595 |
| 592 | Ga0207667_10074524 | 3300025949 | Bacteria | 3526 |
| 593 | Ga0207667_10303399 | 3300025949 | Unclassified | 1631 |
| 594 | Ga0207651_10006315 | 3300025960 | Bacteria | 6187 |
| 595 | Ga0207651_10007614 | 3300025960 | Bacteria | 5780 |
| 596 | Ga0207651_10011224 | 3300025960 | Bacteria | 5005 |
| 597 | Ga0207651_10012811 | 3300025960 | Bacteria | 4765 |
| 598 | Ga0207651_10047413 | 3300025960 | Bacteria | 2897 |
| 599 | Ga0207651_10186258 | 3300025960 | Bacteria | 1652 |
| 600 | Ga0207712_10024503 | 3300025961 | Bacteria | 3997 |
| 601 | Ga0207712_10208932 | 3300025961 | Bacteria | 1553 |
| 602 | Ga0207668_10039675 | 3300025972 | Bacteria | 3172 |
| 603 | Ga0207668_10281653 | 3300025972 | Bacteria | 1364 |
| 604 | Ga0207640_10006668 | 3300025981 | Bacteria | 6344 |
| 605 | Ga0207640_10013622 | 3300025981 | Bacteria | 4666 |
| 606 | Ga0207640_10060137 | 3300025981 | Bacteria | 2510 |
| 607 | Ga0207658_10001772 | 3300025986 | Bacteria | 16204 |
| 608 | Ga0207658_10016258 | 3300025986 | Bacteria | 5117 |
| 609 | Ga0207677_10001268 | 3300026023 | Bacteria | 13594 |
| 610 | Ga0207677_10005627 | 3300026023 | Bacteria | 6810 |
| 611 | Ga0207677_10131393 | 3300026023 | Bacteria | 1902 |
| 612 | Ga0207677_10209806 | 3300026023 | Bacteria | 1554 |
| 613 | Ga0207677_10670337 | 3300026023 | Bacteria | 917 |
| 614 | Ga0207703_10001047 | 3300026035 | Bacteria | 26351 |
| 615 | Ga0207703_10004544 | 3300026035 | Bacteria | 11377 |
| 616 | Ga0207703_10035999 | 3300026035 | Bacteria | 3936 |
| 617 | Ga0207703_10038715 | 3300026035 | Bacteria | 3808 |
| 618 | Ga0207678_10000518 | 3300026067 | Bacteria | 34984 |
| 619 | Ga0207678_10229270 | 3300026067 | Bacteria | 1590 |
| 620 | Ga0207678_10296308 | 3300026067 | Bacteria | 1390 |
| 621 | Ga0207678_10296668 | 3300026067 | Bacteria | 1389 |
| 622 | Ga0207678_10303302 | 3300026067 | Bacteria | 1372 |
| 623 | Ga0207708_10097433 | 3300026075 | Bacteria | 2273 |
| 624 | Ga0207708_10320011 | 3300026075 | Bacteria | 1266 |
| 625 | Ga0207702_10000784 | 3300026078 | Bacteria | 33661 |
| 626 | Ga0207702_10000946 | 3300026078 | Bacteria | 29831 |
| 627 | Ga0207702_10001288 | 3300026078 | Bacteria | 25108 |
| 628 | Ga0207702_10005752 | 3300026078 | Bacteria | 10792 |
| 629 | Ga0207702_10023362 | 3300026078 | Bacteria | 5127 |
| 630 | Ga0207702_10108476 | 3300026078 | Bacteria | 2463 |
| 631 | Ga0207702_10352820 | 3300026078 | Unclassified | 1408 |
| 632 | Ga0207641_10023176 | 3300026088 | Bacteria | 5115 |
| 633 | Ga0207641_10024355 | 3300026088 | Bacteria | 4989 |
| 634 | Ga0207648_10002110 | 3300026089 | Bacteria | 21651 |
| 635 | Ga0207648_10016441 | 3300026089 | Bacteria | 6758 |
| 636 | Ga0207648_10231620 | 3300026089 | Bacteria | 1643 |
| 637 | Ga0207648_10411927 | 3300026089 | Bacteria | 1226 |
| 638 | Ga0207648_10474701 | 3300026089 | Bacteria | 1142 |
| 639 | Ga0207648_10516774 | 3300026089 | Bacteria | 1094 |
| 640 | Ga0207676_10000733 | 3300026095 | Bacteria | 25719 |
| 641 | Ga0207676_10004725 | 3300026095 | Bacteria | 9652 |
| 642 | Ga0207676_10178795 | 3300026095 | Bacteria | 1856 |
| 643 | Ga0207676_10197867 | 3300026095 | Bacteria | 1773 |
| 644 | Ga0207674_10000190 | 3300026116 | Bacteria | 75394 |
| 645 | Ga0207674_10089845 | 3300026116 | Bacteria | 3064 |
| 646 | Ga0207674_10139968 | 3300026116 | Bacteria | 2380 |
| 647 | Ga0207675_100017183 | 3300026118 | Bacteria | 6757 |
| 648 | Ga0207675_100035659 | 3300026118 | Bacteria | 4640 |
| 649 | Ga0207675_100042815 | 3300026118 | Bacteria | 4228 |
| 650 | Ga0207675_100128862 | 3300026118 | Bacteria | 2398 |
| 651 | Ga0207675_100144539 | 3300026118 | Bacteria | 2261 |
| 652 | Ga0207675_100152575 | 3300026118 | Bacteria | 2200 |
| 653 | Ga0207675_100274431 | 3300026118 | Bacteria | 1637 |
| 654 | Ga0207683_10001702 | 3300026121 | Bacteria | 19675 |
| 655 | Ga0207683_10008866 | 3300026121 | Bacteria | 8577 |
| 656 | Ga0207683_10016550 | 3300026121 | Bacteria | 6277 |
| 657 | Ga0207698_10052496 | 3300026142 | Bacteria | 3124 |
| 658 | Ga0207698_10056614 | 3300026142 | Bacteria | 3028 |
| 659 | Ga0207698_10224609 | 3300026142 | Bacteria | 1700 |
| 660 | Ga0207698_10292366 | 3300026142 | Bacteria | 1513 |
| 661 | Ga0207698_10319372 | 3300026142 | Bacteria | 1454 |
| 662 | Ga0207698_10599437 | 3300026142 | Bacteria | 1086 |
| 663 | Ga0207428_10000671 | 3300027907 | Bacteria | 39984 |
| 664 | Ga0265354_1000050 | 3300028016 | Bacteria | 19370 |
| 665 | Ga0265354_1000584 | 3300028016 | Bacteria | 6144 |
| 666 | Ga0268266_10050403 | 3300028379 | Bacteria | 3572 |
| 667 | Ga0268266_10079015 | 3300028379 | Bacteria | 2864 |
| 668 | Ga0268266_10085387 | 3300028379 | Bacteria | 2758 |
| 669 | Ga0268266_10395256 | 3300028379 | Bacteria | 1306 |
| 670 | Ga0268264_10012037 | 3300028381 | Bacteria | 7122 |
| 671 | Ga0268264_10037455 | 3300028381 | Bacteria | 3999 |
| 672 | Ga0268264_10159632 | 3300028381 | Bacteria | 2030 |
| 673 | Ga0268264_10203070 | 3300028381 | Bacteria | 1814 |
| 674 | Ga0268264_10287927 | 3300028381 | Bacteria | 1542 |
| 675 | Ga0265336_10000006 | 3300028666 | Bacteria | 348453 |
| 676 | Ga0265336_10000039 | 3300028666 | Bacteria | 149376 |
| 677 | Ga0307517_10164321 | 3300028786 | Bacteria | 1479 |
| 678 | Ga0307515_10000110 | 3300028794 | Bacteria | 195560 |
| 679 | Ga0307515_10000366 | 3300028794 | Bacteria | 111195 |
| 680 | Ga0307515_10001235 | 3300028794 | Bacteria | 58313 |
| 681 | Ga0307515_10002229 | 3300028794 | Bacteria | 42507 |
| 682 | Ga0307515_10034594 | 3300028794 | Bacteria | 8261 |
| 683 | Ga0265338_10207480 | 3300028800 | Bacteria | 1473 |
| 684 | Ga0265324_10000223 | 3300029957 | Bacteria | 43654 |
| 685 | Ga0265324_10001026 | 3300029957 | Bacteria | 17151 |
| 686 | Ga0307511_10056167 | 3300030521 | Bacteria | 3082 |
| 687 | Ga0307512_10032623 | 3300030522 | Bacteria | 4493 |
| 688 | Ga0307512_10114714 | 3300030522 | Bacteria | 1758 |
| 689 | Ga0265770_1004651 | 3300030878 | Unclassified | 1876 |
| 690 | Ga0265760_10006171 | 3300031090 | Unclassified | 3427 |
| 691 | Ga0265760_10007108 | 3300031090 | Unclassified | 3205 |
| 692 | Ga0265327_10009479 | 3300031251 | Bacteria | 7018 |
| 693 | Ga0307513_10011456 | 3300031456 | Bacteria | 11022 |
| 694 | Ga0307513_10059527 | 3300031456 | Bacteria | 4054 |
| 695 | Ga0307513_10154193 | 3300031456 | Bacteria | 2200 |
| 696 | Ga0307509_10114290 | 3300031507 | Bacteria | 2695 |
| 697 | Ga0307408_100000006 | 3300031548 | Bacteria | 472824 |
| 698 | Ga0307408_100000140 | 3300031548 | Bacteria | 80709 |
| 699 | Ga0307408_100015385 | 3300031548 | Bacteria | 5092 |
| 700 | Ga0307408_100025904 | 3300031548 | Bacteria | 4020 |
| 701 | Ga0307508_10000107 | 3300031616 | Bacteria | 97818 |
| 702 | Ga0307514_10006915 | 3300031649 | Bacteria | 9819 |
| 703 | Ga0307516_10002030 | 3300031730 | Bacteria | 27591 |
| 704 | Ga0307516_10007929 | 3300031730 | Bacteria | 12093 |
| 705 | Ga0307516_10029384 | 3300031730 | Bacteria | 5557 |
| 706 | Ga0307405_10590910 | 3300031731 | Bacteria | 904 |
| 707 | Ga0307413_10202109 | 3300031824 | Bacteria | 1436 |
| 708 | Ga0307413_10223023 | 3300031824 | Bacteria | 1378 |
| 709 | Ga0307410_10057607 | 3300031852 | Bacteria | 2646 |
| 710 | Ga0307410_10640037 | 3300031852 | Unclassified | 891 |
| 711 | Ga0307406_10025118 | 3300031901 | Bacteria | 3564 |
| 712 | Ga0307407_10232004 | 3300031903 | Bacteria | 1254 |
| 713 | Ga0307412_10003387 | 3300031911 | Bacteria | 8858 |
| 714 | Ga0307416_100061701 | 3300032002 | Bacteria | 3061 |
| 715 | Ga0307416_100242343 | 3300032002 | Bacteria | 1748 |
| 716 | Ga0307416_101043823 | 3300032002 | Bacteria | 921 |
| 717 | Ga0307416_101147549 | 3300032002 | Bacteria | 882 |
| 718 | Ga0307414_10016384 | 3300032004 | Bacteria | 4505 |
| 719 | Ga0307411_10028697 | 3300032005 | Bacteria | 3387 |
| 720 | Ga0307411_10093375 | 3300032005 | Bacteria | 2107 |
| 721 | Ga0307411_10682166 | 3300032005 | Bacteria | 893 |
| 722 | Ga0316212_1000963 | 3300033547 | Unclassified | 3766 |
| 723 | Ga0373948_0002839 | 3300034817 | Bacteria | 2601 |
| 724 | Ga0373950_0007074 | 3300034818 | Bacteria | 1731 |
| 725 | Ga0373926_0055970 | 3300035083 | Bacteria | 1430 |
| 726 | Ga0373934_0067146 | 3300035086 | Bacteria | 1432 |
| 727 | Ga0373940_0010445 | 3300035088 | Bacteria | 2182 |
| 728 | Ga0373940_0097231 | 3300035088 | Bacteria | 889 |
| 729 | Ga0373949_0027316 | 3300035090 | Bacteria | 1341 |
| 730 | Ga0373951_0001888 | 3300035091 | Bacteria | 5395 |
| 731 | Ga0373923_0114125 | 3300035111 | Bacteria | 1202 |
| 732 | Ga0373939_0000224 | 3300035114 | Bacteria | 15540 |
| 733 | Ga0373939_0000948 | 3300035114 | Bacteria | 7221 |
| 734 | Ga0373939_0097919 | 3300035114 | Unclassified | 1002 |
| 735 | Ga0373954_0006248 | 3300035118 | Bacteria | 5194 |
| 736 | Ga0373954_0049581 | 3300035118 | Bacteria | 1969 |
| 737 | Ga0373960_0001470 | 3300035121 | Bacteria | 5220 |
| 738 | Ga0373946_0025368 | 3300035171 | Bacteria | 2331 |
| 739 | Ga0373961_0015507 | 3300035241 | Bacteria | 1950 |
| 740 | Ga0373962_0007884 | 3300035242 | Bacteria | 2613 |
| 741 | Ga0373931_0000233 | 3300035691 | Bacteria | 23590 |
| 742 | Ga0373931_0000962 | 3300035691 | Bacteria | 12161 |
| 743 | Ga0373931_0007872 | 3300035691 | Bacteria | 5038 |
| 744 | Ga0373931_0143600 | 3300035691 | Bacteria | 1385 |
| 745 | Ga0373937_0223295 | 3300036401 | Bacteria | 1773 |
| 746 | Ga0373925_0050089 | 3300037068 | Bacteria | 3114 |
| 747 | Ga0373925_0436537 | 3300037068 | Bacteria | 1071 |
| 748 | Ga0395899_0002978 | 3300037312 | Bacteria | 13552 |
| 749 | Ga0395899_0017472 | 3300037312 | Bacteria | 5465 |
| 750 | Ga0395899_0030197 | 3300037312 | Bacteria | 4076 |
| 751 | Ga0395899_0034829 | 3300037312 | Bacteria | 3781 |
| 752 | Ga0395899_0070045 | 3300037312 | Bacteria | 2567 |
| 753 | Ga0395899_0173363 | 3300037312 | Bacteria | 1518 |
| 754 | Ga0395900_0001085 | 3300037418 | Bacteria | 34636 |
| 755 | Ga0395900_0001906 | 3300037418 | Bacteria | 23725 |
| 756 | Ga0395900_0004368 | 3300037418 | Bacteria | 14997 |
| 757 | Ga0395900_0131598 | 3300037418 | Bacteria | 2563 |
| 758 | Ga0395900_0453057 | 3300037418 | Bacteria | 1239 |
| 759 | Ga0395898_0043556 | 3300037466 | Bacteria | 4422 |
| 760 | Ga0395898_0093100 | 3300037466 | Bacteria | 2897 |
| 761 | Ga0395898_0207317 | 3300037466 | Bacteria | 1870 |
| 762 | Ga0395905_0004973 | 3300037471 | Bacteria | 13691 |
| 763 | Ga0395905_0012391 | 3300037471 | Bacteria | 8209 |
| 764 | Ga0395905_0072079 | 3300037471 | Bacteria | 3238 |
| 765 | Ga0395905_0254715 | 3300037471 | Bacteria | 1639 |
| 766 | Ga0395905_0256136 | 3300037471 | Bacteria | 1634 |
| 767 | Ga0436364_0905352 | 3300037853 | Unclassified | 1061 |
| 768 | Ga0395901_0000307 | 3300038443 | Bacteria | 60012 |
| 769 | Ga0395901_0002559 | 3300038443 | Bacteria | 18423 |
| 770 | Ga0395901_0024867 | 3300038443 | Bacteria | 6147 |
| 771 | Ga0395901_0048856 | 3300038443 | Bacteria | 4394 |
| 772 | Ga0395901_0068069 | 3300038443 | Bacteria | 3709 |
| 773 | Ga0395901_0204556 | 3300038443 | Bacteria | 2069 |
| 774 | Ga0436365_1684313 | 3300039437 | Bacteria | 4349 |
| 775 | Ga0436360_1344729 | 3300039438 | Unclassified | 1713 |
| 776 | Ga0436361_0496436 | 3300039447 | Bacteria | 2303 |
| 777 | Ga0436361_0563588 | 3300039447 | Bacteria | 97448 |
| 778 | Ga0436361_0590082 | 3300039447 | Bacteria | 5543 |
| 779 | Ga0436361_0761139 | 3300039447 | Bacteria | 9389 |
| 780 | Ga0436361_1046788 | 3300039447 | Bacteria | 2868 |
| 781 | Ga0451789_1345118 | 3300041443 | Bacteria | 1478 |
| 782 | Ga0451791_1290972 | 3300041451 | Bacteria | 1376 |
| 783 | Ga0451793_0226805 | 3300041452 | Bacteria | 2298 |
| 784 | Ga0451798_0925854 | 3300041458 | Bacteria | 917 |
| 785 | Ga0451802_1287762 | 3300041460 | Bacteria | 1532 |
| 786 | Ga0451802_1902642 | 3300041460 | Bacteria | 1120 |
| 787 | Ga0451835_0321985 | 3300041492 | Bacteria | 916 |
| 788 | Ga0451853_2760822 | 3300041512 | Bacteria | 1171 |
| 789 | Ga0439433_0005973 | 3300041999 | Bacteria | 2617 |
| 790 | Ga0439437_005601 | 3300042000 | Bacteria | 1382 |
| 791 | Ga0439448_0001451 | 3300042005 | Bacteria | 6138 |
| 792 | Ga0439450_003588 | 3300042008 | Bacteria | 2581 |
| 793 | Ga0439450_005798 | 3300042008 | Bacteria | 2192 |
| 794 | Ga0439455_0038359 | 3300042012 | Bacteria | 1218 |
| 795 | Ga0450917_000304 | 3300042120 | Bacteria | 3610 |
| 796 | Ga0450888_002355 | 3300042126 | Bacteria | 1862 |
| 797 | Ga0450891_004129 | 3300042129 | Bacteria | 1366 |
| 798 | Ga0450904_000113 | 3300042139 | Bacteria | 17967 |
| 799 | Ga0450889_001126 | 3300042144 | Bacteria | 2797 |
| 800 | Ga0439458_0026560 | 3300042157 | Bacteria | 1362 |
| 801 | Ga0450893_0005547 | 3300042532 | Bacteria | 2027 |
| 802 | Ga0451577_0000490 | 3300042876 | Bacteria | 67079 |
| 803 | Ga0451577_0566685 | 3300042876 | Bacteria | 1031 |
| 804 | Ga0466969_0014737 | 3300044656 | Bacteria | 4109 |
| 805 | Ga0466969_0077563 | 3300044656 | Bacteria | 1590 |
| 806 | Ga0466972_0000072 | 3300044658 | Bacteria | 98587 |
| 807 | Ga0466972_0001011 | 3300044658 | Bacteria | 13486 |
| 808 | Ga0466972_0004705 | 3300044658 | Bacteria | 6834 |
| 809 | Ga0466972_0207014 | 3300044658 | Bacteria | 918 |
| 810 | Ga0466965_0008989 | 3300044683 | Bacteria | 4635 |
| 811 | Ga0466965_0013679 | 3300044683 | Bacteria | 3831 |
| 812 | Ga0466965_0019358 | 3300044683 | Bacteria | 3268 |
| 813 | Ga0466965_0030015 | 3300044683 | Bacteria | 2647 |
| 814 | Ga0466965_0032473 | 3300044683 | Bacteria | 2549 |
| 815 | Ga0466965_0040704 | 3300044683 | Bacteria | 2288 |
| 816 | Ga0466965_0048656 | 3300044683 | Bacteria | 2101 |
| 817 | Ga0466965_0189450 | 3300044683 | Bacteria | 1087 |
| 818 | Ga0466966_0003363 | 3300044684 | Bacteria | 10545 |
| 819 | Ga0466966_0046947 | 3300044684 | Bacteria | 2755 |
| 820 | Ga0466966_0052122 | 3300044684 | Bacteria | 2600 |
| 821 | Ga0466966_0226791 | 3300044684 | Bacteria | 1127 |
| 822 | Ga0466966_0238108 | 3300044684 | Bacteria | 1097 |
| 823 | Ga0466961_0087980 | 3300044693 | Bacteria | 1962 |
| 824 | Ga0466961_0117057 | 3300044693 | Bacteria | 1674 |
| 825 | Ga0466961_0173510 | 3300044693 | Bacteria | 1340 |
| 826 | Ga0466961_0216712 | 3300044693 | Bacteria | 1180 |
| 827 | Ga0466963_0107422 | 3300044694 | Bacteria | 1914 |
| 828 | Ga0466963_0230397 | 3300044694 | Bacteria | 1298 |
| 829 | Ga0466964_0000097 | 3300044706 | Bacteria | 21037 |
| 830 | Ga0466964_0054675 | 3300044706 | Bacteria | 1646 |
| 831 | Ga0466964_0065072 | 3300044706 | Bacteria | 1526 |
| 832 | Ga0453684_0000987 | 3300044712 | Bacteria | 92919 |
| 833 | Ga0453684_0150183 | 3300044712 | Bacteria | 2770 |
| 834 | Ga0466971_0045915 | 3300044719 | Bacteria | 1962 |
| 835 | Ga0466971_0066728 | 3300044719 | Bacteria | 1630 |
| 836 | Ga0466968_0000838 | 3300044735 | Bacteria | 10735 |
| 837 | Ga0466968_0001188 | 3300044735 | Bacteria | 9222 |
| 838 | Ga0466968_0010885 | 3300044735 | Bacteria | 3534 |
| 839 | Ga0466968_0090969 | 3300044735 | Bacteria | 1352 |
| 840 | Ga0466970_0074529 | 3300044765 | Bacteria | 1827 |
| 841 | Ga0466957_0000827 | 3300044842 | Bacteria | 15809 |
| 842 | Ga0466957_0029322 | 3300044842 | Bacteria | 3280 |
| 843 | Ga0466957_0072676 | 3300044842 | Bacteria | 2130 |
| 844 | Ga0466959_0003718 | 3300045049 | Bacteria | 10076 |
| 845 | Ga0466959_0014520 | 3300045049 | Bacteria | 5727 |
| 846 | Ga0466959_0056501 | 3300045049 | Bacteria | 2863 |
| 847 | Ga0466959_0107555 | 3300045049 | Bacteria | 1993 |
| 848 | Ga0466959_0140310 | 3300045049 | Bacteria | 1708 |
| 849 | Ga0466959_0162107 | 3300045049 | Bacteria | 1571 |
| 850 | Ga0466959_0230992 | 3300045049 | Bacteria | 1280 |
| 851 | Ga0451576_0158030 | 3300045051 | Bacteria | 2365 |
| 852 | Ga0451576_0221078 | 3300045051 | Bacteria | 1977 |
| 853 | Ga0466958_0010194 | 3300045836 | Bacteria | 5255 |
| 854 | Ga0466958_0030402 | 3300045836 | Bacteria | 3208 |
| 855 | Ga0466958_0063890 | 3300045836 | Bacteria | 2245 |
| 856 | Ga0466958_0077484 | 3300045836 | Bacteria | 2041 |
| 857 | Ga0466958_0414759 | 3300045836 | Bacteria | 870 |
| 858 | Ga0466967_0024676 | 3300045976 | Bacteria | 4947 |
| 859 | Ga0466967_0030592 | 3300045976 | Bacteria | 4520 |
| 860 | Ga0466967_0052296 | 3300045976 | Bacteria | 3585 |
| 861 | Ga0466967_0127800 | 3300045976 | Bacteria | 2356 |
| 862 | Ga0466967_0140326 | 3300045976 | Bacteria | 2250 |
| 863 | Ga0466967_0149306 | 3300045976 | Bacteria | 2183 |
| 864 | Ga0495617_000125 | 3300046452 | Bacteria | 50630 |
| 865 | Ga0495617_011782 | 3300046452 | Bacteria | 2983 |
| 866 | Ga0495627_000325 | 3300046453 | Bacteria | 46495 |
| 867 | Ga0495627_007288 | 3300046453 | Bacteria | 4256 |
| 868 | Ga0495627_011815 | 3300046453 | Bacteria | 3118 |
| 869 | Ga0495590_0000166 | 3300046457 | Bacteria | 39657 |
| 870 | Ga0495590_0002849 | 3300046457 | Bacteria | 7124 |
| 871 | Ga0495590_0006344 | 3300046457 | Bacteria | 4621 |
| 872 | Ga0495591_000149 | 3300046458 | Bacteria | 74051 |
| 873 | Ga0495629_0006820 | 3300046459 | Bacteria | 8444 |
| 874 | Ga0495629_0038992 | 3300046459 | Bacteria | 3345 |
| 875 | Ga0495638_0005648 | 3300046460 | Bacteria | 9218 |
| 876 | Ga0495638_0084022 | 3300046460 | Bacteria | 1927 |
| 877 | Ga0495651_0139605 | 3300046462 | Bacteria | 1759 |
| 878 | Ga0495653_0002884 | 3300046463 | Bacteria | 13744 |
| 879 | Ga0495653_0009399 | 3300046463 | Bacteria | 8000 |
| 880 | Ga0495653_0021151 | 3300046463 | Bacteria | 5271 |
| 881 | Ga0495653_0026777 | 3300046463 | Bacteria | 4620 |
| 882 | Ga0495653_0154429 | 3300046463 | Bacteria | 1600 |
| 883 | Ga0495650_0001100 | 3300046471 | Bacteria | 29639 |
| 884 | Ga0495650_0037741 | 3300046471 | Bacteria | 2100 |
| 885 | Ga0495650_0048197 | 3300046471 | Bacteria | 1777 |
| 886 | Ga0495580_0025056 | 3300046472 | Bacteria | 4361 |
| 887 | Ga0495580_0027291 | 3300046472 | Bacteria | 4155 |
| 888 | Ga0495580_0035556 | 3300046472 | Bacteria | 3582 |
| 889 | Ga0495580_0375186 | 3300046472 | Bacteria | 961 |
| 890 | Ga0495582_0000662 | 3300046473 | Bacteria | 18974 |
| 891 | Ga0495582_0009678 | 3300046473 | Bacteria | 5308 |
| 892 | Ga0495605_0000725 | 3300046474 | Bacteria | 24295 |
| 893 | Ga0495605_0000845 | 3300046474 | Bacteria | 21424 |
| 894 | Ga0495605_0007379 | 3300046474 | Bacteria | 6242 |
| 895 | Ga0495605_0019429 | 3300046474 | Bacteria | 3628 |
| 896 | Ga0495605_0029687 | 3300046474 | Bacteria | 2809 |
| 897 | Ga0495605_0029689 | 3300046474 | Bacteria | 2809 |
| 898 | Ga0495605_0050785 | 3300046474 | Bacteria | 2021 |
| 899 | Ga0495605_0059238 | 3300046474 | Bacteria | 1839 |
| 900 | Ga0495605_0104487 | 3300046474 | Bacteria | 1298 |
| 901 | Ga0495605_0107446 | 3300046474 | Bacteria | 1276 |
| 902 | Ga0495639_0081874 | 3300046475 | Bacteria | 1504 |
| 903 | Ga0495584_0000417 | 3300046491 | Bacteria | 29344 |
| 904 | Ga0495584_0000820 | 3300046491 | Bacteria | 20419 |
| 905 | Ga0495584_0002513 | 3300046491 | Bacteria | 10392 |
| 906 | Ga0495584_0004515 | 3300046491 | Bacteria | 7474 |
| 907 | Ga0495584_0018617 | 3300046491 | Bacteria | 3530 |
| 908 | Ga0495584_0019660 | 3300046491 | Bacteria | 3431 |
| 909 | Ga0495584_0027008 | 3300046491 | Bacteria | 2908 |
| 910 | Ga0495584_0033942 | 3300046491 | Bacteria | 2581 |
| 911 | Ga0495584_0037339 | 3300046491 | Bacteria | 2455 |
| 912 | Ga0495584_0089264 | 3300046491 | Bacteria | 1554 |
| 913 | Ga0495584_0129974 | 3300046491 | Bacteria | 1277 |
| 914 | Ga0495584_0195744 | 3300046491 | Bacteria | 1027 |
| 915 | Ga0495585_0002621 | 3300046492 | Bacteria | 12677 |
| 916 | Ga0495585_0004000 | 3300046492 | Bacteria | 9711 |
| 917 | Ga0495585_0004922 | 3300046492 | Bacteria | 8545 |
| 918 | Ga0495585_0007278 | 3300046492 | Bacteria | 6794 |
| 919 | Ga0495585_0009447 | 3300046492 | Bacteria | 5849 |
| 920 | Ga0495585_0012348 | 3300046492 | Bacteria | 5033 |
| 921 | Ga0495585_0015200 | 3300046492 | Bacteria | 4473 |
| 922 | Ga0495585_0015519 | 3300046492 | Bacteria | 4427 |
| 923 | Ga0495585_0016706 | 3300046492 | Bacteria | 4251 |
| 924 | Ga0495585_0017877 | 3300046492 | Bacteria | 4091 |
| 925 | Ga0495585_0029378 | 3300046492 | Bacteria | 3129 |
| 926 | Ga0495585_0038815 | 3300046492 | Bacteria | 2679 |
| 927 | Ga0495585_0043551 | 3300046492 | Bacteria | 2509 |
| 928 | Ga0495585_0259460 | 3300046492 | Bacteria | 864 |
| 929 | Ga0495594_0006433 | 3300046499 | Bacteria | 6043 |
| 930 | Ga0495594_0008151 | 3300046499 | Bacteria | 5390 |
| 931 | Ga0495594_0027401 | 3300046499 | Bacteria | 3070 |
| 932 | Ga0495594_0051421 | 3300046499 | Bacteria | 2267 |
| 933 | Ga0495594_0053067 | 3300046499 | Bacteria | 2232 |
| 934 | Ga0495594_0117610 | 3300046499 | Bacteria | 1501 |
| 935 | Ga0495594_0133179 | 3300046499 | Bacteria | 1408 |
| 936 | Ga0495596_0000442 | 3300046500 | Bacteria | 26554 |
| 937 | Ga0495596_0000863 | 3300046500 | Bacteria | 18275 |
| 938 | Ga0495596_0002569 | 3300046500 | Bacteria | 9650 |
| 939 | Ga0495596_0005420 | 3300046500 | Bacteria | 6029 |
| 940 | Ga0495596_0005727 | 3300046500 | Bacteria | 5832 |
| 941 | Ga0495596_0006378 | 3300046500 | Bacteria | 5438 |
| 942 | Ga0495596_0006897 | 3300046500 | Bacteria | 5175 |
| 943 | Ga0495596_0014671 | 3300046500 | Bacteria | 3298 |
| 944 | Ga0495596_0016650 | 3300046500 | Bacteria | 3051 |
| 945 | Ga0495596_0019749 | 3300046500 | Bacteria | 2764 |
| 946 | Ga0495596_0031922 | 3300046500 | Bacteria | 2101 |
| 947 | Ga0495596_0046697 | 3300046500 | Bacteria | 1700 |
| 948 | Ga0495596_0082920 | 3300046500 | Bacteria | 1244 |
| 949 | Ga0495607_0001392 | 3300046501 | Bacteria | 21517 |
| 950 | Ga0495607_0001408 | 3300046501 | Bacteria | 21405 |
| 951 | Ga0495607_0002063 | 3300046501 | Bacteria | 16805 |
| 952 | Ga0495607_0005724 | 3300046501 | Bacteria | 8848 |
| 953 | Ga0495607_0018695 | 3300046501 | Bacteria | 4411 |
| 954 | Ga0495607_0027250 | 3300046501 | Bacteria | 3536 |
| 955 | Ga0495607_0027417 | 3300046501 | Bacteria | 3522 |
| 956 | Ga0495607_0035999 | 3300046501 | Bacteria | 2988 |
| 957 | Ga0495607_0072115 | 3300046501 | Bacteria | 1924 |
| 958 | Ga0495607_0092582 | 3300046501 | Bacteria | 1635 |
| 959 | Ga0495583_0000144 | 3300046506 | Bacteria | 121268 |
| 960 | Ga0495583_0000200 | 3300046506 | Bacteria | 100827 |
| 961 | Ga0495583_0000217 | 3300046506 | Bacteria | 96747 |
| 962 | Ga0495583_0001216 | 3300046506 | Bacteria | 27432 |
| 963 | Ga0495583_0002127 | 3300046506 | Bacteria | 17732 |
| 964 | Ga0495583_0002154 | 3300046506 | Bacteria | 17591 |
| 965 | Ga0495583_0002410 | 3300046506 | Bacteria | 16071 |
| 966 | Ga0495583_0003295 | 3300046506 | Bacteria | 12520 |
| 967 | Ga0495583_0004038 | 3300046506 | Bacteria | 10800 |
| 968 | Ga0495583_0009165 | 3300046506 | Bacteria | 5946 |
| 969 | Ga0495583_0016673 | 3300046506 | Bacteria | 3937 |
| 970 | Ga0495583_0019228 | 3300046506 | Bacteria | 3570 |
| 971 | Ga0495583_0023216 | 3300046506 | Bacteria | 3142 |
| 972 | Ga0495583_0100455 | 3300046506 | Bacteria | 1235 |
| 973 | Ga0495606_0005844 | 3300046507 | Bacteria | 11604 |
| 974 | Ga0495606_0011722 | 3300046507 | Bacteria | 7114 |
| 975 | Ga0495606_0036866 | 3300046507 | Bacteria | 3326 |
| 976 | Ga0495606_0037150 | 3300046507 | Bacteria | 3309 |
| 977 | Ga0495606_0041518 | 3300046507 | Bacteria | 3084 |
| 978 | Ga0495606_0044217 | 3300046507 | Bacteria | 2964 |
| 979 | Ga0495606_0098994 | 3300046507 | Bacteria | 1778 |
| 980 | Ga0495606_0210819 | 3300046507 | Bacteria | 1100 |
| 981 | Ga0495608_0182076 | 3300046511 | Unclassified | 1329 |
| 982 | Ga0495610_0000876 | 3300046512 | Bacteria | 28094 |
| 983 | Ga0495610_0011457 | 3300046512 | Bacteria | 5420 |
| 984 | Ga0495610_0110177 | 3300046512 | Bacteria | 1220 |
| 985 | Ga0495616_0000126 | 3300046513 | Bacteria | 66696 |
| 986 | Ga0495616_0000227 | 3300046513 | Bacteria | 46305 |
| 987 | Ga0495616_0000786 | 3300046513 | Bacteria | 23181 |
| 988 | Ga0495616_0010067 | 3300046513 | Bacteria | 5487 |
| 989 | Ga0495616_0011469 | 3300046513 | Bacteria | 5075 |
| 990 | Ga0495616_0015340 | 3300046513 | Bacteria | 4260 |
| 991 | Ga0495616_0016359 | 3300046513 | Bacteria | 4107 |
| 992 | Ga0495616_0026462 | 3300046513 | Bacteria | 3087 |
| 993 | Ga0495616_0026491 | 3300046513 | Bacteria | 3084 |
| 994 | Ga0495616_0030858 | 3300046513 | Bacteria | 2811 |
| 995 | Ga0495616_0080904 | 3300046513 | Bacteria | 1554 |
| 996 | Ga0495616_0082045 | 3300046513 | Bacteria | 1540 |
| 997 | Ga0495616_0103351 | 3300046513 | Bacteria | 1333 |
| 998 | Ga0495616_0107351 | 3300046513 | Bacteria | 1301 |
| 999 | Ga0495616_0162821 | 3300046513 | Bacteria | 1002 |
| 1000 | Ga0495616_0286784 | 3300046513 | Bacteria | 698 |
| 1001 | Ga0495620_0031194 | 3300046515 | Bacteria | 2445 |
| 1002 | Ga0495630_0012504 | 3300046517 | Bacteria | 6165 |
| 1003 | Ga0495630_0021661 | 3300046517 | Bacteria | 4746 |
| 1004 | Ga0495630_0040007 | 3300046517 | Bacteria | 3504 |
| 1005 | Ga0495630_0190703 | 3300046517 | Bacteria | 1564 |
| 1006 | Ga0495631_0000342 | 3300046518 | Bacteria | 32071 |
| 1007 | Ga0495631_0000501 | 3300046518 | Bacteria | 26200 |
| 1008 | Ga0495631_0001168 | 3300046518 | Bacteria | 16231 |
| 1009 | Ga0495631_0002960 | 3300046518 | Bacteria | 9402 |
| 1010 | Ga0495631_0003047 | 3300046518 | Bacteria | 9260 |
| 1011 | Ga0495631_0005084 | 3300046518 | Bacteria | 6928 |
| 1012 | Ga0495631_0007296 | 3300046518 | Bacteria | 5631 |
| 1013 | Ga0495631_0010064 | 3300046518 | Bacteria | 4698 |
| 1014 | Ga0495631_0011340 | 3300046518 | Bacteria | 4385 |
| 1015 | Ga0495631_0030184 | 3300046518 | Bacteria | 2460 |
| 1016 | Ga0495631_0126919 | 3300046518 | Bacteria | 1096 |
| 1017 | Ga0495632_0000195 | 3300046519 | Bacteria | 61419 |
| 1018 | Ga0495632_0000391 | 3300046519 | Bacteria | 41120 |
| 1019 | Ga0495632_0000757 | 3300046519 | Bacteria | 29021 |
| 1020 | Ga0495632_0001773 | 3300046519 | Bacteria | 17428 |
| 1021 | Ga0495632_0007690 | 3300046519 | Bacteria | 6730 |
| 1022 | Ga0495632_0008015 | 3300046519 | Bacteria | 6554 |
| 1023 | Ga0495632_0009140 | 3300046519 | Bacteria | 5990 |
| 1024 | Ga0495632_0021495 | 3300046519 | Bacteria | 3476 |
| 1025 | Ga0495632_0120328 | 3300046519 | Bacteria | 1227 |
| 1026 | Ga0495632_0131815 | 3300046519 | Bacteria | 1163 |
| 1027 | Ga0495637_0000014 | 3300046520 | Bacteria | 228956 |
| 1028 | Ga0495637_0003657 | 3300046520 | Bacteria | 8140 |
| 1029 | Ga0495643_0000171 | 3300046522 | Bacteria | 103167 |
| 1030 | Ga0495643_0001865 | 3300046522 | Bacteria | 17871 |
| 1031 | Ga0495643_0003366 | 3300046522 | Bacteria | 11776 |
| 1032 | Ga0495643_0004555 | 3300046522 | Bacteria | 9654 |
| 1033 | Ga0495643_0017614 | 3300046522 | Bacteria | 4172 |
| 1034 | Ga0495643_0021828 | 3300046522 | Bacteria | 3664 |
| 1035 | Ga0495643_0058358 | 3300046522 | Bacteria | 2054 |
| 1036 | Ga0495643_0061391 | 3300046522 | Bacteria | 1993 |
| 1037 | Ga0495643_0077063 | 3300046522 | Bacteria | 1742 |
| 1038 | Ga0495644_0002262 | 3300046523 | Bacteria | 7703 |
| 1039 | Ga0495644_0004151 | 3300046523 | Bacteria | 5695 |
| 1040 | Ga0495644_0007576 | 3300046523 | Bacteria | 4184 |
| 1041 | Ga0495644_0007682 | 3300046523 | Bacteria | 4158 |
| 1042 | Ga0495644_0009852 | 3300046523 | Bacteria | 3678 |
| 1043 | Ga0495644_0031758 | 3300046523 | Bacteria | 1996 |
| 1044 | Ga0495648_0000612 | 3300046524 | Bacteria | 38167 |
| 1045 | Ga0495648_0004164 | 3300046524 | Bacteria | 12440 |
| 1046 | Ga0495648_0007541 | 3300046524 | Bacteria | 8696 |
| 1047 | Ga0495648_0009116 | 3300046524 | Bacteria | 7737 |
| 1048 | Ga0495648_0011285 | 3300046524 | Bacteria | 6744 |
| 1049 | Ga0495648_0014828 | 3300046524 | Bacteria | 5678 |
| 1050 | Ga0495648_0015940 | 3300046524 | Bacteria | 5430 |
| 1051 | Ga0495648_0083205 | 3300046524 | Bacteria | 1814 |
| 1052 | Ga0495648_0190341 | 3300046524 | Bacteria | 1035 |
| 1053 | Ga0495663_0004646 | 3300046525 | Bacteria | 3848 |
| 1054 | Ga0495663_0006091 | 3300046525 | Bacteria | 3336 |
| 1055 | Ga0495666_0003941 | 3300046526 | Bacteria | 7502 |
| 1056 | Ga0495666_0036806 | 3300046526 | Bacteria | 2382 |
| 1057 | Ga0495642_0000515 | 3300046528 | Bacteria | 19938 |
| 1058 | Ga0495642_0000729 | 3300046528 | Bacteria | 16345 |
| 1059 | Ga0495642_0001661 | 3300046528 | Bacteria | 9634 |
| 1060 | Ga0495642_0005838 | 3300046528 | Bacteria | 4723 |
| 1061 | Ga0495642_0007429 | 3300046528 | Bacteria | 4199 |
| 1062 | Ga0495642_0008099 | 3300046528 | Bacteria | 4022 |
| 1063 | Ga0495642_0010769 | 3300046528 | Bacteria | 3503 |
| 1064 | Ga0495642_0011184 | 3300046528 | Bacteria | 3442 |
| 1065 | Ga0495642_0013639 | 3300046528 | Bacteria | 3147 |
| 1066 | Ga0495642_0025739 | 3300046528 | Bacteria | 2333 |
| 1067 | Ga0495642_0056465 | 3300046528 | Bacteria | 1622 |
| 1068 | Ga0495642_0058961 | 3300046528 | Bacteria | 1590 |
| 1069 | Ga0495652_0033257 | 3300046529 | Bacteria | 4503 |
| 1070 | Ga0495652_0037308 | 3300046529 | Bacteria | 4217 |
| 1071 | Ga0495652_0434559 | 3300046529 | Unclassified | 922 |
| 1072 | Ga0495654_0005529 | 3300046530 | Bacteria | 7321 |
| 1073 | Ga0495654_0008911 | 3300046530 | Bacteria | 5513 |
| 1074 | Ga0495654_0008988 | 3300046530 | Bacteria | 5485 |
| 1075 | Ga0495654_0069302 | 3300046530 | Bacteria | 1675 |
| 1076 | Ga0495665_0002306 | 3300046531 | Bacteria | 10307 |
| 1077 | Ga0495665_0002338 | 3300046531 | Bacteria | 10242 |
| 1078 | Ga0495665_0044871 | 3300046531 | Bacteria | 2348 |
| 1079 | Ga0495665_0178365 | 3300046531 | Bacteria | 1104 |
| 1080 | Ga0495586_0013981 | 3300046535 | Bacteria | 4259 |
| 1081 | Ga0495586_0028693 | 3300046535 | Bacteria | 2977 |
| 1082 | Ga0495586_0114694 | 3300046535 | Bacteria | 1501 |
| 1083 | Ga0495587_0011337 | 3300046536 | Bacteria | 5649 |
| 1084 | Ga0495587_0015833 | 3300046536 | Bacteria | 4700 |
| 1085 | Ga0495587_0108545 | 3300046536 | Bacteria | 1595 |
| 1086 | Ga0495598_0031523 | 3300046537 | Bacteria | 1492 |
| 1087 | Ga0495609_0000028 | 3300046538 | Bacteria | 219908 |
| 1088 | Ga0495609_0001293 | 3300046538 | Bacteria | 17074 |
| 1089 | Ga0495609_0011460 | 3300046538 | Bacteria | 4221 |
| 1090 | Ga0495609_0012174 | 3300046538 | Bacteria | 4080 |
| 1091 | Ga0495609_0014596 | 3300046538 | Bacteria | 3690 |
| 1092 | Ga0495609_0030033 | 3300046538 | Bacteria | 2473 |
| 1093 | Ga0495609_0037371 | 3300046538 | Bacteria | 2190 |
| 1094 | Ga0495597_0000793 | 3300046542 | Bacteria | 24960 |
| 1095 | Ga0495597_0004145 | 3300046542 | Bacteria | 8045 |
| 1096 | Ga0495597_0006507 | 3300046542 | Bacteria | 6031 |
| 1097 | Ga0495597_0020247 | 3300046542 | Bacteria | 3100 |
| 1098 | Ga0495597_0024241 | 3300046542 | Bacteria | 2802 |
| 1099 | Ga0495597_0042303 | 3300046542 | Bacteria | 2032 |
| 1100 | Ga0495597_0058665 | 3300046542 | Bacteria | 1681 |
| 1101 | Ga0495597_0150141 | 3300046542 | Bacteria | 956 |
| 1102 | Ga0495645_0020763 | 3300046543 | Bacteria | 4744 |
| 1103 | Ga0495622_0006298 | 3300046557 | Bacteria | 5511 |
| 1104 | Ga0495622_0006406 | 3300046557 | Bacteria | 5462 |
| 1105 | Ga0495622_0108744 | 3300046557 | Bacteria | 1269 |
| 1106 | Ga0495633_0001203 | 3300046558 | Bacteria | 20819 |
| 1107 | Ga0495633_0004585 | 3300046558 | Bacteria | 8716 |
| 1108 | Ga0495633_0009782 | 3300046558 | Bacteria | 5269 |
| 1109 | Ga0495633_0021899 | 3300046558 | Bacteria | 3190 |
| 1110 | Ga0495633_0066402 | 3300046558 | Bacteria | 1684 |
| 1111 | Ga0495633_0086147 | 3300046558 | Bacteria | 1461 |
| 1112 | Ga0495633_0117129 | 3300046558 | Bacteria | 1234 |
| 1113 | Ga0495656_0001345 | 3300046615 | Bacteria | 8014 |
| 1114 | Ga0495656_0010316 | 3300046615 | Bacteria | 3392 |
| 1115 | Ga0495668_0000318 | 3300046616 | Bacteria | 66017 |
| 1116 | Ga0495668_0003076 | 3300046616 | Bacteria | 12908 |
| 1117 | Ga0495668_0004892 | 3300046616 | Bacteria | 9303 |
| 1118 | Ga0495668_0014737 | 3300046616 | Bacteria | 4577 |
| 1119 | Ga0495668_0018328 | 3300046616 | Bacteria | 4045 |
| 1120 | Ga0495668_0022609 | 3300046616 | Bacteria | 3593 |
| 1121 | Ga0495668_0029648 | 3300046616 | Bacteria | 3090 |
| 1122 | Ga0495668_0031522 | 3300046616 | Bacteria | 2987 |
| 1123 | Ga0495668_0033852 | 3300046616 | Bacteria | 2869 |
| 1124 | Ga0495668_0036134 | 3300046616 | Bacteria | 2769 |
| 1125 | Ga0495668_0059992 | 3300046616 | Bacteria | 2099 |
| 1126 | Ga0495668_0094581 | 3300046616 | Bacteria | 1636 |
| 1127 | Ga0495668_0111172 | 3300046616 | Bacteria | 1499 |
| 1128 | Ga0495668_0122367 | 3300046616 | Bacteria | 1423 |
| 1129 | Ga0495668_0145154 | 3300046616 | Bacteria | 1299 |
| 1130 | Ga0495634_0011085 | 3300046642 | Bacteria | 6576 |
| 1131 | Ga0495634_0148362 | 3300046642 | Bacteria | 1485 |
| 1132 | Ga0495611_0001329 | 3300046648 | Bacteria | 12532 |
| 1133 | Ga0495611_0002853 | 3300046648 | Bacteria | 7726 |
| 1134 | Ga0495611_0009912 | 3300046648 | Bacteria | 4032 |
| 1135 | Ga0495611_0011261 | 3300046648 | Bacteria | 3792 |
| 1136 | Ga0495611_0012978 | 3300046648 | Bacteria | 3542 |
| 1137 | Ga0495611_0023156 | 3300046648 | Bacteria | 2693 |
| 1138 | Ga0495625_0001217 | 3300046660 | Bacteria | 32653 |
| 1139 | Ga0495625_0006720 | 3300046660 | Bacteria | 10196 |
| 1140 | Ga0495625_0013252 | 3300046660 | Bacteria | 6634 |
| 1141 | Ga0495625_0033624 | 3300046660 | Bacteria | 3789 |
| 1142 | Ga0495625_0048308 | 3300046660 | Bacteria | 3065 |
| 1143 | Ga0495625_0050976 | 3300046660 | Bacteria | 2968 |
| 1144 | Ga0495625_0090934 | 3300046660 | Bacteria | 2110 |
| 1145 | Ga0495659_0004919 | 3300046664 | Bacteria | 4205 |
| 1146 | Ga0495661_0000682 | 3300046665 | Bacteria | 33847 |
| 1147 | Ga0495661_0000805 | 3300046665 | Bacteria | 29621 |
| 1148 | Ga0495661_0001495 | 3300046665 | Bacteria | 19464 |
| 1149 | Ga0495661_0001512 | 3300046665 | Bacteria | 19353 |
| 1150 | Ga0495661_0002426 | 3300046665 | Bacteria | 14350 |
| 1151 | Ga0495661_0003500 | 3300046665 | Bacteria | 11565 |
| 1152 | Ga0495661_0004095 | 3300046665 | Bacteria | 10621 |
| 1153 | Ga0495661_0008507 | 3300046665 | Bacteria | 7095 |
| 1154 | Ga0495661_0016379 | 3300046665 | Bacteria | 4915 |
| 1155 | Ga0495661_0031851 | 3300046665 | Bacteria | 3338 |
| 1156 | Ga0495661_0035128 | 3300046665 | Bacteria | 3149 |
| 1157 | Ga0495661_0039001 | 3300046665 | Bacteria | 2954 |
| 1158 | Ga0495661_0048803 | 3300046665 | Bacteria | 2570 |
| 1159 | Ga0495661_0064418 | 3300046665 | Bacteria | 2162 |
| 1160 | Ga0495661_0091666 | 3300046665 | Bacteria | 1728 |
| 1161 | Ga0495661_0129034 | 3300046665 | Bacteria | 1387 |
| 1162 | Ga0495588_0000259 | 3300046674 | Bacteria | 43325 |
| 1163 | Ga0495588_0005996 | 3300046674 | Bacteria | 5452 |
| 1164 | Ga0495588_0010296 | 3300046674 | Bacteria | 4344 |
| 1165 | Ga0495588_0013104 | 3300046674 | Bacteria | 3941 |
| 1166 | Ga0495588_0042649 | 3300046674 | Bacteria | 2320 |
| 1167 | Ga0495588_0060609 | 3300046674 | Bacteria | 1958 |
| 1168 | Ga0495588_0088846 | 3300046674 | Bacteria | 1617 |
| 1169 | Ga0495588_0158297 | 3300046674 | Bacteria | 1197 |
| 1170 | Ga0495588_0161904 | 3300046674 | Bacteria | 1183 |
| 1171 | Ga0495623_0029342 | 3300046679 | Bacteria | 3539 |
| 1172 | Ga0495623_0047536 | 3300046679 | Bacteria | 2724 |
| 1173 | Ga0495623_0160914 | 3300046679 | Bacteria | 1319 |
| 1174 | Ga0495658_0095535 | 3300046683 | Bacteria | 1767 |
| 1175 | Ga0495669_0000328 | 3300046684 | Bacteria | 25643 |
| 1176 | Ga0495669_0004475 | 3300046684 | Bacteria | 5773 |
| 1177 | Ga0495669_0006151 | 3300046684 | Bacteria | 5006 |
| 1178 | Ga0495669_0006817 | 3300046684 | Bacteria | 4780 |
| 1179 | Ga0495669_0007018 | 3300046684 | Bacteria | 4714 |
| 1180 | Ga0495669_0007342 | 3300046684 | Bacteria | 4618 |
| 1181 | Ga0495669_0008646 | 3300046684 | Bacteria | 4285 |
| 1182 | Ga0495669_0013315 | 3300046684 | Bacteria | 3503 |
| 1183 | Ga0495669_0092966 | 3300046684 | Bacteria | 1394 |
| 1184 | Ga0495613_0340180 | 3300046689 | Bacteria | 1032 |
| 1185 | Ga0495624_0050037 | 3300046690 | Bacteria | 2648 |
| 1186 | Ga0495670_0001980 | 3300046691 | Bacteria | 10054 |
| 1187 | Ga0495670_0014690 | 3300046691 | Bacteria | 3851 |
| 1188 | Ga0495670_0017210 | 3300046691 | Bacteria | 3557 |
| 1189 | Ga0495670_0049330 | 3300046691 | Bacteria | 2106 |
| 1190 | Ga0495670_0089365 | 3300046691 | Bacteria | 1575 |
| 1191 | Ga0495670_0099077 | 3300046691 | Bacteria | 1499 |
| 1192 | Ga0495670_0119812 | 3300046691 | Bacteria | 1367 |
| 1193 | Ga0495671_0001884 | 3300046692 | Bacteria | 13473 |
| 1194 | Ga0495671_0005590 | 3300046692 | Bacteria | 7335 |
| 1195 | Ga0495671_0008602 | 3300046692 | Bacteria | 5732 |
| 1196 | Ga0495671_0010066 | 3300046692 | Bacteria | 5258 |
| 1197 | Ga0495671_0013583 | 3300046692 | Bacteria | 4403 |
| 1198 | Ga0495671_0099882 | 3300046692 | Bacteria | 1419 |
| 1199 | Ga0495671_0165840 | 3300046692 | Bacteria | 1074 |
| 1200 | Ga0495649_0000068 | 3300046694 | Bacteria | 92317 |
| 1201 | Ga0495649_0000595 | 3300046694 | Bacteria | 30203 |
| 1202 | Ga0495649_0000911 | 3300046694 | Bacteria | 23367 |
| 1203 | Ga0495649_0002466 | 3300046694 | Bacteria | 13009 |
| 1204 | Ga0495649_0019571 | 3300046694 | Bacteria | 3803 |
| 1205 | Ga0495649_0039794 | 3300046694 | Bacteria | 2577 |
| 1206 | Ga0495649_0118817 | 3300046694 | Bacteria | 1399 |
| 1207 | Ga0495589_0000309 | 3300046794 | Bacteria | 38979 |
| 1208 | Ga0495589_0000407 | 3300046794 | Bacteria | 32420 |
| 1209 | Ga0495589_0000903 | 3300046794 | Bacteria | 18338 |
| 1210 | Ga0495589_0001297 | 3300046794 | Bacteria | 14743 |
| 1211 | Ga0495589_0013553 | 3300046794 | Bacteria | 4204 |
| 1212 | Ga0495589_0016551 | 3300046794 | Bacteria | 3789 |
| 1213 | Ga0495589_0018426 | 3300046794 | Bacteria | 3578 |
| 1214 | Ga0495589_0025560 | 3300046794 | Bacteria | 2996 |
| 1215 | Ga0495589_0029994 | 3300046794 | Bacteria | 2740 |
| 1216 | Ga0495589_0136047 | 3300046794 | Bacteria | 1178 |
| 1217 | Ga0495600_0122737 | 3300046809 | Bacteria | 1689 |
| 1218 | Ga0495600_0296556 | 3300046809 | Bacteria | 1021 |
| 1219 | Ga0495660_0000734 | 3300046810 | Bacteria | 24893 |
| 1220 | Ga0495660_0005935 | 3300046810 | Bacteria | 7275 |
| 1221 | Ga0495660_0006198 | 3300046810 | Bacteria | 7099 |
| 1222 | Ga0495660_0009695 | 3300046810 | Bacteria | 5610 |
| 1223 | Ga0495660_0016643 | 3300046810 | Bacteria | 4238 |
| 1224 | Ga0495660_0039188 | 3300046810 | Bacteria | 2632 |
| 1225 | Ga0495660_0059921 | 3300046810 | Bacteria | 2046 |
| 1226 | Ga0495581_0004794 | 3300047315 | Bacteria | 7818 |
| 1227 | Ga0495581_0005818 | 3300047315 | Bacteria | 7149 |
| 1228 | Ga0495581_0067179 | 3300047315 | Bacteria | 2073 |
| 1229 | Ga0495581_0090651 | 3300047315 | Bacteria | 1773 |
| 1230 | Ga0495581_0179417 | 3300047315 | Bacteria | 1238 |
| 1231 | Ga0495604_0014594 | 3300047317 | Bacteria | 6261 |
| 1232 | Ga0495604_0027123 | 3300047317 | Bacteria | 4557 |
| 1233 | Ga0495604_0083696 | 3300047317 | Bacteria | 2383 |
| 1234 | Ga0495604_0091241 | 3300047317 | Bacteria | 2260 |
| 1235 | Ga0495636_0004008 | 3300047318 | Bacteria | 5756 |
| 1236 | Ga0495636_0049277 | 3300047318 | Bacteria | 1761 |
| 1237 | Ga0495636_0103562 | 3300047318 | Bacteria | 1247 |
| 1238 | Ga0495674_0003295 | 3300047319 | Bacteria | 15683 |
| 1239 | Ga0495674_0146882 | 3300047319 | Bacteria | 1979 |
| 1240 | Ga0495672_0000140 | 3300047320 | Bacteria | 106637 |
| 1241 | Ga0495672_0000777 | 3300047320 | Bacteria | 34668 |
| 1242 | Ga0495672_0000865 | 3300047320 | Bacteria | 31951 |
| 1243 | Ga0495672_0001198 | 3300047320 | Bacteria | 26215 |
| 1244 | Ga0495672_0013872 | 3300047320 | Bacteria | 5540 |
| 1245 | Ga0495676_0000100 | 3300047321 | Bacteria | 65339 |
| 1246 | Ga0495676_0000639 | 3300047321 | Bacteria | 29038 |
| 1247 | Ga0495680_0014119 | 3300047322 | Bacteria | 6937 |
| 1248 | Ga0495680_0022854 | 3300047322 | Bacteria | 5207 |
| 1249 | Ga0495680_0066489 | 3300047322 | Bacteria | 2759 |
| 1250 | Ga0495683_0000499 | 3300047323 | Bacteria | 30330 |
| 1251 | Ga0495683_0001842 | 3300047323 | Bacteria | 13316 |
| 1252 | Ga0495683_0006464 | 3300047323 | Bacteria | 6405 |
| 1253 | Ga0495683_0011901 | 3300047323 | Bacteria | 4574 |
| 1254 | Ga0495683_0012472 | 3300047323 | Bacteria | 4459 |
| 1255 | Ga0495683_0040118 | 3300047323 | Bacteria | 2365 |
| 1256 | Ga0495683_0066186 | 3300047323 | Bacteria | 1781 |
| 1257 | Ga0495683_0180288 | 3300047323 | Bacteria | 965 |
| 1258 | Ga0495687_000253 | 3300047443 | Bacteria | 71917 |
| 1259 | Ga0495687_000288 | 3300047443 | Bacteria | 66346 |
| 1260 | Ga0495687_000656 | 3300047443 | Bacteria | 39649 |
| 1261 | Ga0495687_000829 | 3300047443 | Bacteria | 33057 |
| 1262 | Ga0495687_000866 | 3300047443 | Bacteria | 32045 |
| 1263 | Ga0495687_002113 | 3300047443 | Bacteria | 16645 |
| 1264 | Ga0495675_0008125 | 3300047444 | Bacteria | 6492 |
| 1265 | Ga0495675_0052895 | 3300047444 | Bacteria | 2578 |
| 1266 | Ga0495675_0063701 | 3300047444 | Bacteria | 2332 |
| 1267 | Ga0495677_0000143 | 3300047445 | Bacteria | 34260 |
| 1268 | Ga0495677_0000257 | 3300047445 | Bacteria | 23318 |
| 1269 | Ga0495677_0000770 | 3300047445 | Bacteria | 12903 |
| 1270 | Ga0495677_0001181 | 3300047445 | Bacteria | 10458 |
| 1271 | Ga0495677_0003090 | 3300047445 | Bacteria | 6481 |
| 1272 | Ga0495677_0003795 | 3300047445 | Bacteria | 5843 |
| 1273 | Ga0495677_0009163 | 3300047445 | Bacteria | 3658 |
| 1274 | Ga0495677_0009263 | 3300047445 | Bacteria | 3638 |
| 1275 | Ga0495677_0014086 | 3300047445 | Bacteria | 2912 |
| 1276 | Ga0495677_0014771 | 3300047445 | Bacteria | 2840 |
| 1277 | Ga0495677_0030368 | 3300047445 | Bacteria | 1966 |
| 1278 | Ga0495679_005544 | 3300047446 | Bacteria | 5577 |
| 1279 | Ga0495679_006181 | 3300047446 | Bacteria | 5201 |
| 1280 | Ga0495685_004973 | 3300047447 | Bacteria | 4322 |
| 1281 | Ga0495685_012637 | 3300047447 | Bacteria | 2861 |
| 1282 | Ga0495685_016362 | 3300047447 | Bacteria | 2533 |
| 1283 | Ga0495681_0000511 | 3300047470 | Bacteria | 29544 |
| 1284 | Ga0495681_0004519 | 3300047470 | Bacteria | 9486 |
| 1285 | Ga0495681_0007323 | 3300047470 | Bacteria | 7070 |
| 1286 | Ga0495681_0007880 | 3300047470 | Bacteria | 6735 |
| 1287 | Ga0495681_0011042 | 3300047470 | Bacteria | 5414 |
| 1288 | Ga0495681_0014050 | 3300047470 | Bacteria | 4613 |
| 1289 | Ga0495681_0021427 | 3300047470 | Bacteria | 3483 |
| 1290 | Ga0495681_0132894 | 3300047470 | Bacteria | 1057 |
| 1291 | Ga0495686_0000285 | 3300047472 | Bacteria | 88880 |
| 1292 | Ga0495686_0002310 | 3300047472 | Bacteria | 18237 |
| 1293 | Ga0495686_0006705 | 3300047472 | Bacteria | 8759 |
| 1294 | Ga0495686_0027657 | 3300047472 | Bacteria | 3701 |
| 1295 | Ga0495686_0045808 | 3300047472 | Bacteria | 2766 |
| 1296 | Ga0495686_0062322 | 3300047472 | Bacteria | 2313 |
| 1297 | Ga0495686_0095539 | 3300047472 | Bacteria | 1800 |
| 1298 | Ga0495593_0019690 | 3300047673 | Bacteria | 3782 |
| 1299 | Ga0495593_0059720 | 3300047673 | Bacteria | 1997 |
| 1300 | Ga0495602_0001988 | 3300048088 | Bacteria | 20511 |
| 1301 | Ga0495614_0022782 | 3300048089 | Bacteria | 2700 |
| 1302 | Ga0495614_0023201 | 3300048089 | Bacteria | 2676 |
| 1303 | Ga0495626_0000292 | 3300048091 | Bacteria | 53923 |
| 1304 | Ga0495626_0000613 | 3300048091 | Bacteria | 34843 |
| 1305 | Ga0495626_0001135 | 3300048091 | Bacteria | 22262 |
| 1306 | Ga0495626_0002631 | 3300048091 | Bacteria | 12216 |
| 1307 | Ga0495626_0002852 | 3300048091 | Bacteria | 11539 |
| 1308 | Ga0495626_0004684 | 3300048091 | Bacteria | 8299 |
| 1309 | Ga0495626_0007031 | 3300048091 | Bacteria | 6320 |
| 1310 | Ga0495626_0007060 | 3300048091 | Bacteria | 6300 |
| 1311 | Ga0495626_0009023 | 3300048091 | Bacteria | 5407 |
| 1312 | Ga0495626_0010170 | 3300048091 | Bacteria | 5045 |
| 1313 | Ga0495626_0011436 | 3300048091 | Bacteria | 4694 |
| 1314 | Ga0495626_0023223 | 3300048091 | Bacteria | 3056 |
| 1315 | Ga0495626_0031585 | 3300048091 | Bacteria | 2547 |
| 1316 | Ga0495626_0041572 | 3300048091 | Bacteria | 2164 |
| 1317 | Ga0495626_0041615 | 3300048091 | Bacteria | 2162 |
| 1318 | Ga0495626_0046013 | 3300048091 | Bacteria | 2034 |
| 1319 | Ga0495626_0095325 | 3300048091 | Bacteria | 1303 |
| 1320 | Ga0496102_0001005 | 3300048905 | Bacteria | 26461 |
| 1321 | Ga0496102_0061189 | 3300048905 | Bacteria | 3445 |
| 1322 | Ga0496102_0299954 | 3300048905 | Bacteria | 1514 |
| 1323 | Ga0496103_0048845 | 3300048906 | Bacteria | 2616 |
| 1324 | Ga0496103_0177770 | 3300048906 | Bacteria | 1367 |
| 1325 | Ga0496104_0013974 | 3300048907 | Bacteria | 7243 |
| 1326 | Ga0496104_0072768 | 3300048907 | Bacteria | 3269 |
| 1327 | Ga0496104_0076174 | 3300048907 | Bacteria | 3195 |
| 1328 | Ga0496104_0129352 | 3300048907 | Bacteria | 2425 |
| 1329 | Ga0496104_0285282 | 3300048907 | Bacteria | 1564 |
| 1330 | Ga0496104_0642085 | 3300048907 | Bacteria | 971 |
| 1331 | Ga0496105_0004007 | 3300048908 | Bacteria | 11021 |
| 1332 | Ga0496105_0102484 | 3300048908 | Bacteria | 2364 |
| 1333 | Ga0496105_0442394 | 3300048908 | Bacteria | 1027 |
| 1334 | Ga0496106_0010926 | 3300048909 | Bacteria | 6711 |
| 1335 | Ga0496106_0210985 | 3300048909 | Bacteria | 1547 |
| 1336 | Ga0496109_0006786 | 3300048912 | Bacteria | 9645 |
| 1337 | Ga0496109_0453714 | 3300048912 | Bacteria | 1211 |
| 1338 | Ga0496109_0545671 | 3300048912 | Bacteria | 1094 |
| 1339 | Ga0496109_0571652 | 3300048912 | Bacteria | 1066 |
| 1340 | Ga0496110_0000641 | 3300048913 | Bacteria | 23992 |
| 1341 | Ga0496110_0005948 | 3300048913 | Bacteria | 9600 |
| 1342 | Ga0496110_0320276 | 3300048913 | Bacteria | 1412 |
| 1343 | Ga0496111_0004898 | 3300048914 | Bacteria | 8505 |
| 1344 | Ga0496111_0449360 | 3300048914 | Bacteria | 951 |
| 1345 | Ga0496112_0023445 | 3300048915 | Bacteria | 5897 |
| 1346 | Ga0496112_0116116 | 3300048915 | Bacteria | 2647 |
| 1347 | Ga0496113_0009852 | 3300048916 | Bacteria | 6291 |
| 1348 | Ga0496115_0007458 | 3300048918 | Bacteria | 8049 |
| 1349 | Ga0496115_0219241 | 3300048918 | Bacteria | 1570 |
| 1350 | Ga0496122_0001645 | 3300048925 | Bacteria | 34677 |
| 1351 | Ga0496122_0004436 | 3300048925 | Bacteria | 17417 |
| 1352 | Ga0496123_0002540 | 3300048926 | Bacteria | 22349 |
| 1353 | Ga0496123_0005998 | 3300048926 | Bacteria | 11947 |
| 1354 | Ga0496123_0045219 | 3300048926 | Bacteria | 3002 |
| 1355 | Ga0496124_0211724 | 3300048927 | Bacteria | 1466 |
| 1356 | Ga0496125_0001339 | 3300048928 | Bacteria | 36299 |
| 1357 | Ga0496125_0349408 | 3300048928 | Bacteria | 884 |
| 1358 | Ga0495678_000230 | 3300049459 | Bacteria | 64445 |
| 1359 | Ga0495678_000244 | 3300049459 | Bacteria | 61112 |
| 1360 | Ga0495678_001100 | 3300049459 | Bacteria | 22780 |
| 1361 | Ga0495678_001526 | 3300049459 | Bacteria | 17891 |
| 1362 | Ga0495678_007687 | 3300049459 | Bacteria | 5558 |
| 1363 | Ga0495682_0000987 | 3300049460 | Bacteria | 16949 |
| 1364 | Ga0495682_0004089 | 3300049460 | Bacteria | 6339 |
| 1365 | Ga0495682_0009652 | 3300049460 | Bacteria | 3762 |
| 1366 | Ga0495682_0021110 | 3300049460 | Bacteria | 2442 |
| 1367 | Ga0501291_030416 | 3300049514 | Bacteria | 908 |
| 1368 | Ga0501031_0039432 | 3300049568 | Bacteria | 3082 |
| 1369 | Ga0501031_0044131 | 3300049568 | Bacteria | 2909 |
| 1370 | Ga0501032_0010578 | 3300049569 | Bacteria | 6652 |
| 1371 | Ga0501032_0038231 | 3300049569 | Bacteria | 3270 |
| 1372 | Ga0501033_0002781 | 3300049570 | Bacteria | 14664 |
| 1373 | Ga0501033_0030331 | 3300049570 | Bacteria | 4064 |
| 1374 | Ga0501034_0002575 | 3300049571 | Bacteria | 21577 |
| 1375 | Ga0501034_0025960 | 3300049571 | Bacteria | 5967 |
| 1376 | Ga0501034_0072335 | 3300049571 | Bacteria | 3457 |
| 1377 | Ga0501034_0082596 | 3300049571 | Bacteria | 3214 |
| 1378 | Ga0501034_0215112 | 3300049571 | Bacteria | 1876 |
| 1379 | Ga0501036_0015924 | 3300049572 | Bacteria | 6279 |
| 1380 | Ga0501036_0017771 | 3300049572 | Bacteria | 5954 |
| 1381 | Ga0501037_0009766 | 3300049573 | Bacteria | 7046 |
| 1382 | Ga0501038_0045631 | 3300049574 | Bacteria | 3803 |
| 1383 | Ga0501038_0051438 | 3300049574 | Bacteria | 3555 |
| 1384 | Ga0501039_0062588 | 3300049575 | Bacteria | 2883 |
| 1385 | Ga0501042_0513438 | 3300049578 | Bacteria | 870 |
| 1386 | Ga0501043_0014217 | 3300049579 | Bacteria | 6228 |
| 1387 | Ga0501043_0017144 | 3300049579 | Bacteria | 5680 |
| 1388 | Ga0501046_0003771 | 3300049580 | Bacteria | 13876 |
| 1389 | Ga0501046_0034804 | 3300049580 | Bacteria | 4062 |
| 1390 | Ga0501047_0020003 | 3300049581 | Bacteria | 6426 |
| 1391 | Ga0501047_0044284 | 3300049581 | Bacteria | 4299 |
| 1392 | Ga0501047_0083347 | 3300049581 | Bacteria | 3073 |
| 1393 | Ga0501047_0097691 | 3300049581 | Bacteria | 2815 |
| 1394 | Ga0501048_0002543 | 3300049582 | Bacteria | 13959 |
| 1395 | Ga0501048_0029999 | 3300049582 | Bacteria | 3939 |
| 1396 | Ga0501068_0003114 | 3300049584 | Bacteria | 8865 |
| 1397 | Ga0501068_0009245 | 3300049584 | Bacteria | 5509 |
| 1398 | Ga0501069_0007518 | 3300049585 | Bacteria | 5720 |
| 1399 | Ga0501069_0016457 | 3300049585 | Bacteria | 3973 |
| 1400 | Ga0501070_0018373 | 3300049586 | Bacteria | 5866 |
| 1401 | Ga0501070_0130332 | 3300049586 | Bacteria | 2077 |
| 1402 | Ga0501073_0010780 | 3300049589 | Bacteria | 6693 |
| 1403 | Ga0501073_0035014 | 3300049589 | Bacteria | 3570 |
| 1404 | Ga0501074_0038573 | 3300049590 | Bacteria | 3461 |
| 1405 | Ga0501076_0025946 | 3300049592 | Bacteria | 4537 |
| 1406 | Ga0501201_002058 | 3300049651 | Bacteria | 1851 |
| 1407 | Ga0501211_007739 | 3300049658 | Bacteria | 1051 |
| 1408 | Ga0501223_045817 | 3300049663 | Bacteria | 849 |
| 1409 | Ga0501227_003631 | 3300049665 | Bacteria | 3342 |
| 1410 | Ga0501235_009392 | 3300049669 | Bacteria | 2138 |
| 1411 | Ga0501079_0018676 | 3300049741 | Bacteria | 5297 |
| 1412 | Ga0501079_0021225 | 3300049741 | Bacteria | 4966 |
| 1413 | Ga0501080_0017753 | 3300049742 | Bacteria | 6584 |
| 1414 | Ga0501080_0104371 | 3300049742 | Bacteria | 2628 |
| 1415 | Ga0501081_0443174 | 3300049743 | Bacteria | 964 |
| 1416 | Ga0501083_0030960 | 3300049744 | Bacteria | 3672 |
| 1417 | Ga0501083_0073583 | 3300049744 | Bacteria | 2271 |
| 1418 | Ga0501262_016440 | 3300049759 | Bacteria | 979 |
| 1419 | Ga0501264_005389 | 3300049761 | Bacteria | 1166 |
| 1420 | Ga0501267_001826 | 3300049764 | Bacteria | 1865 |
| 1421 | Ga0501271_002473 | 3300049768 | Bacteria | 1651 |
| 1422 | Ga0501272_003078 | 3300049769 | Bacteria | 1678 |
| 1423 | Ga0501279_015204 | 3300049775 | Bacteria | 1064 |
| 1424 | Ga0501035_0000789 | 3300049822 | Bacteria | 33899 |
| 1425 | Ga0501035_0023555 | 3300049822 | Bacteria | 5648 |
| 1426 | Ga0501035_0187718 | 3300049822 | Bacteria | 1778 |
| 1427 | Ga0501044_0089065 | 3300049823 | Bacteria | 3115 |
| 1428 | Ga0501044_0131410 | 3300049823 | Bacteria | 2497 |
| 1429 | Ga0501045_0003433 | 3300049824 | Bacteria | 10841 |
| 1430 | Ga0501226_002698 | 3300049853 | Bacteria | 2145 |
| 1431 | nmdc:mga03683_25437_c1 | 3300050489 | Bacteria | 2326 |
| 1432 | nmdc:mga0k408_189169_c1 | 3300050493 | Bacteria | 1228 |
| 1433 | nmdc:mga0k408_273426_c1 | 3300050493 | Bacteria | 1009 |
| 1434 | nmdc:mga0k408_2817_c1 | 3300050493 | Bacteria | 9230 |
| 1435 | nmdc:mga0k408_67533_c1 | 3300050493 | Bacteria | 2084 |
| 1436 | nmdc:mga06z11_3237_c1 | 3300050494 | Bacteria | 6292 |
| 1437 | nmdc:mga06z11_427815_c1 | 3300050494 | Bacteria | 798 |
| 1438 | nmdc:mga07m45_107955_c1 | 3300050496 | Bacteria | 1601 |
| 1439 | nmdc:mga07m45_108288_c1 | 3300050496 | Bacteria | 1599 |
| 1440 | nmdc:mga07m45_14749_c1 | 3300050496 | Bacteria | 4170 |
| 1441 | nmdc:mga07m45_1739_c1 | 3300050496 | Bacteria | 10020 |
| 1442 | nmdc:mga07m45_17812_c1 | 3300050496 | Bacteria | 3822 |
| 1443 | nmdc:mga07m45_2135_c1 | 3300050496 | Bacteria | 9203 |
| 1444 | nmdc:mga07m45_241469_c1 | 3300050496 | Bacteria | 1051 |
| 1445 | nmdc:mga07m45_36807_c1 | 3300050496 | Bacteria | 2727 |
| 1446 | nmdc:mga07m45_667_c1 | 3300050496 | Bacteria | 14576 |
| 1447 | nmdc:mga07m45_9721_c2 | 3300050496 | Bacteria | 2776 |
| 1448 | nmdc:mga05p37_450441_c1 | 3300050507 | Bacteria | 1490 |
| 1449 | nmdc:mga06r32_149366_c1 | 3300050510 | Bacteria | 2314 |
| 1450 | nmdc:mga08y16_13960_c1 | 3300050511 | Bacteria | 8456 |
| 1451 | nmdc:mga0n895_105939_c1 | 3300050512 | Bacteria | 2824 |
| 1452 | nmdc:mga0n895_178245_c1 | 3300050512 | Bacteria | 2156 |
| 1453 | nmdc:mga0n895_184118_c1 | 3300050512 | Bacteria | 2120 |
| 1454 | nmdc:mga0n895_258186_c1 | 3300050512 | Bacteria | 1768 |
| 1455 | nmdc:mga0n895_798789_c1 | 3300050512 | Bacteria | 934 |
| 1456 | nmdc:mga0rr50_190791_c1 | 3300050513 | Bacteria | 1679 |
| 1457 | nmdc:mga0rr50_44781_c1 | 3300050513 | Bacteria | 3248 |
| 1458 | nmdc:mga08x19_122667_c1 | 3300050514 | Bacteria | 1743 |
| 1459 | nmdc:mga08x19_33584_c1 | 3300050514 | Bacteria | 3238 |
| 1460 | nmdc:mga0a205_759720_c1 | 3300050515 | Bacteria | 818 |
| 1461 | Ga0500635_0000007 | 3300053080 | Bacteria | 169379 |
| 1462 | Ga0500635_0000150 | 3300053080 | Bacteria | 39030 |
| 1463 | Ga0500578_0000025 | 3300053086 | Bacteria | 151485 |
| 1464 | Ga0500644_0027795 | 3300053088 | Bacteria | 1763 |
| 1465 | Ga0500646_0010670 | 3300053090 | Bacteria | 2357 |
| 1466 | Ga0500651_0131626 | 3300053093 | Bacteria | 1512 |
| 1467 | Ga0500651_0450153 | 3300053093 | Bacteria | 716 |
| 1468 | Ga0500562_038607 | 3300053108 | Bacteria | 1268 |
| 1469 | Ga0500608_011126 | 3300053122 | Bacteria | 3894 |
| 1470 | Ga0500608_105189 | 3300053122 | Bacteria | 1302 |
| 1471 | Ga0500652_001368 | 3300053131 | Bacteria | 7638 |
| 1472 | Ga0500658_0041897 | 3300053134 | Bacteria | 1838 |
| 1473 | Ga0500564_057627 | 3300053138 | Bacteria | 1767 |
| 1474 | Ga0500568_0051919 | 3300053139 | Bacteria | 1611 |
| 1475 | Ga0500622_0000279 | 3300053156 | Bacteria | 52053 |
| 1476 | Ga0500636_0004381 | 3300053177 | Bacteria | 7986 |
| 1477 | Ga0501084_0003897 | 3300054114 | Bacteria | 12149 |
| 1478 | Ga0501082_0039601 | 3300060353 | Bacteria | 4066 |
| 1479 | Ga0501082_0053377 | 3300060353 | Bacteria | 3484 |
| 1480 | Ga0466962_0021479 | 3300061719 | Bacteria | 3099 |
| 1481 | Ga0466962_0027083 | 3300061719 | Bacteria | 2752 |
| 1482 | Ga0466962_0042306 | 3300061719 | Bacteria | 2180 |
| 1483 | Ga0466962_0058448 | 3300061719 | Bacteria | 1840 |
| 1484 | 2587725658 | 2585428057 | Bacteria | 6737412 |
| 1485 | 2587735093 | 2585428058 | Bacteria | 6853932 |
| 1486 | 2587760006 | 2585428062 | Bacteria | 6842168 |
| 1487 | 2588290589 | 2588253510 | Bacteria | 6901809 |
| 1488 | 2643744462 | 2643221544 | Bacteria | 5886209 |
| 1489 | 2643787764 | 2643221554 | Bacteria | 6603920 |
| 1490 | 2643800530 | 2643221556 | Bacteria | 7251154 |
| 1491 | 2643934467 | 2643221585 | Bacteria | 5812563 |
| 1492 | 2643968303 | 2643221592 | Bacteria | 6608788 |
| 1493 | 2644143544 | 2643221625 | Bacteria | 6512927 |
| 1494 | 2644211876 | 2643221638 | Bacteria | 6579467 |
| 1495 | 2644219310 | 2643221639 | Bacteria | 6649903 |
| 1496 | 2644222127 | 2643221639 | Bacteria | 6649903 |
| 1497 | 2644255748 | 2643221646 | Bacteria | 6433402 |
| 1498 | 2644257092 | 2643221646 | Bacteria | 6433402 |
| 1499 | 2644272081 | 2643221648 | Bacteria | 6521465 |
| 1500 | 2644315954 | 2643221656 | Bacteria | 5809961 |
| 1501 | 2644470439 | 2643221684 | Bacteria | 7145183 |
| 1502 | 2739054206 | 2738541337 | Bacteria | 6183410 |
| 1503 | 2739055352 | 2738541337 | Bacteria | 6183410 |
| 1504 | 2809144043 | 2808606418 | Bacteria | 6724496 |
| 1505 | 8047678835 | 8047673197 | Bacteria | 7395230 |
| 1506 | Ga0070685_10210500 | |||
| 1507 | JGI25156J39149_1001159 | |||
| 1508 | JGI25156J39149_1002068 | |||
| 1509 | JGI25156J39149_1022654 | |||
| 1510 | JGI25154J39366_1001049 | |||
| 1511 | JGI25154J39366_1002964 | |||
| 1512 | JGI25158J39367_1000226 | |||
| 1513 | JGI25157J39369_1000029 | |||
| 1514 | JGI25157J39369_1000312 | |||
| 1515 | JGI25164J39214_1008298 | |||
| 1516 | JGI25152J39213_1000433 | |||
| 1517 | JGI25150J39212_1000749 | |||
| 1518 | JGI25150J39212_1001006 | |||
| 1519 | JGI25150J39212_1001467 | |||
| 1520 | JGI25150J39212_1002524 | |||
| 1521 | JGI25159J45721_1000365 | |||
| 1522 | JGI25153J46596_10013424 | |||
| 1523 | rootH1_10004599 | |||
| 1524 | rootH1_10007951 | |||
| 1525 | rootH1_10017383 | |||
| 1526 | rootH1_10034050 | |||
| 1527 | rootH1_10037656 | |||
| 1528 | rootH2_10006249 | |||
| 1529 | rootL2_10002470 | |||
| 1530 | rootL2_10016318 | |||
| 1531 | rootL2_10208757 | |||
| 1532 | rootH1_10006598 | |||
| 1533 | rootH1_10015852 | |||
| 1534 | rootH1_10020381 | |||
| 1535 | rootH1_10027575 | |||
| 1536 | rootH1_10030329 | |||
| 1537 | rootH1_10030355 | |||
| 1538 | rootH1_10116314 | |||
| 1539 | JGI25161J50226_1000407 | |||
| 1540 | Ga0055539_1000282 | |||
| 1541 | Ga0055539_1000902 | |||
| 1542 | Ga0055539_1008226 | |||
| 1543 | Ga0055539_1015032 | |||
| 1544 | Ga0055533_1000010 | |||
| 1545 | Ga0055533_1000024 | |||
| 1546 | Ga0055525_1000081 | |||
| 1547 | Ga0055525_1000222 | |||
| 1548 | Ga0055525_1001459 | |||
| 1549 | Ga0055535_1000292 | |||
| 1550 | Ga0055535_1001112 | |||
| 1551 | Ga0055542_1007406 | |||
| 1552 | Ga0055529_1000130 | |||
| 1553 | Ga0055529_1000382 | |||
| 1554 | Ga0055526_1013614 | |||
| 1555 | Ga0055537_1012667 | |||
| 1556 | Ga0055537_1014154 | |||
| 1557 | Ga0055537_1019391 | |||
| 1558 | Ga0055524_1001532 | |||
| 1559 | Ga0055524_1006527 | |||
| 1560 | Ga0055534_1013048 | |||
| 1561 | Ga0055530_10002964 | |||
| 1562 | Ga0055530_10013336 | |||
| 1563 | Ga0055530_10045433 | |||
| 1564 | Ga0055540_1017899 | |||
| 1565 | Ga0055540_1039891 | |||
| 1566 | Ga0055531_10000024 | |||
| 1567 | Ga0055531_10000700 | |||
| 1568 | Ga0055531_10000818 | |||
| 1569 | Ga0055531_10032869 | |||
| 1570 | Ga0055543_1000546 | |||
| 1571 | Ga0065165_1001129 | |||
| 1572 | Ga0065165_1002224 | |||
| 1573 | Ga0065165_1007878 | |||
| 1574 | Ga0065165_1027495 | |||
| 1575 | Ga0065714_10107373 | |||
| 1576 | Ga0065715_10241007 | |||
| 1577 | Ga0070658_10004794 | |||
| 1578 | Ga0070658_10027232 | |||
| 1579 | Ga0070658_10039977 | |||
| 1580 | Ga0070658_10058732 | |||
| 1581 | Ga0070658_10070757 | |||
| 1582 | Ga0070658_10247280 | |||
| 1583 | Ga0070683_100031998 | |||
| 1584 | Ga0070690_100003915 | |||
| 1585 | Ga0070690_100014227 | |||
| 1586 | Ga0070690_100056280 | |||
| 1587 | Ga0070690_100161861 | |||
| 1588 | Ga0070670_100004747 | |||
| 1589 | Ga0070677_10001503 | |||
| 1590 | Ga0070677_10004919 | |||
| 1591 | Ga0068869_100004218 | |||
| 1592 | Ga0068869_100036764 | |||
| 1593 | Ga0068869_100043150 | |||
| 1594 | Ga0068869_100059558 | |||
| 1595 | Ga0068869_100118707 | |||
| 1596 | Ga0070666_10009513 | |||
| 1597 | Ga0070680_100068066 | |||
| 1598 | Ga0070680_100096809 | |||
| 1599 | Ga0070680_100127601 | |||
| 1600 | Ga0070680_100342567 | |||
| 1601 | Ga0070682_100094761 | |||
| 1602 | Ga0070682_100225857 | |||
| 1603 | Ga0068868_100000628 | |||
| 1604 | Ga0068868_100001502 | |||
| 1605 | Ga0068868_100006264 | |||
| 1606 | Ga0068868_100065246 | |||
| 1607 | Ga0068868_100607628 | |||
| 1608 | Ga0070660_100006633 | |||
| 1609 | Ga0070660_100033625 | |||
| 1610 | Ga0070660_100106926 | |||
| 1611 | Ga0070660_100206391 | |||
| 1612 | Ga0070660_100302787 | |||
| 1613 | Ga0070689_100052275 | |||
| 1614 | Ga0070689_100471686 | |||
| 1615 | Ga0070691_10008161 | |||
| 1616 | Ga0070691_10038091 | |||
| 1617 | Ga0070691_10191062 | |||
| 1618 | Ga0070687_100026461 | |||
| 1619 | Ga0070661_100103129 | |||
| 1620 | Ga0070692_10004149 | |||
| 1621 | Ga0070668_100042991 | |||
| 1622 | Ga0070668_100046957 | |||
| 1623 | Ga0070668_100161621 | |||
| 1624 | Ga0070669_100017692 | |||
| 1625 | Ga0070669_100041956 | |||
| 1626 | Ga0070669_100256465 | |||
| 1627 | Ga0070675_100002597 | |||
| 1628 | Ga0070675_100088059 | |||
| 1629 | Ga0070671_100002077 | |||
| 1630 | Ga0070671_100024204 | |||
| 1631 | Ga0070671_100038221 | |||
| 1632 | Ga0070674_100009585 | |||
| 1633 | Ga0070674_100138972 | |||
| 1634 | Ga0070674_100202734 | |||
| 1635 | Ga0070673_100006268 | |||
| 1636 | Ga0070673_100014919 | |||
| 1637 | Ga0070673_100017763 | |||
| 1638 | Ga0070673_100021054 | |||
| 1639 | Ga0070673_100091002 | |||
| 1640 | Ga0070673_100165829 | |||
| 1641 | Ga0070688_100088032 | |||
| 1642 | Ga0070659_100075936 | |||
| 1643 | Ga0070667_100005385 | |||
| 1644 | Ga0070667_100005638 | |||
| 1645 | Ga0070703_10003938 | |||
| 1646 | Ga0070709_10023806 | |||
| 1647 | Ga0070709_10182104 | |||
| 1648 | Ga0070709_10626057 | |||
| 1649 | Ga0070714_100015390 | |||
| 1650 | Ga0070713_100002097 | |||
| 1651 | Ga0070713_100016508 | |||
| 1652 | Ga0070713_100151540 | |||
| 1653 | Ga0070713_100374624 | |||
| 1654 | Ga0070710_10043138 | |||
| 1655 | Ga0070701_10047380 | |||
| 1656 | Ga0070711_100368019 | |||
| 1657 | Ga0070705_100007516 | |||
| 1658 | Ga0070705_100010423 | |||
| 1659 | Ga0070694_100014445 | |||
| 1660 | Ga0070708_100000634 | |||
| 1661 | Ga0070708_100001048 | |||
| 1662 | Ga0070708_100106259 | |||
| 1663 | Ga0070678_100002016 | |||
| 1664 | Ga0070678_100007398 | |||
| 1665 | Ga0070678_100023958 | |||
| 1666 | Ga0070662_100062526 | |||
| 1667 | Ga0070662_100224756 | |||
| 1668 | Ga0070662_100331361 | |||
| 1669 | Ga0070681_10000506 | |||
| 1670 | Ga0070681_10002815 | |||
| 1671 | Ga0070681_10114861 | |||
| 1672 | Ga0068867_100001168 | |||
| 1673 | Ga0068867_100023799 | |||
| 1674 | Ga0068867_100035860 | |||
| 1675 | Ga0068867_100118543 | |||
| 1676 | Ga0070706_100000597 | |||
| 1677 | Ga0070706_100011207 | |||
| 1678 | Ga0070706_100012084 | |||
| 1679 | Ga0070706_100417622 | |||
| 1680 | Ga0070707_100001822 | |||
| 1681 | Ga0070707_100099618 | |||
| 1682 | Ga0070707_100149782 | |||
| 1683 | Ga0070698_100072447 | |||
| 1684 | Ga0070699_100014523 | |||
| 1685 | Ga0070699_100026220 | |||
| 1686 | Ga0070679_100014489 | |||
| 1687 | Ga0070679_100221886 | |||
| 1688 | Ga0070684_100008480 | |||
| 1689 | Ga0070684_100109925 | |||
| 1690 | Ga0070684_100124185 | |||
| 1691 | Ga0070697_100000634 | |||
| 1692 | Ga0070697_100100673 | |||
| 1693 | Ga0070697_100106997 | |||
| 1694 | Ga0070697_100234742 | |||
| 1695 | Ga0070697_100241516 | |||
| 1696 | Ga0068853_100301234 | |||
| 1697 | Ga0068853_100333558 | |||
| 1698 | Ga0070672_100000699 | |||
| 1699 | Ga0070672_100077922 | |||
| 1700 | Ga0070695_100119262 | |||
| 1701 | Ga0070696_100000745 | |||
| 1702 | Ga0070693_100000089 | |||
| 1703 | Ga0070693_100012559 | |||
| 1704 | Ga0070665_100063355 | |||
| 1705 | Ga0070665_100086806 | |||
| 1706 | Ga0070665_100266167 | |||
| 1707 | Ga0070704_100003995 | |||
| 1708 | Ga0070704_100219995 | |||
| 1709 | Ga0068855_100000212 | |||
| 1710 | Ga0068855_100005033 | |||
| 1711 | Ga0068855_100006540 | |||
| 1712 | Ga0068855_100007637 | |||
| 1713 | Ga0068855_100008176 | |||
| 1714 | Ga0068855_100131047 | |||
| 1715 | Ga0068855_100180228 | |||
| 1716 | Ga0068855_100242476 | |||
| 1717 | Ga0068855_100399924 | |||
| 1718 | Ga0068855_100689010 | |||
| 1719 | Ga0070664_100002091 | |||
| 1720 | Ga0070664_100450176 | |||
| 1721 | Ga0068857_100000097 | |||
| 1722 | Ga0068857_100000164 | |||
| 1723 | Ga0068857_100008343 | |||
| 1724 | Ga0068854_100009674 | |||
| 1725 | Ga0068854_100015311 | |||
| 1726 | Ga0068854_100024684 | |||
| 1727 | Ga0068854_100046522 | |||
| 1728 | Ga0068856_100001671 | |||
| 1729 | Ga0068856_100001677 | |||
| 1730 | Ga0068856_100019882 | |||
| 1731 | Ga0068856_100027769 | |||
| 1732 | Ga0068856_100027810 | |||
| 1733 | Ga0068856_100108933 | |||
| 1734 | Ga0068856_100362753 | |||
| 1735 | Ga0068856_100474657 | |||
| 1736 | Ga0070702_100206729 | |||
| 1737 | Ga0070702_100290374 | |||
| 1738 | Ga0068852_100009747 | |||
| 1739 | Ga0068852_100036308 | |||
| 1740 | Ga0068852_100117826 | |||
| 1741 | Ga0068852_100352391 | |||
| 1742 | Ga0068852_100388659 | |||
| 1743 | Ga0068859_100000780 | |||
| 1744 | Ga0068859_100018677 | |||
| 1745 | Ga0068864_100000242 | |||
| 1746 | Ga0068864_100006501 | |||
| 1747 | Ga0068864_100036884 | |||
| 1748 | Ga0068866_10002395 | |||
| 1749 | Ga0068866_10222692 | |||
| 1750 | Ga0068861_100073761 | |||
| 1751 | Ga0068861_100079741 | |||
| 1752 | Ga0068861_100093682 | |||
| 1753 | Ga0068861_100152207 | |||
| 1754 | Ga0068851_10226320 | |||
| 1755 | Ga0068870_10022504 | |||
| 1756 | Ga0068870_10092064 | |||
| 1757 | Ga0068863_100007429 | |||
| 1758 | Ga0068863_100007901 | |||
| 1759 | Ga0068863_100116135 | |||
| 1760 | Ga0068863_100606456 | |||
| 1761 | Ga0068858_100001038 | |||
| 1762 | Ga0068858_100001331 | |||
| 1763 | Ga0068858_100046025 | |||
| 1764 | Ga0068860_100012630 | |||
| 1765 | Ga0068860_100044011 | |||
| 1766 | Ga0068860_100210325 | |||
| 1767 | Ga0068860_100277814 | |||
| 1768 | Ga0068862_100009673 | |||
| 1769 | Ga0068862_100306889 | |||
| 1770 | Ga0068862_100378326 | |||
| 1771 | Ga0081455_10269275 | |||
| 1772 | Ga0070717_10026203 | |||
| 1773 | Ga0070717_10379596 | |||
| 1774 | Ga0075364_10055611 | |||
| 1775 | Ga0070712_100311527 | |||
| 1776 | Ga0075362_10003601 | |||
| 1777 | Ga0075367_10011581 | |||
| 1778 | Ga0075366_10000209 | |||
| 1779 | Ga0075366_10009229 | |||
| 1780 | Ga0075366_10062293 | |||
| 1781 | Ga0075366_10085110 | |||
| 1782 | Ga0097621_100000314 | |||
| 1783 | Ga0097621_100007716 | |||
| 1784 | Ga0097621_100016282 | |||
| 1785 | Ga0097621_100024590 | |||
| 1786 | Ga0097621_100328348 | |||
| 1787 | Ga0075370_10000798 | |||
| 1788 | Ga0075370_10021340 | |||
| 1789 | Ga0075370_10025236 | |||
| 1790 | Ga0075370_10034151 | |||
| 1791 | Ga0075370_10074951 | |||
| 1792 | Ga0068871_100009452 | |||
| 1793 | Ga0068871_100040452 | |||
| 1794 | Ga0068871_100070667 | |||
| 1795 | Ga0075428_100103519 | |||
| 1796 | Ga0075431_100262127 | |||
| 1797 | Ga0075433_10490402 | |||
| 1798 | Ga0075434_100092796 | |||
| 1799 | Ga0075434_100263519 | |||
| 1800 | Ga0075434_100318442 | |||
| 1801 | Ga0075429_100067405 | |||
| 1802 | Ga0068865_100057940 | |||
| 1803 | Ga0075436_100088124 | |||
| 1804 | Ga0075436_100241914 | |||
| 1805 | Ga0097620_100000780 | |||
| 1806 | Ga0097620_100018677 | |||
| 1807 | Ga0075435_100003402 | |||
| 1808 | Ga0099794_10005413 | |||
| 1809 | Ga0099795_10030697 | |||
| 1810 | Ga0099795_10089526 | |||
| 1811 | Ga0105240_10002073 | |||
| 1812 | Ga0105240_10002125 | |||
| 1813 | Ga0105240_10008664 | |||
| 1814 | Ga0105240_10021828 | |||
| 1815 | Ga0105240_10108762 | |||
| 1816 | Ga0105240_10204579 | |||
| 1817 | Ga0105240_10338636 | |||
| 1818 | Ga0105240_10352982 | |||
| 1819 | Ga0105240_10618140 | |||
| 1820 | Ga0111539_10003952 | |||
| 1821 | Ga0105245_10009192 | |||
| 1822 | Ga0105245_10448816 | |||
| 1823 | Ga0114129_10001813 | |||
| 1824 | Ga0114129_10105052 | |||
| 1825 | Ga0114129_10870557 | |||
| 1826 | Ga0114129_11078406 | |||
| 1827 | Ga0105243_10077587 | |||
| 1828 | Ga0105243_10131023 | |||
| 1829 | Ga0105243_10151416 | |||
| 1830 | Ga0105243_10208365 | |||
| 1831 | Ga0105243_10547898 | |||
| 1832 | Ga0105241_10033445 | |||
| 1833 | Ga0105241_10151395 | |||
| 1834 | Ga0105241_10160747 | |||
| 1835 | Ga0105241_10178272 | |||
| 1836 | Ga0105241_10201131 | |||
| 1837 | Ga0105242_10074656 | |||
| 1838 | Ga0105242_10218114 | |||
| 1839 | Ga0105248_10035730 | |||
| 1840 | Ga0105248_10109410 | |||
| 1841 | Ga0105248_10125452 | |||
| 1842 | Ga0105248_10317774 | |||
| 1843 | Ga0105248_11060566 | |||
| 1844 | Ga0105237_10010975 | |||
| 1845 | Ga0105237_10024770 | |||
| 1846 | Ga0105237_10131925 | |||
| 1847 | Ga0105238_10000064 | |||
| 1848 | Ga0105238_10026318 | |||
| 1849 | Ga0105238_10061388 | |||
| 1850 | Ga0105238_10786052 | |||
| 1851 | Ga0105249_10065798 | |||
| 1852 | Ga0105239_10335314 | |||
| 1853 | Ga0105246_10061266 | |||
| 1854 | Ga0105246_10209092 | |||
| 1855 | Ga0105246_10254815 | |||
| 1856 | Ga0157373_10086388 | |||
| 1857 | Ga0157373_10174784 | |||
| 1858 | Ga0157371_10000013 | |||
| 1859 | Ga0157371_10000064 | |||
| 1860 | Ga0157371_10046815 | |||
| 1861 | Ga0157371_10077462 | |||
| 1862 | Ga0157371_10096657 | |||
| 1863 | Ga0157370_10361540 | |||
| 1864 | Ga0157370_10669722 | |||
| 1865 | Ga0157369_10000522 | |||
| 1866 | Ga0157369_10027164 | |||
| 1867 | Ga0157369_10032556 | |||
| 1868 | Ga0157369_10048151 | |||
| 1869 | Ga0157369_10187677 | |||
| 1870 | Ga0157369_10245648 | |||
| 1871 | Ga0157369_10971128 | |||
| 1872 | Ga0157374_10000245 | |||
| 1873 | Ga0157374_10000577 | |||
| 1874 | Ga0157374_10078751 | |||
| 1875 | Ga0157374_10313883 | |||
| 1876 | Ga0157378_10000172 | |||
| 1877 | Ga0157378_10123834 | |||
| 1878 | Ga0157378_10150386 | |||
| 1879 | Ga0157378_10228616 | |||
| 1880 | Ga0157378_10353735 | |||
| 1881 | Ga0163162_10775537 | |||
| 1882 | Ga0157372_10000450 | |||
| 1883 | Ga0157372_10011617 | |||
| 1884 | Ga0157372_10024161 | |||
| 1885 | Ga0157372_10025639 | |||
| 1886 | Ga0157372_10090823 | |||
| 1887 | Ga0157372_10175298 | |||
| 1888 | Ga0157372_10418765 | |||
| 1889 | Ga0157372_10629303 | |||
| 1890 | Ga0157375_10053089 | |||
| 1891 | Ga0163163_10018823 | |||
| 1892 | Ga0163163_10262780 | |||
| 1893 | Ga0157380_10259725 | |||
| 1894 | Ga0182008_10024693 | |||
| 1895 | Ga0157379_10012032 | |||
| 1896 | Ga0157376_10077607 | |||
| 1897 | Ga0157376_10194314 | |||
| 1898 | Ga0157376_10385259 | |||
| 1899 | Ga0157376_11132777 | |||
| 1900 | Ga0182006_1032583 | |||
| 1901 | Ga0182007_10022545 | |||
| 1902 | Ga0182007_10066331 | |||
| 1903 | Ga0163161_10091476 | |||
| 1904 | Ga0213872_10000115 | |||
| 1905 | Ga0213872_10004364 | |||
| 1906 | Ga0213872_10057539 | |||
| 1907 | Ga0209436_100218 | |||
| 1908 | Ga0209674_100003 | |||
| 1909 | Ga0209674_100007 | |||
| 1910 | Ga0209672_102656 | |||
| 1911 | Ga0209563_100015 | |||
| 1912 | Ga0209563_100049 | |||
| 1913 | Ga0209563_100060 | |||
| 1914 | Ga0209563_100088 | |||
| 1915 | Ga0209563_105947 | |||
| 1916 | Ga0207427_100282 | |||
| 1917 | Ga0207427_100623 | |||
| 1918 | Ga0209258_100128 | |||
| 1919 | Ga0209258_100683 | |||
| 1920 | Ga0209258_102459 | |||
| 1921 | Ga0207425_1000109 | |||
| 1922 | Ga0207425_1000122 | |||
| 1923 | Ga0207425_1000482 | |||
| 1924 | Ga0207425_1002022 | |||
| 1925 | Ga0207425_1007654 | |||
| 1926 | Ga0209646_1000056 | |||
| 1927 | Ga0209646_1000111 | |||
| 1928 | Ga0209026_1000009 | |||
| 1929 | Ga0209026_1000054 | |||
| 1930 | Ga0209677_100050 | |||
| 1931 | Ga0209677_100129 | |||
| 1932 | Ga0209677_100514 | |||
| 1933 | Ga0209677_101079 | |||
| 1934 | Ga0209677_101420 | |||
| 1935 | Ga0209677_112089 | |||
| 1936 | Ga0209148_1000272 | |||
| 1937 | Ga0209759_1000035 | |||
| 1938 | Ga0209759_1000043 | |||
| 1939 | Ga0209759_1000666 | |||
| 1940 | Ga0209759_1001454 | |||
| 1941 | Ga0209759_1004314 | |||
| 1942 | Ga0209759_1006725 | |||
| 1943 | Ga0209759_1009204 | |||
| 1944 | Ga0209129_1000582 | |||
| 1945 | Ga0209129_1002417 | |||
| 1946 | Ga0209565_1000600 | |||
| 1947 | Ga0209565_1005953 | |||
| 1948 | Ga0209565_1015548 | |||
| 1949 | Ga0209455_1000108 | |||
| 1950 | Ga0209455_1000116 | |||
| 1951 | Ga0209130_1000171 | |||
| 1952 | Ga0209130_1001410 | |||
| 1953 | Ga0209675_1000739 | |||
| 1954 | Ga0209675_1001493 | |||
| 1955 | Ga0209675_1005760 | |||
| 1956 | Ga0209564_1000095 | |||
| 1957 | Ga0209564_1003896 | |||
| 1958 | Ga0209564_1004713 | |||
| 1959 | Ga0209758_1001664 | |||
| 1960 | Ga0209050_1000011 | |||
| 1961 | Ga0209050_1000547 | |||
| 1962 | Ga0209050_1001381 | |||
| 1963 | Ga0209050_1004051 | |||
| 1964 | Ga0209050_1006205 | |||
| 1965 | Ga0209256_1000987 | |||
| 1966 | Ga0209256_1001062 | |||
| 1967 | Ga0209256_1059981 | |||
| 1968 | Ga0209051_1003873 | |||
| 1969 | Ga0209051_1008357 | |||
| 1970 | Ga0209051_1018162 | |||
| 1971 | Ga0209051_1026335 | |||
| 1972 | Ga0209257_1000003 | |||
| 1973 | Ga0209257_1000017 | |||
| 1974 | Ga0209257_1000117 | |||
| 1975 | Ga0209257_1014465 | |||
| 1976 | Ga0209257_1030252 | |||
| 1977 | Ga0207656_10087765 | |||
| 1978 | Ga0207682_10003095 | |||
| 1979 | Ga0207682_10048403 | |||
| 1980 | Ga0207642_10004420 | |||
| 1981 | Ga0207688_10016962 | |||
| 1982 | Ga0207680_10274907 | |||
| 1983 | Ga0207680_10330494 | |||
| 1984 | Ga0207699_10087189 | |||
| 1985 | Ga0207699_10276793 | |||
| 1986 | Ga0207645_10073735 | |||
| 1987 | Ga0207645_10235079 | |||
| 1988 | Ga0207643_10007445 | |||
| 1989 | Ga0207705_10000922 | |||
| 1990 | Ga0207705_10014081 | |||
| 1991 | Ga0207705_10023899 | |||
| 1992 | Ga0207705_10052182 | |||
| 1993 | Ga0207705_10064246 | |||
| 1994 | Ga0207705_10202375 | |||
| 1995 | Ga0207684_10000125 | |||
| 1996 | Ga0207684_10013608 | |||
| 1997 | Ga0207684_10226178 | |||
| 1998 | Ga0207654_10021970 | |||
| 1999 | Ga0207654_10080747 | |||
| 2000 | Ga0207654_10183518 | |||
| 2001 | Ga0207654_10231662 | |||
| 2002 | Ga0207707_10001125 | |||
| 2003 | Ga0207707_10060943 | |||
| 2004 | Ga0207707_10226090 | |||
| 2005 | Ga0207695_10001924 | |||
| 2006 | Ga0207695_10008820 | |||
| 2007 | Ga0207695_10018362 | |||
| 2008 | Ga0207695_10035278 | |||
| 2009 | Ga0207695_10049321 | |||
| 2010 | Ga0207695_10084876 | |||
| 2011 | Ga0207695_10093813 | |||
| 2012 | Ga0207695_10128664 | |||
| 2013 | Ga0207671_10240263 | |||
| 2014 | Ga0207693_10305720 | |||
| 2015 | Ga0207693_10585282 | |||
| 2016 | Ga0207663_10435488 | |||
| 2017 | Ga0207663_10449168 | |||
| 2018 | Ga0207660_10033710 | |||
| 2019 | Ga0207660_10104439 | |||
| 2020 | Ga0207660_10358913 | |||
| 2021 | Ga0207657_10000491 | |||
| 2022 | Ga0207657_10010663 | |||
| 2023 | Ga0207657_10016061 | |||
| 2024 | Ga0207649_10047767 | |||
| 2025 | Ga0207649_10076573 | |||
| 2026 | Ga0207649_10387357 | |||
| 2027 | Ga0207652_10048726 | |||
| 2028 | Ga0207652_10080300 | |||
| 2029 | Ga0207652_10237251 | |||
| 2030 | Ga0207652_10299749 | |||
| 2031 | Ga0207646_10045253 | |||
| 2032 | Ga0207646_10054214 | |||
| 2033 | Ga0207681_10028871 | |||
| 2034 | Ga0207681_10178304 | |||
| 2035 | Ga0207694_10000892 | |||
| 2036 | Ga0207694_10025695 | |||
| 2037 | Ga0207694_10053670 | |||
| 2038 | Ga0207694_10135566 | |||
| 2039 | Ga0207694_10189339 | |||
| 2040 | Ga0207694_10306341 | |||
| 2041 | Ga0207650_10008943 | |||
| 2042 | Ga0207650_10013039 | |||
| 2043 | Ga0207659_10000312 | |||
| 2044 | Ga0207659_10379040 | |||
| 2045 | Ga0207659_10875022 | |||
| 2046 | Ga0207687_10020028 | |||
| 2047 | Ga0207700_10012386 | |||
| 2048 | Ga0207700_10118923 | |||
| 2049 | Ga0207664_10009316 | |||
| 2050 | Ga0207644_10000437 | |||
| 2051 | Ga0207690_10003250 | |||
| 2052 | Ga0207690_10027464 | |||
| 2053 | Ga0207690_10266177 | |||
| 2054 | Ga0207690_10308267 | |||
| 2055 | Ga0207690_10346723 | |||
| 2056 | Ga0207690_10367811 | |||
| 2057 | Ga0207706_10021959 | |||
| 2058 | Ga0207706_10077498 | |||
| 2059 | Ga0207706_10144285 | |||
| 2060 | Ga0207706_10255393 | |||
| 2061 | Ga0207686_10200975 | |||
| 2062 | Ga0207709_10019410 | |||
| 2063 | Ga0207709_10073088 | |||
| 2064 | Ga0207709_10086867 | |||
| 2065 | Ga0207670_10005757 | |||
| 2066 | Ga0207669_10002447 | |||
| 2067 | Ga0207669_10125155 | |||
| 2068 | Ga0207669_10230185 | |||
| 2069 | Ga0207704_10048448 | |||
| 2070 | Ga0207704_10409649 | |||
| 2071 | Ga0207665_10041537 | |||
| 2072 | Ga0207691_10006654 | |||
| 2073 | Ga0207691_10011341 | |||
| 2074 | Ga0207691_10059505 | |||
| 2075 | Ga0207711_10001682 | |||
| 2076 | Ga0207711_10167602 | |||
| 2077 | Ga0207711_10416745 | |||
| 2078 | Ga0207711_10743858 | |||
| 2079 | Ga0207689_10008999 | |||
| 2080 | Ga0207689_10015618 | |||
| 2081 | Ga0207689_10035478 | |||
| 2082 | Ga0207689_10043834 | |||
| 2083 | Ga0207689_10076344 | |||
| 2084 | Ga0207689_10132622 | |||
| 2085 | Ga0207689_10145775 | |||
| 2086 | Ga0207679_10010631 | |||
| 2087 | Ga0207679_10089918 | |||
| 2088 | Ga0207679_10264748 | |||
| 2089 | Ga0207667_10000370 | |||
| 2090 | Ga0207667_10001781 | |||
| 2091 | Ga0207667_10002286 | |||
| 2092 | Ga0207667_10005671 | |||
| 2093 | Ga0207667_10009062 | |||
| 2094 | Ga0207667_10027546 | |||
| 2095 | Ga0207667_10030004 | |||
| 2096 | Ga0207667_10071942 | |||
| 2097 | Ga0207667_10074524 | |||
| 2098 | Ga0207667_10303399 | |||
| 2099 | Ga0207651_10006315 | |||
| 2100 | Ga0207651_10007614 | |||
| 2101 | Ga0207651_10011224 | |||
| 2102 | Ga0207651_10012811 | |||
| 2103 | Ga0207651_10047413 | |||
| 2104 | Ga0207651_10186258 | |||
| 2105 | Ga0207712_10024503 | |||
| 2106 | Ga0207712_10208932 | |||
| 2107 | Ga0207668_10039675 | |||
| 2108 | Ga0207668_10281653 | |||
| 2109 | Ga0207640_10006668 | |||
| 2110 | Ga0207640_10013622 | |||
| 2111 | Ga0207640_10060137 | |||
| 2112 | Ga0207658_10001772 | |||
| 2113 | Ga0207658_10016258 | |||
| 2114 | Ga0207677_10001268 | |||
| 2115 | Ga0207677_10005627 | |||
| 2116 | Ga0207677_10131393 | |||
| 2117 | Ga0207677_10209806 | |||
| 2118 | Ga0207677_10670337 | |||
| 2119 | Ga0207703_10001047 | |||
| 2120 | Ga0207703_10004544 | |||
| 2121 | Ga0207703_10035999 | |||
| 2122 | Ga0207703_10038715 | |||
| 2123 | Ga0207678_10000518 | |||
| 2124 | Ga0207678_10229270 | |||
| 2125 | Ga0207678_10296308 | |||
| 2126 | Ga0207678_10296668 | |||
| 2127 | Ga0207678_10303302 | |||
| 2128 | Ga0207708_10097433 | |||
| 2129 | Ga0207708_10320011 | |||
| 2130 | Ga0207702_10000784 | |||
| 2131 | Ga0207702_10000946 | |||
| 2132 | Ga0207702_10001288 | |||
| 2133 | Ga0207702_10005752 | |||
| 2134 | Ga0207702_10023362 | |||
| 2135 | Ga0207702_10108476 | |||
| 2136 | Ga0207702_10352820 | |||
| 2137 | Ga0207641_10023176 | |||
| 2138 | Ga0207641_10024355 | |||
| 2139 | Ga0207648_10002110 | |||
| 2140 | Ga0207648_10016441 | |||
| 2141 | Ga0207648_10231620 | |||
| 2142 | Ga0207648_10411927 | |||
| 2143 | Ga0207648_10474701 | |||
| 2144 | Ga0207648_10516774 | |||
| 2145 | Ga0207676_10000733 | |||
| 2146 | Ga0207676_10004725 | |||
| 2147 | Ga0207676_10178795 | |||
| 2148 | Ga0207676_10197867 | |||
| 2149 | Ga0207674_10000190 | |||
| 2150 | Ga0207674_10089845 | |||
| 2151 | Ga0207674_10139968 | |||
| 2152 | Ga0207675_100017183 | |||
| 2153 | Ga0207675_100035659 | |||
| 2154 | Ga0207675_100042815 | |||
| 2155 | Ga0207675_100128862 | |||
| 2156 | Ga0207675_100144539 | |||
| 2157 | Ga0207675_100152575 | |||
| 2158 | Ga0207675_100274431 | |||
| 2159 | Ga0207683_10001702 | |||
| 2160 | Ga0207683_10008866 | |||
| 2161 | Ga0207683_10016550 | |||
| 2162 | Ga0207698_10052496 | |||
| 2163 | Ga0207698_10056614 | |||
| 2164 | Ga0207698_10224609 | |||
| 2165 | Ga0207698_10292366 | |||
| 2166 | Ga0207698_10319372 | |||
| 2167 | Ga0207698_10599437 | |||
| 2168 | Ga0207428_10000671 | |||
| 2169 | Ga0265354_1000050 | |||
| 2170 | Ga0265354_1000584 | |||
| 2171 | Ga0268266_10050403 | |||
| 2172 | Ga0268266_10079015 | |||
| 2173 | Ga0268266_10085387 | |||
| 2174 | Ga0268266_10395256 | |||
| 2175 | Ga0268264_10012037 | |||
| 2176 | Ga0268264_10037455 | |||
| 2177 | Ga0268264_10159632 | |||
| 2178 | Ga0268264_10203070 | |||
| 2179 | Ga0268264_10287927 | |||
| 2180 | Ga0265336_10000006 | |||
| 2181 | Ga0265336_10000039 | |||
| 2182 | Ga0307517_10164321 | |||
| 2183 | Ga0307515_10000110 | |||
| 2184 | Ga0307515_10000366 | |||
| 2185 | Ga0307515_10001235 | |||
| 2186 | Ga0307515_10002229 | |||
| 2187 | Ga0307515_10034594 | |||
| 2188 | Ga0265338_10207480 | |||
| 2189 | Ga0265324_10000223 | |||
| 2190 | Ga0265324_10001026 | |||
| 2191 | Ga0307511_10056167 | |||
| 2192 | Ga0307512_10032623 | |||
| 2193 | Ga0307512_10114714 | |||
| 2194 | Ga0265770_1004651 | |||
| 2195 | Ga0265760_10006171 | |||
| 2196 | Ga0265760_10007108 | |||
| 2197 | Ga0265327_10009479 | |||
| 2198 | Ga0307513_10011456 | |||
| 2199 | Ga0307513_10059527 | |||
| 2200 | Ga0307513_10154193 | |||
| 2201 | Ga0307509_10114290 | |||
| 2202 | Ga0307408_100000006 | |||
| 2203 | Ga0307408_100000140 | |||
| 2204 | Ga0307408_100015385 | |||
| 2205 | Ga0307408_100025904 | |||
| 2206 | Ga0307508_10000107 | |||
| 2207 | Ga0307514_10006915 | |||
| 2208 | Ga0307516_10002030 | |||
| 2209 | Ga0307516_10007929 | |||
| 2210 | Ga0307516_10029384 | |||
| 2211 | Ga0307405_10590910 | |||
| 2212 | Ga0307413_10202109 | |||
| 2213 | Ga0307413_10223023 | |||
| 2214 | Ga0307410_10057607 | |||
| 2215 | Ga0307410_10640037 | |||
| 2216 | Ga0307406_10025118 | |||
| 2217 | Ga0307407_10232004 | |||
| 2218 | Ga0307412_10003387 | |||
| 2219 | Ga0307416_100061701 | |||
| 2220 | Ga0307416_100242343 | |||
| 2221 | Ga0307416_101043823 | |||
| 2222 | Ga0307416_101147549 | |||
| 2223 | Ga0307414_10016384 | |||
| 2224 | Ga0307411_10028697 | |||
| 2225 | Ga0307411_10093375 | |||
| 2226 | Ga0307411_10682166 | |||
| 2227 | Ga0316212_1000963 | |||
| 2228 | Ga0373948_0002839 | |||
| 2229 | Ga0373950_0007074 | |||
| 2230 | Ga0373926_0055970 | |||
| 2231 | Ga0373934_0067146 | |||
| 2232 | Ga0373940_0010445 | |||
| 2233 | Ga0373940_0097231 | |||
| 2234 | Ga0373949_0027316 | |||
| 2235 | Ga0373951_0001888 | |||
| 2236 | Ga0373923_0114125 | |||
| 2237 | Ga0373939_0000224 | |||
| 2238 | Ga0373939_0000948 | |||
| 2239 | Ga0373939_0097919 | |||
| 2240 | Ga0373954_0006248 | |||
| 2241 | Ga0373954_0049581 | |||
| 2242 | Ga0373960_0001470 | |||
| 2243 | Ga0373946_0025368 | |||
| 2244 | Ga0373961_0015507 | |||
| 2245 | Ga0373962_0007884 | |||
| 2246 | Ga0373931_0000233 | |||
| 2247 | Ga0373931_0000962 | |||
| 2248 | Ga0373931_0007872 | |||
| 2249 | Ga0373931_0143600 | |||
| 2250 | Ga0373937_0223295 | |||
| 2251 | Ga0373925_0050089 | |||
| 2252 | Ga0373925_0436537 | |||
| 2253 | Ga0395899_0002978 | |||
| 2254 | Ga0395899_0017472 | |||
| 2255 | Ga0395899_0030197 | |||
| 2256 | Ga0395899_0034829 | |||
| 2257 | Ga0395899_0070045 | |||
| 2258 | Ga0395899_0173363 | |||
| 2259 | Ga0395900_0001085 | |||
| 2260 | Ga0395900_0001906 | |||
| 2261 | Ga0395900_0004368 | |||
| 2262 | Ga0395900_0131598 | |||
| 2263 | Ga0395900_0453057 | |||
| 2264 | Ga0395898_0043556 | |||
| 2265 | Ga0395898_0093100 | |||
| 2266 | Ga0395898_0207317 | |||
| 2267 | Ga0395905_0004973 | |||
| 2268 | Ga0395905_0012391 | |||
| 2269 | Ga0395905_0072079 | |||
| 2270 | Ga0395905_0254715 | |||
| 2271 | Ga0395905_0256136 | |||
| 2272 | Ga0436364_0905352 | |||
| 2273 | Ga0395901_0000307 | |||
| 2274 | Ga0395901_0002559 | |||
| 2275 | Ga0395901_0024867 | |||
| 2276 | Ga0395901_0048856 | |||
| 2277 | Ga0395901_0068069 | |||
| 2278 | Ga0395901_0204556 | |||
| 2279 | Ga0436365_1684313 | |||
| 2280 | Ga0436360_1344729 | |||
| 2281 | Ga0436361_0496436 | |||
| 2282 | Ga0436361_0563588 | |||
| 2283 | Ga0436361_0590082 | |||
| 2284 | Ga0436361_0761139 | |||
| 2285 | Ga0436361_1046788 | |||
| 2286 | Ga0451789_1345118 | |||
| 2287 | Ga0451791_1290972 | |||
| 2288 | Ga0451793_0226805 | |||
| 2289 | Ga0451798_0925854 | |||
| 2290 | Ga0451802_1287762 | |||
| 2291 | Ga0451802_1902642 | |||
| 2292 | Ga0451835_0321985 | |||
| 2293 | Ga0451853_2760822 | |||
| 2294 | Ga0439433_0005973 | |||
| 2295 | Ga0439437_005601 | |||
| 2296 | Ga0439448_0001451 | |||
| 2297 | Ga0439450_003588 | |||
| 2298 | Ga0439450_005798 | |||
| 2299 | Ga0439455_0038359 | |||
| 2300 | Ga0450917_000304 | |||
| 2301 | Ga0450888_002355 | |||
| 2302 | Ga0450891_004129 | |||
| 2303 | Ga0450904_000113 | |||
| 2304 | Ga0450889_001126 | |||
| 2305 | Ga0439458_0026560 | |||
| 2306 | Ga0450893_0005547 | |||
| 2307 | Ga0451577_0000490 | |||
| 2308 | Ga0451577_0566685 | |||
| 2309 | Ga0466969_0014737 | |||
| 2310 | Ga0466969_0077563 | |||
| 2311 | Ga0466972_0000072 | |||
| 2312 | Ga0466972_0001011 | |||
| 2313 | Ga0466972_0004705 | |||
| 2314 | Ga0466972_0207014 | |||
| 2315 | Ga0466965_0008989 | |||
| 2316 | Ga0466965_0013679 | |||
| 2317 | Ga0466965_0019358 | |||
| 2318 | Ga0466965_0030015 | |||
| 2319 | Ga0466965_0032473 | |||
| 2320 | Ga0466965_0040704 | |||
| 2321 | Ga0466965_0048656 | |||
| 2322 | Ga0466965_0189450 | |||
| 2323 | Ga0466966_0003363 | |||
| 2324 | Ga0466966_0046947 | |||
| 2325 | Ga0466966_0052122 | |||
| 2326 | Ga0466966_0226791 | |||
| 2327 | Ga0466966_0238108 | |||
| 2328 | Ga0466961_0087980 | |||
| 2329 | Ga0466961_0117057 | |||
| 2330 | Ga0466961_0173510 | |||
| 2331 | Ga0466961_0216712 | |||
| 2332 | Ga0466963_0107422 | |||
| 2333 | Ga0466963_0230397 | |||
| 2334 | Ga0466964_0000097 | |||
| 2335 | Ga0466964_0054675 | |||
| 2336 | Ga0466964_0065072 | |||
| 2337 | Ga0453684_0000987 | |||
| 2338 | Ga0453684_0150183 | |||
| 2339 | Ga0466971_0045915 | |||
| 2340 | Ga0466971_0066728 | |||
| 2341 | Ga0466968_0000838 | |||
| 2342 | Ga0466968_0001188 | |||
| 2343 | Ga0466968_0010885 | |||
| 2344 | Ga0466968_0090969 | |||
| 2345 | Ga0466970_0074529 | |||
| 2346 | Ga0466957_0000827 | |||
| 2347 | Ga0466957_0029322 | |||
| 2348 | Ga0466957_0072676 | |||
| 2349 | Ga0466959_0003718 | |||
| 2350 | Ga0466959_0014520 | |||
| 2351 | Ga0466959_0056501 | |||
| 2352 | Ga0466959_0107555 | |||
| 2353 | Ga0466959_0140310 | |||
| 2354 | Ga0466959_0162107 | |||
| 2355 | Ga0466959_0230992 | |||
| 2356 | Ga0451576_0158030 | |||
| 2357 | Ga0451576_0221078 | |||
| 2358 | Ga0466958_0010194 | |||
| 2359 | Ga0466958_0030402 | |||
| 2360 | Ga0466958_0063890 | |||
| 2361 | Ga0466958_0077484 | |||
| 2362 | Ga0466958_0414759 | |||
| 2363 | Ga0466967_0024676 | |||
| 2364 | Ga0466967_0030592 | |||
| 2365 | Ga0466967_0052296 | |||
| 2366 | Ga0466967_0127800 | |||
| 2367 | Ga0466967_0140326 | |||
| 2368 | Ga0466967_0149306 | |||
| 2369 | Ga0495617_000125 | |||
| 2370 | Ga0495617_011782 | |||
| 2371 | Ga0495627_000325 | |||
| 2372 | Ga0495627_007288 | |||
| 2373 | Ga0495627_011815 | |||
| 2374 | Ga0495590_0000166 | |||
| 2375 | Ga0495590_0002849 | |||
| 2376 | Ga0495590_0006344 | |||
| 2377 | Ga0495591_000149 | |||
| 2378 | Ga0495629_0006820 | |||
| 2379 | Ga0495629_0038992 | |||
| 2380 | Ga0495638_0005648 | |||
| 2381 | Ga0495638_0084022 | |||
| 2382 | Ga0495651_0139605 | |||
| 2383 | Ga0495653_0002884 | |||
| 2384 | Ga0495653_0009399 | |||
| 2385 | Ga0495653_0021151 | |||
| 2386 | Ga0495653_0026777 | |||
| 2387 | Ga0495653_0154429 | |||
| 2388 | Ga0495650_0001100 | |||
| 2389 | Ga0495650_0037741 | |||
| 2390 | Ga0495650_0048197 | |||
| 2391 | Ga0495580_0025056 | |||
| 2392 | Ga0495580_0027291 | |||
| 2393 | Ga0495580_0035556 | |||
| 2394 | Ga0495580_0375186 | |||
| 2395 | Ga0495582_0000662 | |||
| 2396 | Ga0495582_0009678 | |||
| 2397 | Ga0495605_0000725 | |||
| 2398 | Ga0495605_0000845 | |||
| 2399 | Ga0495605_0007379 | |||
| 2400 | Ga0495605_0019429 | |||
| 2401 | Ga0495605_0029687 | |||
| 2402 | Ga0495605_0029689 | |||
| 2403 | Ga0495605_0050785 | |||
| 2404 | Ga0495605_0059238 | |||
| 2405 | Ga0495605_0104487 | |||
| 2406 | Ga0495605_0107446 | |||
| 2407 | Ga0495639_0081874 | |||
| 2408 | Ga0495584_0000417 | |||
| 2409 | Ga0495584_0000820 | |||
| 2410 | Ga0495584_0002513 | |||
| 2411 | Ga0495584_0004515 | |||
| 2412 | Ga0495584_0018617 | |||
| 2413 | Ga0495584_0019660 | |||
| 2414 | Ga0495584_0027008 | |||
| 2415 | Ga0495584_0033942 | |||
| 2416 | Ga0495584_0037339 | |||
| 2417 | Ga0495584_0089264 | |||
| 2418 | Ga0495584_0129974 | |||
| 2419 | Ga0495584_0195744 | |||
| 2420 | Ga0495585_0002621 | |||
| 2421 | Ga0495585_0004000 | |||
| 2422 | Ga0495585_0004922 | |||
| 2423 | Ga0495585_0007278 | |||
| 2424 | Ga0495585_0009447 | |||
| 2425 | Ga0495585_0012348 | |||
| 2426 | Ga0495585_0015200 | |||
| 2427 | Ga0495585_0015519 | |||
| 2428 | Ga0495585_0016706 | |||
| 2429 | Ga0495585_0017877 | |||
| 2430 | Ga0495585_0029378 | |||
| 2431 | Ga0495585_0038815 | |||
| 2432 | Ga0495585_0043551 | |||
| 2433 | Ga0495585_0259460 | |||
| 2434 | Ga0495594_0006433 | |||
| 2435 | Ga0495594_0008151 | |||
| 2436 | Ga0495594_0027401 | |||
| 2437 | Ga0495594_0051421 | |||
| 2438 | Ga0495594_0053067 | |||
| 2439 | Ga0495594_0117610 | |||
| 2440 | Ga0495594_0133179 | |||
| 2441 | Ga0495596_0000442 | |||
| 2442 | Ga0495596_0000863 | |||
| 2443 | Ga0495596_0002569 | |||
| 2444 | Ga0495596_0005420 | |||
| 2445 | Ga0495596_0005727 | |||
| 2446 | Ga0495596_0006378 | |||
| 2447 | Ga0495596_0006897 | |||
| 2448 | Ga0495596_0014671 | |||
| 2449 | Ga0495596_0016650 | |||
| 2450 | Ga0495596_0019749 | |||
| 2451 | Ga0495596_0031922 | |||
| 2452 | Ga0495596_0046697 | |||
| 2453 | Ga0495596_0082920 | |||
| 2454 | Ga0495607_0001392 | |||
| 2455 | Ga0495607_0001408 | |||
| 2456 | Ga0495607_0002063 | |||
| 2457 | Ga0495607_0005724 | |||
| 2458 | Ga0495607_0018695 | |||
| 2459 | Ga0495607_0027250 | |||
| 2460 | Ga0495607_0027417 | |||
| 2461 | Ga0495607_0035999 | |||
| 2462 | Ga0495607_0072115 | |||
| 2463 | Ga0495607_0092582 | |||
| 2464 | Ga0495583_0000144 | |||
| 2465 | Ga0495583_0000200 | |||
| 2466 | Ga0495583_0000217 | |||
| 2467 | Ga0495583_0001216 | |||
| 2468 | Ga0495583_0002127 | |||
| 2469 | Ga0495583_0002154 | |||
| 2470 | Ga0495583_0002410 | |||
| 2471 | Ga0495583_0003295 | |||
| 2472 | Ga0495583_0004038 | |||
| 2473 | Ga0495583_0009165 | |||
| 2474 | Ga0495583_0016673 | |||
| 2475 | Ga0495583_0019228 | |||
| 2476 | Ga0495583_0023216 | |||
| 2477 | Ga0495583_0100455 | |||
| 2478 | Ga0495606_0005844 | |||
| 2479 | Ga0495606_0011722 | |||
| 2480 | Ga0495606_0036866 | |||
| 2481 | Ga0495606_0037150 | |||
| 2482 | Ga0495606_0041518 | |||
| 2483 | Ga0495606_0044217 | |||
| 2484 | Ga0495606_0098994 | |||
| 2485 | Ga0495606_0210819 | |||
| 2486 | Ga0495608_0182076 | |||
| 2487 | Ga0495610_0000876 | |||
| 2488 | Ga0495610_0011457 | |||
| 2489 | Ga0495610_0110177 | |||
| 2490 | Ga0495616_0000126 | |||
| 2491 | Ga0495616_0000227 | |||
| 2492 | Ga0495616_0000786 | |||
| 2493 | Ga0495616_0010067 | |||
| 2494 | Ga0495616_0011469 | |||
| 2495 | Ga0495616_0015340 | |||
| 2496 | Ga0495616_0016359 | |||
| 2497 | Ga0495616_0026462 | |||
| 2498 | Ga0495616_0026491 | |||
| 2499 | Ga0495616_0030858 | |||
| 2500 | Ga0495616_0080904 | |||
| 2501 | Ga0495616_0082045 | |||
| 2502 | Ga0495616_0103351 | |||
| 2503 | Ga0495616_0107351 | |||
| 2504 | Ga0495616_0162821 | |||
| 2505 | Ga0495616_0286784 | |||
| 2506 | Ga0495620_0031194 | |||
| 2507 | Ga0495630_0012504 | |||
| 2508 | Ga0495630_0021661 | |||
| 2509 | Ga0495630_0040007 | |||
| 2510 | Ga0495630_0190703 | |||
| 2511 | Ga0495631_0000342 | |||
| 2512 | Ga0495631_0000501 | |||
| 2513 | Ga0495631_0001168 | |||
| 2514 | Ga0495631_0002960 | |||
| 2515 | Ga0495631_0003047 | |||
| 2516 | Ga0495631_0005084 | |||
| 2517 | Ga0495631_0007296 | |||
| 2518 | Ga0495631_0010064 | |||
| 2519 | Ga0495631_0011340 | |||
| 2520 | Ga0495631_0030184 | |||
| 2521 | Ga0495631_0126919 | |||
| 2522 | Ga0495632_0000195 | |||
| 2523 | Ga0495632_0000391 | |||
| 2524 | Ga0495632_0000757 | |||
| 2525 | Ga0495632_0001773 | |||
| 2526 | Ga0495632_0007690 | |||
| 2527 | Ga0495632_0008015 | |||
| 2528 | Ga0495632_0009140 | |||
| 2529 | Ga0495632_0021495 | |||
| 2530 | Ga0495632_0120328 | |||
| 2531 | Ga0495632_0131815 | |||
| 2532 | Ga0495637_0000014 | |||
| 2533 | Ga0495637_0003657 | |||
| 2534 | Ga0495643_0000171 | |||
| 2535 | Ga0495643_0001865 | |||
| 2536 | Ga0495643_0003366 | |||
| 2537 | Ga0495643_0004555 | |||
| 2538 | Ga0495643_0017614 | |||
| 2539 | Ga0495643_0021828 | |||
| 2540 | Ga0495643_0058358 | |||
| 2541 | Ga0495643_0061391 | |||
| 2542 | Ga0495643_0077063 | |||
| 2543 | Ga0495644_0002262 | |||
| 2544 | Ga0495644_0004151 | |||
| 2545 | Ga0495644_0007576 | |||
| 2546 | Ga0495644_0007682 | |||
| 2547 | Ga0495644_0009852 | |||
| 2548 | Ga0495644_0031758 | |||
| 2549 | Ga0495648_0000612 | |||
| 2550 | Ga0495648_0004164 | |||
| 2551 | Ga0495648_0007541 | |||
| 2552 | Ga0495648_0009116 | |||
| 2553 | Ga0495648_0011285 | |||
| 2554 | Ga0495648_0014828 | |||
| 2555 | Ga0495648_0015940 | |||
| 2556 | Ga0495648_0083205 | |||
| 2557 | Ga0495648_0190341 | |||
| 2558 | Ga0495663_0004646 | |||
| 2559 | Ga0495663_0006091 | |||
| 2560 | Ga0495666_0003941 | |||
| 2561 | Ga0495666_0036806 | |||
| 2562 | Ga0495642_0000515 | |||
| 2563 | Ga0495642_0000729 | |||
| 2564 | Ga0495642_0001661 | |||
| 2565 | Ga0495642_0005838 | |||
| 2566 | Ga0495642_0007429 | |||
| 2567 | Ga0495642_0008099 | |||
| 2568 | Ga0495642_0010769 | |||
| 2569 | Ga0495642_0011184 | |||
| 2570 | Ga0495642_0013639 | |||
| 2571 | Ga0495642_0025739 | |||
| 2572 | Ga0495642_0056465 | |||
| 2573 | Ga0495642_0058961 | |||
| 2574 | Ga0495652_0033257 | |||
| 2575 | Ga0495652_0037308 | |||
| 2576 | Ga0495652_0434559 | |||
| 2577 | Ga0495654_0005529 | |||
| 2578 | Ga0495654_0008911 | |||
| 2579 | Ga0495654_0008988 | |||
| 2580 | Ga0495654_0069302 | |||
| 2581 | Ga0495665_0002306 | |||
| 2582 | Ga0495665_0002338 | |||
| 2583 | Ga0495665_0044871 | |||
| 2584 | Ga0495665_0178365 | |||
| 2585 | Ga0495586_0013981 | |||
| 2586 | Ga0495586_0028693 | |||
| 2587 | Ga0495586_0114694 | |||
| 2588 | Ga0495587_0011337 | |||
| 2589 | Ga0495587_0015833 | |||
| 2590 | Ga0495587_0108545 | |||
| 2591 | Ga0495598_0031523 | |||
| 2592 | Ga0495609_0000028 | |||
| 2593 | Ga0495609_0001293 | |||
| 2594 | Ga0495609_0011460 | |||
| 2595 | Ga0495609_0012174 | |||
| 2596 | Ga0495609_0014596 | |||
| 2597 | Ga0495609_0030033 | |||
| 2598 | Ga0495609_0037371 | |||
| 2599 | Ga0495597_0000793 | |||
| 2600 | Ga0495597_0004145 | |||
| 2601 | Ga0495597_0006507 | |||
| 2602 | Ga0495597_0020247 | |||
| 2603 | Ga0495597_0024241 | |||
| 2604 | Ga0495597_0042303 | |||
| 2605 | Ga0495597_0058665 | |||
| 2606 | Ga0495597_0150141 | |||
| 2607 | Ga0495645_0020763 | |||
| 2608 | Ga0495622_0006298 | |||
| 2609 | Ga0495622_0006406 | |||
| 2610 | Ga0495622_0108744 | |||
| 2611 | Ga0495633_0001203 | |||
| 2612 | Ga0495633_0004585 | |||
| 2613 | Ga0495633_0009782 | |||
| 2614 | Ga0495633_0021899 | |||
| 2615 | Ga0495633_0066402 | |||
| 2616 | Ga0495633_0086147 | |||
| 2617 | Ga0495633_0117129 | |||
| 2618 | Ga0495656_0001345 | |||
| 2619 | Ga0495656_0010316 | |||
| 2620 | Ga0495668_0000318 | |||
| 2621 | Ga0495668_0003076 | |||
| 2622 | Ga0495668_0004892 | |||
| 2623 | Ga0495668_0014737 | |||
| 2624 | Ga0495668_0018328 | |||
| 2625 | Ga0495668_0022609 | |||
| 2626 | Ga0495668_0029648 | |||
| 2627 | Ga0495668_0031522 | |||
| 2628 | Ga0495668_0033852 | |||
| 2629 | Ga0495668_0036134 | |||
| 2630 | Ga0495668_0059992 | |||
| 2631 | Ga0495668_0094581 | |||
| 2632 | Ga0495668_0111172 | |||
| 2633 | Ga0495668_0122367 | |||
| 2634 | Ga0495668_0145154 | |||
| 2635 | Ga0495634_0011085 | |||
| 2636 | Ga0495634_0148362 | |||
| 2637 | Ga0495611_0001329 | |||
| 2638 | Ga0495611_0002853 | |||
| 2639 | Ga0495611_0009912 | |||
| 2640 | Ga0495611_0011261 | |||
| 2641 | Ga0495611_0012978 | |||
| 2642 | Ga0495611_0023156 | |||
| 2643 | Ga0495625_0001217 | |||
| 2644 | Ga0495625_0006720 | |||
| 2645 | Ga0495625_0013252 | |||
| 2646 | Ga0495625_0033624 | |||
| 2647 | Ga0495625_0048308 | |||
| 2648 | Ga0495625_0050976 | |||
| 2649 | Ga0495625_0090934 | |||
| 2650 | Ga0495659_0004919 | |||
| 2651 | Ga0495661_0000682 | |||
| 2652 | Ga0495661_0000805 | |||
| 2653 | Ga0495661_0001495 | |||
| 2654 | Ga0495661_0001512 | |||
| 2655 | Ga0495661_0002426 | |||
| 2656 | Ga0495661_0003500 | |||
| 2657 | Ga0495661_0004095 | |||
| 2658 | Ga0495661_0008507 | |||
| 2659 | Ga0495661_0016379 | |||
| 2660 | Ga0495661_0031851 | |||
| 2661 | Ga0495661_0035128 | |||
| 2662 | Ga0495661_0039001 | |||
| 2663 | Ga0495661_0048803 | |||
| 2664 | Ga0495661_0064418 | |||
| 2665 | Ga0495661_0091666 | |||
| 2666 | Ga0495661_0129034 | |||
| 2667 | Ga0495588_0000259 | |||
| 2668 | Ga0495588_0005996 | |||
| 2669 | Ga0495588_0010296 | |||
| 2670 | Ga0495588_0013104 | |||
| 2671 | Ga0495588_0042649 | |||
| 2672 | Ga0495588_0060609 | |||
| 2673 | Ga0495588_0088846 | |||
| 2674 | Ga0495588_0158297 | |||
| 2675 | Ga0495588_0161904 | |||
| 2676 | Ga0495623_0029342 | |||
| 2677 | Ga0495623_0047536 | |||
| 2678 | Ga0495623_0160914 | |||
| 2679 | Ga0495658_0095535 | |||
| 2680 | Ga0495669_0000328 | |||
| 2681 | Ga0495669_0004475 | |||
| 2682 | Ga0495669_0006151 | |||
| 2683 | Ga0495669_0006817 | |||
| 2684 | Ga0495669_0007018 | |||
| 2685 | Ga0495669_0007342 | |||
| 2686 | Ga0495669_0008646 | |||
| 2687 | Ga0495669_0013315 | |||
| 2688 | Ga0495669_0092966 | |||
| 2689 | Ga0495613_0340180 | |||
| 2690 | Ga0495624_0050037 | |||
| 2691 | Ga0495670_0001980 | |||
| 2692 | Ga0495670_0014690 | |||
| 2693 | Ga0495670_0017210 | |||
| 2694 | Ga0495670_0049330 | |||
| 2695 | Ga0495670_0089365 | |||
| 2696 | Ga0495670_0099077 | |||
| 2697 | Ga0495670_0119812 | |||
| 2698 | Ga0495671_0001884 | |||
| 2699 | Ga0495671_0005590 | |||
| 2700 | Ga0495671_0008602 | |||
| 2701 | Ga0495671_0010066 | |||
| 2702 | Ga0495671_0013583 | |||
| 2703 | Ga0495671_0099882 | |||
| 2704 | Ga0495671_0165840 | |||
| 2705 | Ga0495649_0000068 | |||
| 2706 | Ga0495649_0000595 | |||
| 2707 | Ga0495649_0000911 | |||
| 2708 | Ga0495649_0002466 | |||
| 2709 | Ga0495649_0019571 | |||
| 2710 | Ga0495649_0039794 | |||
| 2711 | Ga0495649_0118817 | |||
| 2712 | Ga0495589_0000309 | |||
| 2713 | Ga0495589_0000407 | |||
| 2714 | Ga0495589_0000903 | |||
| 2715 | Ga0495589_0001297 | |||
| 2716 | Ga0495589_0013553 | |||
| 2717 | Ga0495589_0016551 | |||
| 2718 | Ga0495589_0018426 | |||
| 2719 | Ga0495589_0025560 | |||
| 2720 | Ga0495589_0029994 | |||
| 2721 | Ga0495589_0136047 | |||
| 2722 | Ga0495600_0122737 | |||
| 2723 | Ga0495600_0296556 | |||
| 2724 | Ga0495660_0000734 | |||
| 2725 | Ga0495660_0005935 | |||
| 2726 | Ga0495660_0006198 | |||
| 2727 | Ga0495660_0009695 | |||
| 2728 | Ga0495660_0016643 | |||
| 2729 | Ga0495660_0039188 | |||
| 2730 | Ga0495660_0059921 | |||
| 2731 | Ga0495581_0004794 | |||
| 2732 | Ga0495581_0005818 | |||
| 2733 | Ga0495581_0067179 | |||
| 2734 | Ga0495581_0090651 | |||
| 2735 | Ga0495581_0179417 | |||
| 2736 | Ga0495604_0014594 | |||
| 2737 | Ga0495604_0027123 | |||
| 2738 | Ga0495604_0083696 | |||
| 2739 | Ga0495604_0091241 | |||
| 2740 | Ga0495636_0004008 | |||
| 2741 | Ga0495636_0049277 | |||
| 2742 | Ga0495636_0103562 | |||
| 2743 | Ga0495674_0003295 | |||
| 2744 | Ga0495674_0146882 | |||
| 2745 | Ga0495672_0000140 | |||
| 2746 | Ga0495672_0000777 | |||
| 2747 | Ga0495672_0000865 | |||
| 2748 | Ga0495672_0001198 | |||
| 2749 | Ga0495672_0013872 | |||
| 2750 | Ga0495676_0000100 | |||
| 2751 | Ga0495676_0000639 | |||
| 2752 | Ga0495680_0014119 | |||
| 2753 | Ga0495680_0022854 | |||
| 2754 | Ga0495680_0066489 | |||
| 2755 | Ga0495683_0000499 | |||
| 2756 | Ga0495683_0001842 | |||
| 2757 | Ga0495683_0006464 | |||
| 2758 | Ga0495683_0011901 | |||
| 2759 | Ga0495683_0012472 | |||
| 2760 | Ga0495683_0040118 | |||
| 2761 | Ga0495683_0066186 | |||
| 2762 | Ga0495683_0180288 | |||
| 2763 | Ga0495687_000253 | |||
| 2764 | Ga0495687_000288 | |||
| 2765 | Ga0495687_000656 | |||
| 2766 | Ga0495687_000829 | |||
| 2767 | Ga0495687_000866 | |||
| 2768 | Ga0495687_002113 | |||
| 2769 | Ga0495675_0008125 | |||
| 2770 | Ga0495675_0052895 | |||
| 2771 | Ga0495675_0063701 | |||
| 2772 | Ga0495677_0000143 | |||
| 2773 | Ga0495677_0000257 | |||
| 2774 | Ga0495677_0000770 | |||
| 2775 | Ga0495677_0001181 | |||
| 2776 | Ga0495677_0003090 | |||
| 2777 | Ga0495677_0003795 | |||
| 2778 | Ga0495677_0009163 | |||
| 2779 | Ga0495677_0009263 | |||
| 2780 | Ga0495677_0014086 | |||
| 2781 | Ga0495677_0014771 | |||
| 2782 | Ga0495677_0030368 | |||
| 2783 | Ga0495679_005544 | |||
| 2784 | Ga0495679_006181 | |||
| 2785 | Ga0495685_004973 | |||
| 2786 | Ga0495685_012637 | |||
| 2787 | Ga0495685_016362 | |||
| 2788 | Ga0495681_0000511 | |||
| 2789 | Ga0495681_0004519 | |||
| 2790 | Ga0495681_0007323 | |||
| 2791 | Ga0495681_0007880 | |||
| 2792 | Ga0495681_0011042 | |||
| 2793 | Ga0495681_0014050 | |||
| 2794 | Ga0495681_0021427 | |||
| 2795 | Ga0495681_0132894 | |||
| 2796 | Ga0495686_0000285 | |||
| 2797 | Ga0495686_0002310 | |||
| 2798 | Ga0495686_0006705 | |||
| 2799 | Ga0495686_0027657 | |||
| 2800 | Ga0495686_0045808 | |||
| 2801 | Ga0495686_0062322 | |||
| 2802 | Ga0495686_0095539 | |||
| 2803 | Ga0495593_0019690 | |||
| 2804 | Ga0495593_0059720 | |||
| 2805 | Ga0495602_0001988 | |||
| 2806 | Ga0495614_0022782 | |||
| 2807 | Ga0495614_0023201 | |||
| 2808 | Ga0495626_0000292 | |||
| 2809 | Ga0495626_0000613 | |||
| 2810 | Ga0495626_0001135 | |||
| 2811 | Ga0495626_0002631 | |||
| 2812 | Ga0495626_0002852 | |||
| 2813 | Ga0495626_0004684 | |||
| 2814 | Ga0495626_0007031 | |||
| 2815 | Ga0495626_0007060 | |||
| 2816 | Ga0495626_0009023 | |||
| 2817 | Ga0495626_0010170 | |||
| 2818 | Ga0495626_0011436 | |||
| 2819 | Ga0495626_0023223 | |||
| 2820 | Ga0495626_0031585 | |||
| 2821 | Ga0495626_0041572 | |||
| 2822 | Ga0495626_0041615 | |||
| 2823 | Ga0495626_0046013 | |||
| 2824 | Ga0495626_0095325 | |||
| 2825 | Ga0496102_0001005 | |||
| 2826 | Ga0496102_0061189 | |||
| 2827 | Ga0496102_0299954 | |||
| 2828 | Ga0496103_0048845 | |||
| 2829 | Ga0496103_0177770 | |||
| 2830 | Ga0496104_0013974 | |||
| 2831 | Ga0496104_0072768 | |||
| 2832 | Ga0496104_0076174 | |||
| 2833 | Ga0496104_0129352 | |||
| 2834 | Ga0496104_0285282 | |||
| 2835 | Ga0496104_0642085 | |||
| 2836 | Ga0496105_0004007 | |||
| 2837 | Ga0496105_0102484 | |||
| 2838 | Ga0496105_0442394 | |||
| 2839 | Ga0496106_0010926 | |||
| 2840 | Ga0496106_0210985 | |||
| 2841 | Ga0496109_0006786 | |||
| 2842 | Ga0496109_0453714 | |||
| 2843 | Ga0496109_0545671 | |||
| 2844 | Ga0496109_0571652 | |||
| 2845 | Ga0496110_0000641 | |||
| 2846 | Ga0496110_0005948 | |||
| 2847 | Ga0496110_0320276 | |||
| 2848 | Ga0496111_0004898 | |||
| 2849 | Ga0496111_0449360 | |||
| 2850 | Ga0496112_0023445 | |||
| 2851 | Ga0496112_0116116 | |||
| 2852 | Ga0496113_0009852 | |||
| 2853 | Ga0496115_0007458 | |||
| 2854 | Ga0496115_0219241 | |||
| 2855 | Ga0496122_0001645 | |||
| 2856 | Ga0496122_0004436 | |||
| 2857 | Ga0496123_0002540 | |||
| 2858 | Ga0496123_0005998 | |||
| 2859 | Ga0496123_0045219 | |||
| 2860 | Ga0496124_0211724 | |||
| 2861 | Ga0496125_0001339 | |||
| 2862 | Ga0496125_0349408 | |||
| 2863 | Ga0495678_000230 | |||
| 2864 | Ga0495678_000244 | |||
| 2865 | Ga0495678_001100 | |||
| 2866 | Ga0495678_001526 | |||
| 2867 | Ga0495678_007687 | |||
| 2868 | Ga0495682_0000987 | |||
| 2869 | Ga0495682_0004089 | |||
| 2870 | Ga0495682_0009652 | |||
| 2871 | Ga0495682_0021110 | |||
| 2872 | Ga0501291_030416 | |||
| 2873 | Ga0501031_0039432 | |||
| 2874 | Ga0501031_0044131 | |||
| 2875 | Ga0501032_0010578 | |||
| 2876 | Ga0501032_0038231 | |||
| 2877 | Ga0501033_0002781 | |||
| 2878 | Ga0501033_0030331 | |||
| 2879 | Ga0501034_0002575 | |||
| 2880 | Ga0501034_0025960 | |||
| 2881 | Ga0501034_0072335 | |||
| 2882 | Ga0501034_0082596 | |||
| 2883 | Ga0501034_0215112 | |||
| 2884 | Ga0501036_0015924 | |||
| 2885 | Ga0501036_0017771 | |||
| 2886 | Ga0501037_0009766 | |||
| 2887 | Ga0501038_0045631 | |||
| 2888 | Ga0501038_0051438 | |||
| 2889 | Ga0501039_0062588 | |||
| 2890 | Ga0501042_0513438 | |||
| 2891 | Ga0501043_0014217 | |||
| 2892 | Ga0501043_0017144 | |||
| 2893 | Ga0501046_0003771 | |||
| 2894 | Ga0501046_0034804 | |||
| 2895 | Ga0501047_0020003 | |||
| 2896 | Ga0501047_0044284 | |||
| 2897 | Ga0501047_0083347 | |||
| 2898 | Ga0501047_0097691 | |||
| 2899 | Ga0501048_0002543 | |||
| 2900 | Ga0501048_0029999 | |||
| 2901 | Ga0501068_0003114 | |||
| 2902 | Ga0501068_0009245 | |||
| 2903 | Ga0501069_0007518 | |||
| 2904 | Ga0501069_0016457 | |||
| 2905 | Ga0501070_0018373 | |||
| 2906 | Ga0501070_0130332 | |||
| 2907 | Ga0501073_0010780 | |||
| 2908 | Ga0501073_0035014 | |||
| 2909 | Ga0501074_0038573 | |||
| 2910 | Ga0501076_0025946 | |||
| 2911 | Ga0501201_002058 | |||
| 2912 | Ga0501211_007739 | |||
| 2913 | Ga0501223_045817 | |||
| 2914 | Ga0501227_003631 | |||
| 2915 | Ga0501235_009392 | |||
| 2916 | Ga0501079_0018676 | |||
| 2917 | Ga0501079_0021225 | |||
| 2918 | Ga0501080_0017753 | |||
| 2919 | Ga0501080_0104371 | |||
| 2920 | Ga0501081_0443174 | |||
| 2921 | Ga0501083_0030960 | |||
| 2922 | Ga0501083_0073583 | |||
| 2923 | Ga0501262_016440 | |||
| 2924 | Ga0501264_005389 | |||
| 2925 | Ga0501267_001826 | |||
| 2926 | Ga0501271_002473 | |||
| 2927 | Ga0501272_003078 | |||
| 2928 | Ga0501279_015204 | |||
| 2929 | Ga0501035_0000789 | |||
| 2930 | Ga0501035_0023555 | |||
| 2931 | Ga0501035_0187718 | |||
| 2932 | Ga0501044_0089065 | |||
| 2933 | Ga0501044_0131410 | |||
| 2934 | Ga0501045_0003433 | |||
| 2935 | Ga0501226_002698 | |||
| 2936 | nmdc:mga03683_25437_c1 | |||
| 2937 | nmdc:mga0k408_189169_c1 | |||
| 2938 | nmdc:mga0k408_273426_c1 | |||
| 2939 | nmdc:mga0k408_2817_c1 | |||
| 2940 | nmdc:mga0k408_67533_c1 | |||
| 2941 | nmdc:mga06z11_3237_c1 | |||
| 2942 | nmdc:mga06z11_427815_c1 | |||
| 2943 | nmdc:mga07m45_107955_c1 | |||
| 2944 | nmdc:mga07m45_108288_c1 | |||
| 2945 | nmdc:mga07m45_14749_c1 | |||
| 2946 | nmdc:mga07m45_1739_c1 | |||
| 2947 | nmdc:mga07m45_17812_c1 | |||
| 2948 | nmdc:mga07m45_2135_c1 | |||
| 2949 | nmdc:mga07m45_241469_c1 | |||
| 2950 | nmdc:mga07m45_36807_c1 | |||
| 2951 | nmdc:mga07m45_667_c1 | |||
| 2952 | nmdc:mga07m45_9721_c2 | |||
| 2953 | nmdc:mga05p37_450441_c1 | |||
| 2954 | nmdc:mga06r32_149366_c1 | |||
| 2955 | nmdc:mga08y16_13960_c1 | |||
| 2956 | nmdc:mga0n895_105939_c1 | |||
| 2957 | nmdc:mga0n895_178245_c1 | |||
| 2958 | nmdc:mga0n895_184118_c1 | |||
| 2959 | nmdc:mga0n895_258186_c1 | |||
| 2960 | nmdc:mga0n895_798789_c1 | |||
| 2961 | nmdc:mga0rr50_190791_c1 | |||
| 2962 | nmdc:mga0rr50_44781_c1 | |||
| 2963 | nmdc:mga08x19_122667_c1 | |||
| 2964 | nmdc:mga08x19_33584_c1 | |||
| 2965 | nmdc:mga0a205_759720_c1 | |||
| 2966 | Ga0500635_0000007 | |||
| 2967 | Ga0500635_0000150 | |||
| 2968 | Ga0500578_0000025 | |||
| 2969 | Ga0500644_0027795 | |||
| 2970 | Ga0500646_0010670 | |||
| 2971 | Ga0500651_0131626 | |||
| 2972 | Ga0500651_0450153 | |||
| 2973 | Ga0500562_038607 | |||
| 2974 | Ga0500608_011126 | |||
| 2975 | Ga0500608_105189 | |||
| 2976 | Ga0500652_001368 | |||
| 2977 | Ga0500658_0041897 | |||
| 2978 | Ga0500564_057627 | |||
| 2979 | Ga0500568_0051919 | |||
| 2980 | Ga0500622_0000279 | |||
| 2981 | Ga0500636_0004381 | |||
| 2982 | Ga0501084_0003897 | |||
| 2983 | Ga0501082_0039601 | |||
| 2984 | Ga0501082_0053377 | |||
| 2985 | Ga0466962_0021479 | |||
| 2986 | Ga0466962_0027083 | |||
| 2987 | Ga0466962_0042306 | |||
| 2988 | Ga0466962_0058448 | |||
| 2989 | 2587725658 | |||
| 2990 | 2587735093 | |||
| 2991 | 2587760006 | |||
| 2992 | 2588290589 | |||
| 2993 | 2643744462 | |||
| 2994 | 2643787764 | |||
| 2995 | 2643800530 | |||
| 2996 | 2643934467 | |||
| 2997 | 2643968303 | |||
| 2998 | 2644143544 | |||
| 2999 | 2644211876 | |||
| 3000 | 2644219310 | |||
| 3001 | 2644222127 | |||
| 3002 | 2644255748 | |||
| 3003 | 2644257092 | |||
| 3004 | 2644272081 | |||
| 3005 | 2644315954 | |||
| 3006 | 2644470439 | |||
| 3007 | 2739054206 | |||
| 3008 | 2739055352 | |||
| 3009 | 2809144043 | |||
| 3010 | 8047678835 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qv0-assembly1.cif.gz_A | crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae | 0.9004 | 8 | 125 |
| 3d6w-assembly1.cif.gz_A | lyttr dna-binding domain of putative methyl-accepting/dna response regulator from bacillus cereus. | 0.9002 | 134 | 238 |
| 2r25-assembly1.cif.gz_B | complex of ypd1 and sln1-r1 with bound mg2+ and bef3- | 0.8951 | 6 | 119 |
| 7od9-assembly1.cif.gz_B | crystal structure of activated chey fused to the c-terminal domain of chef | 0.8925 | 5 | 118 |
| 6m8o-assembly1.cif.gz_A | crystal structure of the receiver domain of lytr from staphylococcus aureus | 0.8911 | 8 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58280_207_250_3.10.450.750 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9663 | 148 | 174 | 3.10.450.750 |
| af_P0AFT5_129_238_2.40.50.1020 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain | 0.9154 | 130 | 237 | 2.40.50.1020 |
| af_P0AFT5_1_126_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9072 | 8 | 121 | 3.40.50.2300 |
| 2qv0B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8996 | 8 | 125 | 3.40.50.2300 |
| 3d6wB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.896 | 134 | 203 | 2.40.50.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C7U9T4-F1-model_v4 | Response regulator | 0.9734 | 1 | 74 |
GO:0000160
|
| AF-A0A660R7R7-F1-model_v4 | Response regulatory domain-containing protein | 0.9731 | 7 | 76 |
GO:0000160
|
| AF-A0A7C7WMN0-F1-model_v4 | LytTR family transcriptional regulator | 0.9665 | 148 | 238 |
GO:0000156
GO:0003677 |
| AF-A0A4Q3FDX0-F1-model_v4 | Response regulator | 0.9646 | 8 | 85 |
GO:0000160
|
| AF-A0A6N9R8L8-F1-model_v4 | LytTR family transcriptional regulator | 0.9485 | 133 | 238 |
GO:0000156
GO:0003677 |