F494444

General Info

Members Datasets Scaffolds Average Seq Length
1507 478 3014 141

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_066041|Ga0400483_066041_11811_12311
Length 155
Sequence MPLAMPQGGNKLMPTFVYMTSCDGCGHCVDICPSDIMHIDKTYRRAYNIEPNMCWNAIDARGYADFAPMGHSVRVLREEDKGTISWRLKFRNGEEKNFVSPIRTTPWGSIKSPEEYDAPSPDDFKSQELAHEPDALNIEGGLPALTPDQLKQGVV

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
93 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
130 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
131 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
144 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
150 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
151 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
227 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
229 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
233 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
234 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
235 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
238 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
239 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
240 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
241 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
242 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
243 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
244 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
245 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
246 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
247 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
248 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
249 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
250 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
251 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
252 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
253 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
254 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
255 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
256 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
257 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
258 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
259 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
263 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
264 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
265 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
266 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
267 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
268 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
269 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
270 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
271 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
272 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
273 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
274 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
275 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
276 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
277 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
278 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
279 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
280 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
281 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
282 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
283 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
284 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
285 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
286 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
287 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
288 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
289 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
290 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
291 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
292 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
293 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
294 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
295 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
296 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
297 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
298 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
299 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
300 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
301 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
302 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
303 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
304 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
305 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
306 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
307 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
308 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
309 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
310 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
311 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
312 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
313 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
314 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
315 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
316 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
317 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
318 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
319 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
320 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
321 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
322 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
323 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
324 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
325 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
326 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
327 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
328 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
329 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
330 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
331 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
332 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
333 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
334 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
335 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
336 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
337 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
338 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
339 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
340 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
341 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
342 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
343 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
344 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
345 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
346 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
347 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
348 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
349 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
350 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
351 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
352 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
353 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
354 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
355 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
356 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
357 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
358 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
359 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
360 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
361 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
362 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
363 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
364 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
365 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
366 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
367 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
368 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
369 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
370 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
371 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
372 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
373 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
374 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
375 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
376 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
377 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
378 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
379 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
380 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
381 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
382 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
383 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
384 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
385 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
386 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
387 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
388 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
389 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
390 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
391 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
392 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
393 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
394 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
395 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
396 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
397 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
398 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
399 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
400 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
401 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
402 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
403 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
404 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
405 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
406 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
407 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
408 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
409 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
410 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
411 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
412 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
427 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
428 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
429 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
430 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
431 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
432 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
433 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
434 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
435 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
436 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
437 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
438 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
439 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
440 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
441 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
442 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
443 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
444 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
445 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
446 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
447 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
448 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
449 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
453 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
454 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
455 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
456 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
457 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
458 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
459 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
460 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
461 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
462 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
463 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
464 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
465 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
466 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
467 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
468 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
469 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
470 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
471 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
472 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
473 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
474 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
475 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
476 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
477 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
478 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 3.25
Rhizosphere 95.16
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_066041 3300039062 Bacteria 12570
2 ARcpr5oldR_c008724 3300000041 Bacteria 859
3 ARSoilOldRDRAFT_c007538 3300000044 Bacteria 906
4 ARCol0yngRDRAFT_1004242 3300000652 Bacteria 1041
5 JGI24752J21851_1025306 3300001976 Bacteria 779
6 JGI24737J22298_10095247 3300001990 Bacteria 882
7 JGI24742J22300_10022069 3300002244 Bacteria 1090
8 JGI25406J46586_10038211 3300003203 Bacteria 1723
9 JGI25406J46586_10210527 3300003203 Unclassified 568
10 JGI25405J52794_10008962 3300003911 Bacteria 1880
11 Ga0065712_10005527 3300005290 Bacteria 4955
12 Ga0065712_10108843 3300005290 Bacteria 1853
13 Ga0065715_10620808 3300005293 Bacteria 695
14 Ga0065707_10002365 3300005295 Bacteria 9369
15 Ga0065707_10088467 3300005295 Bacteria 4651
16 Ga0065707_10099260 3300005295 Bacteria 3020
17 Ga0065707_10636557 3300005295 Bacteria 670
18 Ga0070658_10102291 3300005327 Bacteria 2369
19 Ga0070658_10242319 3300005327 Bacteria 1528
20 Ga0070676_10061777 3300005328 Bacteria 2227
21 Ga0070676_10068148 3300005328 Bacteria 2130
22 Ga0070676_10097603 3300005328 Bacteria 1810
23 Ga0070676_10219955 3300005328 Bacteria 1254
24 Ga0070683_100074710 3300005329 Bacteria 3166
25 Ga0070683_100091214 3300005329 Bacteria 2861
26 Ga0070690_100000203 3300005330 Bacteria 31114
27 Ga0070690_100115816 3300005330 Bacteria 1794
28 Ga0070690_100937605 3300005330 Bacteria 679
29 Ga0070670_100024117 3300005331 Bacteria 5233
30 Ga0070670_100025997 3300005331 Bacteria 5038
31 Ga0070670_100244519 3300005331 Bacteria 1562
32 Ga0070670_100586894 3300005331 Bacteria 996
33 Ga0070677_10003307 3300005333 Bacteria 5189
34 Ga0070677_10183258 3300005333 Bacteria 999
35 Ga0068869_100001312 3300005334 Bacteria 14728
36 Ga0068869_100013668 3300005334 Bacteria 5407
37 Ga0068869_100599159 3300005334 Bacteria 930
38 Ga0068869_100898034 3300005334 Bacteria 767
39 Ga0068869_101027895 3300005334 Bacteria 718
40 Ga0068869_101082364 3300005334 Bacteria 701
41 Ga0070666_10065140 3300005335 Bacteria 2472
42 Ga0070666_10235412 3300005335 Bacteria 1294
43 Ga0070666_10743376 3300005335 Bacteria 721
44 Ga0070666_10815464 3300005335 Bacteria 688
45 Ga0070680_100003010 3300005336 Bacteria 12517
46 Ga0070680_100050080 3300005336 Bacteria 3406
47 Ga0070680_100368816 3300005336 Bacteria 1221
48 Ga0070682_100003169 3300005337 Bacteria 9110
49 Ga0070682_100021852 3300005337 Bacteria 3782
50 Ga0070682_100352302 3300005337 Bacteria 1098
51 Ga0070682_100948056 3300005337 Bacteria 711
52 Ga0068868_100206121 3300005338 Bacteria 1641
53 Ga0068868_100669108 3300005338 Bacteria 926
54 Ga0070660_100013058 3300005339 Bacteria 5946
55 Ga0070660_100069127 3300005339 Bacteria 2753
56 Ga0070660_100245986 3300005339 Bacteria 1457
57 Ga0070660_100725806 3300005339 Bacteria 834
58 Ga0070689_100005620 3300005340 Bacteria 8583
59 Ga0070689_100008280 3300005340 Bacteria 7316
60 Ga0070689_100049288 3300005340 Bacteria 3251
61 Ga0070689_100209773 3300005340 Bacteria 1594
62 Ga0070689_100267632 3300005340 Bacteria 1414
63 Ga0070689_100395251 3300005340 Bacteria 1167
64 Ga0070689_100868643 3300005340 Bacteria 796
65 Ga0070691_10000424 3300005341 Bacteria 15512
66 Ga0070687_100000070 3300005343 Bacteria 33041
67 Ga0070687_100026386 3300005343 Bacteria 2797
68 Ga0070687_100125820 3300005343 Bacteria 1473
69 Ga0070687_100126903 3300005343 Bacteria 1468
70 Ga0070687_100599323 3300005343 Bacteria 757
71 Ga0070687_100835024 3300005343 Bacteria 656
72 Ga0070661_100001889 3300005344 Bacteria 14506
73 Ga0070661_100070625 3300005344 Bacteria 2568
74 Ga0070661_100285902 3300005344 Bacteria 1280
75 Ga0070661_100491845 3300005344 Bacteria 981
76 Ga0070692_10003621 3300005345 Bacteria 6306
77 Ga0070692_10141185 3300005345 Bacteria 1363
78 Ga0070668_100017254 3300005347 Bacteria 5405
79 Ga0070668_100155309 3300005347 Bacteria 1853
80 Ga0070668_100318058 3300005347 Bacteria 1309
81 Ga0070668_100463440 3300005347 Bacteria 1091
82 Ga0070668_101144151 3300005347 Bacteria 704
83 Ga0070669_100001468 3300005353 Bacteria 17062
84 Ga0070669_100159340 3300005353 Bacteria 1752
85 Ga0070669_100176116 3300005353 Bacteria 1670
86 Ga0070669_100403643 3300005353 Bacteria 1119
87 Ga0070669_100533857 3300005353 Bacteria 976
88 Ga0070669_100574985 3300005353 Bacteria 942
89 Ga0070675_100009053 3300005354 Bacteria 7735
90 Ga0070675_100361041 3300005354 Bacteria 1290
91 Ga0070675_100975905 3300005354 Bacteria 778
92 Ga0070675_100993373 3300005354 Bacteria 770
93 Ga0070675_101247644 3300005354 Bacteria 684
94 Ga0070671_100003908 3300005355 Bacteria 11719
95 Ga0070671_100085878 3300005355 Bacteria 2632
96 Ga0070671_100281100 3300005355 Bacteria 1415
97 Ga0070671_100503709 3300005355 Bacteria 1042
98 Ga0070671_100666350 3300005355 Bacteria 901
99 Ga0070671_101703464 3300005355 Bacteria 559
100 Ga0070674_100002697 3300005356 Bacteria 9817
101 Ga0070674_100014002 3300005356 Bacteria 4976
102 Ga0070674_100037392 3300005356 Bacteria 3265
103 Ga0070674_100078744 3300005356 Bacteria 2349
104 Ga0070673_100015782 3300005364 Bacteria 5318
105 Ga0070673_100034438 3300005364 Bacteria 3833
106 Ga0070673_100096978 3300005364 Bacteria 2420
107 Ga0070673_100114289 3300005364 Bacteria 2243
108 Ga0070673_100690315 3300005364 Bacteria 937
109 Ga0070688_100499687 3300005365 Bacteria 917
110 Ga0070688_100557793 3300005365 Bacteria 872
111 Ga0070688_100865594 3300005365 Bacteria 711
112 Ga0070659_100051777 3300005366 Bacteria 3229
113 Ga0070659_100081052 3300005366 Bacteria 2592
114 Ga0070659_100381688 3300005366 Bacteria 1187
115 Ga0070667_100007696 3300005367 Bacteria 8933
116 Ga0070667_100061678 3300005367 Bacteria 3175
117 Ga0070667_100070247 3300005367 Bacteria 2980
118 Ga0070667_100141487 3300005367 Bacteria 2107
119 Ga0070703_10099978 3300005406 Bacteria 1021
120 Ga0070709_10058148 3300005434 Bacteria 2451
121 Ga0070709_10145483 3300005434 Bacteria 1633
122 Ga0070709_10153545 3300005434 Bacteria 1594
123 Ga0070709_10178377 3300005434 Bacteria 1490
124 Ga0070709_10379426 3300005434 Bacteria 1051
125 Ga0070714_100005848 3300005435 Bacteria 9438
126 Ga0070714_100027567 3300005435 Bacteria 4705
127 Ga0070714_100045447 3300005435 Bacteria 3722
128 Ga0070714_100057298 3300005435 Bacteria 3335
129 Ga0070714_100166403 3300005435 Bacteria 1998
130 Ga0070714_100204124 3300005435 Bacteria 1809
131 Ga0070714_100233930 3300005435 Bacteria 1694
132 Ga0070714_100267051 3300005435 Bacteria 1586
133 Ga0070714_100406768 3300005435 Bacteria 1287
134 Ga0070713_100002660 3300005436 Bacteria 11645
135 Ga0070713_100051664 3300005436 Bacteria 3400
136 Ga0070713_100086927 3300005436 Bacteria 2681
137 Ga0070710_10001294 3300005437 Bacteria 11857
138 Ga0070710_10002482 3300005437 Bacteria 8739
139 Ga0070710_10016968 3300005437 Bacteria 3717
140 Ga0070710_10185300 3300005437 Bacteria 1306
141 Ga0070710_10273357 3300005437 Bacteria 1094
142 Ga0070701_10000661 3300005438 Bacteria 12109
143 Ga0070701_10012854 3300005438 Bacteria 3789
144 Ga0070701_10103345 3300005438 Bacteria 1582
145 Ga0070711_100001151 3300005439 Bacteria 14210
146 Ga0070711_100110979 3300005439 Bacteria 2013
147 Ga0070711_100122578 3300005439 Bacteria 1925
148 Ga0070711_100555706 3300005439 Bacteria 953
149 Ga0070711_100556001 3300005439 Bacteria 953
150 Ga0070705_100001132 3300005440 Bacteria 14728
151 Ga0070705_100124126 3300005440 Bacteria 1672
152 Ga0070705_100183316 3300005440 Bacteria 1420
153 Ga0070700_100000651 3300005441 Bacteria 17154
154 Ga0070700_100025003 3300005441 Bacteria 3513
155 Ga0070700_100173283 3300005441 Bacteria 1496
156 Ga0070694_100000669 3300005444 Bacteria 18977
157 Ga0070694_100010076 3300005444 Bacteria 5812
158 Ga0070694_100078205 3300005444 Bacteria 2294
159 Ga0070708_100164107 3300005445 Bacteria 2071
160 Ga0070708_100867733 3300005445 Bacteria 848
161 Ga0070663_100006342 3300005455 Bacteria 7102
162 Ga0070663_100018980 3300005455 Bacteria 4521
163 Ga0070663_101815155 3300005455 Bacteria 547
164 Ga0070678_100153793 3300005456 Bacteria 1856
165 Ga0070678_100402533 3300005456 Bacteria 1189
166 Ga0070662_100000213 3300005457 Bacteria 33995
167 Ga0070662_100128084 3300005457 Bacteria 1954
168 Ga0070662_100277789 3300005457 Bacteria 1355
169 Ga0070662_100569245 3300005457 Bacteria 951
170 Ga0070662_101019226 3300005457 Bacteria 709
171 Ga0070662_101273185 3300005457 Bacteria 633
172 Ga0070662_101372709 3300005457 Bacteria 609
173 Ga0070662_101955176 3300005457 Bacteria 507
174 Ga0070681_10146333 3300005458 Bacteria 2292
175 Ga0070681_10174957 3300005458 Bacteria 2068
176 Ga0070681_10211627 3300005458 Bacteria 1855
177 Ga0070681_10232896 3300005458 Bacteria 1756
178 Ga0068867_100002241 3300005459 Bacteria 13590
179 Ga0068867_100026348 3300005459 Bacteria 4174
180 Ga0068867_100070809 3300005459 Bacteria 2607
181 Ga0068867_100209452 3300005459 Bacteria 1565
182 Ga0068867_101136359 3300005459 Bacteria 715
183 Ga0070685_10008574 3300005466 Bacteria 5262
184 Ga0070685_10014591 3300005466 Bacteria 4163
185 Ga0070706_100520352 3300005467 Bacteria 1107
186 Ga0070698_100360875 3300005471 Bacteria 1385
187 Ga0070698_100478213 3300005471 Bacteria 1182
188 Ga0070698_100742365 3300005471 Bacteria 924
189 Ga0070699_100013067 3300005518 Bacteria 7155
190 Ga0070699_100176113 3300005518 Bacteria 1897
191 Ga0070699_100855114 3300005518 Bacteria 833
192 Ga0070679_100007583 3300005530 Bacteria 10151
193 Ga0070679_100093990 3300005530 Bacteria 2986
194 Ga0070679_100158919 3300005530 Bacteria 2234
195 Ga0070679_100282888 3300005530 Bacteria 1611
196 Ga0070679_100343952 3300005530 Bacteria 1440
197 Ga0070679_100474284 3300005530 Bacteria 1195
198 Ga0070684_100044288 3300005535 Bacteria 3849
199 Ga0070684_100366942 3300005535 Bacteria 1325
200 Ga0070697_100022929 3300005536 Bacteria 4964
201 Ga0068853_100006369 3300005539 Bacteria 9373
202 Ga0068853_100106579 3300005539 Bacteria 2484
203 Ga0068853_100235539 3300005539 Bacteria 1676
204 Ga0068853_100576458 3300005539 Bacteria 1067
205 Ga0068853_101593276 3300005539 Bacteria 633
206 Ga0070672_100000549 3300005543 Bacteria 22048
207 Ga0070672_100001925 3300005543 Bacteria 13029
208 Ga0070672_100008206 3300005543 Bacteria 7136
209 Ga0070672_100188651 3300005543 Bacteria 1720
210 Ga0070672_100471141 3300005543 Bacteria 1084
211 Ga0070686_100002595 3300005544 Bacteria 9973
212 Ga0070686_100006070 3300005544 Bacteria 6702
213 Ga0070686_100042460 3300005544 Bacteria 2848
214 Ga0070686_100587846 3300005544 Bacteria 876
215 Ga0070695_100000808 3300005545 Bacteria 16831
216 Ga0070695_100137634 3300005545 Bacteria 1689
217 Ga0070696_100000441 3300005546 Bacteria 25931
218 Ga0070696_100257650 3300005546 Bacteria 1321
219 Ga0070696_100291239 3300005546 Bacteria 1247
220 Ga0070696_100378515 3300005546 Bacteria 1103
221 Ga0070696_100534371 3300005546 Bacteria 937
222 Ga0070693_100000574 3300005547 Bacteria 16325
223 Ga0070693_100091125 3300005547 Bacteria 1838
224 Ga0070693_100920014 3300005547 Bacteria 657
225 Ga0070665_100108756 3300005548 Bacteria 2775
226 Ga0070665_100226571 3300005548 Bacteria 1869
227 Ga0070665_100302154 3300005548 Bacteria 1603
228 Ga0070665_101486067 3300005548 Bacteria 686
229 Ga0070704_100000617 3300005549 Bacteria 17151
230 Ga0070704_100054392 3300005549 Bacteria 2832
231 Ga0070704_100095571 3300005549 Bacteria 2226
232 Ga0070704_100188068 3300005549 Bacteria 1657
233 Ga0070704_100238680 3300005549 Bacteria 1486
234 Ga0070704_100423248 3300005549 Bacteria 1141
235 Ga0068855_100000606 3300005563 Bacteria 43933
236 Ga0068855_100010150 3300005563 Bacteria 11350
237 Ga0068855_100013117 3300005563 Bacteria 9994
238 Ga0068855_100283202 3300005563 Bacteria 1840
239 Ga0068855_100365630 3300005563 Bacteria 1587
240 Ga0070664_100001419 3300005564 Bacteria 19108
241 Ga0070664_100026130 3300005564 Bacteria 4841
242 Ga0070664_100105074 3300005564 Bacteria 2459
243 Ga0070664_100166809 3300005564 Bacteria 1951
244 Ga0070664_101184549 3300005564 Bacteria 720
245 Ga0068857_100009173 3300005577 Bacteria 8588
246 Ga0068857_100201424 3300005577 Bacteria 1815
247 Ga0068857_100426228 3300005577 Bacteria 1237
248 Ga0068857_101285587 3300005577 Bacteria 710
249 Ga0068857_101775231 3300005577 Bacteria 604
250 Ga0068854_100002203 3300005578 Bacteria 11988
251 Ga0068854_100006160 3300005578 Bacteria 7614
252 Ga0068856_100001525 3300005614 Bacteria 24270
253 Ga0068856_100008271 3300005614 Bacteria 10142
254 Ga0068856_100051047 3300005614 Bacteria 4078
255 Ga0068856_100074478 3300005614 Bacteria 3361
256 Ga0068856_100198323 3300005614 Bacteria 2022
257 Ga0068856_100209412 3300005614 Bacteria 1965
258 Ga0070702_100000349 3300005615 Bacteria 16123
259 Ga0070702_100098605 3300005615 Bacteria 1788
260 Ga0068852_100002715 3300005616 Bacteria 12233
261 Ga0068852_100261512 3300005616 Bacteria 1662
262 Ga0068852_100318145 3300005616 Bacteria 1510
263 Ga0068852_100411322 3300005616 Bacteria 1332
264 Ga0068859_100000445 3300005617 Bacteria 41359
265 Ga0068859_100350188 3300005617 Bacteria 1572
266 Ga0068864_100032507 3300005618 Bacteria 4433
267 Ga0068864_100129378 3300005618 Bacteria 2266
268 Ga0068864_100481280 3300005618 Bacteria 1191
269 Ga0068864_100509716 3300005618 Bacteria 1158
270 Ga0068864_100621995 3300005618 Bacteria 1049
271 Ga0068866_10000640 3300005718 Bacteria 15843
272 Ga0068866_10028466 3300005718 Bacteria 2663
273 Ga0068866_10060889 3300005718 Bacteria 1958
274 Ga0068866_10382455 3300005718 Bacteria 903
275 Ga0068861_100000246 3300005719 Bacteria 29867
276 Ga0068861_100171684 3300005719 Bacteria 1798
277 Ga0068861_100207144 3300005719 Bacteria 1650
278 Ga0068861_100231409 3300005719 Bacteria 1568
279 Ga0068861_100307477 3300005719 Bacteria 1376
280 Ga0068861_100368245 3300005719 Bacteria 1266
281 Ga0068851_10031275 3300005834 Bacteria 2643
282 Ga0068870_10082065 3300005840 Bacteria 1784
283 Ga0068863_100110791 3300005841 Bacteria 2614
284 Ga0068863_100504604 3300005841 Bacteria 1191
285 Ga0068863_100590437 3300005841 Bacteria 1099
286 Ga0068863_100767672 3300005841 Bacteria 960
287 Ga0068863_101716005 3300005841 Bacteria 638
288 Ga0068858_100005536 3300005842 Bacteria 12365
289 Ga0068858_100095652 3300005842 Bacteria 2768
290 Ga0068858_100100838 3300005842 Bacteria 2693
291 Ga0068858_100197202 3300005842 Bacteria 1903
292 Ga0068858_100780719 3300005842 Bacteria 932
293 Ga0068860_100016800 3300005843 Bacteria 7134
294 Ga0068860_100020458 3300005843 Bacteria 6410
295 Ga0068860_100029056 3300005843 Bacteria 5318
296 Ga0068860_100206580 3300005843 Bacteria 1905
297 Ga0068860_101147188 3300005843 Bacteria 797
298 Ga0068862_100000668 3300005844 Bacteria 35204
299 Ga0068862_100064503 3300005844 Bacteria 3153
300 Ga0068862_100174409 3300005844 Bacteria 1926
301 Ga0068862_101148160 3300005844 Bacteria 773
302 Ga0068862_101544973 3300005844 Bacteria 670
303 Ga0081455_10022859 3300005937 Bacteria 5831
304 Ga0081455_10034387 3300005937 Bacteria 4541
305 Ga0081455_10878260 3300005937 Bacteria 559
306 Ga0081538_10023230 3300005981 Bacteria 4464
307 Ga0081538_10057385 3300005981 Bacteria 2269
308 Ga0081540_1014625 3300005983 Bacteria 5016
309 Ga0081539_10000668 3300005985 Bacteria 68754
310 Ga0081539_10010842 3300005985 Bacteria 7323
311 Ga0081539_10062170 3300005985 Bacteria 2042
312 Ga0070717_10004842 3300006028 Bacteria 9791
313 Ga0070717_10120445 3300006028 Bacteria 2247
314 Ga0070717_10531282 3300006028 Bacteria 1064
315 Ga0075365_10000927 3300006038 Bacteria 12378
316 Ga0075365_10299154 3300006038 Bacteria 1132
317 Ga0075368_10001598 3300006042 Bacteria 7279
318 Ga0075363_100003287 3300006048 Bacteria 6844
319 Ga0075364_10000041 3300006051 Bacteria 45457
320 Ga0075364_10011581 3300006051 Bacteria 5360
321 Ga0075432_10107619 3300006058 Bacteria 1036
322 Ga0070715_10000182 3300006163 Bacteria 14731
323 Ga0070715_10000437 3300006163 Bacteria 10688
324 Ga0070716_100003522 3300006173 Bacteria 7379
325 Ga0070716_100080005 3300006173 Bacteria 1947
326 Ga0070712_100002706 3300006175 Bacteria 10946
327 Ga0070712_100007781 3300006175 Bacteria 6706
328 Ga0075362_10008189 3300006177 Bacteria 3989
329 Ga0075367_10005610 3300006178 Bacteria 6255
330 Ga0097621_100001417 3300006237 Bacteria 16484
331 Ga0097621_100020377 3300006237 Bacteria 5108
332 Ga0097621_100022117 3300006237 Bacteria 4932
333 Ga0097621_100083136 3300006237 Bacteria 2667
334 Ga0097621_100097077 3300006237 Bacteria 2473
335 Ga0097621_101080174 3300006237 Bacteria 753
336 Ga0068871_100001297 3300006358 Bacteria 16703
337 Ga0068871_100007981 3300006358 Bacteria 7594
338 Ga0068871_100008656 3300006358 Bacteria 7319
339 Ga0068871_100042675 3300006358 Bacteria 3642
340 Ga0068871_100073999 3300006358 Bacteria 2809
341 Ga0075428_100052937 3300006844 Bacteria 4448
342 Ga0075428_100282077 3300006844 Bacteria 1787
343 Ga0075428_100385998 3300006844 Bacteria 1501
344 Ga0075428_100651616 3300006844 Bacteria 1123
345 Ga0075430_100002128 3300006846 Bacteria 16396
346 Ga0075430_100455550 3300006846 Bacteria 1056
347 Ga0075430_100867491 3300006846 Bacteria 744
348 Ga0075431_100214374 3300006847 Bacteria 1966
349 Ga0075431_100248531 3300006847 Bacteria 1808
350 Ga0075431_100366561 3300006847 Bacteria 1446
351 Ga0075431_100621348 3300006847 Bacteria 1063
352 Ga0075433_10005804 3300006852 Bacteria 9719
353 Ga0075433_10370533 3300006852 Bacteria 1265
354 Ga0075433_10494810 3300006852 Bacteria 1076
355 Ga0075433_10708434 3300006852 Bacteria 881
356 Ga0075434_100000078 3300006871 Bacteria 52232
357 Ga0075434_100005507 3300006871 Bacteria 11531
358 Ga0075434_100251027 3300006871 Bacteria 1788
359 Ga0075434_100398224 3300006871 Bacteria 1398
360 Ga0075434_100529973 3300006871 Bacteria 1198
361 Ga0075434_100770625 3300006871 Bacteria 979
362 Ga0075434_101059080 3300006871 Bacteria 825
363 Ga0075434_101078082 3300006871 Bacteria 817
364 Ga0075429_100016021 3300006880 Bacteria 6493
365 Ga0068865_100001575 3300006881 Bacteria 13328
366 Ga0068865_100027289 3300006881 Bacteria 3770
367 Ga0068865_101009682 3300006881 Bacteria 729
368 Ga0075436_100021839 3300006914 Bacteria 4394
369 Ga0075436_100034523 3300006914 Bacteria 3488
370 Ga0075436_100048582 3300006914 Bacteria 2927
371 Ga0075436_100108509 3300006914 Bacteria 1936
372 Ga0075436_101243502 3300006914 Bacteria 563
373 Ga0097620_100000445 3300006931 Bacteria 41359
374 Ga0097620_100350212 3300006931 Bacteria 1572
375 Ga0075435_100010161 3300007076 Bacteria 6874
376 Ga0075435_100014627 3300007076 Bacteria 5875
377 Ga0075435_100034163 3300007076 Bacteria 4026
378 Ga0075435_100063542 3300007076 Bacteria 2998
379 Ga0075435_100091182 3300007076 Bacteria 2515
380 Ga0075435_100173042 3300007076 Bacteria 1822
381 Ga0075435_100197770 3300007076 Bacteria 1703
382 Ga0075435_100550978 3300007076 Bacteria 999
383 Ga0075435_100669088 3300007076 Bacteria 902
384 Ga0105251_10116809 3300009011 Bacteria 1213
385 Ga0105240_10008246 3300009093 Bacteria 14923
386 Ga0105240_10127951 3300009093 Bacteria 3049
387 Ga0105240_10205645 3300009093 Bacteria 2304
388 Ga0105240_10734918 3300009093 Bacteria 1074
389 Ga0105240_11685905 3300009093 Bacteria 662
390 Ga0111539_10013658 3300009094 Bacteria 10144
391 Ga0111539_10026456 3300009094 Bacteria 7092
392 Ga0111539_10109700 3300009094 Bacteria 3238
393 Ga0111539_10119315 3300009094 Bacteria 3091
394 Ga0111539_10243656 3300009094 Bacteria 2093
395 Ga0111539_10341626 3300009094 Bacteria 1742
396 Ga0111539_10413601 3300009094 Bacteria 1571
397 Ga0111539_10417775 3300009094 Bacteria 1562
398 Ga0111539_10737902 3300009094 Bacteria 1146
399 Ga0105245_10003710 3300009098 Bacteria 13618
400 Ga0105245_10164719 3300009098 Bacteria 2106
401 Ga0105245_10302682 3300009098 Bacteria 1569
402 Ga0105245_11380977 3300009098 Bacteria 754
403 Ga0105245_11441723 3300009098 Bacteria 739
404 Ga0105247_10021649 3300009101 Bacteria 3869
405 Ga0105247_11001745 3300009101 Bacteria 652
406 Ga0105247_11147045 3300009101 Bacteria 616
407 Ga0114129_10009272 3300009147 Bacteria 14034
408 Ga0114129_10107675 3300009147 Bacteria 3849
409 Ga0114129_10207604 3300009147 Bacteria 2650
410 Ga0114129_10268489 3300009147 Bacteria 2283
411 Ga0105243_10001954 3300009148 Bacteria 17554
412 Ga0105243_10074020 3300009148 Bacteria 2762
413 Ga0105243_10136991 3300009148 Bacteria 2084
414 Ga0105243_10309300 3300009148 Bacteria 1435
415 Ga0105243_10510528 3300009148 Bacteria 1141
416 Ga0105243_10586419 3300009148 Bacteria 1071
417 Ga0105243_12742008 3300009148 Bacteria 533
418 Ga0105241_10012048 3300009174 Bacteria 6352
419 Ga0105241_10026716 3300009174 Bacteria 4296
420 Ga0105241_10038739 3300009174 Bacteria 3594
421 Ga0105241_10226728 3300009174 Bacteria 1573
422 Ga0105242_10002505 3300009176 Bacteria 14406
423 Ga0105242_10029479 3300009176 Bacteria 4378
424 Ga0105242_10053049 3300009176 Bacteria 3310
425 Ga0105242_10064199 3300009176 Bacteria 3026
426 Ga0105242_10602692 3300009176 Bacteria 1061
427 Ga0105242_10707290 3300009176 Bacteria 987
428 Ga0105242_11202355 3300009176 Bacteria 777
429 Ga0105242_11252819 3300009176 Bacteria 763
430 Ga0105242_12318532 3300009176 Bacteria 583
431 Ga0105248_10017431 3300009177 Bacteria 7919
432 Ga0105248_10029612 3300009177 Bacteria 6108
433 Ga0105248_10047993 3300009177 Bacteria 4789
434 Ga0105248_10173528 3300009177 Bacteria 2430
435 Ga0105237_10013134 3300009545 Bacteria 8691
436 Ga0105237_10034871 3300009545 Bacteria 5092
437 Ga0105237_10074539 3300009545 Bacteria 3386
438 Ga0105237_10253874 3300009545 Bacteria 1761
439 Ga0105237_10758446 3300009545 Bacteria 977
440 Ga0105237_10780658 3300009545 Bacteria 962
441 Ga0105238_10067129 3300009551 Bacteria 3588
442 Ga0105238_11629773 3300009551 Bacteria 675
443 Ga0105249_10026793 3300009553 Bacteria 5198
444 Ga0105249_10287423 3300009553 Bacteria 1645
445 Ga0105249_10377924 3300009553 Bacteria 1442
446 Ga0105249_10902334 3300009553 Bacteria 951
447 Ga0105249_10992345 3300009553 Bacteria 908
448 Ga0105249_11231650 3300009553 Bacteria 819
449 Ga0105249_12672747 3300009553 Bacteria 571
450 Ga0105239_10013511 3300010375 Bacteria 9065
451 Ga0105239_10641648 3300010375 Bacteria 1212
452 Ga0105239_12034082 3300010375 Bacteria 667
453 Ga0105246_10147383 3300011119 Bacteria 1778
454 Ga0105246_10389000 3300011119 Bacteria 1155
455 Ga0105246_10878288 3300011119 Bacteria 802
456 Ga0157321_1027039 3300012487 Bacteria 563
457 Ga0157341_1002427 3300012494 Bacteria 1229
458 Ga0157341_1018867 3300012494 Bacteria 663
459 Ga0157338_1013841 3300012515 Bacteria 862
460 Ga0157373_10004556 3300013100 Bacteria 10421
461 Ga0157373_10006641 3300013100 Bacteria 8617
462 Ga0157373_10020207 3300013100 Bacteria 4843
463 Ga0157373_10030071 3300013100 Bacteria 3909
464 Ga0157373_10189694 3300013100 Bacteria 1448
465 Ga0157373_10355042 3300013100 Bacteria 1046
466 Ga0157371_10001833 3300013102 Bacteria 21422
467 Ga0157371_10040213 3300013102 Bacteria 3341
468 Ga0157371_10793364 3300013102 Bacteria 713
469 Ga0157371_10837067 3300013102 Bacteria 695
470 Ga0157371_10891512 3300013102 Bacteria 674
471 Ga0157370_10006051 3300013104 Bacteria 13437
472 Ga0157370_10009625 3300013104 Bacteria 10285
473 Ga0157370_10020601 3300013104 Bacteria 6582
474 Ga0157370_10022043 3300013104 Bacteria 6342
475 Ga0157370_10038915 3300013104 Bacteria 4599
476 Ga0157370_10047399 3300013104 Bacteria 4120
477 Ga0157370_10121653 3300013104 Bacteria 2437
478 Ga0157370_10318958 3300013104 Bacteria 1434
479 Ga0157370_10359999 3300013104 Bacteria 1341
480 Ga0157369_10008592 3300013105 Bacteria 11716
481 Ga0157369_10015589 3300013105 Bacteria 8564
482 Ga0157369_10117184 3300013105 Bacteria 2827
483 Ga0157369_10796483 3300013105 Bacteria 971
484 Ga0157369_10829158 3300013105 Bacteria 950
485 Ga0157369_11146261 3300013105 Bacteria 794
486 Ga0157369_12615031 3300013105 Bacteria 510
487 Ga0157374_10047543 3300013296 Bacteria 3979
488 Ga0157374_10194222 3300013296 Bacteria 1986
489 Ga0157374_10685817 3300013296 Bacteria 1037
490 Ga0157378_10001142 3300013297 Bacteria 24153
491 Ga0157378_10004789 3300013297 Bacteria 11859
492 Ga0157378_10057867 3300013297 Bacteria 3456
493 Ga0157378_10371469 3300013297 Bacteria 1402
494 Ga0157378_10970178 3300013297 Bacteria 883
495 Ga0163162_10045373 3300013306 Bacteria 4403
496 Ga0163162_10100801 3300013306 Bacteria 2979
497 Ga0163162_10221834 3300013306 Bacteria 2020
498 Ga0163162_10483176 3300013306 Bacteria 1370
499 Ga0163162_11862376 3300013306 Bacteria 688
500 Ga0157372_10155810 3300013307 Bacteria 2638
501 Ga0157372_10343546 3300013307 Bacteria 1739
502 Ga0157372_10372700 3300013307 Bacteria 1663
503 Ga0157372_10430496 3300013307 Bacteria 1538
504 Ga0157372_10614669 3300013307 Bacteria 1267
505 Ga0157372_11146448 3300013307 Bacteria 899
506 Ga0157372_12251908 3300013307 Bacteria 626
507 Ga0157375_10009737 3300013308 Bacteria 8448
508 Ga0157375_10236624 3300013308 Bacteria 1985
509 Ga0157375_10758569 3300013308 Bacteria 1121
510 Ga0157375_11186320 3300013308 Bacteria 895
511 Ga0157375_11210412 3300013308 Bacteria 886
512 Ga0163163_10122200 3300014325 Bacteria 2638
513 Ga0163163_10249903 3300014325 Bacteria 1824
514 Ga0163163_10495263 3300014325 Bacteria 1284
515 Ga0163163_10668280 3300014325 Bacteria 1102
516 Ga0163163_10904119 3300014325 Bacteria 946
517 Ga0157380_10022847 3300014326 Bacteria 4716
518 Ga0157380_10168744 3300014326 Bacteria 1909
519 Ga0157380_10359519 3300014326 Bacteria 1365
520 Ga0157380_10789224 3300014326 Bacteria 965
521 Ga0157380_12263456 3300014326 Bacteria 608
522 Ga0182008_10260096 3300014497 Bacteria 897
523 Ga0157377_10099694 3300014745 Bacteria 1728
524 Ga0157377_11331231 3300014745 Bacteria 563
525 Ga0157379_10049777 3300014968 Bacteria 3741
526 Ga0157379_10260529 3300014968 Bacteria 1575
527 Ga0157379_10611967 3300014968 Bacteria 1018
528 Ga0157376_10003476 3300014969 Bacteria 10858
529 Ga0157376_10008293 3300014969 Bacteria 7488
530 Ga0157376_10015215 3300014969 Bacteria 5805
531 Ga0157376_10210607 3300014969 Bacteria 1794
532 Ga0157376_10359721 3300014969 Bacteria 1395
533 Ga0157376_10668041 3300014969 Bacteria 1041
534 Ga0163161_10025300 3300017792 Bacteria 4200
535 Ga0163161_10029236 3300017792 Bacteria 3917
536 Ga0163161_10246347 3300017792 Bacteria 1391
537 Ga0163161_10569868 3300017792 Bacteria 930
538 Ga0206356_11413287 3300020070 Bacteria 870
539 Ga0213874_10005027 3300021377 Bacteria 3060
540 Ga0224572_1097226 3300024225 Bacteria 543
541 Ga0207666_1060908 3300025271 Bacteria 603
542 Ga0207697_10030659 3300025315 Bacteria 2200
543 Ga0207697_10358773 3300025315 Bacteria 647
544 Ga0207656_10039789 3300025321 Bacteria 1991
545 Ga0207682_10003597 3300025893 Bacteria 6697
546 Ga0207682_10051678 3300025893 Bacteria 1703
547 Ga0207682_10130280 3300025893 Bacteria 1122
548 Ga0207682_10279103 3300025893 Bacteria 781
549 Ga0207692_10000503 3300025898 Bacteria 13785
550 Ga0207692_10066469 3300025898 Bacteria 1885
551 Ga0207692_10067436 3300025898 Bacteria 1873
552 Ga0207692_10133987 3300025898 Bacteria 1402
553 Ga0207692_10141416 3300025898 Bacteria 1369
554 Ga0207692_10269474 3300025898 Bacteria 1026
555 Ga0207642_10005995 3300025899 Bacteria 4012
556 Ga0207642_10016410 3300025899 Bacteria 2788
557 Ga0207642_10177760 3300025899 Bacteria 1157
558 Ga0207710_10017641 3300025900 Bacteria 3028
559 Ga0207710_10538858 3300025900 Bacteria 607
560 Ga0207688_10037295 3300025901 Bacteria 2695
561 Ga0207688_10532938 3300025901 Bacteria 737
562 Ga0207688_10748326 3300025901 Bacteria 619
563 Ga0207680_10064395 3300025903 Bacteria 2247
564 Ga0207680_10211366 3300025903 Bacteria 1326
565 Ga0207680_10257182 3300025903 Bacteria 1207
566 Ga0207680_10483588 3300025903 Bacteria 881
567 Ga0207647_10267324 3300025904 Bacteria 978
568 Ga0207647_10425684 3300025904 Bacteria 746
569 Ga0207685_10000354 3300025905 Bacteria 7477
570 Ga0207685_10001723 3300025905 Bacteria 4743
571 Ga0207699_10008044 3300025906 Bacteria 5181
572 Ga0207699_10050010 3300025906 Bacteria 2463
573 Ga0207699_10070422 3300025906 Bacteria 2135
574 Ga0207699_10260587 3300025906 Bacteria 1198
575 Ga0207699_10516612 3300025906 Bacteria 863
576 Ga0207699_10739805 3300025906 Bacteria 721
577 Ga0207645_10011966 3300025907 Bacteria 5901
578 Ga0207645_10017690 3300025907 Bacteria 4700
579 Ga0207645_10167044 3300025907 Bacteria 1441
580 Ga0207645_10755000 3300025907 Bacteria 661
581 Ga0207643_10042451 3300025908 Bacteria 2565
582 Ga0207643_10044017 3300025908 Bacteria 2520
583 Ga0207643_10638283 3300025908 Bacteria 687
584 Ga0207705_10090548 3300025909 Bacteria 2239
585 Ga0207684_10032273 3300025910 Bacteria 4454
586 Ga0207684_10474107 3300025910 Bacteria 1074
587 Ga0207684_10583138 3300025910 Bacteria 956
588 Ga0207654_10022974 3300025911 Bacteria 3335
589 Ga0207654_10789850 3300025911 Bacteria 685
590 Ga0207707_10008482 3300025912 Bacteria 8911
591 Ga0207707_10063930 3300025912 Bacteria 3203
592 Ga0207707_10068209 3300025912 Bacteria 3099
593 Ga0207707_10269295 3300025912 Bacteria 1476
594 Ga0207695_10060956 3300025913 Bacteria 3902
595 Ga0207695_10074182 3300025913 Bacteria 3464
596 Ga0207695_10783581 3300025913 Bacteria 833
597 Ga0207671_10133472 3300025914 Bacteria 1907
598 Ga0207693_10001609 3300025915 Bacteria 19964
599 Ga0207693_10006450 3300025915 Bacteria 9723
600 Ga0207693_10008687 3300025915 Bacteria 8308
601 Ga0207663_10003480 3300025916 Bacteria 7705
602 Ga0207663_10028048 3300025916 Bacteria 3290
603 Ga0207663_10080798 3300025916 Bacteria 2127
604 Ga0207663_10158531 3300025916 Bacteria 1595
605 Ga0207663_10276417 3300025916 Bacteria 1246
606 Ga0207663_10474103 3300025916 Bacteria 969
607 Ga0207663_10931511 3300025916 Bacteria 695
608 Ga0207663_11362910 3300025916 Bacteria 571
609 Ga0207660_10003216 3300025917 Bacteria 10688
610 Ga0207660_10080418 3300025917 Bacteria 2393
611 Ga0207660_11008534 3300025917 Bacteria 679
612 Ga0207662_10000088 3300025918 Bacteria 43438
613 Ga0207662_10000710 3300025918 Bacteria 15232
614 Ga0207662_10030460 3300025918 Bacteria 3131
615 Ga0207662_10614424 3300025918 Bacteria 757
616 Ga0207657_10001097 3300025919 Bacteria 28742
617 Ga0207657_10223773 3300025919 Bacteria 1507
618 Ga0207657_10526580 3300025919 Bacteria 925
619 Ga0207649_10022621 3300025920 Bacteria 3632
620 Ga0207649_10035292 3300025920 Bacteria 3004
621 Ga0207649_10331019 3300025920 Bacteria 1122
622 Ga0207649_10692986 3300025920 Bacteria 790
623 Ga0207652_10069270 3300025921 Bacteria 3063
624 Ga0207652_10075338 3300025921 Bacteria 2941
625 Ga0207652_10098416 3300025921 Bacteria 2580
626 Ga0207652_10487175 3300025921 Bacteria 1110
627 Ga0207652_11002316 3300025921 Bacteria 734
628 Ga0207652_11224468 3300025921 Bacteria 653
629 Ga0207681_10013794 3300025923 Bacteria 5006
630 Ga0207681_10044539 3300025923 Bacteria 2974
631 Ga0207681_10101018 3300025923 Bacteria 2080
632 Ga0207681_10227382 3300025923 Bacteria 1446
633 Ga0207681_10333104 3300025923 Bacteria 1210
634 Ga0207681_10371902 3300025923 Bacteria 1149
635 Ga0207681_10718317 3300025923 Bacteria 831
636 Ga0207694_10012843 3300025924 Bacteria 6307
637 Ga0207694_10051639 3300025924 Bacteria 3187
638 Ga0207650_10042140 3300025925 Bacteria 3348
639 Ga0207650_10050535 3300025925 Bacteria 3075
640 Ga0207650_10193945 3300025925 Bacteria 1624
641 Ga0207650_10209174 3300025925 Bacteria 1566
642 Ga0207650_10288046 3300025925 Bacteria 1339
643 Ga0207650_10554211 3300025925 Bacteria 964
644 Ga0207650_10648084 3300025925 Bacteria 890
645 Ga0207650_10808347 3300025925 Bacteria 795
646 Ga0207659_10011330 3300025926 Bacteria 5632
647 Ga0207659_10184628 3300025926 Bacteria 1655
648 Ga0207659_10191881 3300025926 Bacteria 1626
649 Ga0207659_10250026 3300025926 Bacteria 1438
650 Ga0207659_10559502 3300025926 Bacteria 973
651 Ga0207687_10000349 3300025927 Bacteria 30723
652 Ga0207687_10006704 3300025927 Bacteria 7597
653 Ga0207687_11696229 3300025927 Bacteria 542
654 Ga0207700_10001216 3300025928 Bacteria 14755
655 Ga0207700_10027694 3300025928 Bacteria 3973
656 Ga0207700_10263217 3300025928 Bacteria 1477
657 Ga0207700_10783358 3300025928 Bacteria 853
658 Ga0207664_10001209 3300025929 Bacteria 17138
659 Ga0207664_10005216 3300025929 Bacteria 8861
660 Ga0207664_10012693 3300025929 Bacteria 6029
661 Ga0207664_10058051 3300025929 Bacteria 3077
662 Ga0207664_10220252 3300025929 Bacteria 1645
663 Ga0207664_10304665 3300025929 Bacteria 1402
664 Ga0207664_10719320 3300025929 Bacteria 898
665 Ga0207644_10003039 3300025931 Bacteria 10785
666 Ga0207644_10046278 3300025931 Bacteria 3098
667 Ga0207644_10104444 3300025931 Bacteria 2133
668 Ga0207644_10470154 3300025931 Bacteria 1034
669 Ga0207690_10000661 3300025932 Bacteria 22057
670 Ga0207690_10034139 3300025932 Bacteria 3276
671 Ga0207690_10140537 3300025932 Bacteria 1779
672 Ga0207690_10624912 3300025932 Bacteria 881
673 Ga0207690_10684600 3300025932 Bacteria 842
674 Ga0207706_10000040 3300025933 Bacteria 132285
675 Ga0207706_10029338 3300025933 Bacteria 4911
676 Ga0207706_10070688 3300025933 Bacteria 3070
677 Ga0207706_10137397 3300025933 Bacteria 2150
678 Ga0207706_10287595 3300025933 Bacteria 1433
679 Ga0207706_10452261 3300025933 Bacteria 1111
680 Ga0207686_10035803 3300025934 Bacteria 2982
681 Ga0207686_10111571 3300025934 Bacteria 1845
682 Ga0207686_10840042 3300025934 Bacteria 738
683 Ga0207686_10971743 3300025934 Bacteria 688
684 Ga0207709_10001642 3300025935 Bacteria 15151
685 Ga0207709_10039687 3300025935 Bacteria 2814
686 Ga0207709_10114217 3300025935 Bacteria 1812
687 Ga0207709_10336355 3300025935 Bacteria 1135
688 Ga0207670_10002235 3300025936 Bacteria 10121
689 Ga0207670_10049431 3300025936 Bacteria 2813
690 Ga0207670_10087023 3300025936 Bacteria 2200
691 Ga0207670_10282033 3300025936 Bacteria 1295
692 Ga0207670_10600332 3300025936 Bacteria 904
693 Ga0207670_11205798 3300025936 Bacteria 641
694 Ga0207669_10003857 3300025937 Bacteria 6535
695 Ga0207669_10046628 3300025937 Bacteria 2562
696 Ga0207669_10097906 3300025937 Bacteria 1930
697 Ga0207669_10218926 3300025937 Bacteria 1396
698 Ga0207704_10002194 3300025938 Bacteria 8752
699 Ga0207704_10094979 3300025938 Bacteria 1970
700 Ga0207665_10000223 3300025939 Bacteria 38647
701 Ga0207665_10002070 3300025939 Bacteria 13532
702 Ga0207665_10305481 3300025939 Bacteria 1190
703 Ga0207691_10006790 3300025940 Bacteria 11034
704 Ga0207691_10015784 3300025940 Bacteria 7178
705 Ga0207691_10073946 3300025940 Bacteria 3074
706 Ga0207691_10130871 3300025940 Bacteria 2217
707 Ga0207691_10267643 3300025940 Bacteria 1472
708 Ga0207711_10022647 3300025941 Bacteria 5255
709 Ga0207711_10042318 3300025941 Bacteria 3881
710 Ga0207689_10002986 3300025942 Bacteria 15609
711 Ga0207689_10009370 3300025942 Bacteria 8461
712 Ga0207689_10037694 3300025942 Bacteria 4008
713 Ga0207689_10197924 3300025942 Bacteria 1658
714 Ga0207689_10274249 3300025942 Bacteria 1396
715 Ga0207661_10021055 3300025944 Bacteria 4884
716 Ga0207661_10735404 3300025944 Bacteria 908
717 Ga0207679_10011215 3300025945 Bacteria 5792
718 Ga0207679_10013523 3300025945 Bacteria 5350
719 Ga0207679_10223379 3300025945 Bacteria 1586
720 Ga0207679_10404645 3300025945 Bacteria 1201
721 Ga0207679_10943827 3300025945 Bacteria 790
722 Ga0207667_10011779 3300025949 Bacteria 10133
723 Ga0207667_10023839 3300025949 Bacteria 6735
724 Ga0207667_10191445 3300025949 Bacteria 2099
725 Ga0207667_10356339 3300025949 Bacteria 1492
726 Ga0207667_10913291 3300025949 Bacteria 869
727 Ga0207667_11360981 3300025949 Bacteria 684
728 Ga0207651_10002402 3300025960 Bacteria 8947
729 Ga0207651_10019559 3300025960 Bacteria 4061
730 Ga0207651_10116632 3300025960 Bacteria 2016
731 Ga0207651_10151539 3300025960 Bacteria 1805
732 Ga0207712_10103552 3300025961 Bacteria 2121
733 Ga0207712_10361265 3300025961 Bacteria 1210
734 Ga0207668_10072871 3300025972 Bacteria 2459
735 Ga0207668_10225583 3300025972 Bacteria 1507
736 Ga0207668_10531546 3300025972 Bacteria 1016
737 Ga0207668_10563571 3300025972 Bacteria 988
738 Ga0207668_10805313 3300025972 Bacteria 832
739 Ga0207668_11593604 3300025972 Bacteria 589
740 Ga0207640_10011788 3300025981 Bacteria 4961
741 Ga0207640_10012718 3300025981 Bacteria 4802
742 Ga0207658_10010103 3300025986 Bacteria 6411
743 Ga0207658_10146371 3300025986 Bacteria 1919
744 Ga0207658_10193322 3300025986 Bacteria 1693
745 Ga0207658_10249536 3300025986 Bacteria 1507
746 Ga0207658_10459407 3300025986 Bacteria 1128
747 Ga0207677_10096263 3300026023 Bacteria 2165
748 Ga0207677_10417021 3300026023 Bacteria 1143
749 Ga0207677_11238728 3300026023 Bacteria 684
750 Ga0207703_10003517 3300026035 Bacteria 13105
751 Ga0207703_10037996 3300026035 Bacteria 3839
752 Ga0207703_10129896 3300026035 Bacteria 2174
753 Ga0207703_10163974 3300026035 Bacteria 1948
754 Ga0207639_10034249 3300026041 Bacteria 3753
755 Ga0207639_10056193 3300026041 Bacteria 3016
756 Ga0207639_10356725 3300026041 Bacteria 1307
757 Ga0207639_10463505 3300026041 Bacteria 1152
758 Ga0207639_11410573 3300026041 Bacteria 654
759 Ga0207678_10007871 3300026067 Bacteria 9403
760 Ga0207678_10008883 3300026067 Bacteria 8849
761 Ga0207678_10889890 3300026067 Bacteria 787
762 Ga0207678_11039933 3300026067 Bacteria 725
763 Ga0207708_10000326 3300026075 Bacteria 37674
764 Ga0207708_10001430 3300026075 Bacteria 17905
765 Ga0207708_10280709 3300026075 Bacteria 1350
766 Ga0207702_10014584 3300026078 Bacteria 6522
767 Ga0207702_10048686 3300026078 Bacteria 3575
768 Ga0207702_10058542 3300026078 Bacteria 3279
769 Ga0207702_10108244 3300026078 Bacteria 2466
770 Ga0207702_10279895 3300026078 Bacteria 1577
771 Ga0207702_10637779 3300026078 Bacteria 1047
772 Ga0207702_12295361 3300026078 Bacteria 527
773 Ga0207641_10053430 3300026088 Bacteria 3424
774 Ga0207641_10083806 3300026088 Bacteria 2773
775 Ga0207641_10110446 3300026088 Bacteria 2436
776 Ga0207641_10268230 3300026088 Bacteria 1601
777 Ga0207641_10666197 3300026088 Bacteria 1023
778 Ga0207641_10869063 3300026088 Bacteria 894
779 Ga0207641_12027521 3300026088 Bacteria 576
780 Ga0207641_12087896 3300026088 Bacteria 567
781 Ga0207648_10000071 3300026089 Bacteria 95176
782 Ga0207648_10002303 3300026089 Bacteria 20622
783 Ga0207648_10019841 3300026089 Bacteria 6066
784 Ga0207648_10240593 3300026089 Bacteria 1611
785 Ga0207648_10466324 3300026089 Bacteria 1152
786 Ga0207676_10025129 3300026095 Bacteria 4417
787 Ga0207676_10069259 3300026095 Bacteria 2824
788 Ga0207676_10102174 3300026095 Bacteria 2379
789 Ga0207676_10152579 3300026095 Bacteria 1991
790 Ga0207676_10417792 3300026095 Bacteria 1257
791 Ga0207676_10810932 3300026095 Bacteria 913
792 Ga0207676_12164412 3300026095 Bacteria 554
793 Ga0207674_10000155 3300026116 Bacteria 80715
794 Ga0207674_10448512 3300026116 Bacteria 1247
795 Ga0207674_10469949 3300026116 Bacteria 1215
796 Ga0207674_10671961 3300026116 Bacteria 1000
797 Ga0207675_100000040 3300026118 Bacteria 91299
798 Ga0207675_100018658 3300026118 Bacteria 6475
799 Ga0207675_100035478 3300026118 Bacteria 4652
800 Ga0207675_100053014 3300026118 Bacteria 3785
801 Ga0207675_100069717 3300026118 Bacteria 3286
802 Ga0207675_100274651 3300026118 Bacteria 1636
803 Ga0207675_100364166 3300026118 Bacteria 1419
804 Ga0207683_10005993 3300026121 Bacteria 10411
805 Ga0207683_10010627 3300026121 Bacteria 7850
806 Ga0207683_10059677 3300026121 Bacteria 3351
807 Ga0207683_10102434 3300026121 Unclassified 2556
808 Ga0207683_10127013 3300026121 Bacteria 2292
809 Ga0207683_10156286 3300026121 Bacteria 2060
810 Ga0207683_10187204 3300026121 Bacteria 1878
811 Ga0207683_10677497 3300026121 Bacteria 956
812 Ga0207698_10005283 3300026142 Bacteria 7949
813 Ga0207698_10078529 3300026142 Bacteria 2651
814 Ga0207698_10776052 3300026142 Bacteria 959
815 Ga0209969_1001293 3300027360 Bacteria 3442
816 Ga0209969_1026104 3300027360 Bacteria 882
817 Ga0209967_1022930 3300027364 Bacteria 917
818 Ga0209981_1003276 3300027378 Bacteria 2098
819 Ga0209981_1018642 3300027378 Bacteria 984
820 Ga0209996_1043490 3300027395 Bacteria 671
821 Ga0209968_1057731 3300027526 Bacteria 681
822 Ga0209971_1017602 3300027682 Bacteria 1694
823 Ga0209966_1015677 3300027695 Bacteria 1425
824 Ga0209998_10035007 3300027717 Bacteria 1125
825 Ga0209813_10003624 3300027866 Bacteria 3629
826 Ga0209974_10019154 3300027876 Bacteria 2269
827 Ga0209974_10137092 3300027876 Bacteria 876
828 Ga0207428_10003555 3300027907 Bacteria 15064
829 Ga0207428_10187719 3300027907 Bacteria 1559
830 Ga0268266_10027827 3300028379 Bacteria 4807
831 Ga0268266_10038362 3300028379 Bacteria 4078
832 Ga0268266_10253613 3300028379 Bacteria 1628
833 Ga0268266_11095610 3300028379 Bacteria 771
834 Ga0268265_10015432 3300028380 Bacteria 5228
835 Ga0268265_10016234 3300028380 Bacteria 5111
836 Ga0268265_10262872 3300028380 Bacteria 1535
837 Ga0268265_10273866 3300028380 Bacteria 1507
838 Ga0268264_10000527 3300028381 Bacteria 48430
839 Ga0268264_10050378 3300028381 Bacteria 3467
840 Ga0268264_10149206 3300028381 Bacteria 2094
841 Ga0268264_10834279 3300028381 Bacteria 922
842 Ga0268264_10886413 3300028381 Bacteria 895
843 Ga0268264_11090257 3300028381 Bacteria 807
844 Ga0268264_11242777 3300028381 Bacteria 755
845 Ga0265337_1000657 3300028556 Bacteria 18216
846 Ga0265334_10004658 3300028573 Bacteria 6053
847 Ga0265338_10014806 3300028800 Bacteria 8632
848 Ga0265338_10168184 3300028800 Bacteria 1685
849 Ga0265765_1015225 3300030879 Bacteria 893
850 Ga0265760_10135826 3300031090 Bacteria 798
851 Ga0265332_10023006 3300031238 Bacteria 2749
852 Ga0265328_10005004 3300031239 Bacteria 5712
853 Ga0265325_10000004 3300031241 Bacteria 347347
854 Ga0307408_100083689 3300031548 Bacteria 2391
855 Ga0307408_100381515 3300031548 Bacteria 1205
856 Ga0307408_100989894 3300031548 Bacteria 774
857 Ga0307408_101481056 3300031548 Bacteria 641
858 Ga0265313_10003348 3300031595 Bacteria 13088
859 Ga0316579_10293234 3300031691 Bacteria 786
860 Ga0265314_10001644 3300031711 Bacteria 24461
861 Ga0265314_10116754 3300031711 Bacteria 1687
862 Ga0316576_10006013 3300031727 Bacteria 7500
863 Ga0316576_10055935 3300031727 Bacteria 2880
864 Ga0316578_10007067 3300031728 Bacteria 5594
865 Ga0316578_10112158 3300031728 Bacteria 1638
866 Ga0307405_10004237 3300031731 Bacteria 6746
867 Ga0307405_10716221 3300031731 Bacteria 830
868 Ga0307405_10957032 3300031731 Bacteria 728
869 Ga0307413_10000700 3300031824 Bacteria 11495
870 Ga0307413_10055564 3300031824 Bacteria 2410
871 Ga0307413_10811520 3300031824 Bacteria 787
872 Ga0307410_10004286 3300031852 Bacteria 7348
873 Ga0307406_10013188 3300031901 Bacteria 4730
874 Ga0307406_10462944 3300031901 Bacteria 1020
875 Ga0307407_10011597 3300031903 Bacteria 4203
876 Ga0307412_10108155 3300031911 Bacteria 1980
877 Ga0307409_100013370 3300031995 Bacteria 5280
878 Ga0307416_100008987 3300032002 Bacteria 6499
879 Ga0307416_100261457 3300032002 Bacteria 1692
880 Ga0307416_100398283 3300032002 Bacteria 1413
881 Ga0307416_101116004 3300032002 Bacteria 893
882 Ga0307414_10096761 3300032004 Bacteria 2210
883 Ga0307411_10075337 3300032005 Bacteria 2303
884 Ga0307411_10321567 3300032005 Bacteria 1250
885 Ga0307411_10386921 3300032005 Bacteria 1152
886 Ga0307415_100005658 3300032126 Bacteria 6655
887 Ga0316583_10001095 3300032133 Bacteria 8807
888 Ga0316585_10033425 3300032137 Bacteria 1622
889 Ga0316592_1016823 3300033524 Bacteria 1531
890 Ga0316592_1042856 3300033524 Bacteria 1004
891 Ga0316588_1001446 3300033528 Bacteria 3890
892 Ga0316588_1004449 3300033528 Bacteria 2655
893 Ga0316596_1002887 3300033541 Bacteria 3720
894 Ga0373930_0002876 3300034816 Bacteria 2703
895 Ga0373948_0089649 3300034817 Bacteria 712
896 Ga0373948_0096177 3300034817 Bacteria 693
897 Ga0373958_0025895 3300034819 Bacteria 1120
898 Ga0373959_0014349 3300034820 Bacteria 1441
899 Ga0373938_0006574 3300034957 Bacteria 2015
900 Ga0373938_0195483 3300034957 Bacteria 558
901 Ga0373926_0000062 3300035083 Bacteria 19600
902 Ga0373926_0000873 3300035083 Bacteria 8629
903 Ga0373926_0057063 3300035083 Bacteria 1418
904 Ga0373928_0007308 3300035084 Bacteria 2129
905 Ga0373929_0001916 3300035085 Bacteria 3889
906 Ga0373929_0002103 3300035085 Bacteria 3702
907 Ga0373934_0000061 3300035086 Bacteria 37034
908 Ga0373934_0208055 3300035086 Bacteria 806
909 Ga0373940_0020475 3300035088 Bacteria 1681
910 Ga0373940_0069383 3300035088 Bacteria 1023
911 Ga0373944_0001760 3300035089 Bacteria 5470
912 Ga0373944_0010174 3300035089 Bacteria 2561
913 Ga0373944_0016994 3300035089 Bacteria 2059
914 Ga0373944_0136159 3300035089 Bacteria 857
915 Ga0373949_0018039 3300035090 Bacteria 1596
916 Ga0373949_0045115 3300035090 Bacteria 1095
917 Ga0373949_0075239 3300035090 Bacteria 891
918 Ga0373951_0165440 3300035091 Bacteria 628
919 Ga0373952_0013241 3300035092 Bacteria 1633
920 Ga0373952_0025205 3300035092 Bacteria 1283
921 Ga0373952_0040038 3300035092 Bacteria 1079
922 Ga0373932_0010654 3300035112 Bacteria 2229
923 Ga0373932_0149864 3300035112 Bacteria 799
924 Ga0373936_0002266 3300035113 Bacteria 7194
925 Ga0373936_0006259 3300035113 Bacteria 4489
926 Ga0373936_0033352 3300035113 Bacteria 2041
927 Ga0373936_0440763 3300035113 Bacteria 601
928 Ga0373939_0030215 3300035114 Bacteria 1556
929 Ga0373939_0087509 3300035114 Bacteria 1047
930 Ga0373941_0004504 3300035115 Bacteria 3224
931 Ga0373941_0078862 3300035115 Bacteria 1108
932 Ga0373945_0002753 3300035116 Bacteria 5521
933 Ga0373945_0125564 3300035116 Bacteria 1024
934 Ga0373945_0173853 3300035116 Bacteria 883
935 Ga0373945_0365778 3300035116 Bacteria 627
936 Ga0373954_0142478 3300035118 Bacteria 1169
937 Ga0373956_0000003 3300035119 Bacteria 81669
938 Ga0373956_0107578 3300035119 Bacteria 1297
939 Ga0373957_0051231 3300035120 Bacteria 1579
940 Ga0373957_0189182 3300035120 Bacteria 855
941 Ga0373960_0017534 3300035121 Bacteria 1857
942 Ga0373960_0102397 3300035121 Bacteria 930
943 Ga0373943_0000584 3300035170 Bacteria 15774
944 Ga0373943_0001182 3300035170 Bacteria 11660
945 Ga0373943_0038477 3300035170 Bacteria 2300
946 Ga0373943_0205418 3300035170 Bacteria 1092
947 Ga0373943_0241354 3300035170 Bacteria 1012
948 Ga0373943_0684677 3300035170 Bacteria 607
949 Ga0373946_0001536 3300035171 Bacteria 8032
950 Ga0373946_0002920 3300035171 Bacteria 6064
951 Ga0373946_0015306 3300035171 Bacteria 2906
952 Ga0373946_0053061 3300035171 Bacteria 1702
953 Ga0373946_0059926 3300035171 Bacteria 1617
954 Ga0373946_0569241 3300035171 Bacteria 586
955 Ga0373955_0006439 3300035172 Bacteria 5348
956 Ga0373955_0050034 3300035172 Bacteria 2271
957 Ga0373942_0035658 3300035207 Bacteria 1335
958 Ga0373961_0093166 3300035241 Bacteria 965
959 Ga0373962_0036833 3300035242 Bacteria 1364
960 Ga0373962_0139074 3300035242 Bacteria 787
961 Ga0316574_0120679 3300035398 Bacteria 1683
962 Ga0316574_0208595 3300035398 Bacteria 1254
963 Ga0373924_0327817 3300035410 Bacteria 681
964 Ga0373931_0000553 3300035691 Bacteria 15375
965 Ga0373931_0055258 3300035691 Bacteria 2124
966 Ga0373931_0076422 3300035691 Bacteria 1839
967 Ga0373931_0240286 3300035691 Bacteria 1098
968 Ga0373931_0668486 3300035691 Bacteria 684
969 Ga0373931_0789383 3300035691 Bacteria 632
970 Ga0373935_0001505 3300035692 Bacteria 12946
971 Ga0373935_0005854 3300035692 Bacteria 7281
972 Ga0373935_0034524 3300035692 Bacteria 3153
973 Ga0373935_0037110 3300035692 Bacteria 3048
974 Ga0373935_0178262 3300035692 Bacteria 1458
975 Ga0373935_0298795 3300035692 Bacteria 1137
976 Ga0373935_0382207 3300035692 Bacteria 1008
977 Ga0373935_1086346 3300035692 Bacteria 595
978 Ga0373927_0000912 3300035695 Bacteria 22465
979 Ga0373927_0042837 3300035695 Bacteria 2933
980 Ga0373927_0060322 3300035695 Bacteria 2454
981 Ga0373927_0090279 3300035695 Bacteria 1990
982 Ga0373927_0093116 3300035695 Bacteria 1958
983 Ga0373927_0392062 3300035695 Bacteria 916
984 Ga0373933_0005782 3300035724 Bacteria 6726
985 Ga0373933_0211977 3300035724 Bacteria 1241
986 Ga0373933_0228263 3300035724 Bacteria 1195
987 Ga0373933_0240228 3300035724 Bacteria 1165
988 Ga0373947_0002482 3300035725 Bacteria 11092
989 Ga0373947_0003695 3300035725 Bacteria 9031
990 Ga0373947_0012927 3300035725 Bacteria 4787
991 Ga0373947_0014928 3300035725 Bacteria 4458
992 Ga0373947_0025250 3300035725 Bacteria 3464
993 Ga0373947_0026782 3300035725 Bacteria 3371
994 Ga0373947_0122858 3300035725 Bacteria 1651
995 Ga0373947_0245626 3300035725 Bacteria 1182
996 Ga0373947_0982338 3300035725 Bacteria 576
997 Ga0373947_1051989 3300035725 Bacteria 555
998 Ga0373937_0000196 3300036401 Bacteria 59256
999 Ga0373937_0017585 3300036401 Bacteria 6373
1000 Ga0373937_0044504 3300036401 Bacteria 4055
1001 Ga0373937_0069893 3300036401 Bacteria 3238
1002 Ga0373937_0108292 3300036401 Bacteria 2584
1003 Ga0373937_0224611 3300036401 Bacteria 1768
1004 Ga0373937_0357799 3300036401 Bacteria 1383
1005 Ga0373937_0726111 3300036401 Bacteria 940
1006 Ga0316582_0001898 3300036647 Bacteria 9504
1007 Ga0316582_0193563 3300036647 Unclassified 1386
1008 Ga0316584_0048277 3300036712 Bacteria 3180
1009 Ga0316584_0253297 3300036712 Bacteria 1286
1010 Ga0373925_0004491 3300037068 Bacteria 10543
1011 Ga0373925_0005040 3300037068 Bacteria 9910
1012 Ga0373925_0006465 3300037068 Bacteria 8620
1013 Ga0373925_0052700 3300037068 Bacteria 3040
1014 Ga0373925_0060496 3300037068 Bacteria 2844
1015 Ga0373925_0073485 3300037068 Bacteria 2588
1016 Ga0373925_0114666 3300037068 Bacteria 2086
1017 Ga0373925_0129742 3300037068 Bacteria 1964
1018 Ga0373925_0156637 3300037068 Bacteria 1792
1019 Ga0373925_0200579 3300037068 Bacteria 1586
1020 Ga0373925_0616972 3300037068 Bacteria 893
1021 Ga0373925_0884951 3300037068 Bacteria 736
1022 Ga0395899_0097303 3300037312 Bacteria 2128
1023 Ga0395900_0017617 3300037418 Bacteria 7289
1024 Ga0395900_0181537 3300037418 Bacteria 2138
1025 Ga0395900_1867637 3300037418 Bacteria 511
1026 Ga0395898_0020431 3300037466 Bacteria 6725
1027 Ga0395898_0120763 3300037466 Bacteria 2511
1028 Ga0395898_0192133 3300037466 Bacteria 1951
1029 Ga0395905_0085046 3300037471 Bacteria 2964
1030 Ga0395905_0187731 3300037471 Bacteria 1940
1031 Ga0316581_0000256 3300037588 Bacteria 9235
1032 Ga0395901_0032467 3300038443 Bacteria 5387
1033 Ga0395901_0197987 3300038443 Bacteria 2106
1034 Ga0395901_0759588 3300038443 Bacteria 962
1035 Ga0242420_060201 3300038996 Bacteria 756
1036 Ga0400483_249032 3300039062 Bacteria 6577
1037 Ga0436365_1483055 3300039437 Bacteria 788
1038 Ga0436361_0966677 3300039447 Bacteria 1623
1039 Ga0436363_0328509 3300039450 Bacteria 5149
1040 Ga0436362_0044954 3300039453 Bacteria 619
1041 Ga0439436_0093332 3300041404 Bacteria 838
1042 Ga0439439_0023170 3300041406 Bacteria 1555
1043 Ga0451787_728395 3300041441 Bacteria 788
1044 Ga0451853_2158847 3300041512 Bacteria 1596
1045 Ga0439441_000979 3300042001 Bacteria 3502
1046 Ga0439441_066127 3300042001 Bacteria 769
1047 Ga0439441_106654 3300042001 Bacteria 632
1048 Ga0439443_003131 3300042003 Bacteria 2055
1049 Ga0439443_033139 3300042003 Bacteria 859
1050 Ga0439449_0420135 3300042007 Bacteria 508
1051 Ga0439462_0091873 3300042015 Bacteria 833
1052 Ga0450923_039057 3300042125 Bacteria 992
1053 Ga0439458_0173336 3300042157 Bacteria 584
1054 Ga0439434_0060064 3300042435 Bacteria 1188
1055 Ga0439435_0000004 3300042436 Bacteria 26852
1056 Ga0439435_0013464 3300042436 Bacteria 2000
1057 Ga0439444_0093274 3300042437 Bacteria 674
1058 Ga0439459_0095149 3300042438 Bacteria 722
1059 Ga0439460_0000235 3300042461 Bacteria 11229
1060 Ga0439460_0015727 3300042461 Bacteria 2007
1061 Ga0439460_0134767 3300042461 Bacteria 816
1062 Ga0451577_0008862 3300042876 Bacteria 9738
1063 Ga0451577_0057081 3300042876 Bacteria 3481
1064 Ga0453683_0147840 3300044673 Bacteria 1484
1065 Ga0453683_0507009 3300044673 Bacteria 783
1066 Ga0466963_0842857 3300044694 Bacteria 646
1067 Ga0466957_0081969 3300044842 Bacteria 2010
1068 Ga0451576_0003049 3300045051 Bacteria 23602
1069 Ga0451576_0017751 3300045051 Bacteria 7819
1070 Ga0451576_0619603 3300045051 Bacteria 1137
1071 Ga0451576_1380122 3300045051 Bacteria 733
1072 Ga0466958_0040320 3300045836 Bacteria 2807
1073 Ga0466958_0718255 3300045836 Bacteria 651
1074 Ga0466967_0021653 3300045976 Bacteria 5228
1075 Ga0495592_0020464 3300046454 Bacteria 5032
1076 Ga0495592_0224616 3300046454 Bacteria 1253
1077 Ga0495603_0000752 3300046455 Bacteria 18518
1078 Ga0495603_0009108 3300046455 Bacteria 6001
1079 Ga0495603_0021983 3300046455 Bacteria 3862
1080 Ga0495629_0001998 3300046459 Bacteria 15846
1081 Ga0495629_0002312 3300046459 Bacteria 14680
1082 Ga0495629_0015214 3300046459 Bacteria 5528
1083 Ga0495629_0059779 3300046459 Bacteria 2664
1084 Ga0495629_0143234 3300046459 Bacteria 1663
1085 Ga0495651_0004749 3300046462 Bacteria 10399
1086 Ga0495651_0016174 3300046462 Bacteria 5778
1087 Ga0495651_0312278 3300046462 Bacteria 1051
1088 Ga0495653_0005728 3300046463 Bacteria 10159
1089 Ga0495580_0008537 3300046472 Bacteria 8129
1090 Ga0495580_0016385 3300046472 Bacteria 5562
1091 Ga0495580_0029652 3300046472 Bacteria 3969
1092 Ga0495580_0224582 3300046472 Bacteria 1290
1093 Ga0495580_0268638 3300046472 Bacteria 1165
1094 Ga0495582_0014397 3300046473 Bacteria 4348
1095 Ga0495582_0052439 3300046473 Bacteria 2249
1096 Ga0495582_0137252 3300046473 Bacteria 1384
1097 Ga0495639_0004241 3300046475 Bacteria 6152
1098 Ga0495639_0093803 3300046475 Bacteria 1411
1099 Ga0495639_0146968 3300046475 Bacteria 1135
1100 Ga0495662_0003590 3300046476 Bacteria 7838
1101 Ga0495662_0152433 3300046476 Bacteria 1138
1102 Ga0495664_0029532 3300046477 Bacteria 3207
1103 Ga0495664_0098990 3300046477 Bacteria 1756
1104 Ga0495664_0373185 3300046477 Bacteria 858
1105 Ga0495584_0245642 3300046491 Bacteria 910
1106 Ga0495584_0672178 3300046491 Bacteria 528
1107 Ga0495594_0010179 3300046499 Bacteria 4874
1108 Ga0495594_0085149 3300046499 Bacteria 1768
1109 Ga0495608_0001760 3300046511 Bacteria 15463
1110 Ga0495608_0252723 3300046511 Bacteria 1099
1111 Ga0495618_0008377 3300046514 Bacteria 6257
1112 Ga0495618_0014032 3300046514 Bacteria 4877
1113 Ga0495618_0521016 3300046514 Bacteria 715
1114 Ga0495620_0286568 3300046515 Bacteria 626
1115 Ga0495628_0016594 3300046516 Bacteria 6140
1116 Ga0495630_0013313 3300046517 Bacteria 5986
1117 Ga0495630_0055024 3300046517 Bacteria 2981
1118 Ga0495630_0284177 3300046517 Bacteria 1264
1119 Ga0495666_0041999 3300046526 Bacteria 2212
1120 Ga0495666_0133151 3300046526 Bacteria 1161
1121 Ga0495666_0433558 3300046526 Bacteria 589
1122 Ga0495642_0067816 3300046528 Bacteria 1488
1123 Ga0495642_0134426 3300046528 Bacteria 1066
1124 Ga0495642_0290372 3300046528 Bacteria 716
1125 Ga0495652_0006626 3300046529 Bacteria 10756
1126 Ga0495652_0033497 3300046529 Bacteria 4485
1127 Ga0495665_0014479 3300046531 Bacteria 4255
1128 Ga0495665_0197180 3300046531 Bacteria 1044
1129 Ga0495665_0285605 3300046531 Bacteria 846
1130 Ga0495665_0576628 3300046531 Bacteria 563
1131 Ga0495640_0022930 3300046533 Bacteria 4559
1132 Ga0495640_0036793 3300046533 Bacteria 3456
1133 Ga0495640_0060058 3300046533 Bacteria 2587
1134 Ga0495640_0125380 3300046533 Bacteria 1666
1135 Ga0495640_0519742 3300046533 Bacteria 723
1136 Ga0495586_0002269 3300046535 Bacteria 10462
1137 Ga0495586_0185840 3300046535 Bacteria 1176
1138 Ga0495586_0318107 3300046535 Bacteria 892
1139 Ga0495586_0760786 3300046535 Bacteria 559
1140 Ga0495587_0010344 3300046536 Bacteria 5944
1141 Ga0495598_0343615 3300046537 Bacteria 573
1142 Ga0495621_0005915 3300046539 Bacteria 3544
1143 Ga0495621_0023324 3300046539 Bacteria 2058
1144 Ga0495621_0040705 3300046539 Bacteria 1629
1145 Ga0495621_0333202 3300046539 Bacteria 634
1146 Ga0495645_0144881 3300046543 Bacteria 1655
1147 Ga0495622_0035325 3300046557 Bacteria 2331
1148 Ga0495622_0043054 3300046557 Bacteria 2099
1149 Ga0495622_0083252 3300046557 Bacteria 1472
1150 Ga0495667_0005211 3300046559 Bacteria 8787
1151 Ga0495667_0084907 3300046559 Bacteria 2055
1152 Ga0495667_0209176 3300046559 Bacteria 1247
1153 Ga0495667_0286318 3300046559 Bacteria 1046
1154 Ga0495656_0482833 3300046615 Bacteria 656
1155 Ga0495668_0062051 3300046616 Bacteria 2060
1156 Ga0495634_0005555 3300046642 Bacteria 9676
1157 Ga0495634_0026444 3300046642 Bacteria 4049
1158 Ga0495634_0082890 3300046642 Bacteria 2094
1159 Ga0495634_0451135 3300046642 Bacteria 759
1160 Ga0495611_0305797 3300046648 Bacteria 733
1161 Ga0495625_0199301 3300046660 Bacteria 1322
1162 Ga0495635_0036970 3300046663 Bacteria 3381
1163 Ga0495635_0254519 3300046663 Bacteria 1183
1164 Ga0495635_0259549 3300046663 Bacteria 1170
1165 Ga0495635_0413724 3300046663 Bacteria 894
1166 Ga0495659_0207194 3300046664 Bacteria 806
1167 Ga0495588_0007409 3300046674 Bacteria 4992
1168 Ga0495588_0282083 3300046674 Bacteria 875
1169 Ga0495657_0076174 3300046675 Bacteria 2179
1170 Ga0495657_0286504 3300046675 Bacteria 985
1171 Ga0495599_0014294 3300046678 Bacteria 4916
1172 Ga0495599_0436783 3300046678 Bacteria 776
1173 Ga0495623_0122646 3300046679 Bacteria 1563
1174 Ga0495623_0416531 3300046679 Bacteria 720
1175 Ga0495646_0005872 3300046680 Bacteria 7784
1176 Ga0495647_0001142 3300046681 Bacteria 8146
1177 Ga0495647_0001430 3300046681 Bacteria 7386
1178 Ga0495647_0007001 3300046681 Bacteria 3758
1179 Ga0495647_0200845 3300046681 Bacteria 874
1180 Ga0495658_0006322 3300046683 Bacteria 5822
1181 Ga0495658_0026289 3300046683 Bacteria 3118
1182 Ga0495658_0299461 3300046683 Bacteria 1017
1183 Ga0495658_1111031 3300046683 Bacteria 504
1184 Ga0495613_0031123 3300046689 Bacteria 3963
1185 Ga0495613_0057851 3300046689 Bacteria 2846
1186 Ga0495613_0142592 3300046689 Bacteria 1711
1187 Ga0495613_0215168 3300046689 Bacteria 1350
1188 Ga0495624_0222703 3300046690 Bacteria 1144
1189 Ga0495600_0029991 3300046809 Bacteria 3523
1190 Ga0495600_0134740 3300046809 Bacteria 1605
1191 Ga0495581_0010001 3300047315 Bacteria 5486
1192 Ga0495581_0202412 3300047315 Bacteria 1161
1193 Ga0495604_0001820 3300047317 Bacteria 17360
1194 Ga0495604_0150797 3300047317 Bacteria 1652
1195 Ga0495674_0004030 3300047319 Bacteria 14220
1196 Ga0495674_0008008 3300047319 Bacteria 10088
1197 Ga0495674_0242520 3300047319 Bacteria 1485
1198 Ga0495676_0041416 3300047321 Bacteria 3791
1199 Ga0495676_0048143 3300047321 Bacteria 3440
1200 Ga0495676_0051428 3300047321 Bacteria 3296
1201 Ga0495680_0009082 3300047322 Bacteria 8975
1202 Ga0495680_0053072 3300047322 Bacteria 3157
1203 Ga0495680_0094585 3300047322 Bacteria 2236
1204 Ga0495680_0395616 3300047322 Bacteria 955
1205 Ga0495675_0372724 3300047444 Bacteria 836
1206 Ga0495675_0622857 3300047444 Bacteria 610
1207 Ga0495677_0351330 3300047445 Bacteria 582
1208 Ga0495684_0051053 3300047471 Bacteria 3157
1209 Ga0495593_0006649 3300047673 Bacteria 6767
1210 Ga0495593_0031319 3300047673 Bacteria 2906
1211 Ga0495593_0118869 3300047673 Bacteria 1346
1212 Ga0495593_0436149 3300047673 Bacteria 655
1213 Ga0495602_0015631 3300048088 Bacteria 7653
1214 Ga0495602_0302113 3300048088 Bacteria 1171
1215 Ga0495602_0307597 3300048088 Bacteria 1158
1216 Ga0495614_0210830 3300048089 Bacteria 881
1217 Ga0496100_0282161 3300048903 Bacteria 1238
1218 Ga0496101_0078839 3300048904 Bacteria 2430
1219 Ga0496101_0203612 3300048904 Bacteria 1531
1220 Ga0496101_0323614 3300048904 Bacteria 1210
1221 Ga0496102_0006530 3300048905 Bacteria 9953
1222 Ga0496102_0171415 3300048905 Bacteria 2043
1223 Ga0496102_0174863 3300048905 Bacteria 2022
1224 Ga0496102_0469931 3300048905 Bacteria 1178
1225 Ga0496102_0649735 3300048905 Bacteria 978
1226 Ga0496103_0401436 3300048906 Bacteria 880
1227 Ga0496104_0023361 3300048907 Bacteria 5684
1228 Ga0496104_0727771 3300048907 Bacteria 899
1229 Ga0496105_0059059 3300048908 Bacteria 3164
1230 Ga0496106_0001392 3300048909 Bacteria 18135
1231 Ga0496106_0430748 3300048909 Bacteria 1060
1232 Ga0496106_0982397 3300048909 Bacteria 664
1233 Ga0496106_1583184 3300048909 Bacteria 502
1234 Ga0496107_0151151 3300048910 Bacteria 1717
1235 Ga0496107_0880682 3300048910 Bacteria 653
1236 Ga0496108_0049767 3300048911 Bacteria 3505
1237 Ga0496108_0469302 3300048911 Bacteria 1100
1238 Ga0496108_0908654 3300048911 Bacteria 755
1239 Ga0496109_0015325 3300048912 Bacteria 6677
1240 Ga0496109_0127622 3300048912 Bacteria 2372
1241 Ga0496109_0140878 3300048912 Bacteria 2254
1242 Ga0496109_1118299 3300048912 Bacteria 725
1243 Ga0496110_0036932 3300048913 Bacteria 4244
1244 Ga0496110_0238421 3300048913 Bacteria 1655
1245 Ga0496110_0593092 3300048913 Bacteria 1005
1246 Ga0496110_0606365 3300048913 Bacteria 993
1247 Ga0496110_0967264 3300048913 Bacteria 758
1248 Ga0496110_1900217 3300048913 Bacteria 505
1249 Ga0496111_0131281 3300048914 Bacteria 1853
1250 Ga0496111_0157727 3300048914 Bacteria 1684
1251 Ga0496111_0756016 3300048914 Bacteria 705
1252 Ga0496111_1111670 3300048914 Bacteria 563
1253 Ga0496112_0003253 3300048915 Bacteria 13397
1254 Ga0496112_1264623 3300048915 Bacteria 654
1255 Ga0496112_1385731 3300048915 Bacteria 618
1256 Ga0496113_0028635 3300048916 Bacteria 4009
1257 Ga0496113_0120256 3300048916 Bacteria 2052
1258 Ga0496113_0409775 3300048916 Bacteria 1088
1259 Ga0496113_1209526 3300048916 Bacteria 590
1260 Ga0496114_0103681 3300048917 Bacteria 2431
1261 Ga0496114_0435101 3300048917 Bacteria 1162
1262 Ga0496114_0806597 3300048917 Bacteria 818
1263 Ga0496115_0165105 3300048918 Bacteria 1831
1264 Ga0496115_0795334 3300048918 Bacteria 736
1265 Ga0496125_0378184 3300048928 Bacteria 836
1266 Ga0501292_081580 3300049515 Bacteria 616
1267 Ga0501298_034855 3300049521 Bacteria 1002
1268 Ga0501298_098036 3300049521 Bacteria 665
1269 Ga0501299_029061 3300049522 Bacteria 1057
1270 Ga0501031_0213980 3300049568 Bacteria 1255
1271 Ga0501031_0471885 3300049568 Bacteria 810
1272 Ga0501032_0393350 3300049569 Bacteria 891
1273 Ga0501032_0452301 3300049569 Bacteria 823
1274 Ga0501034_0037339 3300049571 Bacteria 4918
1275 Ga0501034_0070904 3300049571 Bacteria 3495
1276 Ga0501034_0483758 3300049571 Bacteria 1153
1277 Ga0501034_1389467 3300049571 Bacteria 577
1278 Ga0501036_0162187 3300049572 Bacteria 1884
1279 Ga0501036_0218791 3300049572 Bacteria 1599
1280 Ga0501036_0308645 3300049572 Bacteria 1323
1281 Ga0501036_0378978 3300049572 Bacteria 1181
1282 Ga0501037_0205309 3300049573 Bacteria 1391
1283 Ga0501037_0351409 3300049573 Bacteria 1017
1284 Ga0501038_0047221 3300049574 Bacteria 3730
1285 Ga0501038_0467653 3300049574 Bacteria 968
1286 Ga0501039_0009254 3300049575 Bacteria 7505
1287 Ga0501039_0022793 3300049575 Bacteria 4803
1288 Ga0501039_0089592 3300049575 Bacteria 2397
1289 Ga0501039_0382638 3300049575 Bacteria 1105
1290 Ga0501039_0659625 3300049575 Bacteria 819
1291 Ga0501039_1307404 3300049575 Bacteria 559
1292 Ga0501040_0041439 3300049576 Bacteria 3136
1293 Ga0501040_0105919 3300049576 Bacteria 1965
1294 Ga0501040_0238892 3300049576 Bacteria 1295
1295 Ga0501040_0308782 3300049576 Bacteria 1131
1296 Ga0501040_0623235 3300049576 Bacteria 779
1297 Ga0501040_0763689 3300049576 Bacteria 699
1298 Ga0501040_0983560 3300049576 Bacteria 612
1299 Ga0501041_0005794 3300049577 Bacteria 7220
1300 Ga0501041_0085321 3300049577 Bacteria 1947
1301 Ga0501041_0159468 3300049577 Bacteria 1410
1302 Ga0501041_0216217 3300049577 Bacteria 1202
1303 Ga0501042_0086669 3300049578 Bacteria 2246
1304 Ga0501042_0277917 3300049578 Bacteria 1209
1305 Ga0501042_0472367 3300049578 Bacteria 910
1306 Ga0501042_0813836 3300049578 Bacteria 680
1307 Ga0501042_1349569 3300049578 Bacteria 520
1308 Ga0501043_0034922 3300049579 Bacteria 3955
1309 Ga0501043_0575817 3300049579 Bacteria 834
1310 Ga0501043_1181769 3300049579 Bacteria 538
1311 Ga0501046_0107096 3300049580 Bacteria 2139
1312 Ga0501046_0264329 3300049580 Bacteria 1263
1313 Ga0501046_0697276 3300049580 Bacteria 715
1314 Ga0501047_0007381 3300049581 Bacteria 10341
1315 Ga0501047_0043016 3300049581 Bacteria 4364
1316 Ga0501047_0054694 3300049581 Bacteria 3861
1317 Ga0501048_0065342 3300049582 Bacteria 2572
1318 Ga0501048_0562567 3300049582 Bacteria 818
1319 Ga0501048_0819906 3300049582 Bacteria 669
1320 Ga0501067_0028457 3300049583 Bacteria 3096
1321 Ga0501067_0055645 3300049583 Bacteria 2192
1322 Ga0501067_0112358 3300049583 Bacteria 1515
1323 Ga0501067_0299812 3300049583 Bacteria 895
1324 Ga0501067_0397242 3300049583 Bacteria 769
1325 Ga0501067_0451750 3300049583 Bacteria 718
1326 Ga0501067_0617117 3300049583 Bacteria 608
1327 Ga0501068_0008133 3300049584 Bacteria 5825
1328 Ga0501068_0419184 3300049584 Bacteria 864
1329 Ga0501069_0017609 3300049585 Bacteria 3849
1330 Ga0501069_0247272 3300049585 Bacteria 1040
1331 Ga0501069_0476478 3300049585 Bacteria 743
1332 Ga0501070_0004618 3300049586 Bacteria 11808
1333 Ga0501070_0009796 3300049586 Bacteria 8105
1334 Ga0501070_0251633 3300049586 Bacteria 1445
1335 Ga0501070_0648778 3300049586 Bacteria 838
1336 Ga0501071_0001498 3300049587 Bacteria 13582
1337 Ga0501071_0002072 3300049587 Bacteria 12022
1338 Ga0501071_0011658 3300049587 Bacteria 5933
1339 Ga0501071_0462973 3300049587 Bacteria 971
1340 Ga0501072_0027869 3300049588 Bacteria 4408
1341 Ga0501072_0154871 3300049588 Bacteria 1827
1342 Ga0501072_0215155 3300049588 Bacteria 1531
1343 Ga0501072_0364873 3300049588 Bacteria 1146
1344 Ga0501073_0002898 3300049589 Bacteria 12869
1345 Ga0501073_0006777 3300049589 Bacteria 8520
1346 Ga0501073_0053748 3300049589 Bacteria 2819
1347 Ga0501073_0695868 3300049589 Bacteria 701
1348 Ga0501074_0017221 3300049590 Bacteria 5243
1349 Ga0501074_0030208 3300049590 Bacteria 3927
1350 Ga0501074_0255408 3300049590 Bacteria 1246
1351 Ga0501074_0319323 3300049590 Bacteria 1103
1352 Ga0501074_0664584 3300049590 Bacteria 736
1353 Ga0501074_0769779 3300049590 Bacteria 679
1354 Ga0501074_1183224 3300049590 Bacteria 536
1355 Ga0501075_0050707 3300049591 Bacteria 3120
1356 Ga0501075_0158308 3300049591 Bacteria 1727
1357 Ga0501075_0284217 3300049591 Bacteria 1260
1358 Ga0501075_0357369 3300049591 Bacteria 1113
1359 Ga0501075_0458307 3300049591 Bacteria 972
1360 Ga0501075_1093183 3300049591 Bacteria 606
1361 Ga0501075_1223619 3300049591 Bacteria 570
1362 Ga0501076_0048224 3300049592 Bacteria 3367
1363 Ga0501076_0113880 3300049592 Bacteria 2188
1364 Ga0501076_0219221 3300049592 Bacteria 1555
1365 Ga0501076_0590754 3300049592 Bacteria 916
1366 Ga0501077_0087227 3300049593 Bacteria 1978
1367 Ga0501077_0217860 3300049593 Bacteria 1213
1368 Ga0501077_0238284 3300049593 Bacteria 1156
1369 Ga0501077_1045087 3300049593 Bacteria 526
1370 Ga0501208_147853 3300049655 Bacteria 532
1371 Ga0501216_165927 3300049660 Bacteria 532
1372 Ga0501217_076101 3300049661 Bacteria 921
1373 Ga0501217_131685 3300049661 Bacteria 734
1374 Ga0501233_069758 3300049668 Bacteria 888
1375 Ga0501235_077175 3300049669 Bacteria 793
1376 Ga0501246_033641 3300049676 Bacteria 587
1377 Ga0501079_0042166 3300049741 Bacteria 3525
1378 Ga0501079_0047536 3300049741 Bacteria 3310
1379 Ga0501079_0284662 3300049741 Bacteria 1292
1380 Ga0501079_0553872 3300049741 Bacteria 904
1381 Ga0501079_0816768 3300049741 Bacteria 734
1382 Ga0501080_0006525 3300049742 Bacteria 10481
1383 Ga0501080_0018146 3300049742 Bacteria 6513
1384 Ga0501080_0065999 3300049742 Bacteria 3365
1385 Ga0501080_0091743 3300049742 Bacteria 2821
1386 Ga0501080_0294711 3300049742 Bacteria 1472
1387 Ga0501080_0324807 3300049742 Bacteria 1392
1388 Ga0501080_0737786 3300049742 Bacteria 867
1389 Ga0501081_0101725 3300049743 Bacteria 2032
1390 Ga0501081_0234824 3300049743 Bacteria 1336
1391 Ga0501081_0318727 3300049743 Bacteria 1142
1392 Ga0501081_0512190 3300049743 Bacteria 895
1393 Ga0501081_0596987 3300049743 Bacteria 826
1394 Ga0501081_0731045 3300049743 Bacteria 743
1395 Ga0501083_0012201 3300049744 Bacteria 6013
1396 Ga0501083_0017852 3300049744 Bacteria 4949
1397 Ga0501083_0139059 3300049744 Bacteria 1590
1398 Ga0501083_0148584 3300049744 Bacteria 1534
1399 Ga0501083_0308607 3300049744 Bacteria 1029
1400 Ga0501083_0600626 3300049744 Bacteria 716
1401 Ga0501270_147032 3300049767 Bacteria 534
1402 Ga0501283_011611 3300049779 Bacteria 1313
1403 Ga0501035_0529999 3300049822 Bacteria 967
1404 Ga0501035_0681280 3300049822 Bacteria 831
1405 Ga0501035_0725919 3300049822 Bacteria 799
1406 Ga0501044_0015376 3300049823 Bacteria 8241
1407 Ga0501044_0239820 3300049823 Bacteria 1757
1408 Ga0501045_0071244 3300049824 Bacteria 2558
1409 Ga0501045_0208124 3300049824 Bacteria 1457
1410 Ga0501045_0619428 3300049824 Bacteria 801
1411 Ga0501045_0640772 3300049824 Bacteria 786
1412 Ga0501045_0777151 3300049824 Bacteria 705
1413 Ga0501204_019434 3300049850 Bacteria 876
1414 Ga0501212_049278 3300049851 Bacteria 711
1415 nmdc:mga03683_5884_c1 3300050489 Bacteria 4170
1416 nmdc:mga03n38_125_c1 3300050490 Bacteria 16669
1417 nmdc:mga00v17_565_c1 3300050491 Bacteria 20718
1418 nmdc:mga0yw44_170996_c1 3300050492 Bacteria 1427
1419 nmdc:mga0yw44_811_c1 3300050492 Bacteria 11637
1420 nmdc:mga06z11_1903_c1 3300050494 Bacteria 7874
1421 nmdc:mga04h51_3880_c1 3300050495 Bacteria 3677
1422 nmdc:mga05p37_1283494_c1 3300050507 Bacteria 748
1423 nmdc:mga05p37_355_c1 3300050507 Bacteria 49150
1424 nmdc:mga05p37_7114_c1 3300050507 Bacteria 13190
1425 nmdc:mga05p37_952760_c1 3300050507 Bacteria 918
1426 nmdc:mga09592_17223_c1 3300050508 Bacteria 5917
1427 nmdc:mga09592_1792_c1 3300050508 Bacteria 17230
1428 nmdc:mga09592_204680_c1 3300050508 Bacteria 1709
1429 nmdc:mga09592_21121_c1 3300050508 Bacteria 5363
1430 nmdc:mga09592_272438_c1 3300050508 Bacteria 1468
1431 nmdc:mga09592_547455_c1 3300050508 Bacteria 994
1432 nmdc:mga0qj67_284205_c1 3300050509 Bacteria 1341
1433 nmdc:mga0qj67_336788_c1 3300050509 Bacteria 1221
1434 nmdc:mga0qj67_360502_c1 3300050509 Bacteria 1175
1435 nmdc:mga0qj67_853527_c1 3300050509 Bacteria 719
1436 nmdc:mga06r32_158503_c1 3300050510 Bacteria 2245
1437 nmdc:mga06r32_167341_c1 3300050510 Bacteria 2181
1438 nmdc:mga06r32_293964_c1 3300050510 Bacteria 1611
1439 nmdc:mga06r32_570574_c1 3300050510 Bacteria 1104
1440 nmdc:mga08y16_101924_c1 3300050511 Bacteria 2988
1441 nmdc:mga08y16_14088_c1 3300050511 Bacteria 2974
1442 nmdc:mga08y16_18626_c1 3300050511 Bacteria 7313
1443 nmdc:mga08y16_197067_c1 3300050511 Bacteria 2087
1444 nmdc:mga08y16_213614_c1 3300050511 Bacteria 1998
1445 nmdc:mga08y16_261479_c1 3300050511 Bacteria 1787
1446 nmdc:mga08y16_423612_c1 3300050511 Bacteria 1360
1447 nmdc:mga08y16_4258_c1 3300050511 Bacteria 14941
1448 nmdc:mga0n895_1478842_c1 3300050512 Bacteria 646
1449 nmdc:mga0n895_1843217_c1 3300050512 Bacteria 565
1450 nmdc:mga0n895_36969_c1 3300050512 Bacteria 4720
1451 nmdc:mga0n895_470256_c1 3300050512 Bacteria 1268
1452 nmdc:mga0n895_5640_c1 3300050512 Bacteria 10489
1453 nmdc:mga0n895_802994_c1 3300050512 Bacteria 931
1454 nmdc:mga0rr50_1003820_c1 3300050513 Bacteria 711
1455 nmdc:mga0rr50_101580_c1 3300050513 Bacteria 2261
1456 nmdc:mga0rr50_133033_c1 3300050513 Bacteria 1993
1457 nmdc:mga0rr50_1406_c1 3300050513 Bacteria 13196
1458 nmdc:mga0rr50_172666_c1 3300050513 Bacteria 1763
1459 nmdc:mga0rr50_267644_c1 3300050513 Bacteria 1423
1460 nmdc:mga0rr50_541424_c1 3300050513 Bacteria 991
1461 nmdc:mga0rr50_61731_c1 3300050513 Bacteria 2825
1462 nmdc:mga0rr50_71538_c1 3300050513 Bacteria 2647
1463 nmdc:mga08x19_21595_c1 3300050514 Bacteria 3977
1464 nmdc:mga08x19_28316_c1 3300050514 Bacteria 3508
1465 nmdc:mga08x19_431822_c1 3300050514 Bacteria 926
1466 nmdc:mga08x19_49998_c1 3300050514 Bacteria 2682
1467 nmdc:mga08x19_71273_c1 3300050514 Bacteria 2266
1468 nmdc:mga08x19_9133_c1 3300050514 Bacteria 5919
1469 nmdc:mga0a205_1205520_c1 3300050515 Bacteria 605
1470 nmdc:mga0a205_136217_c1 3300050515 Bacteria 2356
1471 nmdc:mga0a205_294_c1 3300050515 Bacteria 36893
1472 Ga0495601_0002136 3300053077 Bacteria 11126
1473 Ga0495601_0010686 3300053077 Bacteria 5474
1474 Ga0495612_0008626 3300053078 Bacteria 4133
1475 Ga0495612_0043466 3300053078 Bacteria 1836
1476 Ga0495612_0210857 3300053078 Bacteria 858
1477 Ga0495655_0373090 3300053083 Bacteria 503
1478 Ga0495595_0000270 3300053084 Bacteria 20465
1479 Ga0495595_0050637 3300053084 Bacteria 1924
1480 Ga0495595_0327898 3300053084 Bacteria 771
1481 Ga0495619_0000324 3300053085 Bacteria 33369
1482 Ga0495619_0002457 3300053085 Bacteria 12130
1483 Ga0495619_0022462 3300053085 Bacteria 4038
1484 Ga0495619_0429373 3300053085 Bacteria 911
1485 Ga0500616_0073015 3300053153 Bacteria 1743
1486 Ga0501084_0034148 3300054114 Bacteria 4253
1487 Ga0501084_0195928 3300054114 Bacteria 1704
1488 Ga0501084_0351460 3300054114 Bacteria 1245
1489 Ga0501084_0601003 3300054114 Bacteria 929
1490 Ga0501084_0674879 3300054114 Bacteria 872
1491 Ga0501084_0806262 3300054114 Bacteria 791
1492 Ga0501084_0927880 3300054114 Bacteria 732
1493 Ga0501084_1006995 3300054114 Bacteria 700
1494 Ga0590077_055784 3300059426 Bacteria 891
1495 Ga0501082_0058019 3300060353 Bacteria 3335
1496 Ga0501082_0101184 3300060353 Bacteria 2493
1497 Ga0501082_0126930 3300060353 Bacteria 2212
1498 Ga0501082_0145715 3300060353 Bacteria 2056
1499 Ga0501082_0363831 3300060353 Bacteria 1262
1500 Ga0501082_0659404 3300060353 Bacteria 916
1501 Ga0501082_0871948 3300060353 Bacteria 787
1502 Ga0501082_1915553 3300060353 Bacteria 517
1503 Ga0530510_0079461 3300061734 Bacteria 2385
1504 Ga0530510_0083068 3300061734 Bacteria 2333
1505 Ga0530510_0754718 3300061734 Bacteria 742
1506 Ga0530510_0832149 3300061734 Bacteria 705
1507 Ga0530510_1412585 3300061734 Bacteria 534
1508 Ga0400483_066041
1509 ARcpr5oldR_c008724
1510 ARSoilOldRDRAFT_c007538
1511 ARCol0yngRDRAFT_1004242
1512 JGI24752J21851_1025306
1513 JGI24737J22298_10095247
1514 JGI24742J22300_10022069
1515 JGI25406J46586_10038211
1516 JGI25406J46586_10210527
1517 JGI25405J52794_10008962
1518 Ga0065712_10005527
1519 Ga0065712_10108843
1520 Ga0065715_10620808
1521 Ga0065707_10002365
1522 Ga0065707_10088467
1523 Ga0065707_10099260
1524 Ga0065707_10636557
1525 Ga0070658_10102291
1526 Ga0070658_10242319
1527 Ga0070676_10061777
1528 Ga0070676_10068148
1529 Ga0070676_10097603
1530 Ga0070676_10219955
1531 Ga0070683_100074710
1532 Ga0070683_100091214
1533 Ga0070690_100000203
1534 Ga0070690_100115816
1535 Ga0070690_100937605
1536 Ga0070670_100024117
1537 Ga0070670_100025997
1538 Ga0070670_100244519
1539 Ga0070670_100586894
1540 Ga0070677_10003307
1541 Ga0070677_10183258
1542 Ga0068869_100001312
1543 Ga0068869_100013668
1544 Ga0068869_100599159
1545 Ga0068869_100898034
1546 Ga0068869_101027895
1547 Ga0068869_101082364
1548 Ga0070666_10065140
1549 Ga0070666_10235412
1550 Ga0070666_10743376
1551 Ga0070666_10815464
1552 Ga0070680_100003010
1553 Ga0070680_100050080
1554 Ga0070680_100368816
1555 Ga0070682_100003169
1556 Ga0070682_100021852
1557 Ga0070682_100352302
1558 Ga0070682_100948056
1559 Ga0068868_100206121
1560 Ga0068868_100669108
1561 Ga0070660_100013058
1562 Ga0070660_100069127
1563 Ga0070660_100245986
1564 Ga0070660_100725806
1565 Ga0070689_100005620
1566 Ga0070689_100008280
1567 Ga0070689_100049288
1568 Ga0070689_100209773
1569 Ga0070689_100267632
1570 Ga0070689_100395251
1571 Ga0070689_100868643
1572 Ga0070691_10000424
1573 Ga0070687_100000070
1574 Ga0070687_100026386
1575 Ga0070687_100125820
1576 Ga0070687_100126903
1577 Ga0070687_100599323
1578 Ga0070687_100835024
1579 Ga0070661_100001889
1580 Ga0070661_100070625
1581 Ga0070661_100285902
1582 Ga0070661_100491845
1583 Ga0070692_10003621
1584 Ga0070692_10141185
1585 Ga0070668_100017254
1586 Ga0070668_100155309
1587 Ga0070668_100318058
1588 Ga0070668_100463440
1589 Ga0070668_101144151
1590 Ga0070669_100001468
1591 Ga0070669_100159340
1592 Ga0070669_100176116
1593 Ga0070669_100403643
1594 Ga0070669_100533857
1595 Ga0070669_100574985
1596 Ga0070675_100009053
1597 Ga0070675_100361041
1598 Ga0070675_100975905
1599 Ga0070675_100993373
1600 Ga0070675_101247644
1601 Ga0070671_100003908
1602 Ga0070671_100085878
1603 Ga0070671_100281100
1604 Ga0070671_100503709
1605 Ga0070671_100666350
1606 Ga0070671_101703464
1607 Ga0070674_100002697
1608 Ga0070674_100014002
1609 Ga0070674_100037392
1610 Ga0070674_100078744
1611 Ga0070673_100015782
1612 Ga0070673_100034438
1613 Ga0070673_100096978
1614 Ga0070673_100114289
1615 Ga0070673_100690315
1616 Ga0070688_100499687
1617 Ga0070688_100557793
1618 Ga0070688_100865594
1619 Ga0070659_100051777
1620 Ga0070659_100081052
1621 Ga0070659_100381688
1622 Ga0070667_100007696
1623 Ga0070667_100061678
1624 Ga0070667_100070247
1625 Ga0070667_100141487
1626 Ga0070703_10099978
1627 Ga0070709_10058148
1628 Ga0070709_10145483
1629 Ga0070709_10153545
1630 Ga0070709_10178377
1631 Ga0070709_10379426
1632 Ga0070714_100005848
1633 Ga0070714_100027567
1634 Ga0070714_100045447
1635 Ga0070714_100057298
1636 Ga0070714_100166403
1637 Ga0070714_100204124
1638 Ga0070714_100233930
1639 Ga0070714_100267051
1640 Ga0070714_100406768
1641 Ga0070713_100002660
1642 Ga0070713_100051664
1643 Ga0070713_100086927
1644 Ga0070710_10001294
1645 Ga0070710_10002482
1646 Ga0070710_10016968
1647 Ga0070710_10185300
1648 Ga0070710_10273357
1649 Ga0070701_10000661
1650 Ga0070701_10012854
1651 Ga0070701_10103345
1652 Ga0070711_100001151
1653 Ga0070711_100110979
1654 Ga0070711_100122578
1655 Ga0070711_100555706
1656 Ga0070711_100556001
1657 Ga0070705_100001132
1658 Ga0070705_100124126
1659 Ga0070705_100183316
1660 Ga0070700_100000651
1661 Ga0070700_100025003
1662 Ga0070700_100173283
1663 Ga0070694_100000669
1664 Ga0070694_100010076
1665 Ga0070694_100078205
1666 Ga0070708_100164107
1667 Ga0070708_100867733
1668 Ga0070663_100006342
1669 Ga0070663_100018980
1670 Ga0070663_101815155
1671 Ga0070678_100153793
1672 Ga0070678_100402533
1673 Ga0070662_100000213
1674 Ga0070662_100128084
1675 Ga0070662_100277789
1676 Ga0070662_100569245
1677 Ga0070662_101019226
1678 Ga0070662_101273185
1679 Ga0070662_101372709
1680 Ga0070662_101955176
1681 Ga0070681_10146333
1682 Ga0070681_10174957
1683 Ga0070681_10211627
1684 Ga0070681_10232896
1685 Ga0068867_100002241
1686 Ga0068867_100026348
1687 Ga0068867_100070809
1688 Ga0068867_100209452
1689 Ga0068867_101136359
1690 Ga0070685_10008574
1691 Ga0070685_10014591
1692 Ga0070706_100520352
1693 Ga0070698_100360875
1694 Ga0070698_100478213
1695 Ga0070698_100742365
1696 Ga0070699_100013067
1697 Ga0070699_100176113
1698 Ga0070699_100855114
1699 Ga0070679_100007583
1700 Ga0070679_100093990
1701 Ga0070679_100158919
1702 Ga0070679_100282888
1703 Ga0070679_100343952
1704 Ga0070679_100474284
1705 Ga0070684_100044288
1706 Ga0070684_100366942
1707 Ga0070697_100022929
1708 Ga0068853_100006369
1709 Ga0068853_100106579
1710 Ga0068853_100235539
1711 Ga0068853_100576458
1712 Ga0068853_101593276
1713 Ga0070672_100000549
1714 Ga0070672_100001925
1715 Ga0070672_100008206
1716 Ga0070672_100188651
1717 Ga0070672_100471141
1718 Ga0070686_100002595
1719 Ga0070686_100006070
1720 Ga0070686_100042460
1721 Ga0070686_100587846
1722 Ga0070695_100000808
1723 Ga0070695_100137634
1724 Ga0070696_100000441
1725 Ga0070696_100257650
1726 Ga0070696_100291239
1727 Ga0070696_100378515
1728 Ga0070696_100534371
1729 Ga0070693_100000574
1730 Ga0070693_100091125
1731 Ga0070693_100920014
1732 Ga0070665_100108756
1733 Ga0070665_100226571
1734 Ga0070665_100302154
1735 Ga0070665_101486067
1736 Ga0070704_100000617
1737 Ga0070704_100054392
1738 Ga0070704_100095571
1739 Ga0070704_100188068
1740 Ga0070704_100238680
1741 Ga0070704_100423248
1742 Ga0068855_100000606
1743 Ga0068855_100010150
1744 Ga0068855_100013117
1745 Ga0068855_100283202
1746 Ga0068855_100365630
1747 Ga0070664_100001419
1748 Ga0070664_100026130
1749 Ga0070664_100105074
1750 Ga0070664_100166809
1751 Ga0070664_101184549
1752 Ga0068857_100009173
1753 Ga0068857_100201424
1754 Ga0068857_100426228
1755 Ga0068857_101285587
1756 Ga0068857_101775231
1757 Ga0068854_100002203
1758 Ga0068854_100006160
1759 Ga0068856_100001525
1760 Ga0068856_100008271
1761 Ga0068856_100051047
1762 Ga0068856_100074478
1763 Ga0068856_100198323
1764 Ga0068856_100209412
1765 Ga0070702_100000349
1766 Ga0070702_100098605
1767 Ga0068852_100002715
1768 Ga0068852_100261512
1769 Ga0068852_100318145
1770 Ga0068852_100411322
1771 Ga0068859_100000445
1772 Ga0068859_100350188
1773 Ga0068864_100032507
1774 Ga0068864_100129378
1775 Ga0068864_100481280
1776 Ga0068864_100509716
1777 Ga0068864_100621995
1778 Ga0068866_10000640
1779 Ga0068866_10028466
1780 Ga0068866_10060889
1781 Ga0068866_10382455
1782 Ga0068861_100000246
1783 Ga0068861_100171684
1784 Ga0068861_100207144
1785 Ga0068861_100231409
1786 Ga0068861_100307477
1787 Ga0068861_100368245
1788 Ga0068851_10031275
1789 Ga0068870_10082065
1790 Ga0068863_100110791
1791 Ga0068863_100504604
1792 Ga0068863_100590437
1793 Ga0068863_100767672
1794 Ga0068863_101716005
1795 Ga0068858_100005536
1796 Ga0068858_100095652
1797 Ga0068858_100100838
1798 Ga0068858_100197202
1799 Ga0068858_100780719
1800 Ga0068860_100016800
1801 Ga0068860_100020458
1802 Ga0068860_100029056
1803 Ga0068860_100206580
1804 Ga0068860_101147188
1805 Ga0068862_100000668
1806 Ga0068862_100064503
1807 Ga0068862_100174409
1808 Ga0068862_101148160
1809 Ga0068862_101544973
1810 Ga0081455_10022859
1811 Ga0081455_10034387
1812 Ga0081455_10878260
1813 Ga0081538_10023230
1814 Ga0081538_10057385
1815 Ga0081540_1014625
1816 Ga0081539_10000668
1817 Ga0081539_10010842
1818 Ga0081539_10062170
1819 Ga0070717_10004842
1820 Ga0070717_10120445
1821 Ga0070717_10531282
1822 Ga0075365_10000927
1823 Ga0075365_10299154
1824 Ga0075368_10001598
1825 Ga0075363_100003287
1826 Ga0075364_10000041
1827 Ga0075364_10011581
1828 Ga0075432_10107619
1829 Ga0070715_10000182
1830 Ga0070715_10000437
1831 Ga0070716_100003522
1832 Ga0070716_100080005
1833 Ga0070712_100002706
1834 Ga0070712_100007781
1835 Ga0075362_10008189
1836 Ga0075367_10005610
1837 Ga0097621_100001417
1838 Ga0097621_100020377
1839 Ga0097621_100022117
1840 Ga0097621_100083136
1841 Ga0097621_100097077
1842 Ga0097621_101080174
1843 Ga0068871_100001297
1844 Ga0068871_100007981
1845 Ga0068871_100008656
1846 Ga0068871_100042675
1847 Ga0068871_100073999
1848 Ga0075428_100052937
1849 Ga0075428_100282077
1850 Ga0075428_100385998
1851 Ga0075428_100651616
1852 Ga0075430_100002128
1853 Ga0075430_100455550
1854 Ga0075430_100867491
1855 Ga0075431_100214374
1856 Ga0075431_100248531
1857 Ga0075431_100366561
1858 Ga0075431_100621348
1859 Ga0075433_10005804
1860 Ga0075433_10370533
1861 Ga0075433_10494810
1862 Ga0075433_10708434
1863 Ga0075434_100000078
1864 Ga0075434_100005507
1865 Ga0075434_100251027
1866 Ga0075434_100398224
1867 Ga0075434_100529973
1868 Ga0075434_100770625
1869 Ga0075434_101059080
1870 Ga0075434_101078082
1871 Ga0075429_100016021
1872 Ga0068865_100001575
1873 Ga0068865_100027289
1874 Ga0068865_101009682
1875 Ga0075436_100021839
1876 Ga0075436_100034523
1877 Ga0075436_100048582
1878 Ga0075436_100108509
1879 Ga0075436_101243502
1880 Ga0097620_100000445
1881 Ga0097620_100350212
1882 Ga0075435_100010161
1883 Ga0075435_100014627
1884 Ga0075435_100034163
1885 Ga0075435_100063542
1886 Ga0075435_100091182
1887 Ga0075435_100173042
1888 Ga0075435_100197770
1889 Ga0075435_100550978
1890 Ga0075435_100669088
1891 Ga0105251_10116809
1892 Ga0105240_10008246
1893 Ga0105240_10127951
1894 Ga0105240_10205645
1895 Ga0105240_10734918
1896 Ga0105240_11685905
1897 Ga0111539_10013658
1898 Ga0111539_10026456
1899 Ga0111539_10109700
1900 Ga0111539_10119315
1901 Ga0111539_10243656
1902 Ga0111539_10341626
1903 Ga0111539_10413601
1904 Ga0111539_10417775
1905 Ga0111539_10737902
1906 Ga0105245_10003710
1907 Ga0105245_10164719
1908 Ga0105245_10302682
1909 Ga0105245_11380977
1910 Ga0105245_11441723
1911 Ga0105247_10021649
1912 Ga0105247_11001745
1913 Ga0105247_11147045
1914 Ga0114129_10009272
1915 Ga0114129_10107675
1916 Ga0114129_10207604
1917 Ga0114129_10268489
1918 Ga0105243_10001954
1919 Ga0105243_10074020
1920 Ga0105243_10136991
1921 Ga0105243_10309300
1922 Ga0105243_10510528
1923 Ga0105243_10586419
1924 Ga0105243_12742008
1925 Ga0105241_10012048
1926 Ga0105241_10026716
1927 Ga0105241_10038739
1928 Ga0105241_10226728
1929 Ga0105242_10002505
1930 Ga0105242_10029479
1931 Ga0105242_10053049
1932 Ga0105242_10064199
1933 Ga0105242_10602692
1934 Ga0105242_10707290
1935 Ga0105242_11202355
1936 Ga0105242_11252819
1937 Ga0105242_12318532
1938 Ga0105248_10017431
1939 Ga0105248_10029612
1940 Ga0105248_10047993
1941 Ga0105248_10173528
1942 Ga0105237_10013134
1943 Ga0105237_10034871
1944 Ga0105237_10074539
1945 Ga0105237_10253874
1946 Ga0105237_10758446
1947 Ga0105237_10780658
1948 Ga0105238_10067129
1949 Ga0105238_11629773
1950 Ga0105249_10026793
1951 Ga0105249_10287423
1952 Ga0105249_10377924
1953 Ga0105249_10902334
1954 Ga0105249_10992345
1955 Ga0105249_11231650
1956 Ga0105249_12672747
1957 Ga0105239_10013511
1958 Ga0105239_10641648
1959 Ga0105239_12034082
1960 Ga0105246_10147383
1961 Ga0105246_10389000
1962 Ga0105246_10878288
1963 Ga0157321_1027039
1964 Ga0157341_1002427
1965 Ga0157341_1018867
1966 Ga0157338_1013841
1967 Ga0157373_10004556
1968 Ga0157373_10006641
1969 Ga0157373_10020207
1970 Ga0157373_10030071
1971 Ga0157373_10189694
1972 Ga0157373_10355042
1973 Ga0157371_10001833
1974 Ga0157371_10040213
1975 Ga0157371_10793364
1976 Ga0157371_10837067
1977 Ga0157371_10891512
1978 Ga0157370_10006051
1979 Ga0157370_10009625
1980 Ga0157370_10020601
1981 Ga0157370_10022043
1982 Ga0157370_10038915
1983 Ga0157370_10047399
1984 Ga0157370_10121653
1985 Ga0157370_10318958
1986 Ga0157370_10359999
1987 Ga0157369_10008592
1988 Ga0157369_10015589
1989 Ga0157369_10117184
1990 Ga0157369_10796483
1991 Ga0157369_10829158
1992 Ga0157369_11146261
1993 Ga0157369_12615031
1994 Ga0157374_10047543
1995 Ga0157374_10194222
1996 Ga0157374_10685817
1997 Ga0157378_10001142
1998 Ga0157378_10004789
1999 Ga0157378_10057867
2000 Ga0157378_10371469
2001 Ga0157378_10970178
2002 Ga0163162_10045373
2003 Ga0163162_10100801
2004 Ga0163162_10221834
2005 Ga0163162_10483176
2006 Ga0163162_11862376
2007 Ga0157372_10155810
2008 Ga0157372_10343546
2009 Ga0157372_10372700
2010 Ga0157372_10430496
2011 Ga0157372_10614669
2012 Ga0157372_11146448
2013 Ga0157372_12251908
2014 Ga0157375_10009737
2015 Ga0157375_10236624
2016 Ga0157375_10758569
2017 Ga0157375_11186320
2018 Ga0157375_11210412
2019 Ga0163163_10122200
2020 Ga0163163_10249903
2021 Ga0163163_10495263
2022 Ga0163163_10668280
2023 Ga0163163_10904119
2024 Ga0157380_10022847
2025 Ga0157380_10168744
2026 Ga0157380_10359519
2027 Ga0157380_10789224
2028 Ga0157380_12263456
2029 Ga0182008_10260096
2030 Ga0157377_10099694
2031 Ga0157377_11331231
2032 Ga0157379_10049777
2033 Ga0157379_10260529
2034 Ga0157379_10611967
2035 Ga0157376_10003476
2036 Ga0157376_10008293
2037 Ga0157376_10015215
2038 Ga0157376_10210607
2039 Ga0157376_10359721
2040 Ga0157376_10668041
2041 Ga0163161_10025300
2042 Ga0163161_10029236
2043 Ga0163161_10246347
2044 Ga0163161_10569868
2045 Ga0206356_11413287
2046 Ga0213874_10005027
2047 Ga0224572_1097226
2048 Ga0207666_1060908
2049 Ga0207697_10030659
2050 Ga0207697_10358773
2051 Ga0207656_10039789
2052 Ga0207682_10003597
2053 Ga0207682_10051678
2054 Ga0207682_10130280
2055 Ga0207682_10279103
2056 Ga0207692_10000503
2057 Ga0207692_10066469
2058 Ga0207692_10067436
2059 Ga0207692_10133987
2060 Ga0207692_10141416
2061 Ga0207692_10269474
2062 Ga0207642_10005995
2063 Ga0207642_10016410
2064 Ga0207642_10177760
2065 Ga0207710_10017641
2066 Ga0207710_10538858
2067 Ga0207688_10037295
2068 Ga0207688_10532938
2069 Ga0207688_10748326
2070 Ga0207680_10064395
2071 Ga0207680_10211366
2072 Ga0207680_10257182
2073 Ga0207680_10483588
2074 Ga0207647_10267324
2075 Ga0207647_10425684
2076 Ga0207685_10000354
2077 Ga0207685_10001723
2078 Ga0207699_10008044
2079 Ga0207699_10050010
2080 Ga0207699_10070422
2081 Ga0207699_10260587
2082 Ga0207699_10516612
2083 Ga0207699_10739805
2084 Ga0207645_10011966
2085 Ga0207645_10017690
2086 Ga0207645_10167044
2087 Ga0207645_10755000
2088 Ga0207643_10042451
2089 Ga0207643_10044017
2090 Ga0207643_10638283
2091 Ga0207705_10090548
2092 Ga0207684_10032273
2093 Ga0207684_10474107
2094 Ga0207684_10583138
2095 Ga0207654_10022974
2096 Ga0207654_10789850
2097 Ga0207707_10008482
2098 Ga0207707_10063930
2099 Ga0207707_10068209
2100 Ga0207707_10269295
2101 Ga0207695_10060956
2102 Ga0207695_10074182
2103 Ga0207695_10783581
2104 Ga0207671_10133472
2105 Ga0207693_10001609
2106 Ga0207693_10006450
2107 Ga0207693_10008687
2108 Ga0207663_10003480
2109 Ga0207663_10028048
2110 Ga0207663_10080798
2111 Ga0207663_10158531
2112 Ga0207663_10276417
2113 Ga0207663_10474103
2114 Ga0207663_10931511
2115 Ga0207663_11362910
2116 Ga0207660_10003216
2117 Ga0207660_10080418
2118 Ga0207660_11008534
2119 Ga0207662_10000088
2120 Ga0207662_10000710
2121 Ga0207662_10030460
2122 Ga0207662_10614424
2123 Ga0207657_10001097
2124 Ga0207657_10223773
2125 Ga0207657_10526580
2126 Ga0207649_10022621
2127 Ga0207649_10035292
2128 Ga0207649_10331019
2129 Ga0207649_10692986
2130 Ga0207652_10069270
2131 Ga0207652_10075338
2132 Ga0207652_10098416
2133 Ga0207652_10487175
2134 Ga0207652_11002316
2135 Ga0207652_11224468
2136 Ga0207681_10013794
2137 Ga0207681_10044539
2138 Ga0207681_10101018
2139 Ga0207681_10227382
2140 Ga0207681_10333104
2141 Ga0207681_10371902
2142 Ga0207681_10718317
2143 Ga0207694_10012843
2144 Ga0207694_10051639
2145 Ga0207650_10042140
2146 Ga0207650_10050535
2147 Ga0207650_10193945
2148 Ga0207650_10209174
2149 Ga0207650_10288046
2150 Ga0207650_10554211
2151 Ga0207650_10648084
2152 Ga0207650_10808347
2153 Ga0207659_10011330
2154 Ga0207659_10184628
2155 Ga0207659_10191881
2156 Ga0207659_10250026
2157 Ga0207659_10559502
2158 Ga0207687_10000349
2159 Ga0207687_10006704
2160 Ga0207687_11696229
2161 Ga0207700_10001216
2162 Ga0207700_10027694
2163 Ga0207700_10263217
2164 Ga0207700_10783358
2165 Ga0207664_10001209
2166 Ga0207664_10005216
2167 Ga0207664_10012693
2168 Ga0207664_10058051
2169 Ga0207664_10220252
2170 Ga0207664_10304665
2171 Ga0207664_10719320
2172 Ga0207644_10003039
2173 Ga0207644_10046278
2174 Ga0207644_10104444
2175 Ga0207644_10470154
2176 Ga0207690_10000661
2177 Ga0207690_10034139
2178 Ga0207690_10140537
2179 Ga0207690_10624912
2180 Ga0207690_10684600
2181 Ga0207706_10000040
2182 Ga0207706_10029338
2183 Ga0207706_10070688
2184 Ga0207706_10137397
2185 Ga0207706_10287595
2186 Ga0207706_10452261
2187 Ga0207686_10035803
2188 Ga0207686_10111571
2189 Ga0207686_10840042
2190 Ga0207686_10971743
2191 Ga0207709_10001642
2192 Ga0207709_10039687
2193 Ga0207709_10114217
2194 Ga0207709_10336355
2195 Ga0207670_10002235
2196 Ga0207670_10049431
2197 Ga0207670_10087023
2198 Ga0207670_10282033
2199 Ga0207670_10600332
2200 Ga0207670_11205798
2201 Ga0207669_10003857
2202 Ga0207669_10046628
2203 Ga0207669_10097906
2204 Ga0207669_10218926
2205 Ga0207704_10002194
2206 Ga0207704_10094979
2207 Ga0207665_10000223
2208 Ga0207665_10002070
2209 Ga0207665_10305481
2210 Ga0207691_10006790
2211 Ga0207691_10015784
2212 Ga0207691_10073946
2213 Ga0207691_10130871
2214 Ga0207691_10267643
2215 Ga0207711_10022647
2216 Ga0207711_10042318
2217 Ga0207689_10002986
2218 Ga0207689_10009370
2219 Ga0207689_10037694
2220 Ga0207689_10197924
2221 Ga0207689_10274249
2222 Ga0207661_10021055
2223 Ga0207661_10735404
2224 Ga0207679_10011215
2225 Ga0207679_10013523
2226 Ga0207679_10223379
2227 Ga0207679_10404645
2228 Ga0207679_10943827
2229 Ga0207667_10011779
2230 Ga0207667_10023839
2231 Ga0207667_10191445
2232 Ga0207667_10356339
2233 Ga0207667_10913291
2234 Ga0207667_11360981
2235 Ga0207651_10002402
2236 Ga0207651_10019559
2237 Ga0207651_10116632
2238 Ga0207651_10151539
2239 Ga0207712_10103552
2240 Ga0207712_10361265
2241 Ga0207668_10072871
2242 Ga0207668_10225583
2243 Ga0207668_10531546
2244 Ga0207668_10563571
2245 Ga0207668_10805313
2246 Ga0207668_11593604
2247 Ga0207640_10011788
2248 Ga0207640_10012718
2249 Ga0207658_10010103
2250 Ga0207658_10146371
2251 Ga0207658_10193322
2252 Ga0207658_10249536
2253 Ga0207658_10459407
2254 Ga0207677_10096263
2255 Ga0207677_10417021
2256 Ga0207677_11238728
2257 Ga0207703_10003517
2258 Ga0207703_10037996
2259 Ga0207703_10129896
2260 Ga0207703_10163974
2261 Ga0207639_10034249
2262 Ga0207639_10056193
2263 Ga0207639_10356725
2264 Ga0207639_10463505
2265 Ga0207639_11410573
2266 Ga0207678_10007871
2267 Ga0207678_10008883
2268 Ga0207678_10889890
2269 Ga0207678_11039933
2270 Ga0207708_10000326
2271 Ga0207708_10001430
2272 Ga0207708_10280709
2273 Ga0207702_10014584
2274 Ga0207702_10048686
2275 Ga0207702_10058542
2276 Ga0207702_10108244
2277 Ga0207702_10279895
2278 Ga0207702_10637779
2279 Ga0207702_12295361
2280 Ga0207641_10053430
2281 Ga0207641_10083806
2282 Ga0207641_10110446
2283 Ga0207641_10268230
2284 Ga0207641_10666197
2285 Ga0207641_10869063
2286 Ga0207641_12027521
2287 Ga0207641_12087896
2288 Ga0207648_10000071
2289 Ga0207648_10002303
2290 Ga0207648_10019841
2291 Ga0207648_10240593
2292 Ga0207648_10466324
2293 Ga0207676_10025129
2294 Ga0207676_10069259
2295 Ga0207676_10102174
2296 Ga0207676_10152579
2297 Ga0207676_10417792
2298 Ga0207676_10810932
2299 Ga0207676_12164412
2300 Ga0207674_10000155
2301 Ga0207674_10448512
2302 Ga0207674_10469949
2303 Ga0207674_10671961
2304 Ga0207675_100000040
2305 Ga0207675_100018658
2306 Ga0207675_100035478
2307 Ga0207675_100053014
2308 Ga0207675_100069717
2309 Ga0207675_100274651
2310 Ga0207675_100364166
2311 Ga0207683_10005993
2312 Ga0207683_10010627
2313 Ga0207683_10059677
2314 Ga0207683_10102434
2315 Ga0207683_10127013
2316 Ga0207683_10156286
2317 Ga0207683_10187204
2318 Ga0207683_10677497
2319 Ga0207698_10005283
2320 Ga0207698_10078529
2321 Ga0207698_10776052
2322 Ga0209969_1001293
2323 Ga0209969_1026104
2324 Ga0209967_1022930
2325 Ga0209981_1003276
2326 Ga0209981_1018642
2327 Ga0209996_1043490
2328 Ga0209968_1057731
2329 Ga0209971_1017602
2330 Ga0209966_1015677
2331 Ga0209998_10035007
2332 Ga0209813_10003624
2333 Ga0209974_10019154
2334 Ga0209974_10137092
2335 Ga0207428_10003555
2336 Ga0207428_10187719
2337 Ga0268266_10027827
2338 Ga0268266_10038362
2339 Ga0268266_10253613
2340 Ga0268266_11095610
2341 Ga0268265_10015432
2342 Ga0268265_10016234
2343 Ga0268265_10262872
2344 Ga0268265_10273866
2345 Ga0268264_10000527
2346 Ga0268264_10050378
2347 Ga0268264_10149206
2348 Ga0268264_10834279
2349 Ga0268264_10886413
2350 Ga0268264_11090257
2351 Ga0268264_11242777
2352 Ga0265337_1000657
2353 Ga0265334_10004658
2354 Ga0265338_10014806
2355 Ga0265338_10168184
2356 Ga0265765_1015225
2357 Ga0265760_10135826
2358 Ga0265332_10023006
2359 Ga0265328_10005004
2360 Ga0265325_10000004
2361 Ga0307408_100083689
2362 Ga0307408_100381515
2363 Ga0307408_100989894
2364 Ga0307408_101481056
2365 Ga0265313_10003348
2366 Ga0316579_10293234
2367 Ga0265314_10001644
2368 Ga0265314_10116754
2369 Ga0316576_10006013
2370 Ga0316576_10055935
2371 Ga0316578_10007067
2372 Ga0316578_10112158
2373 Ga0307405_10004237
2374 Ga0307405_10716221
2375 Ga0307405_10957032
2376 Ga0307413_10000700
2377 Ga0307413_10055564
2378 Ga0307413_10811520
2379 Ga0307410_10004286
2380 Ga0307406_10013188
2381 Ga0307406_10462944
2382 Ga0307407_10011597
2383 Ga0307412_10108155
2384 Ga0307409_100013370
2385 Ga0307416_100008987
2386 Ga0307416_100261457
2387 Ga0307416_100398283
2388 Ga0307416_101116004
2389 Ga0307414_10096761
2390 Ga0307411_10075337
2391 Ga0307411_10321567
2392 Ga0307411_10386921
2393 Ga0307415_100005658
2394 Ga0316583_10001095
2395 Ga0316585_10033425
2396 Ga0316592_1016823
2397 Ga0316592_1042856
2398 Ga0316588_1001446
2399 Ga0316588_1004449
2400 Ga0316596_1002887
2401 Ga0373930_0002876
2402 Ga0373948_0089649
2403 Ga0373948_0096177
2404 Ga0373958_0025895
2405 Ga0373959_0014349
2406 Ga0373938_0006574
2407 Ga0373938_0195483
2408 Ga0373926_0000062
2409 Ga0373926_0000873
2410 Ga0373926_0057063
2411 Ga0373928_0007308
2412 Ga0373929_0001916
2413 Ga0373929_0002103
2414 Ga0373934_0000061
2415 Ga0373934_0208055
2416 Ga0373940_0020475
2417 Ga0373940_0069383
2418 Ga0373944_0001760
2419 Ga0373944_0010174
2420 Ga0373944_0016994
2421 Ga0373944_0136159
2422 Ga0373949_0018039
2423 Ga0373949_0045115
2424 Ga0373949_0075239
2425 Ga0373951_0165440
2426 Ga0373952_0013241
2427 Ga0373952_0025205
2428 Ga0373952_0040038
2429 Ga0373932_0010654
2430 Ga0373932_0149864
2431 Ga0373936_0002266
2432 Ga0373936_0006259
2433 Ga0373936_0033352
2434 Ga0373936_0440763
2435 Ga0373939_0030215
2436 Ga0373939_0087509
2437 Ga0373941_0004504
2438 Ga0373941_0078862
2439 Ga0373945_0002753
2440 Ga0373945_0125564
2441 Ga0373945_0173853
2442 Ga0373945_0365778
2443 Ga0373954_0142478
2444 Ga0373956_0000003
2445 Ga0373956_0107578
2446 Ga0373957_0051231
2447 Ga0373957_0189182
2448 Ga0373960_0017534
2449 Ga0373960_0102397
2450 Ga0373943_0000584
2451 Ga0373943_0001182
2452 Ga0373943_0038477
2453 Ga0373943_0205418
2454 Ga0373943_0241354
2455 Ga0373943_0684677
2456 Ga0373946_0001536
2457 Ga0373946_0002920
2458 Ga0373946_0015306
2459 Ga0373946_0053061
2460 Ga0373946_0059926
2461 Ga0373946_0569241
2462 Ga0373955_0006439
2463 Ga0373955_0050034
2464 Ga0373942_0035658
2465 Ga0373961_0093166
2466 Ga0373962_0036833
2467 Ga0373962_0139074
2468 Ga0316574_0120679
2469 Ga0316574_0208595
2470 Ga0373924_0327817
2471 Ga0373931_0000553
2472 Ga0373931_0055258
2473 Ga0373931_0076422
2474 Ga0373931_0240286
2475 Ga0373931_0668486
2476 Ga0373931_0789383
2477 Ga0373935_0001505
2478 Ga0373935_0005854
2479 Ga0373935_0034524
2480 Ga0373935_0037110
2481 Ga0373935_0178262
2482 Ga0373935_0298795
2483 Ga0373935_0382207
2484 Ga0373935_1086346
2485 Ga0373927_0000912
2486 Ga0373927_0042837
2487 Ga0373927_0060322
2488 Ga0373927_0090279
2489 Ga0373927_0093116
2490 Ga0373927_0392062
2491 Ga0373933_0005782
2492 Ga0373933_0211977
2493 Ga0373933_0228263
2494 Ga0373933_0240228
2495 Ga0373947_0002482
2496 Ga0373947_0003695
2497 Ga0373947_0012927
2498 Ga0373947_0014928
2499 Ga0373947_0025250
2500 Ga0373947_0026782
2501 Ga0373947_0122858
2502 Ga0373947_0245626
2503 Ga0373947_0982338
2504 Ga0373947_1051989
2505 Ga0373937_0000196
2506 Ga0373937_0017585
2507 Ga0373937_0044504
2508 Ga0373937_0069893
2509 Ga0373937_0108292
2510 Ga0373937_0224611
2511 Ga0373937_0357799
2512 Ga0373937_0726111
2513 Ga0316582_0001898
2514 Ga0316582_0193563
2515 Ga0316584_0048277
2516 Ga0316584_0253297
2517 Ga0373925_0004491
2518 Ga0373925_0005040
2519 Ga0373925_0006465
2520 Ga0373925_0052700
2521 Ga0373925_0060496
2522 Ga0373925_0073485
2523 Ga0373925_0114666
2524 Ga0373925_0129742
2525 Ga0373925_0156637
2526 Ga0373925_0200579
2527 Ga0373925_0616972
2528 Ga0373925_0884951
2529 Ga0395899_0097303
2530 Ga0395900_0017617
2531 Ga0395900_0181537
2532 Ga0395900_1867637
2533 Ga0395898_0020431
2534 Ga0395898_0120763
2535 Ga0395898_0192133
2536 Ga0395905_0085046
2537 Ga0395905_0187731
2538 Ga0316581_0000256
2539 Ga0395901_0032467
2540 Ga0395901_0197987
2541 Ga0395901_0759588
2542 Ga0242420_060201
2543 Ga0400483_249032
2544 Ga0436365_1483055
2545 Ga0436361_0966677
2546 Ga0436363_0328509
2547 Ga0436362_0044954
2548 Ga0439436_0093332
2549 Ga0439439_0023170
2550 Ga0451787_728395
2551 Ga0451853_2158847
2552 Ga0439441_000979
2553 Ga0439441_066127
2554 Ga0439441_106654
2555 Ga0439443_003131
2556 Ga0439443_033139
2557 Ga0439449_0420135
2558 Ga0439462_0091873
2559 Ga0450923_039057
2560 Ga0439458_0173336
2561 Ga0439434_0060064
2562 Ga0439435_0000004
2563 Ga0439435_0013464
2564 Ga0439444_0093274
2565 Ga0439459_0095149
2566 Ga0439460_0000235
2567 Ga0439460_0015727
2568 Ga0439460_0134767
2569 Ga0451577_0008862
2570 Ga0451577_0057081
2571 Ga0453683_0147840
2572 Ga0453683_0507009
2573 Ga0466963_0842857
2574 Ga0466957_0081969
2575 Ga0451576_0003049
2576 Ga0451576_0017751
2577 Ga0451576_0619603
2578 Ga0451576_1380122
2579 Ga0466958_0040320
2580 Ga0466958_0718255
2581 Ga0466967_0021653
2582 Ga0495592_0020464
2583 Ga0495592_0224616
2584 Ga0495603_0000752
2585 Ga0495603_0009108
2586 Ga0495603_0021983
2587 Ga0495629_0001998
2588 Ga0495629_0002312
2589 Ga0495629_0015214
2590 Ga0495629_0059779
2591 Ga0495629_0143234
2592 Ga0495651_0004749
2593 Ga0495651_0016174
2594 Ga0495651_0312278
2595 Ga0495653_0005728
2596 Ga0495580_0008537
2597 Ga0495580_0016385
2598 Ga0495580_0029652
2599 Ga0495580_0224582
2600 Ga0495580_0268638
2601 Ga0495582_0014397
2602 Ga0495582_0052439
2603 Ga0495582_0137252
2604 Ga0495639_0004241
2605 Ga0495639_0093803
2606 Ga0495639_0146968
2607 Ga0495662_0003590
2608 Ga0495662_0152433
2609 Ga0495664_0029532
2610 Ga0495664_0098990
2611 Ga0495664_0373185
2612 Ga0495584_0245642
2613 Ga0495584_0672178
2614 Ga0495594_0010179
2615 Ga0495594_0085149
2616 Ga0495608_0001760
2617 Ga0495608_0252723
2618 Ga0495618_0008377
2619 Ga0495618_0014032
2620 Ga0495618_0521016
2621 Ga0495620_0286568
2622 Ga0495628_0016594
2623 Ga0495630_0013313
2624 Ga0495630_0055024
2625 Ga0495630_0284177
2626 Ga0495666_0041999
2627 Ga0495666_0133151
2628 Ga0495666_0433558
2629 Ga0495642_0067816
2630 Ga0495642_0134426
2631 Ga0495642_0290372
2632 Ga0495652_0006626
2633 Ga0495652_0033497
2634 Ga0495665_0014479
2635 Ga0495665_0197180
2636 Ga0495665_0285605
2637 Ga0495665_0576628
2638 Ga0495640_0022930
2639 Ga0495640_0036793
2640 Ga0495640_0060058
2641 Ga0495640_0125380
2642 Ga0495640_0519742
2643 Ga0495586_0002269
2644 Ga0495586_0185840
2645 Ga0495586_0318107
2646 Ga0495586_0760786
2647 Ga0495587_0010344
2648 Ga0495598_0343615
2649 Ga0495621_0005915
2650 Ga0495621_0023324
2651 Ga0495621_0040705
2652 Ga0495621_0333202
2653 Ga0495645_0144881
2654 Ga0495622_0035325
2655 Ga0495622_0043054
2656 Ga0495622_0083252
2657 Ga0495667_0005211
2658 Ga0495667_0084907
2659 Ga0495667_0209176
2660 Ga0495667_0286318
2661 Ga0495656_0482833
2662 Ga0495668_0062051
2663 Ga0495634_0005555
2664 Ga0495634_0026444
2665 Ga0495634_0082890
2666 Ga0495634_0451135
2667 Ga0495611_0305797
2668 Ga0495625_0199301
2669 Ga0495635_0036970
2670 Ga0495635_0254519
2671 Ga0495635_0259549
2672 Ga0495635_0413724
2673 Ga0495659_0207194
2674 Ga0495588_0007409
2675 Ga0495588_0282083
2676 Ga0495657_0076174
2677 Ga0495657_0286504
2678 Ga0495599_0014294
2679 Ga0495599_0436783
2680 Ga0495623_0122646
2681 Ga0495623_0416531
2682 Ga0495646_0005872
2683 Ga0495647_0001142
2684 Ga0495647_0001430
2685 Ga0495647_0007001
2686 Ga0495647_0200845
2687 Ga0495658_0006322
2688 Ga0495658_0026289
2689 Ga0495658_0299461
2690 Ga0495658_1111031
2691 Ga0495613_0031123
2692 Ga0495613_0057851
2693 Ga0495613_0142592
2694 Ga0495613_0215168
2695 Ga0495624_0222703
2696 Ga0495600_0029991
2697 Ga0495600_0134740
2698 Ga0495581_0010001
2699 Ga0495581_0202412
2700 Ga0495604_0001820
2701 Ga0495604_0150797
2702 Ga0495674_0004030
2703 Ga0495674_0008008
2704 Ga0495674_0242520
2705 Ga0495676_0041416
2706 Ga0495676_0048143
2707 Ga0495676_0051428
2708 Ga0495680_0009082
2709 Ga0495680_0053072
2710 Ga0495680_0094585
2711 Ga0495680_0395616
2712 Ga0495675_0372724
2713 Ga0495675_0622857
2714 Ga0495677_0351330
2715 Ga0495684_0051053
2716 Ga0495593_0006649
2717 Ga0495593_0031319
2718 Ga0495593_0118869
2719 Ga0495593_0436149
2720 Ga0495602_0015631
2721 Ga0495602_0302113
2722 Ga0495602_0307597
2723 Ga0495614_0210830
2724 Ga0496100_0282161
2725 Ga0496101_0078839
2726 Ga0496101_0203612
2727 Ga0496101_0323614
2728 Ga0496102_0006530
2729 Ga0496102_0171415
2730 Ga0496102_0174863
2731 Ga0496102_0469931
2732 Ga0496102_0649735
2733 Ga0496103_0401436
2734 Ga0496104_0023361
2735 Ga0496104_0727771
2736 Ga0496105_0059059
2737 Ga0496106_0001392
2738 Ga0496106_0430748
2739 Ga0496106_0982397
2740 Ga0496106_1583184
2741 Ga0496107_0151151
2742 Ga0496107_0880682
2743 Ga0496108_0049767
2744 Ga0496108_0469302
2745 Ga0496108_0908654
2746 Ga0496109_0015325
2747 Ga0496109_0127622
2748 Ga0496109_0140878
2749 Ga0496109_1118299
2750 Ga0496110_0036932
2751 Ga0496110_0238421
2752 Ga0496110_0593092
2753 Ga0496110_0606365
2754 Ga0496110_0967264
2755 Ga0496110_1900217
2756 Ga0496111_0131281
2757 Ga0496111_0157727
2758 Ga0496111_0756016
2759 Ga0496111_1111670
2760 Ga0496112_0003253
2761 Ga0496112_1264623
2762 Ga0496112_1385731
2763 Ga0496113_0028635
2764 Ga0496113_0120256
2765 Ga0496113_0409775
2766 Ga0496113_1209526
2767 Ga0496114_0103681
2768 Ga0496114_0435101
2769 Ga0496114_0806597
2770 Ga0496115_0165105
2771 Ga0496115_0795334
2772 Ga0496125_0378184
2773 Ga0501292_081580
2774 Ga0501298_034855
2775 Ga0501298_098036
2776 Ga0501299_029061
2777 Ga0501031_0213980
2778 Ga0501031_0471885
2779 Ga0501032_0393350
2780 Ga0501032_0452301
2781 Ga0501034_0037339
2782 Ga0501034_0070904
2783 Ga0501034_0483758
2784 Ga0501034_1389467
2785 Ga0501036_0162187
2786 Ga0501036_0218791
2787 Ga0501036_0308645
2788 Ga0501036_0378978
2789 Ga0501037_0205309
2790 Ga0501037_0351409
2791 Ga0501038_0047221
2792 Ga0501038_0467653
2793 Ga0501039_0009254
2794 Ga0501039_0022793
2795 Ga0501039_0089592
2796 Ga0501039_0382638
2797 Ga0501039_0659625
2798 Ga0501039_1307404
2799 Ga0501040_0041439
2800 Ga0501040_0105919
2801 Ga0501040_0238892
2802 Ga0501040_0308782
2803 Ga0501040_0623235
2804 Ga0501040_0763689
2805 Ga0501040_0983560
2806 Ga0501041_0005794
2807 Ga0501041_0085321
2808 Ga0501041_0159468
2809 Ga0501041_0216217
2810 Ga0501042_0086669
2811 Ga0501042_0277917
2812 Ga0501042_0472367
2813 Ga0501042_0813836
2814 Ga0501042_1349569
2815 Ga0501043_0034922
2816 Ga0501043_0575817
2817 Ga0501043_1181769
2818 Ga0501046_0107096
2819 Ga0501046_0264329
2820 Ga0501046_0697276
2821 Ga0501047_0007381
2822 Ga0501047_0043016
2823 Ga0501047_0054694
2824 Ga0501048_0065342
2825 Ga0501048_0562567
2826 Ga0501048_0819906
2827 Ga0501067_0028457
2828 Ga0501067_0055645
2829 Ga0501067_0112358
2830 Ga0501067_0299812
2831 Ga0501067_0397242
2832 Ga0501067_0451750
2833 Ga0501067_0617117
2834 Ga0501068_0008133
2835 Ga0501068_0419184
2836 Ga0501069_0017609
2837 Ga0501069_0247272
2838 Ga0501069_0476478
2839 Ga0501070_0004618
2840 Ga0501070_0009796
2841 Ga0501070_0251633
2842 Ga0501070_0648778
2843 Ga0501071_0001498
2844 Ga0501071_0002072
2845 Ga0501071_0011658
2846 Ga0501071_0462973
2847 Ga0501072_0027869
2848 Ga0501072_0154871
2849 Ga0501072_0215155
2850 Ga0501072_0364873
2851 Ga0501073_0002898
2852 Ga0501073_0006777
2853 Ga0501073_0053748
2854 Ga0501073_0695868
2855 Ga0501074_0017221
2856 Ga0501074_0030208
2857 Ga0501074_0255408
2858 Ga0501074_0319323
2859 Ga0501074_0664584
2860 Ga0501074_0769779
2861 Ga0501074_1183224
2862 Ga0501075_0050707
2863 Ga0501075_0158308
2864 Ga0501075_0284217
2865 Ga0501075_0357369
2866 Ga0501075_0458307
2867 Ga0501075_1093183
2868 Ga0501075_1223619
2869 Ga0501076_0048224
2870 Ga0501076_0113880
2871 Ga0501076_0219221
2872 Ga0501076_0590754
2873 Ga0501077_0087227
2874 Ga0501077_0217860
2875 Ga0501077_0238284
2876 Ga0501077_1045087
2877 Ga0501208_147853
2878 Ga0501216_165927
2879 Ga0501217_076101
2880 Ga0501217_131685
2881 Ga0501233_069758
2882 Ga0501235_077175
2883 Ga0501246_033641
2884 Ga0501079_0042166
2885 Ga0501079_0047536
2886 Ga0501079_0284662
2887 Ga0501079_0553872
2888 Ga0501079_0816768
2889 Ga0501080_0006525
2890 Ga0501080_0018146
2891 Ga0501080_0065999
2892 Ga0501080_0091743
2893 Ga0501080_0294711
2894 Ga0501080_0324807
2895 Ga0501080_0737786
2896 Ga0501081_0101725
2897 Ga0501081_0234824
2898 Ga0501081_0318727
2899 Ga0501081_0512190
2900 Ga0501081_0596987
2901 Ga0501081_0731045
2902 Ga0501083_0012201
2903 Ga0501083_0017852
2904 Ga0501083_0139059
2905 Ga0501083_0148584
2906 Ga0501083_0308607
2907 Ga0501083_0600626
2908 Ga0501270_147032
2909 Ga0501283_011611
2910 Ga0501035_0529999
2911 Ga0501035_0681280
2912 Ga0501035_0725919
2913 Ga0501044_0015376
2914 Ga0501044_0239820
2915 Ga0501045_0071244
2916 Ga0501045_0208124
2917 Ga0501045_0619428
2918 Ga0501045_0640772
2919 Ga0501045_0777151
2920 Ga0501204_019434
2921 Ga0501212_049278
2922 nmdc:mga03683_5884_c1
2923 nmdc:mga03n38_125_c1
2924 nmdc:mga00v17_565_c1
2925 nmdc:mga0yw44_170996_c1
2926 nmdc:mga0yw44_811_c1
2927 nmdc:mga06z11_1903_c1
2928 nmdc:mga04h51_3880_c1
2929 nmdc:mga05p37_1283494_c1
2930 nmdc:mga05p37_355_c1
2931 nmdc:mga05p37_7114_c1
2932 nmdc:mga05p37_952760_c1
2933 nmdc:mga09592_17223_c1
2934 nmdc:mga09592_1792_c1
2935 nmdc:mga09592_204680_c1
2936 nmdc:mga09592_21121_c1
2937 nmdc:mga09592_272438_c1
2938 nmdc:mga09592_547455_c1
2939 nmdc:mga0qj67_284205_c1
2940 nmdc:mga0qj67_336788_c1
2941 nmdc:mga0qj67_360502_c1
2942 nmdc:mga0qj67_853527_c1
2943 nmdc:mga06r32_158503_c1
2944 nmdc:mga06r32_167341_c1
2945 nmdc:mga06r32_293964_c1
2946 nmdc:mga06r32_570574_c1
2947 nmdc:mga08y16_101924_c1
2948 nmdc:mga08y16_14088_c1
2949 nmdc:mga08y16_18626_c1
2950 nmdc:mga08y16_197067_c1
2951 nmdc:mga08y16_213614_c1
2952 nmdc:mga08y16_261479_c1
2953 nmdc:mga08y16_423612_c1
2954 nmdc:mga08y16_4258_c1
2955 nmdc:mga0n895_1478842_c1
2956 nmdc:mga0n895_1843217_c1
2957 nmdc:mga0n895_36969_c1
2958 nmdc:mga0n895_470256_c1
2959 nmdc:mga0n895_5640_c1
2960 nmdc:mga0n895_802994_c1
2961 nmdc:mga0rr50_1003820_c1
2962 nmdc:mga0rr50_101580_c1
2963 nmdc:mga0rr50_133033_c1
2964 nmdc:mga0rr50_1406_c1
2965 nmdc:mga0rr50_172666_c1
2966 nmdc:mga0rr50_267644_c1
2967 nmdc:mga0rr50_541424_c1
2968 nmdc:mga0rr50_61731_c1
2969 nmdc:mga0rr50_71538_c1
2970 nmdc:mga08x19_21595_c1
2971 nmdc:mga08x19_28316_c1
2972 nmdc:mga08x19_431822_c1
2973 nmdc:mga08x19_49998_c1
2974 nmdc:mga08x19_71273_c1
2975 nmdc:mga08x19_9133_c1
2976 nmdc:mga0a205_1205520_c1
2977 nmdc:mga0a205_136217_c1
2978 nmdc:mga0a205_294_c1
2979 Ga0495601_0002136
2980 Ga0495601_0010686
2981 Ga0495612_0008626
2982 Ga0495612_0043466
2983 Ga0495612_0210857
2984 Ga0495655_0373090
2985 Ga0495595_0000270
2986 Ga0495595_0050637
2987 Ga0495595_0327898
2988 Ga0495619_0000324
2989 Ga0495619_0002457
2990 Ga0495619_0022462
2991 Ga0495619_0429373
2992 Ga0500616_0073015
2993 Ga0501084_0034148
2994 Ga0501084_0195928
2995 Ga0501084_0351460
2996 Ga0501084_0601003
2997 Ga0501084_0674879
2998 Ga0501084_0806262
2999 Ga0501084_0927880
3000 Ga0501084_1006995
3001 Ga0590077_055784
3002 Ga0501082_0058019
3003 Ga0501082_0101184
3004 Ga0501082_0126930
3005 Ga0501082_0145715
3006 Ga0501082_0363831
3007 Ga0501082_0659404
3008 Ga0501082_0871948
3009 Ga0501082_1915553
3010 Ga0530510_0079461
3011 Ga0530510_0083068
3012 Ga0530510_0754718
3013 Ga0530510_0832149
3014 Ga0530510_1412585

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12139

APS-reductase_C

Adenosine-5'-phosphosulfate reductase beta subunit

60

142

0.97

PF00037

Fer4

4Fe-4S binding domain

15

38

0.86

Map