F494432

General Info

Members Datasets Scaffolds Average Seq Length
1505 513 3010 245

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10210500|Ga0070685_102105002
Length 278
Sequence MSVPRPPEDTCTAVRKDGASTMSSSPRLRALVVDDEDLARHLIREYLQGHADVEVVGECENGLDAVKQIGALNPDLVFLDIQMPRLTGLEVLELTGRRAGVIFTTAYDEHAIKAFELHAVDYLLKPFSKARFDDALARARTLHASARASGGAGATPGPAQGVDALVARRGATLERILIRDREQVHVIPVEQVECIEAQGDYLAIEVDGKCHLKPQRISEIEEQLDPTRFLRVHRSFIINLAHLQAIERPGPDRHAARLRSGKRVPISRSGYEKLRELV

Samples

Sample ID Description Type Environment
1 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
59 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
62 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
63 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
64 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
65 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
73 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
74 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
75 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
78 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
123 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
152 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
155 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
156 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
162 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
163 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
164 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
167 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
168 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
174 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
242 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
243 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
244 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
245 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
246 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
247 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
248 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
251 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
252 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
253 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
254 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
255 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
256 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
257 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
258 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
259 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
260 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
261 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
262 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
263 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
264 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
265 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
266 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
267 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
268 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
269 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
270 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
271 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
272 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
273 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
274 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
276 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
277 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
278 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
279 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
280 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
281 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
282 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
283 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
285 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
286 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
287 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
288 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
289 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
290 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
291 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
292 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
293 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
294 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
295 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
296 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
297 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
298 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
299 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
300 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
301 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
302 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
303 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
304 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
305 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
306 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
307 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
308 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
309 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
310 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
311 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
312 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
313 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
314 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
315 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
316 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
317 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
318 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
319 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
320 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
321 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
322 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
323 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
324 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
325 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
326 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
327 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
328 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
329 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
330 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
331 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
332 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
333 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
334 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
335 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
336 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
337 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
338 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
339 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
340 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
341 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
342 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
343 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
344 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
345 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
346 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
347 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
348 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
349 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
350 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
351 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
352 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
353 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
354 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
355 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
356 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
357 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
358 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
359 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
360 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
361 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
362 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
363 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
364 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
365 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
366 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
367 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
368 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
369 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
370 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
371 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
372 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
373 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
374 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
375 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
376 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
377 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
378 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
379 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
380 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
381 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
382 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
383 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
384 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
385 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
386 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
387 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
388 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
389 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
390 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
391 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
392 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
393 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
394 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
395 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
396 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
397 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
398 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
399 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
400 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
401 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
402 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
403 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
404 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
405 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
406 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
407 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
408 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
409 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
410 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
411 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
412 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
413 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
414 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
415 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
416 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
417 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
418 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
419 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
420 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
421 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
422 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
423 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
424 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
425 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
426 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
427 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
428 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
429 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
430 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
444 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
445 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
446 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
447 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
448 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
449 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
450 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
451 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
452 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
453 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
454 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
455 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
456 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
457 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
458 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
459 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
460 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
461 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
462 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
463 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
464 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
468 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
469 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
470 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
471 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
472 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
473 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
474 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
475 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
476 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
477 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
478 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
479 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
480 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
481 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
482 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
483 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
484 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
485 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
486 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
487 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
488 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
489 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
490 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
491 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
492 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
493 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
494 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
495 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
496 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
497 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
498 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
499 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
500 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
501 2643221556 Massilia sp. Root1485 Isolate Unclassified
502 2643221585 Pelomonas sp. Root662 Isolate Unclassified
503 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
504 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
505 2643221638 Duganella sp. Root336D2 Isolate Unclassified
506 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
507 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
508 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
509 2643221656 Pelomonas sp. Root405 Isolate Unclassified
510 2643221684 Massilia sp. Root133 Isolate Unclassified
511 2738541337 Pelomonas sp. BT06 Isolate Unclassified
512 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
513 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 0.2
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.9
Nodule 0
Rhizoplane 2.39
Rhizosphere 82.33
Stem 0
Stem Tuber 0
Unclassified 1.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070685_10210500 3300005466 Bacteria 1269
2 JGI25156J39149_1001159 3300002705 Bacteria 11792
3 JGI25156J39149_1002068 3300002705 Bacteria 7625
4 JGI25156J39149_1022654 3300002705 Bacteria 1062
5 JGI25154J39366_1001049 3300002738 Bacteria 11003
6 JGI25154J39366_1002964 3300002738 Bacteria 3891
7 JGI25158J39367_1000226 3300002739 Bacteria 13227
8 JGI25157J39369_1000029 3300002741 Bacteria 146928
9 JGI25157J39369_1000312 3300002741 Bacteria 35057
10 JGI25164J39214_1008298 3300002772 Bacteria 1041
11 JGI25152J39213_1000433 3300002773 Bacteria 25094
12 JGI25150J39212_1000749 3300002774 Bacteria 11402
13 JGI25150J39212_1001006 3300002774 Bacteria 8743
14 JGI25150J39212_1001467 3300002774 Bacteria 6565
15 JGI25150J39212_1002524 3300002774 Bacteria 4520
16 JGI25159J45721_1000365 3300002987 Bacteria 21057
17 JGI25153J46596_10013424 3300003215 Bacteria 3459
18 rootH1_10004599 3300003316 Bacteria 4465
19 rootH1_10007951 3300003316 Bacteria 4827
20 rootH1_10017383 3300003316 Bacteria 20136
21 rootH1_10034050 3300003316 Bacteria 2320
22 rootH1_10037656 3300003316 Bacteria 1573
23 rootH2_10006249 3300003320 Bacteria 9881
24 rootL2_10002470 3300003322 Bacteria 7787
25 rootL2_10016318 3300003322 Bacteria 5312
26 rootL2_10208757 3300003322 Bacteria 4122
27 rootH1_10006598 3300003323 Bacteria 4161
28 rootH1_10015852 3300003323 Bacteria 11750
29 rootH1_10020381 3300003323 Bacteria 15790
30 rootH1_10027575 3300003323 Bacteria 5176
31 rootH1_10030329 3300003323 Bacteria 1393
32 rootH1_10030355 3300003323 Bacteria 8033
33 rootH1_10116314 3300003323 Bacteria 4099
34 JGI25161J50226_1000407 3300003374 Bacteria 21057
35 Ga0055539_1000282 3300003752 Bacteria 29273
36 Ga0055539_1000902 3300003752 Bacteria 6739
37 Ga0055539_1008226 3300003752 Bacteria 1309
38 Ga0055539_1015032 3300003752 Bacteria 941
39 Ga0055533_1000010 3300003756 Bacteria 491196
40 Ga0055533_1000024 3300003756 Bacteria 338067
41 Ga0055525_1000081 3300003759 Bacteria 161329
42 Ga0055525_1000222 3300003759 Bacteria 61500
43 Ga0055525_1001459 3300003759 Bacteria 4222
44 Ga0055535_1000292 3300003761 Bacteria 52350
45 Ga0055535_1001112 3300003761 Bacteria 16330
46 Ga0055542_1007406 3300003762 Bacteria 2229
47 Ga0055529_1000130 3300003763 Bacteria 105654
48 Ga0055529_1000382 3300003763 Bacteria 48005
49 Ga0055526_1013614 3300003771 Bacteria 3423
50 Ga0055537_1012667 3300003773 Bacteria 1630
51 Ga0055537_1014154 3300003773 Bacteria 1461
52 Ga0055537_1019391 3300003773 Bacteria 1058
53 Ga0055524_1001532 3300003775 Bacteria 13066
54 Ga0055524_1006527 3300003775 Bacteria 5049
55 Ga0055534_1013048 3300003784 Bacteria 1612
56 Ga0055530_10002964 3300003791 Bacteria 10220
57 Ga0055530_10013336 3300003791 Bacteria 2811
58 Ga0055530_10045433 3300003791 Bacteria 1048
59 Ga0055540_1017899 3300003792 Bacteria 1960
60 Ga0055540_1039891 3300003792 Bacteria 1020
61 Ga0055531_10000024 3300003794 Bacteria 164239
62 Ga0055531_10000700 3300003794 Bacteria 28529
63 Ga0055531_10000818 3300003794 Bacteria 25805
64 Ga0055531_10032869 3300003794 Bacteria 1685
65 Ga0055543_1000546 3300004625 Bacteria 21095
66 Ga0065165_1001129 3300005262 Bacteria 31369
67 Ga0065165_1002224 3300005262 Bacteria 17321
68 Ga0065165_1007878 3300005262 Bacteria 5118
69 Ga0065165_1027495 3300005262 Bacteria 1854
70 Ga0065714_10107373 3300005288 Bacteria 1532
71 Ga0065715_10241007 3300005293 Bacteria 1199
72 Ga0070658_10004794 3300005327 Bacteria 11007
73 Ga0070658_10027232 3300005327 Bacteria 4588
74 Ga0070658_10039977 3300005327 Unclassified 3784
75 Ga0070658_10058732 3300005327 Bacteria 3131
76 Ga0070658_10070757 3300005327 Bacteria 2857
77 Ga0070658_10247280 3300005327 Bacteria 1513
78 Ga0070683_100031998 3300005329 Bacteria 4787
79 Ga0070690_100003915 3300005330 Bacteria 8211
80 Ga0070690_100014227 3300005330 Bacteria 4717
81 Ga0070690_100056280 3300005330 Bacteria 2521
82 Ga0070690_100161861 3300005330 Bacteria 1534
83 Ga0070670_100004747 3300005331 Bacteria 11410
84 Ga0070677_10001503 3300005333 Bacteria 7376
85 Ga0070677_10004919 3300005333 Bacteria 4387
86 Ga0068869_100004218 3300005334 Bacteria 8917
87 Ga0068869_100036764 3300005334 Bacteria 3478
88 Ga0068869_100043150 3300005334 Bacteria 3238
89 Ga0068869_100059558 3300005334 Bacteria 2796
90 Ga0068869_100118707 3300005334 Bacteria 2020
91 Ga0070666_10009513 3300005335 Bacteria 6061
92 Ga0070680_100068066 3300005336 Bacteria 2922
93 Ga0070680_100096809 3300005336 Bacteria 2447
94 Ga0070680_100127601 3300005336 Bacteria 2126
95 Ga0070680_100342567 3300005336 Bacteria 1270
96 Ga0070682_100094761 3300005337 Bacteria 1959
97 Ga0070682_100225857 3300005337 Bacteria 1336
98 Ga0068868_100000628 3300005338 Bacteria 23749
99 Ga0068868_100001502 3300005338 Bacteria 16064
100 Ga0068868_100006264 3300005338 Bacteria 8416
101 Ga0068868_100065246 3300005338 Bacteria 2892
102 Ga0068868_100607628 3300005338 Bacteria 969
103 Ga0070660_100006633 3300005339 Bacteria 8030
104 Ga0070660_100033625 3300005339 Bacteria 3866
105 Ga0070660_100106926 3300005339 Bacteria 2222
106 Ga0070660_100206391 3300005339 Bacteria 1594
107 Ga0070660_100302787 3300005339 Bacteria 1311
108 Ga0070689_100052275 3300005340 Bacteria 3160
109 Ga0070689_100471686 3300005340 Bacteria 1071
110 Ga0070691_10008161 3300005341 Bacteria 4797
111 Ga0070691_10038091 3300005341 Unclassified 2270
112 Ga0070691_10191062 3300005341 Bacteria 1071
113 Ga0070687_100026461 3300005343 Bacteria 2794
114 Ga0070661_100103129 3300005344 Bacteria 2124
115 Ga0070692_10004149 3300005345 Bacteria 5997
116 Ga0070668_100042991 3300005347 Bacteria 3464
117 Ga0070668_100046957 3300005347 Bacteria 3319
118 Ga0070668_100161621 3300005347 Bacteria 1818
119 Ga0070669_100017692 3300005353 Bacteria 5085
120 Ga0070669_100041956 3300005353 Bacteria 3329
121 Ga0070669_100256465 3300005353 Bacteria 1394
122 Ga0070675_100002597 3300005354 Bacteria 13545
123 Ga0070675_100088059 3300005354 Bacteria 2597
124 Ga0070671_100002077 3300005355 Bacteria 15425
125 Ga0070671_100024204 3300005355 Bacteria 4970
126 Ga0070671_100038221 3300005355 Bacteria 3984
127 Ga0070674_100009585 3300005356 Bacteria 5802
128 Ga0070674_100138972 3300005356 Bacteria 1821
129 Ga0070674_100202734 3300005356 Bacteria 1533
130 Ga0070673_100006268 3300005364 Bacteria 7715
131 Ga0070673_100014919 3300005364 Bacteria 5437
132 Ga0070673_100017763 3300005364 Bacteria 5067
133 Ga0070673_100021054 3300005364 Bacteria 4718
134 Ga0070673_100091002 3300005364 Bacteria 2493
135 Ga0070673_100165829 3300005364 Bacteria 1882
136 Ga0070688_100088032 3300005365 Bacteria 2024
137 Ga0070659_100075936 3300005366 Bacteria 2679
138 Ga0070667_100005385 3300005367 Bacteria 10689
139 Ga0070667_100005638 3300005367 Bacteria 10455
140 Ga0070703_10003938 3300005406 Bacteria 4206
141 Ga0070709_10023806 3300005434 Bacteria 3601
142 Ga0070709_10182104 3300005434 Bacteria 1476
143 Ga0070709_10626057 3300005434 Bacteria 831
144 Ga0070714_100015390 3300005435 Bacteria 6155
145 Ga0070713_100002097 3300005436 Bacteria 12891
146 Ga0070713_100016508 3300005436 Bacteria 5552
147 Ga0070713_100151540 3300005436 Bacteria 2063
148 Ga0070713_100374624 3300005436 Bacteria 1325
149 Ga0070710_10043138 3300005437 Bacteria 2497
150 Ga0070701_10047380 3300005438 Bacteria 2214
151 Ga0070711_100368019 3300005439 Bacteria 1159
152 Ga0070705_100007516 3300005440 Bacteria 5365
153 Ga0070705_100010423 3300005440 Bacteria 4652
154 Ga0070694_100014445 3300005444 Bacteria 4944
155 Ga0070708_100000634 3300005445 Bacteria 26540
156 Ga0070708_100001048 3300005445 Bacteria 21050
157 Ga0070708_100106259 3300005445 Bacteria 2576
158 Ga0070678_100002016 3300005456 Bacteria 10981
159 Ga0070678_100007398 3300005456 Bacteria 6509
160 Ga0070678_100023958 3300005456 Bacteria 4077
161 Ga0070662_100062526 3300005457 Bacteria 2720
162 Ga0070662_100224756 3300005457 Bacteria 1499
163 Ga0070662_100331361 3300005457 Bacteria 1244
164 Ga0070681_10000506 3300005458 Bacteria 31860
165 Ga0070681_10002815 3300005458 Bacteria 16054
166 Ga0070681_10114861 3300005458 Bacteria 2630
167 Ga0068867_100001168 3300005459 Bacteria 17958
168 Ga0068867_100023799 3300005459 Bacteria 4387
169 Ga0068867_100035860 3300005459 Unclassified 3599
170 Ga0068867_100118543 3300005459 Bacteria 2042
171 Ga0070706_100000597 3300005467 Bacteria 41802
172 Ga0070706_100011207 3300005467 Bacteria 8325
173 Ga0070706_100012084 3300005467 Bacteria 8014
174 Ga0070706_100417622 3300005467 Bacteria 1249
175 Ga0070707_100001822 3300005468 Bacteria 20514
176 Ga0070707_100099618 3300005468 Bacteria 2815
177 Ga0070707_100149782 3300005468 Bacteria 2272
178 Ga0070698_100072447 3300005471 Bacteria 3453
179 Ga0070699_100014523 3300005518 Bacteria 6774
180 Ga0070699_100026220 3300005518 Bacteria 5027
181 Ga0070679_100014489 3300005530 Bacteria 7574
182 Ga0070679_100221886 3300005530 Bacteria 1851
183 Ga0070684_100008480 3300005535 Bacteria 8038
184 Ga0070684_100109925 3300005535 Bacteria 2471
185 Ga0070684_100124185 3300005535 Bacteria 2324
186 Ga0070697_100000634 3300005536 Bacteria 26650
187 Ga0070697_100100673 3300005536 Bacteria 2400
188 Ga0070697_100106997 3300005536 Bacteria 2327
189 Ga0070697_100234742 3300005536 Bacteria 1565
190 Ga0070697_100241516 3300005536 Unclassified 1543
191 Ga0068853_100301234 3300005539 Bacteria 1482
192 Ga0068853_100333558 3300005539 Bacteria 1408
193 Ga0070672_100000699 3300005543 Bacteria 19860
194 Ga0070672_100077922 3300005543 Bacteria 2651
195 Ga0070695_100119262 3300005545 Bacteria 1802
196 Ga0070696_100000745 3300005546 Bacteria 20783
197 Ga0070693_100000089 3300005547 Bacteria 38952
198 Ga0070693_100012559 3300005547 Bacteria 4288
199 Ga0070665_100063355 3300005548 Bacteria 3707
200 Ga0070665_100086806 3300005548 Bacteria 3134
201 Ga0070665_100266167 3300005548 Bacteria 1715
202 Ga0070704_100003995 3300005549 Bacteria 8507
203 Ga0070704_100219995 3300005549 Unclassified 1543
204 Ga0068855_100000212 3300005563 Bacteria 73927
205 Ga0068855_100005033 3300005563 Bacteria 16129
206 Ga0068855_100006540 3300005563 Bacteria 14172
207 Ga0068855_100007637 3300005563 Bacteria 13080
208 Ga0068855_100008176 3300005563 Bacteria 12649
209 Ga0068855_100131047 3300005563 Unclassified 2864
210 Ga0068855_100180228 3300005563 Bacteria 2389
211 Ga0068855_100242476 3300005563 Bacteria 2013
212 Ga0068855_100399924 3300005563 Bacteria 1505
213 Ga0068855_100689010 3300005563 Bacteria 1094
214 Ga0070664_100002091 3300005564 Bacteria 15967
215 Ga0070664_100450176 3300005564 Bacteria 1182
216 Ga0068857_100000097 3300005577 Bacteria 51356
217 Ga0068857_100000164 3300005577 Bacteria 41522
218 Ga0068857_100008343 3300005577 Bacteria 8948
219 Ga0068854_100009674 3300005578 Bacteria 6229
220 Ga0068854_100015311 3300005578 Bacteria 5078
221 Ga0068854_100024684 3300005578 Bacteria 4119
222 Ga0068854_100046522 3300005578 Unclassified 3089
223 Ga0068856_100001671 3300005614 Bacteria 23232
224 Ga0068856_100001677 3300005614 Bacteria 23200
225 Ga0068856_100019882 3300005614 Bacteria 6519
226 Ga0068856_100027769 3300005614 Bacteria 5521
227 Ga0068856_100027810 3300005614 Bacteria 5517
228 Ga0068856_100108933 3300005614 Bacteria 2766
229 Ga0068856_100362753 3300005614 Unclassified 1467
230 Ga0068856_100474657 3300005614 Bacteria 1271
231 Ga0070702_100206729 3300005615 Bacteria 1303
232 Ga0070702_100290374 3300005615 Bacteria 1127
233 Ga0068852_100009747 3300005616 Bacteria 7141
234 Ga0068852_100036308 3300005616 Unclassified 4122
235 Ga0068852_100117826 3300005616 Bacteria 2426
236 Ga0068852_100352391 3300005616 Bacteria 1438
237 Ga0068852_100388659 3300005616 Bacteria 1370
238 Ga0068859_100000780 3300005617 Bacteria 32169
239 Ga0068859_100018677 3300005617 Bacteria 6967
240 Ga0068864_100000242 3300005618 Bacteria 48756
241 Ga0068864_100006501 3300005618 Bacteria 9577
242 Ga0068864_100036884 3300005618 Bacteria 4168
243 Ga0068866_10002395 3300005718 Bacteria 7765
244 Ga0068866_10222692 3300005718 Bacteria 1139
245 Ga0068861_100073761 3300005719 Bacteria 2652
246 Ga0068861_100079741 3300005719 Bacteria 2560
247 Ga0068861_100093682 3300005719 Bacteria 2375
248 Ga0068861_100152207 3300005719 Bacteria 1899
249 Ga0068851_10226320 3300005834 Bacteria 1053
250 Ga0068870_10022504 3300005840 Bacteria 3097
251 Ga0068870_10092064 3300005840 Unclassified 1697
252 Ga0068863_100007429 3300005841 Bacteria 10726
253 Ga0068863_100007901 3300005841 Bacteria 10401
254 Ga0068863_100116135 3300005841 Bacteria 2550
255 Ga0068863_100606456 3300005841 Bacteria 1084
256 Ga0068858_100001038 3300005842 Bacteria 28685
257 Ga0068858_100001331 3300005842 Bacteria 25503
258 Ga0068858_100046025 3300005842 Bacteria 4045
259 Ga0068860_100012630 3300005843 Bacteria 8311
260 Ga0068860_100044011 3300005843 Bacteria 4256
261 Ga0068860_100210325 3300005843 Bacteria 1887
262 Ga0068860_100277814 3300005843 Bacteria 1636
263 Ga0068862_100009673 3300005844 Bacteria 7968
264 Ga0068862_100306889 3300005844 Bacteria 1461
265 Ga0068862_100378326 3300005844 Bacteria 1320
266 Ga0081455_10269275 3300005937 Bacteria 1236
267 Ga0070717_10026203 3300006028 Bacteria 4649
268 Ga0070717_10379596 3300006028 Bacteria 1267
269 Ga0075364_10055611 3300006051 Bacteria 2589
270 Ga0070712_100311527 3300006175 Bacteria 1277
271 Ga0075362_10003601 3300006177 Bacteria 5447
272 Ga0075367_10011581 3300006178 Bacteria 4674
273 Ga0075366_10000209 3300006195 Bacteria 25751
274 Ga0075366_10009229 3300006195 Bacteria 5505
275 Ga0075366_10062293 3300006195 Bacteria 2217
276 Ga0075366_10085110 3300006195 Bacteria 1891
277 Ga0097621_100000314 3300006237 Bacteria 32871
278 Ga0097621_100007716 3300006237 Bacteria 7714
279 Ga0097621_100016282 3300006237 Bacteria 5616
280 Ga0097621_100024590 3300006237 Bacteria 4705
281 Ga0097621_100328348 3300006237 Bacteria 1356
282 Ga0075370_10000798 3300006353 Bacteria 12604
283 Ga0075370_10021340 3300006353 Bacteria 3548
284 Ga0075370_10025236 3300006353 Bacteria 3286
285 Ga0075370_10034151 3300006353 Bacteria 2851
286 Ga0075370_10074951 3300006353 Bacteria 1939
287 Ga0068871_100009452 3300006358 Bacteria 7067
288 Ga0068871_100040452 3300006358 Bacteria 3734
289 Ga0068871_100070667 3300006358 Bacteria 2869
290 Ga0075428_100103519 3300006844 Bacteria 3104
291 Ga0075431_100262127 3300006847 Bacteria 1754
292 Ga0075433_10490402 3300006852 Bacteria 1082
293 Ga0075434_100092796 3300006871 Bacteria 3022
294 Ga0075434_100263519 3300006871 Bacteria 1742
295 Ga0075434_100318442 3300006871 Bacteria 1576
296 Ga0075429_100067405 3300006880 Bacteria 3114
297 Ga0068865_100057940 3300006881 Bacteria 2704
298 Ga0075436_100088124 3300006914 Bacteria 2156
299 Ga0075436_100241914 3300006914 Bacteria 1284
300 Ga0097620_100000780 3300006931 Bacteria 32169
301 Ga0097620_100018677 3300006931 Bacteria 6967
302 Ga0075435_100003402 3300007076 Bacteria 10788
303 Ga0099794_10005413 3300007265 Bacteria 5115
304 Ga0099795_10030697 3300007788 Bacteria 1847
305 Ga0099795_10089526 3300007788 Bacteria 1191
306 Ga0105240_10002073 3300009093 Bacteria 32845
307 Ga0105240_10002125 3300009093 Bacteria 32374
308 Ga0105240_10008664 3300009093 Bacteria 14523
309 Ga0105240_10021828 3300009093 Bacteria 8508
310 Ga0105240_10108762 3300009093 Bacteria 3358
311 Ga0105240_10204579 3300009093 Bacteria 2312
312 Ga0105240_10338636 3300009093 Bacteria 1709
313 Ga0105240_10352982 3300009093 Bacteria 1668
314 Ga0105240_10618140 3300009093 Bacteria 1191
315 Ga0111539_10003952 3300009094 Bacteria 19471
316 Ga0105245_10009192 3300009098 Bacteria 8617
317 Ga0105245_10448816 3300009098 Bacteria 1298
318 Ga0114129_10001813 3300009147 Bacteria 29131
319 Ga0114129_10105052 3300009147 Bacteria 3903
320 Ga0114129_10870557 3300009147 Bacteria 1144
321 Ga0114129_11078406 3300009147 Bacteria 1007
322 Ga0105243_10077587 3300009148 Bacteria 2702
323 Ga0105243_10131023 3300009148 Bacteria 2127
324 Ga0105243_10151416 3300009148 Bacteria 1990
325 Ga0105243_10208365 3300009148 Bacteria 1720
326 Ga0105243_10547898 3300009148 Bacteria 1105
327 Ga0105241_10033445 3300009174 Bacteria 3860
328 Ga0105241_10151395 3300009174 Bacteria 1898
329 Ga0105241_10160747 3300009174 Bacteria 1846
330 Ga0105241_10178272 3300009174 Bacteria 1761
331 Ga0105241_10201131 3300009174 Bacteria 1664
332 Ga0105242_10074656 3300009176 Bacteria 2822
333 Ga0105242_10218114 3300009176 Unclassified 1703
334 Ga0105248_10035730 3300009177 Bacteria 5559
335 Ga0105248_10109410 3300009177 Bacteria 3116
336 Ga0105248_10125452 3300009177 Bacteria 2896
337 Ga0105248_10317774 3300009177 Bacteria 1754
338 Ga0105248_11060566 3300009177 Bacteria 916
339 Ga0105237_10010975 3300009545 Bacteria 9613
340 Ga0105237_10024770 3300009545 Bacteria 6139
341 Ga0105237_10131925 3300009545 Bacteria 2493
342 Ga0105238_10000064 3300009551 Bacteria 122380
343 Ga0105238_10026318 3300009551 Bacteria 5929
344 Ga0105238_10061388 3300009551 Bacteria 3762
345 Ga0105238_10786052 3300009551 Bacteria 967
346 Ga0105249_10065798 3300009553 Bacteria 3335
347 Ga0105239_10335314 3300010375 Bacteria 1706
348 Ga0105246_10061266 3300011119 Bacteria 2617
349 Ga0105246_10209092 3300011119 Bacteria 1522
350 Ga0105246_10254815 3300011119 Bacteria 1395
351 Ga0157373_10086388 3300013100 Bacteria 2211
352 Ga0157373_10174784 3300013100 Bacteria 1511
353 Ga0157371_10000013 3300013102 Bacteria 352631
354 Ga0157371_10000064 3300013102 Bacteria 169056
355 Ga0157371_10046815 3300013102 Bacteria 3075
356 Ga0157371_10077462 3300013102 Bacteria 2354
357 Ga0157371_10096657 3300013102 Unclassified 2093
358 Ga0157370_10361540 3300013104 Bacteria 1337
359 Ga0157370_10669722 3300013104 Bacteria 948
360 Ga0157369_10000522 3300013105 Bacteria 50647
361 Ga0157369_10027164 3300013105 Bacteria 6347
362 Ga0157369_10032556 3300013105 Bacteria 5732
363 Ga0157369_10048151 3300013105 Bacteria 4626
364 Ga0157369_10187677 3300013105 Bacteria 2173
365 Ga0157369_10245648 3300013105 Bacteria 1869
366 Ga0157369_10971128 3300013105 Bacteria 870
367 Ga0157374_10000245 3300013296 Bacteria 50434
368 Ga0157374_10000577 3300013296 Bacteria 32518
369 Ga0157374_10078751 3300013296 Bacteria 3122
370 Ga0157374_10313883 3300013296 Bacteria 1552
371 Ga0157378_10000172 3300013297 Bacteria 61182
372 Ga0157378_10123834 3300013297 Bacteria 2386
373 Ga0157378_10150386 3300013297 Bacteria 2169
374 Ga0157378_10228616 3300013297 Bacteria 1771
375 Ga0157378_10353735 3300013297 Bacteria 1436
376 Ga0163162_10775537 3300013306 Bacteria 1077
377 Ga0157372_10000450 3300013307 Bacteria 45152
378 Ga0157372_10011617 3300013307 Bacteria 9375
379 Ga0157372_10024161 3300013307 Bacteria 6596
380 Ga0157372_10025639 3300013307 Bacteria 6412
381 Ga0157372_10090823 3300013307 Bacteria 3473
382 Ga0157372_10175298 3300013307 Bacteria 2482
383 Ga0157372_10418765 3300013307 Bacteria 1561
384 Ga0157372_10629303 3300013307 Bacteria 1250
385 Ga0157375_10053089 3300013308 Bacteria 3987
386 Ga0163163_10018823 3300014325 Bacteria 6475
387 Ga0163163_10262780 3300014325 Bacteria 1777
388 Ga0157380_10259725 3300014326 Bacteria 1577
389 Ga0182008_10024693 3300014497 Bacteria 3057
390 Ga0157379_10012032 3300014968 Bacteria 7559
391 Ga0157376_10077607 3300014969 Bacteria 2841
392 Ga0157376_10194314 3300014969 Bacteria 1863
393 Ga0157376_10385259 3300014969 Bacteria 1352
394 Ga0157376_11132777 3300014969 Bacteria 809
395 Ga0182006_1032583 3300015261 Bacteria 2093
396 Ga0182007_10022545 3300015262 Bacteria 2223
397 Ga0182007_10066331 3300015262 Bacteria 1182
398 Ga0163161_10091476 3300017792 Bacteria 2252
399 Ga0213872_10000115 3300021361 Bacteria 74334
400 Ga0213872_10004364 3300021361 Bacteria 7531
401 Ga0213872_10057539 3300021361 Bacteria 1760
402 Ga0209436_100218 3300025208 Bacteria 26371
403 Ga0209674_100003 3300025226 Bacteria 2196646
404 Ga0209674_100007 3300025226 Bacteria 1077082
405 Ga0209672_102656 3300025228 Bacteria 4191
406 Ga0209563_100015 3300025230 Bacteria 879901
407 Ga0209563_100049 3300025230 Bacteria 358472
408 Ga0209563_100060 3300025230 Bacteria 284876
409 Ga0209563_100088 3300025230 Bacteria 175375
410 Ga0209563_105947 3300025230 Bacteria 2147
411 Ga0207427_100282 3300025231 Bacteria 37116
412 Ga0207427_100623 3300025231 Bacteria 17397
413 Ga0209258_100128 3300025242 Bacteria 177216
414 Ga0209258_100683 3300025242 Bacteria 23569
415 Ga0209258_102459 3300025242 Bacteria 4763
416 Ga0207425_1000109 3300025245 Bacteria 77611
417 Ga0207425_1000122 3300025245 Bacteria 73381
418 Ga0207425_1000482 3300025245 Bacteria 25150
419 Ga0207425_1002022 3300025245 Bacteria 7559
420 Ga0207425_1007654 3300025245 Bacteria 2830
421 Ga0209646_1000056 3300025246 Bacteria 269860
422 Ga0209646_1000111 3300025246 Bacteria 155786
423 Ga0209026_1000009 3300025250 Bacteria 531812
424 Ga0209026_1000054 3300025250 Bacteria 242508
425 Ga0209677_100050 3300025253 Bacteria 176828
426 Ga0209677_100129 3300025253 Bacteria 73193
427 Ga0209677_100514 3300025253 Bacteria 21584
428 Ga0209677_101079 3300025253 Bacteria 12880
429 Ga0209677_101420 3300025253 Bacteria 10367
430 Ga0209677_112089 3300025253 Bacteria 1302
431 Ga0209148_1000272 3300025254 Bacteria 81330
432 Ga0209759_1000035 3300025256 Bacteria 264254
433 Ga0209759_1000043 3300025256 Bacteria 242513
434 Ga0209759_1000666 3300025256 Bacteria 31844
435 Ga0209759_1001454 3300025256 Bacteria 13344
436 Ga0209759_1004314 3300025256 Bacteria 5351
437 Ga0209759_1006725 3300025256 Bacteria 3815
438 Ga0209759_1009204 3300025256 Bacteria 3003
439 Ga0209129_1000582 3300025258 Bacteria 25150
440 Ga0209129_1002417 3300025258 Bacteria 9177
441 Ga0209565_1000600 3300025263 Bacteria 24200
442 Ga0209565_1005953 3300025263 Bacteria 3489
443 Ga0209565_1015548 3300025263 Bacteria 1714
444 Ga0209455_1000108 3300025272 Bacteria 193021
445 Ga0209455_1000116 3300025272 Bacteria 177216
446 Ga0209130_1000171 3300025284 Bacteria 94371
447 Ga0209130_1001410 3300025284 Bacteria 16030
448 Ga0209675_1000739 3300025291 Bacteria 22095
449 Ga0209675_1001493 3300025291 Bacteria 13414
450 Ga0209675_1005760 3300025291 Bacteria 5110
451 Ga0209564_1000095 3300025295 Bacteria 237896
452 Ga0209564_1003896 3300025295 Bacteria 9588
453 Ga0209564_1004713 3300025295 Bacteria 8176
454 Ga0209758_1001664 3300025297 Bacteria 25150
455 Ga0209050_1000011 3300025298 Bacteria 914037
456 Ga0209050_1000547 3300025298 Bacteria 62265
457 Ga0209050_1001381 3300025298 Bacteria 26455
458 Ga0209050_1004051 3300025298 Bacteria 10279
459 Ga0209050_1006205 3300025298 Bacteria 7171
460 Ga0209256_1000987 3300025299 Bacteria 34068
461 Ga0209256_1001062 3300025299 Bacteria 31871
462 Ga0209256_1059981 3300025299 Bacteria 889
463 Ga0209051_1003873 3300025303 Bacteria 9559
464 Ga0209051_1008357 3300025303 Bacteria 5489
465 Ga0209051_1018162 3300025303 Bacteria 3120
466 Ga0209051_1026335 3300025303 Bacteria 2345
467 Ga0209257_1000003 3300025304 Bacteria 1702593
468 Ga0209257_1000017 3300025304 Bacteria 866287
469 Ga0209257_1000117 3300025304 Bacteria 227328
470 Ga0209257_1014465 3300025304 Bacteria 3388
471 Ga0209257_1030252 3300025304 Bacteria 1751
472 Ga0207656_10087765 3300025321 Bacteria 1407
473 Ga0207682_10003095 3300025893 Bacteria 7289
474 Ga0207682_10048403 3300025893 Bacteria 1752
475 Ga0207642_10004420 3300025899 Bacteria 4533
476 Ga0207688_10016962 3300025901 Bacteria 3957
477 Ga0207680_10274907 3300025903 Bacteria 1169
478 Ga0207680_10330494 3300025903 Bacteria 1067
479 Ga0207699_10087189 3300025906 Bacteria 1951
480 Ga0207699_10276793 3300025906 Bacteria 1165
481 Ga0207645_10073735 3300025907 Bacteria 2185
482 Ga0207645_10235079 3300025907 Bacteria 1210
483 Ga0207643_10007445 3300025908 Bacteria 5874
484 Ga0207705_10000922 3300025909 Bacteria 24029
485 Ga0207705_10014081 3300025909 Bacteria 5763
486 Ga0207705_10023899 3300025909 Bacteria 4361
487 Ga0207705_10052182 3300025909 Bacteria 2944
488 Ga0207705_10064246 3300025909 Bacteria 2652
489 Ga0207705_10202375 3300025909 Bacteria 1505
490 Ga0207684_10000125 3300025910 Bacteria 141210
491 Ga0207684_10013608 3300025910 Bacteria 7032
492 Ga0207684_10226178 3300025910 Bacteria 1614
493 Ga0207654_10021970 3300025911 Bacteria 3399
494 Ga0207654_10080747 3300025911 Unclassified 1956
495 Ga0207654_10183518 3300025911 Bacteria 1366
496 Ga0207654_10231662 3300025911 Bacteria 1230
497 Ga0207707_10001125 3300025912 Bacteria 25351
498 Ga0207707_10060943 3300025912 Bacteria 3283
499 Ga0207707_10226090 3300025912 Bacteria 1628
500 Ga0207695_10001924 3300025913 Bacteria 32293
501 Ga0207695_10008820 3300025913 Bacteria 12557
502 Ga0207695_10018362 3300025913 Bacteria 8091
503 Ga0207695_10035278 3300025913 Bacteria 5427
504 Ga0207695_10049321 3300025913 Bacteria 4440
505 Ga0207695_10084876 3300025913 Bacteria 3196
506 Ga0207695_10093813 3300025913 Bacteria 3010
507 Ga0207695_10128664 3300025913 Bacteria 2492
508 Ga0207671_10240263 3300025914 Bacteria 1423
509 Ga0207693_10305720 3300025915 Bacteria 1245
510 Ga0207693_10585282 3300025915 Bacteria 869
511 Ga0207663_10435488 3300025916 Bacteria 1009
512 Ga0207663_10449168 3300025916 Bacteria 994
513 Ga0207660_10033710 3300025917 Bacteria 3545
514 Ga0207660_10104439 3300025917 Bacteria 2122
515 Ga0207660_10358913 3300025917 Bacteria 1169
516 Ga0207657_10000491 3300025919 Bacteria 41762
517 Ga0207657_10010663 3300025919 Bacteria 9153
518 Ga0207657_10016061 3300025919 Bacteria 7227
519 Ga0207649_10047767 3300025920 Bacteria 2636
520 Ga0207649_10076573 3300025920 Bacteria 2153
521 Ga0207649_10387357 3300025920 Bacteria 1043
522 Ga0207652_10048726 3300025921 Bacteria 3623
523 Ga0207652_10080300 3300025921 Bacteria 2851
524 Ga0207652_10237251 3300025921 Bacteria 1644
525 Ga0207652_10299749 3300025921 Unclassified 1451
526 Ga0207646_10045253 3300025922 Bacteria 3951
527 Ga0207646_10054214 3300025922 Bacteria 3587
528 Ga0207681_10028871 3300025923 Bacteria 3596
529 Ga0207681_10178304 3300025923 Bacteria 1616
530 Ga0207694_10000892 3300025924 Bacteria 26471
531 Ga0207694_10025695 3300025924 Bacteria 4477
532 Ga0207694_10053670 3300025924 Bacteria 3126
533 Ga0207694_10135566 3300025924 Bacteria 1977
534 Ga0207694_10189339 3300025924 Bacteria 1671
535 Ga0207694_10306341 3300025924 Bacteria 1309
536 Ga0207650_10008943 3300025925 Bacteria 6845
537 Ga0207650_10013039 3300025925 Bacteria 5749
538 Ga0207659_10000312 3300025926 Bacteria 29506
539 Ga0207659_10379040 3300025926 Unclassified 1179
540 Ga0207659_10875022 3300025926 Bacteria 772
541 Ga0207687_10020028 3300025927 Bacteria 4436
542 Ga0207700_10012386 3300025928 Bacteria 5498
543 Ga0207700_10118923 3300025928 Bacteria 2139
544 Ga0207664_10009316 3300025929 Bacteria 6884
545 Ga0207644_10000437 3300025931 Bacteria 26946
546 Ga0207690_10003250 3300025932 Bacteria 9750
547 Ga0207690_10027464 3300025932 Bacteria 3596
548 Ga0207690_10266177 3300025932 Unclassified 1330
549 Ga0207690_10308267 3300025932 Bacteria 1241
550 Ga0207690_10346723 3300025932 Bacteria 1173
551 Ga0207690_10367811 3300025932 Bacteria 1140
552 Ga0207706_10021959 3300025933 Bacteria 5729
553 Ga0207706_10077498 3300025933 Bacteria 2923
554 Ga0207706_10144285 3300025933 Bacteria 2094
555 Ga0207706_10255393 3300025933 Bacteria 1530
556 Ga0207686_10200975 3300025934 Bacteria 1427
557 Ga0207709_10019410 3300025935 Bacteria 3821
558 Ga0207709_10073088 3300025935 Bacteria 2183
559 Ga0207709_10086867 3300025935 Bacteria 2032
560 Ga0207670_10005757 3300025936 Bacteria 6837
561 Ga0207669_10002447 3300025937 Bacteria 7920
562 Ga0207669_10125155 3300025937 Bacteria 1754
563 Ga0207669_10230185 3300025937 Bacteria 1367
564 Ga0207704_10048448 3300025938 Unclassified 2548
565 Ga0207704_10409649 3300025938 Bacteria 1072
566 Ga0207665_10041537 3300025939 Bacteria 3072
567 Ga0207691_10006654 3300025940 Bacteria 11153
568 Ga0207691_10011341 3300025940 Bacteria 8551
569 Ga0207691_10059505 3300025940 Bacteria 3473
570 Ga0207711_10001682 3300025941 Bacteria 20373
571 Ga0207711_10167602 3300025941 Bacteria 1991
572 Ga0207711_10416745 3300025941 Bacteria 1249
573 Ga0207711_10743858 3300025941 Bacteria 914
574 Ga0207689_10008999 3300025942 Bacteria 8648
575 Ga0207689_10015618 3300025942 Bacteria 6431
576 Ga0207689_10035478 3300025942 Bacteria 4143
577 Ga0207689_10043834 3300025942 Bacteria 3698
578 Ga0207689_10076344 3300025942 Bacteria 2755
579 Ga0207689_10132622 3300025942 Bacteria 2050
580 Ga0207689_10145775 3300025942 Bacteria 1951
581 Ga0207679_10010631 3300025945 Bacteria 5931
582 Ga0207679_10089918 3300025945 Bacteria 2371
583 Ga0207679_10264748 3300025945 Bacteria 1468
584 Ga0207667_10000370 3300025949 Bacteria 60796
585 Ga0207667_10001781 3300025949 Bacteria 27113
586 Ga0207667_10002286 3300025949 Bacteria 24079
587 Ga0207667_10005671 3300025949 Bacteria 15220
588 Ga0207667_10009062 3300025949 Bacteria 11765
589 Ga0207667_10027546 3300025949 Bacteria 6183
590 Ga0207667_10030004 3300025949 Bacteria 5889
591 Ga0207667_10071942 3300025949 Bacteria 3595
592 Ga0207667_10074524 3300025949 Bacteria 3526
593 Ga0207667_10303399 3300025949 Unclassified 1631
594 Ga0207651_10006315 3300025960 Bacteria 6187
595 Ga0207651_10007614 3300025960 Bacteria 5780
596 Ga0207651_10011224 3300025960 Bacteria 5005
597 Ga0207651_10012811 3300025960 Bacteria 4765
598 Ga0207651_10047413 3300025960 Bacteria 2897
599 Ga0207651_10186258 3300025960 Bacteria 1652
600 Ga0207712_10024503 3300025961 Bacteria 3997
601 Ga0207712_10208932 3300025961 Bacteria 1553
602 Ga0207668_10039675 3300025972 Bacteria 3172
603 Ga0207668_10281653 3300025972 Bacteria 1364
604 Ga0207640_10006668 3300025981 Bacteria 6344
605 Ga0207640_10013622 3300025981 Bacteria 4666
606 Ga0207640_10060137 3300025981 Bacteria 2510
607 Ga0207658_10001772 3300025986 Bacteria 16204
608 Ga0207658_10016258 3300025986 Bacteria 5117
609 Ga0207677_10001268 3300026023 Bacteria 13594
610 Ga0207677_10005627 3300026023 Bacteria 6810
611 Ga0207677_10131393 3300026023 Bacteria 1902
612 Ga0207677_10209806 3300026023 Bacteria 1554
613 Ga0207677_10670337 3300026023 Bacteria 917
614 Ga0207703_10001047 3300026035 Bacteria 26351
615 Ga0207703_10004544 3300026035 Bacteria 11377
616 Ga0207703_10035999 3300026035 Bacteria 3936
617 Ga0207703_10038715 3300026035 Bacteria 3808
618 Ga0207678_10000518 3300026067 Bacteria 34984
619 Ga0207678_10229270 3300026067 Bacteria 1590
620 Ga0207678_10296308 3300026067 Bacteria 1390
621 Ga0207678_10296668 3300026067 Bacteria 1389
622 Ga0207678_10303302 3300026067 Bacteria 1372
623 Ga0207708_10097433 3300026075 Bacteria 2273
624 Ga0207708_10320011 3300026075 Bacteria 1266
625 Ga0207702_10000784 3300026078 Bacteria 33661
626 Ga0207702_10000946 3300026078 Bacteria 29831
627 Ga0207702_10001288 3300026078 Bacteria 25108
628 Ga0207702_10005752 3300026078 Bacteria 10792
629 Ga0207702_10023362 3300026078 Bacteria 5127
630 Ga0207702_10108476 3300026078 Bacteria 2463
631 Ga0207702_10352820 3300026078 Unclassified 1408
632 Ga0207641_10023176 3300026088 Bacteria 5115
633 Ga0207641_10024355 3300026088 Bacteria 4989
634 Ga0207648_10002110 3300026089 Bacteria 21651
635 Ga0207648_10016441 3300026089 Bacteria 6758
636 Ga0207648_10231620 3300026089 Bacteria 1643
637 Ga0207648_10411927 3300026089 Bacteria 1226
638 Ga0207648_10474701 3300026089 Bacteria 1142
639 Ga0207648_10516774 3300026089 Bacteria 1094
640 Ga0207676_10000733 3300026095 Bacteria 25719
641 Ga0207676_10004725 3300026095 Bacteria 9652
642 Ga0207676_10178795 3300026095 Bacteria 1856
643 Ga0207676_10197867 3300026095 Bacteria 1773
644 Ga0207674_10000190 3300026116 Bacteria 75394
645 Ga0207674_10089845 3300026116 Bacteria 3064
646 Ga0207674_10139968 3300026116 Bacteria 2380
647 Ga0207675_100017183 3300026118 Bacteria 6757
648 Ga0207675_100035659 3300026118 Bacteria 4640
649 Ga0207675_100042815 3300026118 Bacteria 4228
650 Ga0207675_100128862 3300026118 Bacteria 2398
651 Ga0207675_100144539 3300026118 Bacteria 2261
652 Ga0207675_100152575 3300026118 Bacteria 2200
653 Ga0207675_100274431 3300026118 Bacteria 1637
654 Ga0207683_10001702 3300026121 Bacteria 19675
655 Ga0207683_10008866 3300026121 Bacteria 8577
656 Ga0207683_10016550 3300026121 Bacteria 6277
657 Ga0207698_10052496 3300026142 Bacteria 3124
658 Ga0207698_10056614 3300026142 Bacteria 3028
659 Ga0207698_10224609 3300026142 Bacteria 1700
660 Ga0207698_10292366 3300026142 Bacteria 1513
661 Ga0207698_10319372 3300026142 Bacteria 1454
662 Ga0207698_10599437 3300026142 Bacteria 1086
663 Ga0207428_10000671 3300027907 Bacteria 39984
664 Ga0265354_1000050 3300028016 Bacteria 19370
665 Ga0265354_1000584 3300028016 Bacteria 6144
666 Ga0268266_10050403 3300028379 Bacteria 3572
667 Ga0268266_10079015 3300028379 Bacteria 2864
668 Ga0268266_10085387 3300028379 Bacteria 2758
669 Ga0268266_10395256 3300028379 Bacteria 1306
670 Ga0268264_10012037 3300028381 Bacteria 7122
671 Ga0268264_10037455 3300028381 Bacteria 3999
672 Ga0268264_10159632 3300028381 Bacteria 2030
673 Ga0268264_10203070 3300028381 Bacteria 1814
674 Ga0268264_10287927 3300028381 Bacteria 1542
675 Ga0265336_10000006 3300028666 Bacteria 348453
676 Ga0265336_10000039 3300028666 Bacteria 149376
677 Ga0307517_10164321 3300028786 Bacteria 1479
678 Ga0307515_10000110 3300028794 Bacteria 195560
679 Ga0307515_10000366 3300028794 Bacteria 111195
680 Ga0307515_10001235 3300028794 Bacteria 58313
681 Ga0307515_10002229 3300028794 Bacteria 42507
682 Ga0307515_10034594 3300028794 Bacteria 8261
683 Ga0265338_10207480 3300028800 Bacteria 1473
684 Ga0265324_10000223 3300029957 Bacteria 43654
685 Ga0265324_10001026 3300029957 Bacteria 17151
686 Ga0307511_10056167 3300030521 Bacteria 3082
687 Ga0307512_10032623 3300030522 Bacteria 4493
688 Ga0307512_10114714 3300030522 Bacteria 1758
689 Ga0265770_1004651 3300030878 Unclassified 1876
690 Ga0265760_10006171 3300031090 Unclassified 3427
691 Ga0265760_10007108 3300031090 Unclassified 3205
692 Ga0265327_10009479 3300031251 Bacteria 7018
693 Ga0307513_10011456 3300031456 Bacteria 11022
694 Ga0307513_10059527 3300031456 Bacteria 4054
695 Ga0307513_10154193 3300031456 Bacteria 2200
696 Ga0307509_10114290 3300031507 Bacteria 2695
697 Ga0307408_100000006 3300031548 Bacteria 472824
698 Ga0307408_100000140 3300031548 Bacteria 80709
699 Ga0307408_100015385 3300031548 Bacteria 5092
700 Ga0307408_100025904 3300031548 Bacteria 4020
701 Ga0307508_10000107 3300031616 Bacteria 97818
702 Ga0307514_10006915 3300031649 Bacteria 9819
703 Ga0307516_10002030 3300031730 Bacteria 27591
704 Ga0307516_10007929 3300031730 Bacteria 12093
705 Ga0307516_10029384 3300031730 Bacteria 5557
706 Ga0307405_10590910 3300031731 Bacteria 904
707 Ga0307413_10202109 3300031824 Bacteria 1436
708 Ga0307413_10223023 3300031824 Bacteria 1378
709 Ga0307410_10057607 3300031852 Bacteria 2646
710 Ga0307410_10640037 3300031852 Unclassified 891
711 Ga0307406_10025118 3300031901 Bacteria 3564
712 Ga0307407_10232004 3300031903 Bacteria 1254
713 Ga0307412_10003387 3300031911 Bacteria 8858
714 Ga0307416_100061701 3300032002 Bacteria 3061
715 Ga0307416_100242343 3300032002 Bacteria 1748
716 Ga0307416_101043823 3300032002 Bacteria 921
717 Ga0307416_101147549 3300032002 Bacteria 882
718 Ga0307414_10016384 3300032004 Bacteria 4505
719 Ga0307411_10028697 3300032005 Bacteria 3387
720 Ga0307411_10093375 3300032005 Bacteria 2107
721 Ga0307411_10682166 3300032005 Bacteria 893
722 Ga0316212_1000963 3300033547 Unclassified 3766
723 Ga0373948_0002839 3300034817 Bacteria 2601
724 Ga0373950_0007074 3300034818 Bacteria 1731
725 Ga0373926_0055970 3300035083 Bacteria 1430
726 Ga0373934_0067146 3300035086 Bacteria 1432
727 Ga0373940_0010445 3300035088 Bacteria 2182
728 Ga0373940_0097231 3300035088 Bacteria 889
729 Ga0373949_0027316 3300035090 Bacteria 1341
730 Ga0373951_0001888 3300035091 Bacteria 5395
731 Ga0373923_0114125 3300035111 Bacteria 1202
732 Ga0373939_0000224 3300035114 Bacteria 15540
733 Ga0373939_0000948 3300035114 Bacteria 7221
734 Ga0373939_0097919 3300035114 Unclassified 1002
735 Ga0373954_0006248 3300035118 Bacteria 5194
736 Ga0373954_0049581 3300035118 Bacteria 1969
737 Ga0373960_0001470 3300035121 Bacteria 5220
738 Ga0373946_0025368 3300035171 Bacteria 2331
739 Ga0373961_0015507 3300035241 Bacteria 1950
740 Ga0373962_0007884 3300035242 Bacteria 2613
741 Ga0373931_0000233 3300035691 Bacteria 23590
742 Ga0373931_0000962 3300035691 Bacteria 12161
743 Ga0373931_0007872 3300035691 Bacteria 5038
744 Ga0373931_0143600 3300035691 Bacteria 1385
745 Ga0373937_0223295 3300036401 Bacteria 1773
746 Ga0373925_0050089 3300037068 Bacteria 3114
747 Ga0373925_0436537 3300037068 Bacteria 1071
748 Ga0395899_0002978 3300037312 Bacteria 13552
749 Ga0395899_0017472 3300037312 Bacteria 5465
750 Ga0395899_0030197 3300037312 Bacteria 4076
751 Ga0395899_0034829 3300037312 Bacteria 3781
752 Ga0395899_0070045 3300037312 Bacteria 2567
753 Ga0395899_0173363 3300037312 Bacteria 1518
754 Ga0395900_0001085 3300037418 Bacteria 34636
755 Ga0395900_0001906 3300037418 Bacteria 23725
756 Ga0395900_0004368 3300037418 Bacteria 14997
757 Ga0395900_0131598 3300037418 Bacteria 2563
758 Ga0395900_0453057 3300037418 Bacteria 1239
759 Ga0395898_0043556 3300037466 Bacteria 4422
760 Ga0395898_0093100 3300037466 Bacteria 2897
761 Ga0395898_0207317 3300037466 Bacteria 1870
762 Ga0395905_0004973 3300037471 Bacteria 13691
763 Ga0395905_0012391 3300037471 Bacteria 8209
764 Ga0395905_0072079 3300037471 Bacteria 3238
765 Ga0395905_0254715 3300037471 Bacteria 1639
766 Ga0395905_0256136 3300037471 Bacteria 1634
767 Ga0436364_0905352 3300037853 Unclassified 1061
768 Ga0395901_0000307 3300038443 Bacteria 60012
769 Ga0395901_0002559 3300038443 Bacteria 18423
770 Ga0395901_0024867 3300038443 Bacteria 6147
771 Ga0395901_0048856 3300038443 Bacteria 4394
772 Ga0395901_0068069 3300038443 Bacteria 3709
773 Ga0395901_0204556 3300038443 Bacteria 2069
774 Ga0436365_1684313 3300039437 Bacteria 4349
775 Ga0436360_1344729 3300039438 Unclassified 1713
776 Ga0436361_0496436 3300039447 Bacteria 2303
777 Ga0436361_0563588 3300039447 Bacteria 97448
778 Ga0436361_0590082 3300039447 Bacteria 5543
779 Ga0436361_0761139 3300039447 Bacteria 9389
780 Ga0436361_1046788 3300039447 Bacteria 2868
781 Ga0451789_1345118 3300041443 Bacteria 1478
782 Ga0451791_1290972 3300041451 Bacteria 1376
783 Ga0451793_0226805 3300041452 Bacteria 2298
784 Ga0451798_0925854 3300041458 Bacteria 917
785 Ga0451802_1287762 3300041460 Bacteria 1532
786 Ga0451802_1902642 3300041460 Bacteria 1120
787 Ga0451835_0321985 3300041492 Bacteria 916
788 Ga0451853_2760822 3300041512 Bacteria 1171
789 Ga0439433_0005973 3300041999 Bacteria 2617
790 Ga0439437_005601 3300042000 Bacteria 1382
791 Ga0439448_0001451 3300042005 Bacteria 6138
792 Ga0439450_003588 3300042008 Bacteria 2581
793 Ga0439450_005798 3300042008 Bacteria 2192
794 Ga0439455_0038359 3300042012 Bacteria 1218
795 Ga0450917_000304 3300042120 Bacteria 3610
796 Ga0450888_002355 3300042126 Bacteria 1862
797 Ga0450891_004129 3300042129 Bacteria 1366
798 Ga0450904_000113 3300042139 Bacteria 17967
799 Ga0450889_001126 3300042144 Bacteria 2797
800 Ga0439458_0026560 3300042157 Bacteria 1362
801 Ga0450893_0005547 3300042532 Bacteria 2027
802 Ga0451577_0000490 3300042876 Bacteria 67079
803 Ga0451577_0566685 3300042876 Bacteria 1031
804 Ga0466969_0014737 3300044656 Bacteria 4109
805 Ga0466969_0077563 3300044656 Bacteria 1590
806 Ga0466972_0000072 3300044658 Bacteria 98587
807 Ga0466972_0001011 3300044658 Bacteria 13486
808 Ga0466972_0004705 3300044658 Bacteria 6834
809 Ga0466972_0207014 3300044658 Bacteria 918
810 Ga0466965_0008989 3300044683 Bacteria 4635
811 Ga0466965_0013679 3300044683 Bacteria 3831
812 Ga0466965_0019358 3300044683 Bacteria 3268
813 Ga0466965_0030015 3300044683 Bacteria 2647
814 Ga0466965_0032473 3300044683 Bacteria 2549
815 Ga0466965_0040704 3300044683 Bacteria 2288
816 Ga0466965_0048656 3300044683 Bacteria 2101
817 Ga0466965_0189450 3300044683 Bacteria 1087
818 Ga0466966_0003363 3300044684 Bacteria 10545
819 Ga0466966_0046947 3300044684 Bacteria 2755
820 Ga0466966_0052122 3300044684 Bacteria 2600
821 Ga0466966_0226791 3300044684 Bacteria 1127
822 Ga0466966_0238108 3300044684 Bacteria 1097
823 Ga0466961_0087980 3300044693 Bacteria 1962
824 Ga0466961_0117057 3300044693 Bacteria 1674
825 Ga0466961_0173510 3300044693 Bacteria 1340
826 Ga0466961_0216712 3300044693 Bacteria 1180
827 Ga0466963_0107422 3300044694 Bacteria 1914
828 Ga0466963_0230397 3300044694 Bacteria 1298
829 Ga0466964_0000097 3300044706 Bacteria 21037
830 Ga0466964_0054675 3300044706 Bacteria 1646
831 Ga0466964_0065072 3300044706 Bacteria 1526
832 Ga0453684_0000987 3300044712 Bacteria 92919
833 Ga0453684_0150183 3300044712 Bacteria 2770
834 Ga0466971_0045915 3300044719 Bacteria 1962
835 Ga0466971_0066728 3300044719 Bacteria 1630
836 Ga0466968_0000838 3300044735 Bacteria 10735
837 Ga0466968_0001188 3300044735 Bacteria 9222
838 Ga0466968_0010885 3300044735 Bacteria 3534
839 Ga0466968_0090969 3300044735 Bacteria 1352
840 Ga0466970_0074529 3300044765 Bacteria 1827
841 Ga0466957_0000827 3300044842 Bacteria 15809
842 Ga0466957_0029322 3300044842 Bacteria 3280
843 Ga0466957_0072676 3300044842 Bacteria 2130
844 Ga0466959_0003718 3300045049 Bacteria 10076
845 Ga0466959_0014520 3300045049 Bacteria 5727
846 Ga0466959_0056501 3300045049 Bacteria 2863
847 Ga0466959_0107555 3300045049 Bacteria 1993
848 Ga0466959_0140310 3300045049 Bacteria 1708
849 Ga0466959_0162107 3300045049 Bacteria 1571
850 Ga0466959_0230992 3300045049 Bacteria 1280
851 Ga0451576_0158030 3300045051 Bacteria 2365
852 Ga0451576_0221078 3300045051 Bacteria 1977
853 Ga0466958_0010194 3300045836 Bacteria 5255
854 Ga0466958_0030402 3300045836 Bacteria 3208
855 Ga0466958_0063890 3300045836 Bacteria 2245
856 Ga0466958_0077484 3300045836 Bacteria 2041
857 Ga0466958_0414759 3300045836 Bacteria 870
858 Ga0466967_0024676 3300045976 Bacteria 4947
859 Ga0466967_0030592 3300045976 Bacteria 4520
860 Ga0466967_0052296 3300045976 Bacteria 3585
861 Ga0466967_0127800 3300045976 Bacteria 2356
862 Ga0466967_0140326 3300045976 Bacteria 2250
863 Ga0466967_0149306 3300045976 Bacteria 2183
864 Ga0495617_000125 3300046452 Bacteria 50630
865 Ga0495617_011782 3300046452 Bacteria 2983
866 Ga0495627_000325 3300046453 Bacteria 46495
867 Ga0495627_007288 3300046453 Bacteria 4256
868 Ga0495627_011815 3300046453 Bacteria 3118
869 Ga0495590_0000166 3300046457 Bacteria 39657
870 Ga0495590_0002849 3300046457 Bacteria 7124
871 Ga0495590_0006344 3300046457 Bacteria 4621
872 Ga0495591_000149 3300046458 Bacteria 74051
873 Ga0495629_0006820 3300046459 Bacteria 8444
874 Ga0495629_0038992 3300046459 Bacteria 3345
875 Ga0495638_0005648 3300046460 Bacteria 9218
876 Ga0495638_0084022 3300046460 Bacteria 1927
877 Ga0495651_0139605 3300046462 Bacteria 1759
878 Ga0495653_0002884 3300046463 Bacteria 13744
879 Ga0495653_0009399 3300046463 Bacteria 8000
880 Ga0495653_0021151 3300046463 Bacteria 5271
881 Ga0495653_0026777 3300046463 Bacteria 4620
882 Ga0495653_0154429 3300046463 Bacteria 1600
883 Ga0495650_0001100 3300046471 Bacteria 29639
884 Ga0495650_0037741 3300046471 Bacteria 2100
885 Ga0495650_0048197 3300046471 Bacteria 1777
886 Ga0495580_0025056 3300046472 Bacteria 4361
887 Ga0495580_0027291 3300046472 Bacteria 4155
888 Ga0495580_0035556 3300046472 Bacteria 3582
889 Ga0495580_0375186 3300046472 Bacteria 961
890 Ga0495582_0000662 3300046473 Bacteria 18974
891 Ga0495582_0009678 3300046473 Bacteria 5308
892 Ga0495605_0000725 3300046474 Bacteria 24295
893 Ga0495605_0000845 3300046474 Bacteria 21424
894 Ga0495605_0007379 3300046474 Bacteria 6242
895 Ga0495605_0019429 3300046474 Bacteria 3628
896 Ga0495605_0029687 3300046474 Bacteria 2809
897 Ga0495605_0029689 3300046474 Bacteria 2809
898 Ga0495605_0050785 3300046474 Bacteria 2021
899 Ga0495605_0059238 3300046474 Bacteria 1839
900 Ga0495605_0104487 3300046474 Bacteria 1298
901 Ga0495605_0107446 3300046474 Bacteria 1276
902 Ga0495639_0081874 3300046475 Bacteria 1504
903 Ga0495584_0000417 3300046491 Bacteria 29344
904 Ga0495584_0000820 3300046491 Bacteria 20419
905 Ga0495584_0002513 3300046491 Bacteria 10392
906 Ga0495584_0004515 3300046491 Bacteria 7474
907 Ga0495584_0018617 3300046491 Bacteria 3530
908 Ga0495584_0019660 3300046491 Bacteria 3431
909 Ga0495584_0027008 3300046491 Bacteria 2908
910 Ga0495584_0033942 3300046491 Bacteria 2581
911 Ga0495584_0037339 3300046491 Bacteria 2455
912 Ga0495584_0089264 3300046491 Bacteria 1554
913 Ga0495584_0129974 3300046491 Bacteria 1277
914 Ga0495584_0195744 3300046491 Bacteria 1027
915 Ga0495585_0002621 3300046492 Bacteria 12677
916 Ga0495585_0004000 3300046492 Bacteria 9711
917 Ga0495585_0004922 3300046492 Bacteria 8545
918 Ga0495585_0007278 3300046492 Bacteria 6794
919 Ga0495585_0009447 3300046492 Bacteria 5849
920 Ga0495585_0012348 3300046492 Bacteria 5033
921 Ga0495585_0015200 3300046492 Bacteria 4473
922 Ga0495585_0015519 3300046492 Bacteria 4427
923 Ga0495585_0016706 3300046492 Bacteria 4251
924 Ga0495585_0017877 3300046492 Bacteria 4091
925 Ga0495585_0029378 3300046492 Bacteria 3129
926 Ga0495585_0038815 3300046492 Bacteria 2679
927 Ga0495585_0043551 3300046492 Bacteria 2509
928 Ga0495585_0259460 3300046492 Bacteria 864
929 Ga0495594_0006433 3300046499 Bacteria 6043
930 Ga0495594_0008151 3300046499 Bacteria 5390
931 Ga0495594_0027401 3300046499 Bacteria 3070
932 Ga0495594_0051421 3300046499 Bacteria 2267
933 Ga0495594_0053067 3300046499 Bacteria 2232
934 Ga0495594_0117610 3300046499 Bacteria 1501
935 Ga0495594_0133179 3300046499 Bacteria 1408
936 Ga0495596_0000442 3300046500 Bacteria 26554
937 Ga0495596_0000863 3300046500 Bacteria 18275
938 Ga0495596_0002569 3300046500 Bacteria 9650
939 Ga0495596_0005420 3300046500 Bacteria 6029
940 Ga0495596_0005727 3300046500 Bacteria 5832
941 Ga0495596_0006378 3300046500 Bacteria 5438
942 Ga0495596_0006897 3300046500 Bacteria 5175
943 Ga0495596_0014671 3300046500 Bacteria 3298
944 Ga0495596_0016650 3300046500 Bacteria 3051
945 Ga0495596_0019749 3300046500 Bacteria 2764
946 Ga0495596_0031922 3300046500 Bacteria 2101
947 Ga0495596_0046697 3300046500 Bacteria 1700
948 Ga0495596_0082920 3300046500 Bacteria 1244
949 Ga0495607_0001392 3300046501 Bacteria 21517
950 Ga0495607_0001408 3300046501 Bacteria 21405
951 Ga0495607_0002063 3300046501 Bacteria 16805
952 Ga0495607_0005724 3300046501 Bacteria 8848
953 Ga0495607_0018695 3300046501 Bacteria 4411
954 Ga0495607_0027250 3300046501 Bacteria 3536
955 Ga0495607_0027417 3300046501 Bacteria 3522
956 Ga0495607_0035999 3300046501 Bacteria 2988
957 Ga0495607_0072115 3300046501 Bacteria 1924
958 Ga0495607_0092582 3300046501 Bacteria 1635
959 Ga0495583_0000144 3300046506 Bacteria 121268
960 Ga0495583_0000200 3300046506 Bacteria 100827
961 Ga0495583_0000217 3300046506 Bacteria 96747
962 Ga0495583_0001216 3300046506 Bacteria 27432
963 Ga0495583_0002127 3300046506 Bacteria 17732
964 Ga0495583_0002154 3300046506 Bacteria 17591
965 Ga0495583_0002410 3300046506 Bacteria 16071
966 Ga0495583_0003295 3300046506 Bacteria 12520
967 Ga0495583_0004038 3300046506 Bacteria 10800
968 Ga0495583_0009165 3300046506 Bacteria 5946
969 Ga0495583_0016673 3300046506 Bacteria 3937
970 Ga0495583_0019228 3300046506 Bacteria 3570
971 Ga0495583_0023216 3300046506 Bacteria 3142
972 Ga0495583_0100455 3300046506 Bacteria 1235
973 Ga0495606_0005844 3300046507 Bacteria 11604
974 Ga0495606_0011722 3300046507 Bacteria 7114
975 Ga0495606_0036866 3300046507 Bacteria 3326
976 Ga0495606_0037150 3300046507 Bacteria 3309
977 Ga0495606_0041518 3300046507 Bacteria 3084
978 Ga0495606_0044217 3300046507 Bacteria 2964
979 Ga0495606_0098994 3300046507 Bacteria 1778
980 Ga0495606_0210819 3300046507 Bacteria 1100
981 Ga0495608_0182076 3300046511 Unclassified 1329
982 Ga0495610_0000876 3300046512 Bacteria 28094
983 Ga0495610_0011457 3300046512 Bacteria 5420
984 Ga0495610_0110177 3300046512 Bacteria 1220
985 Ga0495616_0000126 3300046513 Bacteria 66696
986 Ga0495616_0000227 3300046513 Bacteria 46305
987 Ga0495616_0000786 3300046513 Bacteria 23181
988 Ga0495616_0010067 3300046513 Bacteria 5487
989 Ga0495616_0011469 3300046513 Bacteria 5075
990 Ga0495616_0015340 3300046513 Bacteria 4260
991 Ga0495616_0016359 3300046513 Bacteria 4107
992 Ga0495616_0026462 3300046513 Bacteria 3087
993 Ga0495616_0026491 3300046513 Bacteria 3084
994 Ga0495616_0030858 3300046513 Bacteria 2811
995 Ga0495616_0080904 3300046513 Bacteria 1554
996 Ga0495616_0082045 3300046513 Bacteria 1540
997 Ga0495616_0103351 3300046513 Bacteria 1333
998 Ga0495616_0107351 3300046513 Bacteria 1301
999 Ga0495616_0162821 3300046513 Bacteria 1002
1000 Ga0495616_0286784 3300046513 Bacteria 698
1001 Ga0495620_0031194 3300046515 Bacteria 2445
1002 Ga0495630_0012504 3300046517 Bacteria 6165
1003 Ga0495630_0021661 3300046517 Bacteria 4746
1004 Ga0495630_0040007 3300046517 Bacteria 3504
1005 Ga0495630_0190703 3300046517 Bacteria 1564
1006 Ga0495631_0000342 3300046518 Bacteria 32071
1007 Ga0495631_0000501 3300046518 Bacteria 26200
1008 Ga0495631_0001168 3300046518 Bacteria 16231
1009 Ga0495631_0002960 3300046518 Bacteria 9402
1010 Ga0495631_0003047 3300046518 Bacteria 9260
1011 Ga0495631_0005084 3300046518 Bacteria 6928
1012 Ga0495631_0007296 3300046518 Bacteria 5631
1013 Ga0495631_0010064 3300046518 Bacteria 4698
1014 Ga0495631_0011340 3300046518 Bacteria 4385
1015 Ga0495631_0030184 3300046518 Bacteria 2460
1016 Ga0495631_0126919 3300046518 Bacteria 1096
1017 Ga0495632_0000195 3300046519 Bacteria 61419
1018 Ga0495632_0000391 3300046519 Bacteria 41120
1019 Ga0495632_0000757 3300046519 Bacteria 29021
1020 Ga0495632_0001773 3300046519 Bacteria 17428
1021 Ga0495632_0007690 3300046519 Bacteria 6730
1022 Ga0495632_0008015 3300046519 Bacteria 6554
1023 Ga0495632_0009140 3300046519 Bacteria 5990
1024 Ga0495632_0021495 3300046519 Bacteria 3476
1025 Ga0495632_0120328 3300046519 Bacteria 1227
1026 Ga0495632_0131815 3300046519 Bacteria 1163
1027 Ga0495637_0000014 3300046520 Bacteria 228956
1028 Ga0495637_0003657 3300046520 Bacteria 8140
1029 Ga0495643_0000171 3300046522 Bacteria 103167
1030 Ga0495643_0001865 3300046522 Bacteria 17871
1031 Ga0495643_0003366 3300046522 Bacteria 11776
1032 Ga0495643_0004555 3300046522 Bacteria 9654
1033 Ga0495643_0017614 3300046522 Bacteria 4172
1034 Ga0495643_0021828 3300046522 Bacteria 3664
1035 Ga0495643_0058358 3300046522 Bacteria 2054
1036 Ga0495643_0061391 3300046522 Bacteria 1993
1037 Ga0495643_0077063 3300046522 Bacteria 1742
1038 Ga0495644_0002262 3300046523 Bacteria 7703
1039 Ga0495644_0004151 3300046523 Bacteria 5695
1040 Ga0495644_0007576 3300046523 Bacteria 4184
1041 Ga0495644_0007682 3300046523 Bacteria 4158
1042 Ga0495644_0009852 3300046523 Bacteria 3678
1043 Ga0495644_0031758 3300046523 Bacteria 1996
1044 Ga0495648_0000612 3300046524 Bacteria 38167
1045 Ga0495648_0004164 3300046524 Bacteria 12440
1046 Ga0495648_0007541 3300046524 Bacteria 8696
1047 Ga0495648_0009116 3300046524 Bacteria 7737
1048 Ga0495648_0011285 3300046524 Bacteria 6744
1049 Ga0495648_0014828 3300046524 Bacteria 5678
1050 Ga0495648_0015940 3300046524 Bacteria 5430
1051 Ga0495648_0083205 3300046524 Bacteria 1814
1052 Ga0495648_0190341 3300046524 Bacteria 1035
1053 Ga0495663_0004646 3300046525 Bacteria 3848
1054 Ga0495663_0006091 3300046525 Bacteria 3336
1055 Ga0495666_0003941 3300046526 Bacteria 7502
1056 Ga0495666_0036806 3300046526 Bacteria 2382
1057 Ga0495642_0000515 3300046528 Bacteria 19938
1058 Ga0495642_0000729 3300046528 Bacteria 16345
1059 Ga0495642_0001661 3300046528 Bacteria 9634
1060 Ga0495642_0005838 3300046528 Bacteria 4723
1061 Ga0495642_0007429 3300046528 Bacteria 4199
1062 Ga0495642_0008099 3300046528 Bacteria 4022
1063 Ga0495642_0010769 3300046528 Bacteria 3503
1064 Ga0495642_0011184 3300046528 Bacteria 3442
1065 Ga0495642_0013639 3300046528 Bacteria 3147
1066 Ga0495642_0025739 3300046528 Bacteria 2333
1067 Ga0495642_0056465 3300046528 Bacteria 1622
1068 Ga0495642_0058961 3300046528 Bacteria 1590
1069 Ga0495652_0033257 3300046529 Bacteria 4503
1070 Ga0495652_0037308 3300046529 Bacteria 4217
1071 Ga0495652_0434559 3300046529 Unclassified 922
1072 Ga0495654_0005529 3300046530 Bacteria 7321
1073 Ga0495654_0008911 3300046530 Bacteria 5513
1074 Ga0495654_0008988 3300046530 Bacteria 5485
1075 Ga0495654_0069302 3300046530 Bacteria 1675
1076 Ga0495665_0002306 3300046531 Bacteria 10307
1077 Ga0495665_0002338 3300046531 Bacteria 10242
1078 Ga0495665_0044871 3300046531 Bacteria 2348
1079 Ga0495665_0178365 3300046531 Bacteria 1104
1080 Ga0495586_0013981 3300046535 Bacteria 4259
1081 Ga0495586_0028693 3300046535 Bacteria 2977
1082 Ga0495586_0114694 3300046535 Bacteria 1501
1083 Ga0495587_0011337 3300046536 Bacteria 5649
1084 Ga0495587_0015833 3300046536 Bacteria 4700
1085 Ga0495587_0108545 3300046536 Bacteria 1595
1086 Ga0495598_0031523 3300046537 Bacteria 1492
1087 Ga0495609_0000028 3300046538 Bacteria 219908
1088 Ga0495609_0001293 3300046538 Bacteria 17074
1089 Ga0495609_0011460 3300046538 Bacteria 4221
1090 Ga0495609_0012174 3300046538 Bacteria 4080
1091 Ga0495609_0014596 3300046538 Bacteria 3690
1092 Ga0495609_0030033 3300046538 Bacteria 2473
1093 Ga0495609_0037371 3300046538 Bacteria 2190
1094 Ga0495597_0000793 3300046542 Bacteria 24960
1095 Ga0495597_0004145 3300046542 Bacteria 8045
1096 Ga0495597_0006507 3300046542 Bacteria 6031
1097 Ga0495597_0020247 3300046542 Bacteria 3100
1098 Ga0495597_0024241 3300046542 Bacteria 2802
1099 Ga0495597_0042303 3300046542 Bacteria 2032
1100 Ga0495597_0058665 3300046542 Bacteria 1681
1101 Ga0495597_0150141 3300046542 Bacteria 956
1102 Ga0495645_0020763 3300046543 Bacteria 4744
1103 Ga0495622_0006298 3300046557 Bacteria 5511
1104 Ga0495622_0006406 3300046557 Bacteria 5462
1105 Ga0495622_0108744 3300046557 Bacteria 1269
1106 Ga0495633_0001203 3300046558 Bacteria 20819
1107 Ga0495633_0004585 3300046558 Bacteria 8716
1108 Ga0495633_0009782 3300046558 Bacteria 5269
1109 Ga0495633_0021899 3300046558 Bacteria 3190
1110 Ga0495633_0066402 3300046558 Bacteria 1684
1111 Ga0495633_0086147 3300046558 Bacteria 1461
1112 Ga0495633_0117129 3300046558 Bacteria 1234
1113 Ga0495656_0001345 3300046615 Bacteria 8014
1114 Ga0495656_0010316 3300046615 Bacteria 3392
1115 Ga0495668_0000318 3300046616 Bacteria 66017
1116 Ga0495668_0003076 3300046616 Bacteria 12908
1117 Ga0495668_0004892 3300046616 Bacteria 9303
1118 Ga0495668_0014737 3300046616 Bacteria 4577
1119 Ga0495668_0018328 3300046616 Bacteria 4045
1120 Ga0495668_0022609 3300046616 Bacteria 3593
1121 Ga0495668_0029648 3300046616 Bacteria 3090
1122 Ga0495668_0031522 3300046616 Bacteria 2987
1123 Ga0495668_0033852 3300046616 Bacteria 2869
1124 Ga0495668_0036134 3300046616 Bacteria 2769
1125 Ga0495668_0059992 3300046616 Bacteria 2099
1126 Ga0495668_0094581 3300046616 Bacteria 1636
1127 Ga0495668_0111172 3300046616 Bacteria 1499
1128 Ga0495668_0122367 3300046616 Bacteria 1423
1129 Ga0495668_0145154 3300046616 Bacteria 1299
1130 Ga0495634_0011085 3300046642 Bacteria 6576
1131 Ga0495634_0148362 3300046642 Bacteria 1485
1132 Ga0495611_0001329 3300046648 Bacteria 12532
1133 Ga0495611_0002853 3300046648 Bacteria 7726
1134 Ga0495611_0009912 3300046648 Bacteria 4032
1135 Ga0495611_0011261 3300046648 Bacteria 3792
1136 Ga0495611_0012978 3300046648 Bacteria 3542
1137 Ga0495611_0023156 3300046648 Bacteria 2693
1138 Ga0495625_0001217 3300046660 Bacteria 32653
1139 Ga0495625_0006720 3300046660 Bacteria 10196
1140 Ga0495625_0013252 3300046660 Bacteria 6634
1141 Ga0495625_0033624 3300046660 Bacteria 3789
1142 Ga0495625_0048308 3300046660 Bacteria 3065
1143 Ga0495625_0050976 3300046660 Bacteria 2968
1144 Ga0495625_0090934 3300046660 Bacteria 2110
1145 Ga0495659_0004919 3300046664 Bacteria 4205
1146 Ga0495661_0000682 3300046665 Bacteria 33847
1147 Ga0495661_0000805 3300046665 Bacteria 29621
1148 Ga0495661_0001495 3300046665 Bacteria 19464
1149 Ga0495661_0001512 3300046665 Bacteria 19353
1150 Ga0495661_0002426 3300046665 Bacteria 14350
1151 Ga0495661_0003500 3300046665 Bacteria 11565
1152 Ga0495661_0004095 3300046665 Bacteria 10621
1153 Ga0495661_0008507 3300046665 Bacteria 7095
1154 Ga0495661_0016379 3300046665 Bacteria 4915
1155 Ga0495661_0031851 3300046665 Bacteria 3338
1156 Ga0495661_0035128 3300046665 Bacteria 3149
1157 Ga0495661_0039001 3300046665 Bacteria 2954
1158 Ga0495661_0048803 3300046665 Bacteria 2570
1159 Ga0495661_0064418 3300046665 Bacteria 2162
1160 Ga0495661_0091666 3300046665 Bacteria 1728
1161 Ga0495661_0129034 3300046665 Bacteria 1387
1162 Ga0495588_0000259 3300046674 Bacteria 43325
1163 Ga0495588_0005996 3300046674 Bacteria 5452
1164 Ga0495588_0010296 3300046674 Bacteria 4344
1165 Ga0495588_0013104 3300046674 Bacteria 3941
1166 Ga0495588_0042649 3300046674 Bacteria 2320
1167 Ga0495588_0060609 3300046674 Bacteria 1958
1168 Ga0495588_0088846 3300046674 Bacteria 1617
1169 Ga0495588_0158297 3300046674 Bacteria 1197
1170 Ga0495588_0161904 3300046674 Bacteria 1183
1171 Ga0495623_0029342 3300046679 Bacteria 3539
1172 Ga0495623_0047536 3300046679 Bacteria 2724
1173 Ga0495623_0160914 3300046679 Bacteria 1319
1174 Ga0495658_0095535 3300046683 Bacteria 1767
1175 Ga0495669_0000328 3300046684 Bacteria 25643
1176 Ga0495669_0004475 3300046684 Bacteria 5773
1177 Ga0495669_0006151 3300046684 Bacteria 5006
1178 Ga0495669_0006817 3300046684 Bacteria 4780
1179 Ga0495669_0007018 3300046684 Bacteria 4714
1180 Ga0495669_0007342 3300046684 Bacteria 4618
1181 Ga0495669_0008646 3300046684 Bacteria 4285
1182 Ga0495669_0013315 3300046684 Bacteria 3503
1183 Ga0495669_0092966 3300046684 Bacteria 1394
1184 Ga0495613_0340180 3300046689 Bacteria 1032
1185 Ga0495624_0050037 3300046690 Bacteria 2648
1186 Ga0495670_0001980 3300046691 Bacteria 10054
1187 Ga0495670_0014690 3300046691 Bacteria 3851
1188 Ga0495670_0017210 3300046691 Bacteria 3557
1189 Ga0495670_0049330 3300046691 Bacteria 2106
1190 Ga0495670_0089365 3300046691 Bacteria 1575
1191 Ga0495670_0099077 3300046691 Bacteria 1499
1192 Ga0495670_0119812 3300046691 Bacteria 1367
1193 Ga0495671_0001884 3300046692 Bacteria 13473
1194 Ga0495671_0005590 3300046692 Bacteria 7335
1195 Ga0495671_0008602 3300046692 Bacteria 5732
1196 Ga0495671_0010066 3300046692 Bacteria 5258
1197 Ga0495671_0013583 3300046692 Bacteria 4403
1198 Ga0495671_0099882 3300046692 Bacteria 1419
1199 Ga0495671_0165840 3300046692 Bacteria 1074
1200 Ga0495649_0000068 3300046694 Bacteria 92317
1201 Ga0495649_0000595 3300046694 Bacteria 30203
1202 Ga0495649_0000911 3300046694 Bacteria 23367
1203 Ga0495649_0002466 3300046694 Bacteria 13009
1204 Ga0495649_0019571 3300046694 Bacteria 3803
1205 Ga0495649_0039794 3300046694 Bacteria 2577
1206 Ga0495649_0118817 3300046694 Bacteria 1399
1207 Ga0495589_0000309 3300046794 Bacteria 38979
1208 Ga0495589_0000407 3300046794 Bacteria 32420
1209 Ga0495589_0000903 3300046794 Bacteria 18338
1210 Ga0495589_0001297 3300046794 Bacteria 14743
1211 Ga0495589_0013553 3300046794 Bacteria 4204
1212 Ga0495589_0016551 3300046794 Bacteria 3789
1213 Ga0495589_0018426 3300046794 Bacteria 3578
1214 Ga0495589_0025560 3300046794 Bacteria 2996
1215 Ga0495589_0029994 3300046794 Bacteria 2740
1216 Ga0495589_0136047 3300046794 Bacteria 1178
1217 Ga0495600_0122737 3300046809 Bacteria 1689
1218 Ga0495600_0296556 3300046809 Bacteria 1021
1219 Ga0495660_0000734 3300046810 Bacteria 24893
1220 Ga0495660_0005935 3300046810 Bacteria 7275
1221 Ga0495660_0006198 3300046810 Bacteria 7099
1222 Ga0495660_0009695 3300046810 Bacteria 5610
1223 Ga0495660_0016643 3300046810 Bacteria 4238
1224 Ga0495660_0039188 3300046810 Bacteria 2632
1225 Ga0495660_0059921 3300046810 Bacteria 2046
1226 Ga0495581_0004794 3300047315 Bacteria 7818
1227 Ga0495581_0005818 3300047315 Bacteria 7149
1228 Ga0495581_0067179 3300047315 Bacteria 2073
1229 Ga0495581_0090651 3300047315 Bacteria 1773
1230 Ga0495581_0179417 3300047315 Bacteria 1238
1231 Ga0495604_0014594 3300047317 Bacteria 6261
1232 Ga0495604_0027123 3300047317 Bacteria 4557
1233 Ga0495604_0083696 3300047317 Bacteria 2383
1234 Ga0495604_0091241 3300047317 Bacteria 2260
1235 Ga0495636_0004008 3300047318 Bacteria 5756
1236 Ga0495636_0049277 3300047318 Bacteria 1761
1237 Ga0495636_0103562 3300047318 Bacteria 1247
1238 Ga0495674_0003295 3300047319 Bacteria 15683
1239 Ga0495674_0146882 3300047319 Bacteria 1979
1240 Ga0495672_0000140 3300047320 Bacteria 106637
1241 Ga0495672_0000777 3300047320 Bacteria 34668
1242 Ga0495672_0000865 3300047320 Bacteria 31951
1243 Ga0495672_0001198 3300047320 Bacteria 26215
1244 Ga0495672_0013872 3300047320 Bacteria 5540
1245 Ga0495676_0000100 3300047321 Bacteria 65339
1246 Ga0495676_0000639 3300047321 Bacteria 29038
1247 Ga0495680_0014119 3300047322 Bacteria 6937
1248 Ga0495680_0022854 3300047322 Bacteria 5207
1249 Ga0495680_0066489 3300047322 Bacteria 2759
1250 Ga0495683_0000499 3300047323 Bacteria 30330
1251 Ga0495683_0001842 3300047323 Bacteria 13316
1252 Ga0495683_0006464 3300047323 Bacteria 6405
1253 Ga0495683_0011901 3300047323 Bacteria 4574
1254 Ga0495683_0012472 3300047323 Bacteria 4459
1255 Ga0495683_0040118 3300047323 Bacteria 2365
1256 Ga0495683_0066186 3300047323 Bacteria 1781
1257 Ga0495683_0180288 3300047323 Bacteria 965
1258 Ga0495687_000253 3300047443 Bacteria 71917
1259 Ga0495687_000288 3300047443 Bacteria 66346
1260 Ga0495687_000656 3300047443 Bacteria 39649
1261 Ga0495687_000829 3300047443 Bacteria 33057
1262 Ga0495687_000866 3300047443 Bacteria 32045
1263 Ga0495687_002113 3300047443 Bacteria 16645
1264 Ga0495675_0008125 3300047444 Bacteria 6492
1265 Ga0495675_0052895 3300047444 Bacteria 2578
1266 Ga0495675_0063701 3300047444 Bacteria 2332
1267 Ga0495677_0000143 3300047445 Bacteria 34260
1268 Ga0495677_0000257 3300047445 Bacteria 23318
1269 Ga0495677_0000770 3300047445 Bacteria 12903
1270 Ga0495677_0001181 3300047445 Bacteria 10458
1271 Ga0495677_0003090 3300047445 Bacteria 6481
1272 Ga0495677_0003795 3300047445 Bacteria 5843
1273 Ga0495677_0009163 3300047445 Bacteria 3658
1274 Ga0495677_0009263 3300047445 Bacteria 3638
1275 Ga0495677_0014086 3300047445 Bacteria 2912
1276 Ga0495677_0014771 3300047445 Bacteria 2840
1277 Ga0495677_0030368 3300047445 Bacteria 1966
1278 Ga0495679_005544 3300047446 Bacteria 5577
1279 Ga0495679_006181 3300047446 Bacteria 5201
1280 Ga0495685_004973 3300047447 Bacteria 4322
1281 Ga0495685_012637 3300047447 Bacteria 2861
1282 Ga0495685_016362 3300047447 Bacteria 2533
1283 Ga0495681_0000511 3300047470 Bacteria 29544
1284 Ga0495681_0004519 3300047470 Bacteria 9486
1285 Ga0495681_0007323 3300047470 Bacteria 7070
1286 Ga0495681_0007880 3300047470 Bacteria 6735
1287 Ga0495681_0011042 3300047470 Bacteria 5414
1288 Ga0495681_0014050 3300047470 Bacteria 4613
1289 Ga0495681_0021427 3300047470 Bacteria 3483
1290 Ga0495681_0132894 3300047470 Bacteria 1057
1291 Ga0495686_0000285 3300047472 Bacteria 88880
1292 Ga0495686_0002310 3300047472 Bacteria 18237
1293 Ga0495686_0006705 3300047472 Bacteria 8759
1294 Ga0495686_0027657 3300047472 Bacteria 3701
1295 Ga0495686_0045808 3300047472 Bacteria 2766
1296 Ga0495686_0062322 3300047472 Bacteria 2313
1297 Ga0495686_0095539 3300047472 Bacteria 1800
1298 Ga0495593_0019690 3300047673 Bacteria 3782
1299 Ga0495593_0059720 3300047673 Bacteria 1997
1300 Ga0495602_0001988 3300048088 Bacteria 20511
1301 Ga0495614_0022782 3300048089 Bacteria 2700
1302 Ga0495614_0023201 3300048089 Bacteria 2676
1303 Ga0495626_0000292 3300048091 Bacteria 53923
1304 Ga0495626_0000613 3300048091 Bacteria 34843
1305 Ga0495626_0001135 3300048091 Bacteria 22262
1306 Ga0495626_0002631 3300048091 Bacteria 12216
1307 Ga0495626_0002852 3300048091 Bacteria 11539
1308 Ga0495626_0004684 3300048091 Bacteria 8299
1309 Ga0495626_0007031 3300048091 Bacteria 6320
1310 Ga0495626_0007060 3300048091 Bacteria 6300
1311 Ga0495626_0009023 3300048091 Bacteria 5407
1312 Ga0495626_0010170 3300048091 Bacteria 5045
1313 Ga0495626_0011436 3300048091 Bacteria 4694
1314 Ga0495626_0023223 3300048091 Bacteria 3056
1315 Ga0495626_0031585 3300048091 Bacteria 2547
1316 Ga0495626_0041572 3300048091 Bacteria 2164
1317 Ga0495626_0041615 3300048091 Bacteria 2162
1318 Ga0495626_0046013 3300048091 Bacteria 2034
1319 Ga0495626_0095325 3300048091 Bacteria 1303
1320 Ga0496102_0001005 3300048905 Bacteria 26461
1321 Ga0496102_0061189 3300048905 Bacteria 3445
1322 Ga0496102_0299954 3300048905 Bacteria 1514
1323 Ga0496103_0048845 3300048906 Bacteria 2616
1324 Ga0496103_0177770 3300048906 Bacteria 1367
1325 Ga0496104_0013974 3300048907 Bacteria 7243
1326 Ga0496104_0072768 3300048907 Bacteria 3269
1327 Ga0496104_0076174 3300048907 Bacteria 3195
1328 Ga0496104_0129352 3300048907 Bacteria 2425
1329 Ga0496104_0285282 3300048907 Bacteria 1564
1330 Ga0496104_0642085 3300048907 Bacteria 971
1331 Ga0496105_0004007 3300048908 Bacteria 11021
1332 Ga0496105_0102484 3300048908 Bacteria 2364
1333 Ga0496105_0442394 3300048908 Bacteria 1027
1334 Ga0496106_0010926 3300048909 Bacteria 6711
1335 Ga0496106_0210985 3300048909 Bacteria 1547
1336 Ga0496109_0006786 3300048912 Bacteria 9645
1337 Ga0496109_0453714 3300048912 Bacteria 1211
1338 Ga0496109_0545671 3300048912 Bacteria 1094
1339 Ga0496109_0571652 3300048912 Bacteria 1066
1340 Ga0496110_0000641 3300048913 Bacteria 23992
1341 Ga0496110_0005948 3300048913 Bacteria 9600
1342 Ga0496110_0320276 3300048913 Bacteria 1412
1343 Ga0496111_0004898 3300048914 Bacteria 8505
1344 Ga0496111_0449360 3300048914 Bacteria 951
1345 Ga0496112_0023445 3300048915 Bacteria 5897
1346 Ga0496112_0116116 3300048915 Bacteria 2647
1347 Ga0496113_0009852 3300048916 Bacteria 6291
1348 Ga0496115_0007458 3300048918 Bacteria 8049
1349 Ga0496115_0219241 3300048918 Bacteria 1570
1350 Ga0496122_0001645 3300048925 Bacteria 34677
1351 Ga0496122_0004436 3300048925 Bacteria 17417
1352 Ga0496123_0002540 3300048926 Bacteria 22349
1353 Ga0496123_0005998 3300048926 Bacteria 11947
1354 Ga0496123_0045219 3300048926 Bacteria 3002
1355 Ga0496124_0211724 3300048927 Bacteria 1466
1356 Ga0496125_0001339 3300048928 Bacteria 36299
1357 Ga0496125_0349408 3300048928 Bacteria 884
1358 Ga0495678_000230 3300049459 Bacteria 64445
1359 Ga0495678_000244 3300049459 Bacteria 61112
1360 Ga0495678_001100 3300049459 Bacteria 22780
1361 Ga0495678_001526 3300049459 Bacteria 17891
1362 Ga0495678_007687 3300049459 Bacteria 5558
1363 Ga0495682_0000987 3300049460 Bacteria 16949
1364 Ga0495682_0004089 3300049460 Bacteria 6339
1365 Ga0495682_0009652 3300049460 Bacteria 3762
1366 Ga0495682_0021110 3300049460 Bacteria 2442
1367 Ga0501291_030416 3300049514 Bacteria 908
1368 Ga0501031_0039432 3300049568 Bacteria 3082
1369 Ga0501031_0044131 3300049568 Bacteria 2909
1370 Ga0501032_0010578 3300049569 Bacteria 6652
1371 Ga0501032_0038231 3300049569 Bacteria 3270
1372 Ga0501033_0002781 3300049570 Bacteria 14664
1373 Ga0501033_0030331 3300049570 Bacteria 4064
1374 Ga0501034_0002575 3300049571 Bacteria 21577
1375 Ga0501034_0025960 3300049571 Bacteria 5967
1376 Ga0501034_0072335 3300049571 Bacteria 3457
1377 Ga0501034_0082596 3300049571 Bacteria 3214
1378 Ga0501034_0215112 3300049571 Bacteria 1876
1379 Ga0501036_0015924 3300049572 Bacteria 6279
1380 Ga0501036_0017771 3300049572 Bacteria 5954
1381 Ga0501037_0009766 3300049573 Bacteria 7046
1382 Ga0501038_0045631 3300049574 Bacteria 3803
1383 Ga0501038_0051438 3300049574 Bacteria 3555
1384 Ga0501039_0062588 3300049575 Bacteria 2883
1385 Ga0501042_0513438 3300049578 Bacteria 870
1386 Ga0501043_0014217 3300049579 Bacteria 6228
1387 Ga0501043_0017144 3300049579 Bacteria 5680
1388 Ga0501046_0003771 3300049580 Bacteria 13876
1389 Ga0501046_0034804 3300049580 Bacteria 4062
1390 Ga0501047_0020003 3300049581 Bacteria 6426
1391 Ga0501047_0044284 3300049581 Bacteria 4299
1392 Ga0501047_0083347 3300049581 Bacteria 3073
1393 Ga0501047_0097691 3300049581 Bacteria 2815
1394 Ga0501048_0002543 3300049582 Bacteria 13959
1395 Ga0501048_0029999 3300049582 Bacteria 3939
1396 Ga0501068_0003114 3300049584 Bacteria 8865
1397 Ga0501068_0009245 3300049584 Bacteria 5509
1398 Ga0501069_0007518 3300049585 Bacteria 5720
1399 Ga0501069_0016457 3300049585 Bacteria 3973
1400 Ga0501070_0018373 3300049586 Bacteria 5866
1401 Ga0501070_0130332 3300049586 Bacteria 2077
1402 Ga0501073_0010780 3300049589 Bacteria 6693
1403 Ga0501073_0035014 3300049589 Bacteria 3570
1404 Ga0501074_0038573 3300049590 Bacteria 3461
1405 Ga0501076_0025946 3300049592 Bacteria 4537
1406 Ga0501201_002058 3300049651 Bacteria 1851
1407 Ga0501211_007739 3300049658 Bacteria 1051
1408 Ga0501223_045817 3300049663 Bacteria 849
1409 Ga0501227_003631 3300049665 Bacteria 3342
1410 Ga0501235_009392 3300049669 Bacteria 2138
1411 Ga0501079_0018676 3300049741 Bacteria 5297
1412 Ga0501079_0021225 3300049741 Bacteria 4966
1413 Ga0501080_0017753 3300049742 Bacteria 6584
1414 Ga0501080_0104371 3300049742 Bacteria 2628
1415 Ga0501081_0443174 3300049743 Bacteria 964
1416 Ga0501083_0030960 3300049744 Bacteria 3672
1417 Ga0501083_0073583 3300049744 Bacteria 2271
1418 Ga0501262_016440 3300049759 Bacteria 979
1419 Ga0501264_005389 3300049761 Bacteria 1166
1420 Ga0501267_001826 3300049764 Bacteria 1865
1421 Ga0501271_002473 3300049768 Bacteria 1651
1422 Ga0501272_003078 3300049769 Bacteria 1678
1423 Ga0501279_015204 3300049775 Bacteria 1064
1424 Ga0501035_0000789 3300049822 Bacteria 33899
1425 Ga0501035_0023555 3300049822 Bacteria 5648
1426 Ga0501035_0187718 3300049822 Bacteria 1778
1427 Ga0501044_0089065 3300049823 Bacteria 3115
1428 Ga0501044_0131410 3300049823 Bacteria 2497
1429 Ga0501045_0003433 3300049824 Bacteria 10841
1430 Ga0501226_002698 3300049853 Bacteria 2145
1431 nmdc:mga03683_25437_c1 3300050489 Bacteria 2326
1432 nmdc:mga0k408_189169_c1 3300050493 Bacteria 1228
1433 nmdc:mga0k408_273426_c1 3300050493 Bacteria 1009
1434 nmdc:mga0k408_2817_c1 3300050493 Bacteria 9230
1435 nmdc:mga0k408_67533_c1 3300050493 Bacteria 2084
1436 nmdc:mga06z11_3237_c1 3300050494 Bacteria 6292
1437 nmdc:mga06z11_427815_c1 3300050494 Bacteria 798
1438 nmdc:mga07m45_107955_c1 3300050496 Bacteria 1601
1439 nmdc:mga07m45_108288_c1 3300050496 Bacteria 1599
1440 nmdc:mga07m45_14749_c1 3300050496 Bacteria 4170
1441 nmdc:mga07m45_1739_c1 3300050496 Bacteria 10020
1442 nmdc:mga07m45_17812_c1 3300050496 Bacteria 3822
1443 nmdc:mga07m45_2135_c1 3300050496 Bacteria 9203
1444 nmdc:mga07m45_241469_c1 3300050496 Bacteria 1051
1445 nmdc:mga07m45_36807_c1 3300050496 Bacteria 2727
1446 nmdc:mga07m45_667_c1 3300050496 Bacteria 14576
1447 nmdc:mga07m45_9721_c2 3300050496 Bacteria 2776
1448 nmdc:mga05p37_450441_c1 3300050507 Bacteria 1490
1449 nmdc:mga06r32_149366_c1 3300050510 Bacteria 2314
1450 nmdc:mga08y16_13960_c1 3300050511 Bacteria 8456
1451 nmdc:mga0n895_105939_c1 3300050512 Bacteria 2824
1452 nmdc:mga0n895_178245_c1 3300050512 Bacteria 2156
1453 nmdc:mga0n895_184118_c1 3300050512 Bacteria 2120
1454 nmdc:mga0n895_258186_c1 3300050512 Bacteria 1768
1455 nmdc:mga0n895_798789_c1 3300050512 Bacteria 934
1456 nmdc:mga0rr50_190791_c1 3300050513 Bacteria 1679
1457 nmdc:mga0rr50_44781_c1 3300050513 Bacteria 3248
1458 nmdc:mga08x19_122667_c1 3300050514 Bacteria 1743
1459 nmdc:mga08x19_33584_c1 3300050514 Bacteria 3238
1460 nmdc:mga0a205_759720_c1 3300050515 Bacteria 818
1461 Ga0500635_0000007 3300053080 Bacteria 169379
1462 Ga0500635_0000150 3300053080 Bacteria 39030
1463 Ga0500578_0000025 3300053086 Bacteria 151485
1464 Ga0500644_0027795 3300053088 Bacteria 1763
1465 Ga0500646_0010670 3300053090 Bacteria 2357
1466 Ga0500651_0131626 3300053093 Bacteria 1512
1467 Ga0500651_0450153 3300053093 Bacteria 716
1468 Ga0500562_038607 3300053108 Bacteria 1268
1469 Ga0500608_011126 3300053122 Bacteria 3894
1470 Ga0500608_105189 3300053122 Bacteria 1302
1471 Ga0500652_001368 3300053131 Bacteria 7638
1472 Ga0500658_0041897 3300053134 Bacteria 1838
1473 Ga0500564_057627 3300053138 Bacteria 1767
1474 Ga0500568_0051919 3300053139 Bacteria 1611
1475 Ga0500622_0000279 3300053156 Bacteria 52053
1476 Ga0500636_0004381 3300053177 Bacteria 7986
1477 Ga0501084_0003897 3300054114 Bacteria 12149
1478 Ga0501082_0039601 3300060353 Bacteria 4066
1479 Ga0501082_0053377 3300060353 Bacteria 3484
1480 Ga0466962_0021479 3300061719 Bacteria 3099
1481 Ga0466962_0027083 3300061719 Bacteria 2752
1482 Ga0466962_0042306 3300061719 Bacteria 2180
1483 Ga0466962_0058448 3300061719 Bacteria 1840
1484 2587725658 2585428057 Bacteria 6737412
1485 2587735093 2585428058 Bacteria 6853932
1486 2587760006 2585428062 Bacteria 6842168
1487 2588290589 2588253510 Bacteria 6901809
1488 2643744462 2643221544 Bacteria 5886209
1489 2643787764 2643221554 Bacteria 6603920
1490 2643800530 2643221556 Bacteria 7251154
1491 2643934467 2643221585 Bacteria 5812563
1492 2643968303 2643221592 Bacteria 6608788
1493 2644143544 2643221625 Bacteria 6512927
1494 2644211876 2643221638 Bacteria 6579467
1495 2644219310 2643221639 Bacteria 6649903
1496 2644222127 2643221639 Bacteria 6649903
1497 2644255748 2643221646 Bacteria 6433402
1498 2644257092 2643221646 Bacteria 6433402
1499 2644272081 2643221648 Bacteria 6521465
1500 2644315954 2643221656 Bacteria 5809961
1501 2644470439 2643221684 Bacteria 7145183
1502 2739054206 2738541337 Bacteria 6183410
1503 2739055352 2738541337 Bacteria 6183410
1504 2809144043 2808606418 Bacteria 6724496
1505 8047678835 8047673197 Bacteria 7395230
1506 Ga0070685_10210500
1507 JGI25156J39149_1001159
1508 JGI25156J39149_1002068
1509 JGI25156J39149_1022654
1510 JGI25154J39366_1001049
1511 JGI25154J39366_1002964
1512 JGI25158J39367_1000226
1513 JGI25157J39369_1000029
1514 JGI25157J39369_1000312
1515 JGI25164J39214_1008298
1516 JGI25152J39213_1000433
1517 JGI25150J39212_1000749
1518 JGI25150J39212_1001006
1519 JGI25150J39212_1001467
1520 JGI25150J39212_1002524
1521 JGI25159J45721_1000365
1522 JGI25153J46596_10013424
1523 rootH1_10004599
1524 rootH1_10007951
1525 rootH1_10017383
1526 rootH1_10034050
1527 rootH1_10037656
1528 rootH2_10006249
1529 rootL2_10002470
1530 rootL2_10016318
1531 rootL2_10208757
1532 rootH1_10006598
1533 rootH1_10015852
1534 rootH1_10020381
1535 rootH1_10027575
1536 rootH1_10030329
1537 rootH1_10030355
1538 rootH1_10116314
1539 JGI25161J50226_1000407
1540 Ga0055539_1000282
1541 Ga0055539_1000902
1542 Ga0055539_1008226
1543 Ga0055539_1015032
1544 Ga0055533_1000010
1545 Ga0055533_1000024
1546 Ga0055525_1000081
1547 Ga0055525_1000222
1548 Ga0055525_1001459
1549 Ga0055535_1000292
1550 Ga0055535_1001112
1551 Ga0055542_1007406
1552 Ga0055529_1000130
1553 Ga0055529_1000382
1554 Ga0055526_1013614
1555 Ga0055537_1012667
1556 Ga0055537_1014154
1557 Ga0055537_1019391
1558 Ga0055524_1001532
1559 Ga0055524_1006527
1560 Ga0055534_1013048
1561 Ga0055530_10002964
1562 Ga0055530_10013336
1563 Ga0055530_10045433
1564 Ga0055540_1017899
1565 Ga0055540_1039891
1566 Ga0055531_10000024
1567 Ga0055531_10000700
1568 Ga0055531_10000818
1569 Ga0055531_10032869
1570 Ga0055543_1000546
1571 Ga0065165_1001129
1572 Ga0065165_1002224
1573 Ga0065165_1007878
1574 Ga0065165_1027495
1575 Ga0065714_10107373
1576 Ga0065715_10241007
1577 Ga0070658_10004794
1578 Ga0070658_10027232
1579 Ga0070658_10039977
1580 Ga0070658_10058732
1581 Ga0070658_10070757
1582 Ga0070658_10247280
1583 Ga0070683_100031998
1584 Ga0070690_100003915
1585 Ga0070690_100014227
1586 Ga0070690_100056280
1587 Ga0070690_100161861
1588 Ga0070670_100004747
1589 Ga0070677_10001503
1590 Ga0070677_10004919
1591 Ga0068869_100004218
1592 Ga0068869_100036764
1593 Ga0068869_100043150
1594 Ga0068869_100059558
1595 Ga0068869_100118707
1596 Ga0070666_10009513
1597 Ga0070680_100068066
1598 Ga0070680_100096809
1599 Ga0070680_100127601
1600 Ga0070680_100342567
1601 Ga0070682_100094761
1602 Ga0070682_100225857
1603 Ga0068868_100000628
1604 Ga0068868_100001502
1605 Ga0068868_100006264
1606 Ga0068868_100065246
1607 Ga0068868_100607628
1608 Ga0070660_100006633
1609 Ga0070660_100033625
1610 Ga0070660_100106926
1611 Ga0070660_100206391
1612 Ga0070660_100302787
1613 Ga0070689_100052275
1614 Ga0070689_100471686
1615 Ga0070691_10008161
1616 Ga0070691_10038091
1617 Ga0070691_10191062
1618 Ga0070687_100026461
1619 Ga0070661_100103129
1620 Ga0070692_10004149
1621 Ga0070668_100042991
1622 Ga0070668_100046957
1623 Ga0070668_100161621
1624 Ga0070669_100017692
1625 Ga0070669_100041956
1626 Ga0070669_100256465
1627 Ga0070675_100002597
1628 Ga0070675_100088059
1629 Ga0070671_100002077
1630 Ga0070671_100024204
1631 Ga0070671_100038221
1632 Ga0070674_100009585
1633 Ga0070674_100138972
1634 Ga0070674_100202734
1635 Ga0070673_100006268
1636 Ga0070673_100014919
1637 Ga0070673_100017763
1638 Ga0070673_100021054
1639 Ga0070673_100091002
1640 Ga0070673_100165829
1641 Ga0070688_100088032
1642 Ga0070659_100075936
1643 Ga0070667_100005385
1644 Ga0070667_100005638
1645 Ga0070703_10003938
1646 Ga0070709_10023806
1647 Ga0070709_10182104
1648 Ga0070709_10626057
1649 Ga0070714_100015390
1650 Ga0070713_100002097
1651 Ga0070713_100016508
1652 Ga0070713_100151540
1653 Ga0070713_100374624
1654 Ga0070710_10043138
1655 Ga0070701_10047380
1656 Ga0070711_100368019
1657 Ga0070705_100007516
1658 Ga0070705_100010423
1659 Ga0070694_100014445
1660 Ga0070708_100000634
1661 Ga0070708_100001048
1662 Ga0070708_100106259
1663 Ga0070678_100002016
1664 Ga0070678_100007398
1665 Ga0070678_100023958
1666 Ga0070662_100062526
1667 Ga0070662_100224756
1668 Ga0070662_100331361
1669 Ga0070681_10000506
1670 Ga0070681_10002815
1671 Ga0070681_10114861
1672 Ga0068867_100001168
1673 Ga0068867_100023799
1674 Ga0068867_100035860
1675 Ga0068867_100118543
1676 Ga0070706_100000597
1677 Ga0070706_100011207
1678 Ga0070706_100012084
1679 Ga0070706_100417622
1680 Ga0070707_100001822
1681 Ga0070707_100099618
1682 Ga0070707_100149782
1683 Ga0070698_100072447
1684 Ga0070699_100014523
1685 Ga0070699_100026220
1686 Ga0070679_100014489
1687 Ga0070679_100221886
1688 Ga0070684_100008480
1689 Ga0070684_100109925
1690 Ga0070684_100124185
1691 Ga0070697_100000634
1692 Ga0070697_100100673
1693 Ga0070697_100106997
1694 Ga0070697_100234742
1695 Ga0070697_100241516
1696 Ga0068853_100301234
1697 Ga0068853_100333558
1698 Ga0070672_100000699
1699 Ga0070672_100077922
1700 Ga0070695_100119262
1701 Ga0070696_100000745
1702 Ga0070693_100000089
1703 Ga0070693_100012559
1704 Ga0070665_100063355
1705 Ga0070665_100086806
1706 Ga0070665_100266167
1707 Ga0070704_100003995
1708 Ga0070704_100219995
1709 Ga0068855_100000212
1710 Ga0068855_100005033
1711 Ga0068855_100006540
1712 Ga0068855_100007637
1713 Ga0068855_100008176
1714 Ga0068855_100131047
1715 Ga0068855_100180228
1716 Ga0068855_100242476
1717 Ga0068855_100399924
1718 Ga0068855_100689010
1719 Ga0070664_100002091
1720 Ga0070664_100450176
1721 Ga0068857_100000097
1722 Ga0068857_100000164
1723 Ga0068857_100008343
1724 Ga0068854_100009674
1725 Ga0068854_100015311
1726 Ga0068854_100024684
1727 Ga0068854_100046522
1728 Ga0068856_100001671
1729 Ga0068856_100001677
1730 Ga0068856_100019882
1731 Ga0068856_100027769
1732 Ga0068856_100027810
1733 Ga0068856_100108933
1734 Ga0068856_100362753
1735 Ga0068856_100474657
1736 Ga0070702_100206729
1737 Ga0070702_100290374
1738 Ga0068852_100009747
1739 Ga0068852_100036308
1740 Ga0068852_100117826
1741 Ga0068852_100352391
1742 Ga0068852_100388659
1743 Ga0068859_100000780
1744 Ga0068859_100018677
1745 Ga0068864_100000242
1746 Ga0068864_100006501
1747 Ga0068864_100036884
1748 Ga0068866_10002395
1749 Ga0068866_10222692
1750 Ga0068861_100073761
1751 Ga0068861_100079741
1752 Ga0068861_100093682
1753 Ga0068861_100152207
1754 Ga0068851_10226320
1755 Ga0068870_10022504
1756 Ga0068870_10092064
1757 Ga0068863_100007429
1758 Ga0068863_100007901
1759 Ga0068863_100116135
1760 Ga0068863_100606456
1761 Ga0068858_100001038
1762 Ga0068858_100001331
1763 Ga0068858_100046025
1764 Ga0068860_100012630
1765 Ga0068860_100044011
1766 Ga0068860_100210325
1767 Ga0068860_100277814
1768 Ga0068862_100009673
1769 Ga0068862_100306889
1770 Ga0068862_100378326
1771 Ga0081455_10269275
1772 Ga0070717_10026203
1773 Ga0070717_10379596
1774 Ga0075364_10055611
1775 Ga0070712_100311527
1776 Ga0075362_10003601
1777 Ga0075367_10011581
1778 Ga0075366_10000209
1779 Ga0075366_10009229
1780 Ga0075366_10062293
1781 Ga0075366_10085110
1782 Ga0097621_100000314
1783 Ga0097621_100007716
1784 Ga0097621_100016282
1785 Ga0097621_100024590
1786 Ga0097621_100328348
1787 Ga0075370_10000798
1788 Ga0075370_10021340
1789 Ga0075370_10025236
1790 Ga0075370_10034151
1791 Ga0075370_10074951
1792 Ga0068871_100009452
1793 Ga0068871_100040452
1794 Ga0068871_100070667
1795 Ga0075428_100103519
1796 Ga0075431_100262127
1797 Ga0075433_10490402
1798 Ga0075434_100092796
1799 Ga0075434_100263519
1800 Ga0075434_100318442
1801 Ga0075429_100067405
1802 Ga0068865_100057940
1803 Ga0075436_100088124
1804 Ga0075436_100241914
1805 Ga0097620_100000780
1806 Ga0097620_100018677
1807 Ga0075435_100003402
1808 Ga0099794_10005413
1809 Ga0099795_10030697
1810 Ga0099795_10089526
1811 Ga0105240_10002073
1812 Ga0105240_10002125
1813 Ga0105240_10008664
1814 Ga0105240_10021828
1815 Ga0105240_10108762
1816 Ga0105240_10204579
1817 Ga0105240_10338636
1818 Ga0105240_10352982
1819 Ga0105240_10618140
1820 Ga0111539_10003952
1821 Ga0105245_10009192
1822 Ga0105245_10448816
1823 Ga0114129_10001813
1824 Ga0114129_10105052
1825 Ga0114129_10870557
1826 Ga0114129_11078406
1827 Ga0105243_10077587
1828 Ga0105243_10131023
1829 Ga0105243_10151416
1830 Ga0105243_10208365
1831 Ga0105243_10547898
1832 Ga0105241_10033445
1833 Ga0105241_10151395
1834 Ga0105241_10160747
1835 Ga0105241_10178272
1836 Ga0105241_10201131
1837 Ga0105242_10074656
1838 Ga0105242_10218114
1839 Ga0105248_10035730
1840 Ga0105248_10109410
1841 Ga0105248_10125452
1842 Ga0105248_10317774
1843 Ga0105248_11060566
1844 Ga0105237_10010975
1845 Ga0105237_10024770
1846 Ga0105237_10131925
1847 Ga0105238_10000064
1848 Ga0105238_10026318
1849 Ga0105238_10061388
1850 Ga0105238_10786052
1851 Ga0105249_10065798
1852 Ga0105239_10335314
1853 Ga0105246_10061266
1854 Ga0105246_10209092
1855 Ga0105246_10254815
1856 Ga0157373_10086388
1857 Ga0157373_10174784
1858 Ga0157371_10000013
1859 Ga0157371_10000064
1860 Ga0157371_10046815
1861 Ga0157371_10077462
1862 Ga0157371_10096657
1863 Ga0157370_10361540
1864 Ga0157370_10669722
1865 Ga0157369_10000522
1866 Ga0157369_10027164
1867 Ga0157369_10032556
1868 Ga0157369_10048151
1869 Ga0157369_10187677
1870 Ga0157369_10245648
1871 Ga0157369_10971128
1872 Ga0157374_10000245
1873 Ga0157374_10000577
1874 Ga0157374_10078751
1875 Ga0157374_10313883
1876 Ga0157378_10000172
1877 Ga0157378_10123834
1878 Ga0157378_10150386
1879 Ga0157378_10228616
1880 Ga0157378_10353735
1881 Ga0163162_10775537
1882 Ga0157372_10000450
1883 Ga0157372_10011617
1884 Ga0157372_10024161
1885 Ga0157372_10025639
1886 Ga0157372_10090823
1887 Ga0157372_10175298
1888 Ga0157372_10418765
1889 Ga0157372_10629303
1890 Ga0157375_10053089
1891 Ga0163163_10018823
1892 Ga0163163_10262780
1893 Ga0157380_10259725
1894 Ga0182008_10024693
1895 Ga0157379_10012032
1896 Ga0157376_10077607
1897 Ga0157376_10194314
1898 Ga0157376_10385259
1899 Ga0157376_11132777
1900 Ga0182006_1032583
1901 Ga0182007_10022545
1902 Ga0182007_10066331
1903 Ga0163161_10091476
1904 Ga0213872_10000115
1905 Ga0213872_10004364
1906 Ga0213872_10057539
1907 Ga0209436_100218
1908 Ga0209674_100003
1909 Ga0209674_100007
1910 Ga0209672_102656
1911 Ga0209563_100015
1912 Ga0209563_100049
1913 Ga0209563_100060
1914 Ga0209563_100088
1915 Ga0209563_105947
1916 Ga0207427_100282
1917 Ga0207427_100623
1918 Ga0209258_100128
1919 Ga0209258_100683
1920 Ga0209258_102459
1921 Ga0207425_1000109
1922 Ga0207425_1000122
1923 Ga0207425_1000482
1924 Ga0207425_1002022
1925 Ga0207425_1007654
1926 Ga0209646_1000056
1927 Ga0209646_1000111
1928 Ga0209026_1000009
1929 Ga0209026_1000054
1930 Ga0209677_100050
1931 Ga0209677_100129
1932 Ga0209677_100514
1933 Ga0209677_101079
1934 Ga0209677_101420
1935 Ga0209677_112089
1936 Ga0209148_1000272
1937 Ga0209759_1000035
1938 Ga0209759_1000043
1939 Ga0209759_1000666
1940 Ga0209759_1001454
1941 Ga0209759_1004314
1942 Ga0209759_1006725
1943 Ga0209759_1009204
1944 Ga0209129_1000582
1945 Ga0209129_1002417
1946 Ga0209565_1000600
1947 Ga0209565_1005953
1948 Ga0209565_1015548
1949 Ga0209455_1000108
1950 Ga0209455_1000116
1951 Ga0209130_1000171
1952 Ga0209130_1001410
1953 Ga0209675_1000739
1954 Ga0209675_1001493
1955 Ga0209675_1005760
1956 Ga0209564_1000095
1957 Ga0209564_1003896
1958 Ga0209564_1004713
1959 Ga0209758_1001664
1960 Ga0209050_1000011
1961 Ga0209050_1000547
1962 Ga0209050_1001381
1963 Ga0209050_1004051
1964 Ga0209050_1006205
1965 Ga0209256_1000987
1966 Ga0209256_1001062
1967 Ga0209256_1059981
1968 Ga0209051_1003873
1969 Ga0209051_1008357
1970 Ga0209051_1018162
1971 Ga0209051_1026335
1972 Ga0209257_1000003
1973 Ga0209257_1000017
1974 Ga0209257_1000117
1975 Ga0209257_1014465
1976 Ga0209257_1030252
1977 Ga0207656_10087765
1978 Ga0207682_10003095
1979 Ga0207682_10048403
1980 Ga0207642_10004420
1981 Ga0207688_10016962
1982 Ga0207680_10274907
1983 Ga0207680_10330494
1984 Ga0207699_10087189
1985 Ga0207699_10276793
1986 Ga0207645_10073735
1987 Ga0207645_10235079
1988 Ga0207643_10007445
1989 Ga0207705_10000922
1990 Ga0207705_10014081
1991 Ga0207705_10023899
1992 Ga0207705_10052182
1993 Ga0207705_10064246
1994 Ga0207705_10202375
1995 Ga0207684_10000125
1996 Ga0207684_10013608
1997 Ga0207684_10226178
1998 Ga0207654_10021970
1999 Ga0207654_10080747
2000 Ga0207654_10183518
2001 Ga0207654_10231662
2002 Ga0207707_10001125
2003 Ga0207707_10060943
2004 Ga0207707_10226090
2005 Ga0207695_10001924
2006 Ga0207695_10008820
2007 Ga0207695_10018362
2008 Ga0207695_10035278
2009 Ga0207695_10049321
2010 Ga0207695_10084876
2011 Ga0207695_10093813
2012 Ga0207695_10128664
2013 Ga0207671_10240263
2014 Ga0207693_10305720
2015 Ga0207693_10585282
2016 Ga0207663_10435488
2017 Ga0207663_10449168
2018 Ga0207660_10033710
2019 Ga0207660_10104439
2020 Ga0207660_10358913
2021 Ga0207657_10000491
2022 Ga0207657_10010663
2023 Ga0207657_10016061
2024 Ga0207649_10047767
2025 Ga0207649_10076573
2026 Ga0207649_10387357
2027 Ga0207652_10048726
2028 Ga0207652_10080300
2029 Ga0207652_10237251
2030 Ga0207652_10299749
2031 Ga0207646_10045253
2032 Ga0207646_10054214
2033 Ga0207681_10028871
2034 Ga0207681_10178304
2035 Ga0207694_10000892
2036 Ga0207694_10025695
2037 Ga0207694_10053670
2038 Ga0207694_10135566
2039 Ga0207694_10189339
2040 Ga0207694_10306341
2041 Ga0207650_10008943
2042 Ga0207650_10013039
2043 Ga0207659_10000312
2044 Ga0207659_10379040
2045 Ga0207659_10875022
2046 Ga0207687_10020028
2047 Ga0207700_10012386
2048 Ga0207700_10118923
2049 Ga0207664_10009316
2050 Ga0207644_10000437
2051 Ga0207690_10003250
2052 Ga0207690_10027464
2053 Ga0207690_10266177
2054 Ga0207690_10308267
2055 Ga0207690_10346723
2056 Ga0207690_10367811
2057 Ga0207706_10021959
2058 Ga0207706_10077498
2059 Ga0207706_10144285
2060 Ga0207706_10255393
2061 Ga0207686_10200975
2062 Ga0207709_10019410
2063 Ga0207709_10073088
2064 Ga0207709_10086867
2065 Ga0207670_10005757
2066 Ga0207669_10002447
2067 Ga0207669_10125155
2068 Ga0207669_10230185
2069 Ga0207704_10048448
2070 Ga0207704_10409649
2071 Ga0207665_10041537
2072 Ga0207691_10006654
2073 Ga0207691_10011341
2074 Ga0207691_10059505
2075 Ga0207711_10001682
2076 Ga0207711_10167602
2077 Ga0207711_10416745
2078 Ga0207711_10743858
2079 Ga0207689_10008999
2080 Ga0207689_10015618
2081 Ga0207689_10035478
2082 Ga0207689_10043834
2083 Ga0207689_10076344
2084 Ga0207689_10132622
2085 Ga0207689_10145775
2086 Ga0207679_10010631
2087 Ga0207679_10089918
2088 Ga0207679_10264748
2089 Ga0207667_10000370
2090 Ga0207667_10001781
2091 Ga0207667_10002286
2092 Ga0207667_10005671
2093 Ga0207667_10009062
2094 Ga0207667_10027546
2095 Ga0207667_10030004
2096 Ga0207667_10071942
2097 Ga0207667_10074524
2098 Ga0207667_10303399
2099 Ga0207651_10006315
2100 Ga0207651_10007614
2101 Ga0207651_10011224
2102 Ga0207651_10012811
2103 Ga0207651_10047413
2104 Ga0207651_10186258
2105 Ga0207712_10024503
2106 Ga0207712_10208932
2107 Ga0207668_10039675
2108 Ga0207668_10281653
2109 Ga0207640_10006668
2110 Ga0207640_10013622
2111 Ga0207640_10060137
2112 Ga0207658_10001772
2113 Ga0207658_10016258
2114 Ga0207677_10001268
2115 Ga0207677_10005627
2116 Ga0207677_10131393
2117 Ga0207677_10209806
2118 Ga0207677_10670337
2119 Ga0207703_10001047
2120 Ga0207703_10004544
2121 Ga0207703_10035999
2122 Ga0207703_10038715
2123 Ga0207678_10000518
2124 Ga0207678_10229270
2125 Ga0207678_10296308
2126 Ga0207678_10296668
2127 Ga0207678_10303302
2128 Ga0207708_10097433
2129 Ga0207708_10320011
2130 Ga0207702_10000784
2131 Ga0207702_10000946
2132 Ga0207702_10001288
2133 Ga0207702_10005752
2134 Ga0207702_10023362
2135 Ga0207702_10108476
2136 Ga0207702_10352820
2137 Ga0207641_10023176
2138 Ga0207641_10024355
2139 Ga0207648_10002110
2140 Ga0207648_10016441
2141 Ga0207648_10231620
2142 Ga0207648_10411927
2143 Ga0207648_10474701
2144 Ga0207648_10516774
2145 Ga0207676_10000733
2146 Ga0207676_10004725
2147 Ga0207676_10178795
2148 Ga0207676_10197867
2149 Ga0207674_10000190
2150 Ga0207674_10089845
2151 Ga0207674_10139968
2152 Ga0207675_100017183
2153 Ga0207675_100035659
2154 Ga0207675_100042815
2155 Ga0207675_100128862
2156 Ga0207675_100144539
2157 Ga0207675_100152575
2158 Ga0207675_100274431
2159 Ga0207683_10001702
2160 Ga0207683_10008866
2161 Ga0207683_10016550
2162 Ga0207698_10052496
2163 Ga0207698_10056614
2164 Ga0207698_10224609
2165 Ga0207698_10292366
2166 Ga0207698_10319372
2167 Ga0207698_10599437
2168 Ga0207428_10000671
2169 Ga0265354_1000050
2170 Ga0265354_1000584
2171 Ga0268266_10050403
2172 Ga0268266_10079015
2173 Ga0268266_10085387
2174 Ga0268266_10395256
2175 Ga0268264_10012037
2176 Ga0268264_10037455
2177 Ga0268264_10159632
2178 Ga0268264_10203070
2179 Ga0268264_10287927
2180 Ga0265336_10000006
2181 Ga0265336_10000039
2182 Ga0307517_10164321
2183 Ga0307515_10000110
2184 Ga0307515_10000366
2185 Ga0307515_10001235
2186 Ga0307515_10002229
2187 Ga0307515_10034594
2188 Ga0265338_10207480
2189 Ga0265324_10000223
2190 Ga0265324_10001026
2191 Ga0307511_10056167
2192 Ga0307512_10032623
2193 Ga0307512_10114714
2194 Ga0265770_1004651
2195 Ga0265760_10006171
2196 Ga0265760_10007108
2197 Ga0265327_10009479
2198 Ga0307513_10011456
2199 Ga0307513_10059527
2200 Ga0307513_10154193
2201 Ga0307509_10114290
2202 Ga0307408_100000006
2203 Ga0307408_100000140
2204 Ga0307408_100015385
2205 Ga0307408_100025904
2206 Ga0307508_10000107
2207 Ga0307514_10006915
2208 Ga0307516_10002030
2209 Ga0307516_10007929
2210 Ga0307516_10029384
2211 Ga0307405_10590910
2212 Ga0307413_10202109
2213 Ga0307413_10223023
2214 Ga0307410_10057607
2215 Ga0307410_10640037
2216 Ga0307406_10025118
2217 Ga0307407_10232004
2218 Ga0307412_10003387
2219 Ga0307416_100061701
2220 Ga0307416_100242343
2221 Ga0307416_101043823
2222 Ga0307416_101147549
2223 Ga0307414_10016384
2224 Ga0307411_10028697
2225 Ga0307411_10093375
2226 Ga0307411_10682166
2227 Ga0316212_1000963
2228 Ga0373948_0002839
2229 Ga0373950_0007074
2230 Ga0373926_0055970
2231 Ga0373934_0067146
2232 Ga0373940_0010445
2233 Ga0373940_0097231
2234 Ga0373949_0027316
2235 Ga0373951_0001888
2236 Ga0373923_0114125
2237 Ga0373939_0000224
2238 Ga0373939_0000948
2239 Ga0373939_0097919
2240 Ga0373954_0006248
2241 Ga0373954_0049581
2242 Ga0373960_0001470
2243 Ga0373946_0025368
2244 Ga0373961_0015507
2245 Ga0373962_0007884
2246 Ga0373931_0000233
2247 Ga0373931_0000962
2248 Ga0373931_0007872
2249 Ga0373931_0143600
2250 Ga0373937_0223295
2251 Ga0373925_0050089
2252 Ga0373925_0436537
2253 Ga0395899_0002978
2254 Ga0395899_0017472
2255 Ga0395899_0030197
2256 Ga0395899_0034829
2257 Ga0395899_0070045
2258 Ga0395899_0173363
2259 Ga0395900_0001085
2260 Ga0395900_0001906
2261 Ga0395900_0004368
2262 Ga0395900_0131598
2263 Ga0395900_0453057
2264 Ga0395898_0043556
2265 Ga0395898_0093100
2266 Ga0395898_0207317
2267 Ga0395905_0004973
2268 Ga0395905_0012391
2269 Ga0395905_0072079
2270 Ga0395905_0254715
2271 Ga0395905_0256136
2272 Ga0436364_0905352
2273 Ga0395901_0000307
2274 Ga0395901_0002559
2275 Ga0395901_0024867
2276 Ga0395901_0048856
2277 Ga0395901_0068069
2278 Ga0395901_0204556
2279 Ga0436365_1684313
2280 Ga0436360_1344729
2281 Ga0436361_0496436
2282 Ga0436361_0563588
2283 Ga0436361_0590082
2284 Ga0436361_0761139
2285 Ga0436361_1046788
2286 Ga0451789_1345118
2287 Ga0451791_1290972
2288 Ga0451793_0226805
2289 Ga0451798_0925854
2290 Ga0451802_1287762
2291 Ga0451802_1902642
2292 Ga0451835_0321985
2293 Ga0451853_2760822
2294 Ga0439433_0005973
2295 Ga0439437_005601
2296 Ga0439448_0001451
2297 Ga0439450_003588
2298 Ga0439450_005798
2299 Ga0439455_0038359
2300 Ga0450917_000304
2301 Ga0450888_002355
2302 Ga0450891_004129
2303 Ga0450904_000113
2304 Ga0450889_001126
2305 Ga0439458_0026560
2306 Ga0450893_0005547
2307 Ga0451577_0000490
2308 Ga0451577_0566685
2309 Ga0466969_0014737
2310 Ga0466969_0077563
2311 Ga0466972_0000072
2312 Ga0466972_0001011
2313 Ga0466972_0004705
2314 Ga0466972_0207014
2315 Ga0466965_0008989
2316 Ga0466965_0013679
2317 Ga0466965_0019358
2318 Ga0466965_0030015
2319 Ga0466965_0032473
2320 Ga0466965_0040704
2321 Ga0466965_0048656
2322 Ga0466965_0189450
2323 Ga0466966_0003363
2324 Ga0466966_0046947
2325 Ga0466966_0052122
2326 Ga0466966_0226791
2327 Ga0466966_0238108
2328 Ga0466961_0087980
2329 Ga0466961_0117057
2330 Ga0466961_0173510
2331 Ga0466961_0216712
2332 Ga0466963_0107422
2333 Ga0466963_0230397
2334 Ga0466964_0000097
2335 Ga0466964_0054675
2336 Ga0466964_0065072
2337 Ga0453684_0000987
2338 Ga0453684_0150183
2339 Ga0466971_0045915
2340 Ga0466971_0066728
2341 Ga0466968_0000838
2342 Ga0466968_0001188
2343 Ga0466968_0010885
2344 Ga0466968_0090969
2345 Ga0466970_0074529
2346 Ga0466957_0000827
2347 Ga0466957_0029322
2348 Ga0466957_0072676
2349 Ga0466959_0003718
2350 Ga0466959_0014520
2351 Ga0466959_0056501
2352 Ga0466959_0107555
2353 Ga0466959_0140310
2354 Ga0466959_0162107
2355 Ga0466959_0230992
2356 Ga0451576_0158030
2357 Ga0451576_0221078
2358 Ga0466958_0010194
2359 Ga0466958_0030402
2360 Ga0466958_0063890
2361 Ga0466958_0077484
2362 Ga0466958_0414759
2363 Ga0466967_0024676
2364 Ga0466967_0030592
2365 Ga0466967_0052296
2366 Ga0466967_0127800
2367 Ga0466967_0140326
2368 Ga0466967_0149306
2369 Ga0495617_000125
2370 Ga0495617_011782
2371 Ga0495627_000325
2372 Ga0495627_007288
2373 Ga0495627_011815
2374 Ga0495590_0000166
2375 Ga0495590_0002849
2376 Ga0495590_0006344
2377 Ga0495591_000149
2378 Ga0495629_0006820
2379 Ga0495629_0038992
2380 Ga0495638_0005648
2381 Ga0495638_0084022
2382 Ga0495651_0139605
2383 Ga0495653_0002884
2384 Ga0495653_0009399
2385 Ga0495653_0021151
2386 Ga0495653_0026777
2387 Ga0495653_0154429
2388 Ga0495650_0001100
2389 Ga0495650_0037741
2390 Ga0495650_0048197
2391 Ga0495580_0025056
2392 Ga0495580_0027291
2393 Ga0495580_0035556
2394 Ga0495580_0375186
2395 Ga0495582_0000662
2396 Ga0495582_0009678
2397 Ga0495605_0000725
2398 Ga0495605_0000845
2399 Ga0495605_0007379
2400 Ga0495605_0019429
2401 Ga0495605_0029687
2402 Ga0495605_0029689
2403 Ga0495605_0050785
2404 Ga0495605_0059238
2405 Ga0495605_0104487
2406 Ga0495605_0107446
2407 Ga0495639_0081874
2408 Ga0495584_0000417
2409 Ga0495584_0000820
2410 Ga0495584_0002513
2411 Ga0495584_0004515
2412 Ga0495584_0018617
2413 Ga0495584_0019660
2414 Ga0495584_0027008
2415 Ga0495584_0033942
2416 Ga0495584_0037339
2417 Ga0495584_0089264
2418 Ga0495584_0129974
2419 Ga0495584_0195744
2420 Ga0495585_0002621
2421 Ga0495585_0004000
2422 Ga0495585_0004922
2423 Ga0495585_0007278
2424 Ga0495585_0009447
2425 Ga0495585_0012348
2426 Ga0495585_0015200
2427 Ga0495585_0015519
2428 Ga0495585_0016706
2429 Ga0495585_0017877
2430 Ga0495585_0029378
2431 Ga0495585_0038815
2432 Ga0495585_0043551
2433 Ga0495585_0259460
2434 Ga0495594_0006433
2435 Ga0495594_0008151
2436 Ga0495594_0027401
2437 Ga0495594_0051421
2438 Ga0495594_0053067
2439 Ga0495594_0117610
2440 Ga0495594_0133179
2441 Ga0495596_0000442
2442 Ga0495596_0000863
2443 Ga0495596_0002569
2444 Ga0495596_0005420
2445 Ga0495596_0005727
2446 Ga0495596_0006378
2447 Ga0495596_0006897
2448 Ga0495596_0014671
2449 Ga0495596_0016650
2450 Ga0495596_0019749
2451 Ga0495596_0031922
2452 Ga0495596_0046697
2453 Ga0495596_0082920
2454 Ga0495607_0001392
2455 Ga0495607_0001408
2456 Ga0495607_0002063
2457 Ga0495607_0005724
2458 Ga0495607_0018695
2459 Ga0495607_0027250
2460 Ga0495607_0027417
2461 Ga0495607_0035999
2462 Ga0495607_0072115
2463 Ga0495607_0092582
2464 Ga0495583_0000144
2465 Ga0495583_0000200
2466 Ga0495583_0000217
2467 Ga0495583_0001216
2468 Ga0495583_0002127
2469 Ga0495583_0002154
2470 Ga0495583_0002410
2471 Ga0495583_0003295
2472 Ga0495583_0004038
2473 Ga0495583_0009165
2474 Ga0495583_0016673
2475 Ga0495583_0019228
2476 Ga0495583_0023216
2477 Ga0495583_0100455
2478 Ga0495606_0005844
2479 Ga0495606_0011722
2480 Ga0495606_0036866
2481 Ga0495606_0037150
2482 Ga0495606_0041518
2483 Ga0495606_0044217
2484 Ga0495606_0098994
2485 Ga0495606_0210819
2486 Ga0495608_0182076
2487 Ga0495610_0000876
2488 Ga0495610_0011457
2489 Ga0495610_0110177
2490 Ga0495616_0000126
2491 Ga0495616_0000227
2492 Ga0495616_0000786
2493 Ga0495616_0010067
2494 Ga0495616_0011469
2495 Ga0495616_0015340
2496 Ga0495616_0016359
2497 Ga0495616_0026462
2498 Ga0495616_0026491
2499 Ga0495616_0030858
2500 Ga0495616_0080904
2501 Ga0495616_0082045
2502 Ga0495616_0103351
2503 Ga0495616_0107351
2504 Ga0495616_0162821
2505 Ga0495616_0286784
2506 Ga0495620_0031194
2507 Ga0495630_0012504
2508 Ga0495630_0021661
2509 Ga0495630_0040007
2510 Ga0495630_0190703
2511 Ga0495631_0000342
2512 Ga0495631_0000501
2513 Ga0495631_0001168
2514 Ga0495631_0002960
2515 Ga0495631_0003047
2516 Ga0495631_0005084
2517 Ga0495631_0007296
2518 Ga0495631_0010064
2519 Ga0495631_0011340
2520 Ga0495631_0030184
2521 Ga0495631_0126919
2522 Ga0495632_0000195
2523 Ga0495632_0000391
2524 Ga0495632_0000757
2525 Ga0495632_0001773
2526 Ga0495632_0007690
2527 Ga0495632_0008015
2528 Ga0495632_0009140
2529 Ga0495632_0021495
2530 Ga0495632_0120328
2531 Ga0495632_0131815
2532 Ga0495637_0000014
2533 Ga0495637_0003657
2534 Ga0495643_0000171
2535 Ga0495643_0001865
2536 Ga0495643_0003366
2537 Ga0495643_0004555
2538 Ga0495643_0017614
2539 Ga0495643_0021828
2540 Ga0495643_0058358
2541 Ga0495643_0061391
2542 Ga0495643_0077063
2543 Ga0495644_0002262
2544 Ga0495644_0004151
2545 Ga0495644_0007576
2546 Ga0495644_0007682
2547 Ga0495644_0009852
2548 Ga0495644_0031758
2549 Ga0495648_0000612
2550 Ga0495648_0004164
2551 Ga0495648_0007541
2552 Ga0495648_0009116
2553 Ga0495648_0011285
2554 Ga0495648_0014828
2555 Ga0495648_0015940
2556 Ga0495648_0083205
2557 Ga0495648_0190341
2558 Ga0495663_0004646
2559 Ga0495663_0006091
2560 Ga0495666_0003941
2561 Ga0495666_0036806
2562 Ga0495642_0000515
2563 Ga0495642_0000729
2564 Ga0495642_0001661
2565 Ga0495642_0005838
2566 Ga0495642_0007429
2567 Ga0495642_0008099
2568 Ga0495642_0010769
2569 Ga0495642_0011184
2570 Ga0495642_0013639
2571 Ga0495642_0025739
2572 Ga0495642_0056465
2573 Ga0495642_0058961
2574 Ga0495652_0033257
2575 Ga0495652_0037308
2576 Ga0495652_0434559
2577 Ga0495654_0005529
2578 Ga0495654_0008911
2579 Ga0495654_0008988
2580 Ga0495654_0069302
2581 Ga0495665_0002306
2582 Ga0495665_0002338
2583 Ga0495665_0044871
2584 Ga0495665_0178365
2585 Ga0495586_0013981
2586 Ga0495586_0028693
2587 Ga0495586_0114694
2588 Ga0495587_0011337
2589 Ga0495587_0015833
2590 Ga0495587_0108545
2591 Ga0495598_0031523
2592 Ga0495609_0000028
2593 Ga0495609_0001293
2594 Ga0495609_0011460
2595 Ga0495609_0012174
2596 Ga0495609_0014596
2597 Ga0495609_0030033
2598 Ga0495609_0037371
2599 Ga0495597_0000793
2600 Ga0495597_0004145
2601 Ga0495597_0006507
2602 Ga0495597_0020247
2603 Ga0495597_0024241
2604 Ga0495597_0042303
2605 Ga0495597_0058665
2606 Ga0495597_0150141
2607 Ga0495645_0020763
2608 Ga0495622_0006298
2609 Ga0495622_0006406
2610 Ga0495622_0108744
2611 Ga0495633_0001203
2612 Ga0495633_0004585
2613 Ga0495633_0009782
2614 Ga0495633_0021899
2615 Ga0495633_0066402
2616 Ga0495633_0086147
2617 Ga0495633_0117129
2618 Ga0495656_0001345
2619 Ga0495656_0010316
2620 Ga0495668_0000318
2621 Ga0495668_0003076
2622 Ga0495668_0004892
2623 Ga0495668_0014737
2624 Ga0495668_0018328
2625 Ga0495668_0022609
2626 Ga0495668_0029648
2627 Ga0495668_0031522
2628 Ga0495668_0033852
2629 Ga0495668_0036134
2630 Ga0495668_0059992
2631 Ga0495668_0094581
2632 Ga0495668_0111172
2633 Ga0495668_0122367
2634 Ga0495668_0145154
2635 Ga0495634_0011085
2636 Ga0495634_0148362
2637 Ga0495611_0001329
2638 Ga0495611_0002853
2639 Ga0495611_0009912
2640 Ga0495611_0011261
2641 Ga0495611_0012978
2642 Ga0495611_0023156
2643 Ga0495625_0001217
2644 Ga0495625_0006720
2645 Ga0495625_0013252
2646 Ga0495625_0033624
2647 Ga0495625_0048308
2648 Ga0495625_0050976
2649 Ga0495625_0090934
2650 Ga0495659_0004919
2651 Ga0495661_0000682
2652 Ga0495661_0000805
2653 Ga0495661_0001495
2654 Ga0495661_0001512
2655 Ga0495661_0002426
2656 Ga0495661_0003500
2657 Ga0495661_0004095
2658 Ga0495661_0008507
2659 Ga0495661_0016379
2660 Ga0495661_0031851
2661 Ga0495661_0035128
2662 Ga0495661_0039001
2663 Ga0495661_0048803
2664 Ga0495661_0064418
2665 Ga0495661_0091666
2666 Ga0495661_0129034
2667 Ga0495588_0000259
2668 Ga0495588_0005996
2669 Ga0495588_0010296
2670 Ga0495588_0013104
2671 Ga0495588_0042649
2672 Ga0495588_0060609
2673 Ga0495588_0088846
2674 Ga0495588_0158297
2675 Ga0495588_0161904
2676 Ga0495623_0029342
2677 Ga0495623_0047536
2678 Ga0495623_0160914
2679 Ga0495658_0095535
2680 Ga0495669_0000328
2681 Ga0495669_0004475
2682 Ga0495669_0006151
2683 Ga0495669_0006817
2684 Ga0495669_0007018
2685 Ga0495669_0007342
2686 Ga0495669_0008646
2687 Ga0495669_0013315
2688 Ga0495669_0092966
2689 Ga0495613_0340180
2690 Ga0495624_0050037
2691 Ga0495670_0001980
2692 Ga0495670_0014690
2693 Ga0495670_0017210
2694 Ga0495670_0049330
2695 Ga0495670_0089365
2696 Ga0495670_0099077
2697 Ga0495670_0119812
2698 Ga0495671_0001884
2699 Ga0495671_0005590
2700 Ga0495671_0008602
2701 Ga0495671_0010066
2702 Ga0495671_0013583
2703 Ga0495671_0099882
2704 Ga0495671_0165840
2705 Ga0495649_0000068
2706 Ga0495649_0000595
2707 Ga0495649_0000911
2708 Ga0495649_0002466
2709 Ga0495649_0019571
2710 Ga0495649_0039794
2711 Ga0495649_0118817
2712 Ga0495589_0000309
2713 Ga0495589_0000407
2714 Ga0495589_0000903
2715 Ga0495589_0001297
2716 Ga0495589_0013553
2717 Ga0495589_0016551
2718 Ga0495589_0018426
2719 Ga0495589_0025560
2720 Ga0495589_0029994
2721 Ga0495589_0136047
2722 Ga0495600_0122737
2723 Ga0495600_0296556
2724 Ga0495660_0000734
2725 Ga0495660_0005935
2726 Ga0495660_0006198
2727 Ga0495660_0009695
2728 Ga0495660_0016643
2729 Ga0495660_0039188
2730 Ga0495660_0059921
2731 Ga0495581_0004794
2732 Ga0495581_0005818
2733 Ga0495581_0067179
2734 Ga0495581_0090651
2735 Ga0495581_0179417
2736 Ga0495604_0014594
2737 Ga0495604_0027123
2738 Ga0495604_0083696
2739 Ga0495604_0091241
2740 Ga0495636_0004008
2741 Ga0495636_0049277
2742 Ga0495636_0103562
2743 Ga0495674_0003295
2744 Ga0495674_0146882
2745 Ga0495672_0000140
2746 Ga0495672_0000777
2747 Ga0495672_0000865
2748 Ga0495672_0001198
2749 Ga0495672_0013872
2750 Ga0495676_0000100
2751 Ga0495676_0000639
2752 Ga0495680_0014119
2753 Ga0495680_0022854
2754 Ga0495680_0066489
2755 Ga0495683_0000499
2756 Ga0495683_0001842
2757 Ga0495683_0006464
2758 Ga0495683_0011901
2759 Ga0495683_0012472
2760 Ga0495683_0040118
2761 Ga0495683_0066186
2762 Ga0495683_0180288
2763 Ga0495687_000253
2764 Ga0495687_000288
2765 Ga0495687_000656
2766 Ga0495687_000829
2767 Ga0495687_000866
2768 Ga0495687_002113
2769 Ga0495675_0008125
2770 Ga0495675_0052895
2771 Ga0495675_0063701
2772 Ga0495677_0000143
2773 Ga0495677_0000257
2774 Ga0495677_0000770
2775 Ga0495677_0001181
2776 Ga0495677_0003090
2777 Ga0495677_0003795
2778 Ga0495677_0009163
2779 Ga0495677_0009263
2780 Ga0495677_0014086
2781 Ga0495677_0014771
2782 Ga0495677_0030368
2783 Ga0495679_005544
2784 Ga0495679_006181
2785 Ga0495685_004973
2786 Ga0495685_012637
2787 Ga0495685_016362
2788 Ga0495681_0000511
2789 Ga0495681_0004519
2790 Ga0495681_0007323
2791 Ga0495681_0007880
2792 Ga0495681_0011042
2793 Ga0495681_0014050
2794 Ga0495681_0021427
2795 Ga0495681_0132894
2796 Ga0495686_0000285
2797 Ga0495686_0002310
2798 Ga0495686_0006705
2799 Ga0495686_0027657
2800 Ga0495686_0045808
2801 Ga0495686_0062322
2802 Ga0495686_0095539
2803 Ga0495593_0019690
2804 Ga0495593_0059720
2805 Ga0495602_0001988
2806 Ga0495614_0022782
2807 Ga0495614_0023201
2808 Ga0495626_0000292
2809 Ga0495626_0000613
2810 Ga0495626_0001135
2811 Ga0495626_0002631
2812 Ga0495626_0002852
2813 Ga0495626_0004684
2814 Ga0495626_0007031
2815 Ga0495626_0007060
2816 Ga0495626_0009023
2817 Ga0495626_0010170
2818 Ga0495626_0011436
2819 Ga0495626_0023223
2820 Ga0495626_0031585
2821 Ga0495626_0041572
2822 Ga0495626_0041615
2823 Ga0495626_0046013
2824 Ga0495626_0095325
2825 Ga0496102_0001005
2826 Ga0496102_0061189
2827 Ga0496102_0299954
2828 Ga0496103_0048845
2829 Ga0496103_0177770
2830 Ga0496104_0013974
2831 Ga0496104_0072768
2832 Ga0496104_0076174
2833 Ga0496104_0129352
2834 Ga0496104_0285282
2835 Ga0496104_0642085
2836 Ga0496105_0004007
2837 Ga0496105_0102484
2838 Ga0496105_0442394
2839 Ga0496106_0010926
2840 Ga0496106_0210985
2841 Ga0496109_0006786
2842 Ga0496109_0453714
2843 Ga0496109_0545671
2844 Ga0496109_0571652
2845 Ga0496110_0000641
2846 Ga0496110_0005948
2847 Ga0496110_0320276
2848 Ga0496111_0004898
2849 Ga0496111_0449360
2850 Ga0496112_0023445
2851 Ga0496112_0116116
2852 Ga0496113_0009852
2853 Ga0496115_0007458
2854 Ga0496115_0219241
2855 Ga0496122_0001645
2856 Ga0496122_0004436
2857 Ga0496123_0002540
2858 Ga0496123_0005998
2859 Ga0496123_0045219
2860 Ga0496124_0211724
2861 Ga0496125_0001339
2862 Ga0496125_0349408
2863 Ga0495678_000230
2864 Ga0495678_000244
2865 Ga0495678_001100
2866 Ga0495678_001526
2867 Ga0495678_007687
2868 Ga0495682_0000987
2869 Ga0495682_0004089
2870 Ga0495682_0009652
2871 Ga0495682_0021110
2872 Ga0501291_030416
2873 Ga0501031_0039432
2874 Ga0501031_0044131
2875 Ga0501032_0010578
2876 Ga0501032_0038231
2877 Ga0501033_0002781
2878 Ga0501033_0030331
2879 Ga0501034_0002575
2880 Ga0501034_0025960
2881 Ga0501034_0072335
2882 Ga0501034_0082596
2883 Ga0501034_0215112
2884 Ga0501036_0015924
2885 Ga0501036_0017771
2886 Ga0501037_0009766
2887 Ga0501038_0045631
2888 Ga0501038_0051438
2889 Ga0501039_0062588
2890 Ga0501042_0513438
2891 Ga0501043_0014217
2892 Ga0501043_0017144
2893 Ga0501046_0003771
2894 Ga0501046_0034804
2895 Ga0501047_0020003
2896 Ga0501047_0044284
2897 Ga0501047_0083347
2898 Ga0501047_0097691
2899 Ga0501048_0002543
2900 Ga0501048_0029999
2901 Ga0501068_0003114
2902 Ga0501068_0009245
2903 Ga0501069_0007518
2904 Ga0501069_0016457
2905 Ga0501070_0018373
2906 Ga0501070_0130332
2907 Ga0501073_0010780
2908 Ga0501073_0035014
2909 Ga0501074_0038573
2910 Ga0501076_0025946
2911 Ga0501201_002058
2912 Ga0501211_007739
2913 Ga0501223_045817
2914 Ga0501227_003631
2915 Ga0501235_009392
2916 Ga0501079_0018676
2917 Ga0501079_0021225
2918 Ga0501080_0017753
2919 Ga0501080_0104371
2920 Ga0501081_0443174
2921 Ga0501083_0030960
2922 Ga0501083_0073583
2923 Ga0501262_016440
2924 Ga0501264_005389
2925 Ga0501267_001826
2926 Ga0501271_002473
2927 Ga0501272_003078
2928 Ga0501279_015204
2929 Ga0501035_0000789
2930 Ga0501035_0023555
2931 Ga0501035_0187718
2932 Ga0501044_0089065
2933 Ga0501044_0131410
2934 Ga0501045_0003433
2935 Ga0501226_002698
2936 nmdc:mga03683_25437_c1
2937 nmdc:mga0k408_189169_c1
2938 nmdc:mga0k408_273426_c1
2939 nmdc:mga0k408_2817_c1
2940 nmdc:mga0k408_67533_c1
2941 nmdc:mga06z11_3237_c1
2942 nmdc:mga06z11_427815_c1
2943 nmdc:mga07m45_107955_c1
2944 nmdc:mga07m45_108288_c1
2945 nmdc:mga07m45_14749_c1
2946 nmdc:mga07m45_1739_c1
2947 nmdc:mga07m45_17812_c1
2948 nmdc:mga07m45_2135_c1
2949 nmdc:mga07m45_241469_c1
2950 nmdc:mga07m45_36807_c1
2951 nmdc:mga07m45_667_c1
2952 nmdc:mga07m45_9721_c2
2953 nmdc:mga05p37_450441_c1
2954 nmdc:mga06r32_149366_c1
2955 nmdc:mga08y16_13960_c1
2956 nmdc:mga0n895_105939_c1
2957 nmdc:mga0n895_178245_c1
2958 nmdc:mga0n895_184118_c1
2959 nmdc:mga0n895_258186_c1
2960 nmdc:mga0n895_798789_c1
2961 nmdc:mga0rr50_190791_c1
2962 nmdc:mga0rr50_44781_c1
2963 nmdc:mga08x19_122667_c1
2964 nmdc:mga08x19_33584_c1
2965 nmdc:mga0a205_759720_c1
2966 Ga0500635_0000007
2967 Ga0500635_0000150
2968 Ga0500578_0000025
2969 Ga0500644_0027795
2970 Ga0500646_0010670
2971 Ga0500651_0131626
2972 Ga0500651_0450153
2973 Ga0500562_038607
2974 Ga0500608_011126
2975 Ga0500608_105189
2976 Ga0500652_001368
2977 Ga0500658_0041897
2978 Ga0500564_057627
2979 Ga0500568_0051919
2980 Ga0500622_0000279
2981 Ga0500636_0004381
2982 Ga0501084_0003897
2983 Ga0501082_0039601
2984 Ga0501082_0053377
2985 Ga0466962_0021479
2986 Ga0466962_0027083
2987 Ga0466962_0042306
2988 Ga0466962_0058448
2989 2587725658
2990 2587735093
2991 2587760006
2992 2588290589
2993 2643744462
2994 2643787764
2995 2643800530
2996 2643934467
2997 2643968303
2998 2644143544
2999 2644211876
3000 2644219310
3001 2644222127
3002 2644255748
3003 2644257092
3004 2644272081
3005 2644315954
3006 2644470439
3007 2739054206
3008 2739055352
3009 2809144043
3010 8047678835

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04397

LytTR

LytTr DNA-binding domain

182

278

0.98

PF00072

Response_reg

Response regulator receiver domain

30

137

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qv0-assembly1.cif.gz_A crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae 0.9004 8 125
3d6w-assembly1.cif.gz_A lyttr dna-binding domain of putative methyl-accepting/dna response regulator from bacillus cereus. 0.9002 134 238
2r25-assembly1.cif.gz_B complex of ypd1 and sln1-r1 with bound mg2+ and bef3- 0.8951 6 119
7od9-assembly1.cif.gz_B crystal structure of activated chey fused to the c-terminal domain of chef 0.8925 5 118
6m8o-assembly1.cif.gz_A crystal structure of the receiver domain of lytr from staphylococcus aureus 0.8911 8 119
ID Description Score Start End Superfamily
af_Q58280_207_250_3.10.450.750 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9663 148 174 3.10.450.750
af_P0AFT5_129_238_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.9154 130 237 2.40.50.1020
af_P0AFT5_1_126_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9072 8 121 3.40.50.2300
2qv0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8996 8 125 3.40.50.2300
3d6wB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.896 134 203 2.40.50.40
ID Description Score Start End GO Terms
AF-A0A7C7U9T4-F1-model_v4 Response regulator 0.9734 1 74 GO:0000160
AF-A0A660R7R7-F1-model_v4 Response regulatory domain-containing protein 0.9731 7 76 GO:0000160
AF-A0A7C7WMN0-F1-model_v4 LytTR family transcriptional regulator 0.9665 148 238 GO:0000156
GO:0003677
AF-A0A4Q3FDX0-F1-model_v4 Response regulator 0.9646 8 85 GO:0000160
AF-A0A6N9R8L8-F1-model_v4 LytTR family transcriptional regulator 0.9485 133 238 GO:0000156
GO:0003677

Map