F494444
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1507 | 478 | 3014 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300039062|Ga0400483_066041|Ga0400483_066041_11811_12311 |
| Length | 155 |
| Sequence | MPLAMPQGGNKLMPTFVYMTSCDGCGHCVDICPSDIMHIDKTYRRAYNIEPNMCWNAIDARGYADFAPMGHSVRVLREEDKGTISWRLKFRNGEEKNFVSPIRTTPWGSIKSPEEYDAPSPDDFKSQELAHEPDALNIEGGLPALTPDQLKQGVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 93 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 101 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 105 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 106 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 107 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 108 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 109 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 114 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 130 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 131 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 132 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 144 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 150 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 151 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 229 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 233 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 239 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 240 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 241 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 243 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 245 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 246 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 248 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 249 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 250 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 251 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 253 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 254 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 255 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 256 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 257 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 258 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 259 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 263 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 264 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 265 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 266 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 267 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 268 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 270 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 276 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 278 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 279 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 280 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 281 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 282 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 284 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 285 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 286 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 291 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 292 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 293 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 294 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 295 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 296 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 297 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 298 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 300 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 301 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 303 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 304 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 305 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 306 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 307 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 308 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 309 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 310 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 311 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 312 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 313 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 314 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 315 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 317 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 318 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 319 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 320 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 321 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 322 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 323 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 324 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 325 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 326 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 327 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 328 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 329 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 330 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 331 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 332 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 333 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 334 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 335 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 395 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 396 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 397 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 398 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 399 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 400 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 403 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 404 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 405 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 406 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 407 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 408 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 409 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 410 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 411 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 412 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 438 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 439 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 440 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 441 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 442 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 443 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 448 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 449 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 453 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 454 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 455 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 456 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 457 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 458 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 459 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 460 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 475 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 477 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.47 |
| Metatranscriptomes | 0.53 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.13 |
| Nodule | 0 |
| Rhizoplane | 3.25 |
| Rhizosphere | 95.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0400483_066041 | 3300039062 | Bacteria | 12570 |
| 2 | ARcpr5oldR_c008724 | 3300000041 | Bacteria | 859 |
| 3 | ARSoilOldRDRAFT_c007538 | 3300000044 | Bacteria | 906 |
| 4 | ARCol0yngRDRAFT_1004242 | 3300000652 | Bacteria | 1041 |
| 5 | JGI24752J21851_1025306 | 3300001976 | Bacteria | 779 |
| 6 | JGI24737J22298_10095247 | 3300001990 | Bacteria | 882 |
| 7 | JGI24742J22300_10022069 | 3300002244 | Bacteria | 1090 |
| 8 | JGI25406J46586_10038211 | 3300003203 | Bacteria | 1723 |
| 9 | JGI25406J46586_10210527 | 3300003203 | Unclassified | 568 |
| 10 | JGI25405J52794_10008962 | 3300003911 | Bacteria | 1880 |
| 11 | Ga0065712_10005527 | 3300005290 | Bacteria | 4955 |
| 12 | Ga0065712_10108843 | 3300005290 | Bacteria | 1853 |
| 13 | Ga0065715_10620808 | 3300005293 | Bacteria | 695 |
| 14 | Ga0065707_10002365 | 3300005295 | Bacteria | 9369 |
| 15 | Ga0065707_10088467 | 3300005295 | Bacteria | 4651 |
| 16 | Ga0065707_10099260 | 3300005295 | Bacteria | 3020 |
| 17 | Ga0065707_10636557 | 3300005295 | Bacteria | 670 |
| 18 | Ga0070658_10102291 | 3300005327 | Bacteria | 2369 |
| 19 | Ga0070658_10242319 | 3300005327 | Bacteria | 1528 |
| 20 | Ga0070676_10061777 | 3300005328 | Bacteria | 2227 |
| 21 | Ga0070676_10068148 | 3300005328 | Bacteria | 2130 |
| 22 | Ga0070676_10097603 | 3300005328 | Bacteria | 1810 |
| 23 | Ga0070676_10219955 | 3300005328 | Bacteria | 1254 |
| 24 | Ga0070683_100074710 | 3300005329 | Bacteria | 3166 |
| 25 | Ga0070683_100091214 | 3300005329 | Bacteria | 2861 |
| 26 | Ga0070690_100000203 | 3300005330 | Bacteria | 31114 |
| 27 | Ga0070690_100115816 | 3300005330 | Bacteria | 1794 |
| 28 | Ga0070690_100937605 | 3300005330 | Bacteria | 679 |
| 29 | Ga0070670_100024117 | 3300005331 | Bacteria | 5233 |
| 30 | Ga0070670_100025997 | 3300005331 | Bacteria | 5038 |
| 31 | Ga0070670_100244519 | 3300005331 | Bacteria | 1562 |
| 32 | Ga0070670_100586894 | 3300005331 | Bacteria | 996 |
| 33 | Ga0070677_10003307 | 3300005333 | Bacteria | 5189 |
| 34 | Ga0070677_10183258 | 3300005333 | Bacteria | 999 |
| 35 | Ga0068869_100001312 | 3300005334 | Bacteria | 14728 |
| 36 | Ga0068869_100013668 | 3300005334 | Bacteria | 5407 |
| 37 | Ga0068869_100599159 | 3300005334 | Bacteria | 930 |
| 38 | Ga0068869_100898034 | 3300005334 | Bacteria | 767 |
| 39 | Ga0068869_101027895 | 3300005334 | Bacteria | 718 |
| 40 | Ga0068869_101082364 | 3300005334 | Bacteria | 701 |
| 41 | Ga0070666_10065140 | 3300005335 | Bacteria | 2472 |
| 42 | Ga0070666_10235412 | 3300005335 | Bacteria | 1294 |
| 43 | Ga0070666_10743376 | 3300005335 | Bacteria | 721 |
| 44 | Ga0070666_10815464 | 3300005335 | Bacteria | 688 |
| 45 | Ga0070680_100003010 | 3300005336 | Bacteria | 12517 |
| 46 | Ga0070680_100050080 | 3300005336 | Bacteria | 3406 |
| 47 | Ga0070680_100368816 | 3300005336 | Bacteria | 1221 |
| 48 | Ga0070682_100003169 | 3300005337 | Bacteria | 9110 |
| 49 | Ga0070682_100021852 | 3300005337 | Bacteria | 3782 |
| 50 | Ga0070682_100352302 | 3300005337 | Bacteria | 1098 |
| 51 | Ga0070682_100948056 | 3300005337 | Bacteria | 711 |
| 52 | Ga0068868_100206121 | 3300005338 | Bacteria | 1641 |
| 53 | Ga0068868_100669108 | 3300005338 | Bacteria | 926 |
| 54 | Ga0070660_100013058 | 3300005339 | Bacteria | 5946 |
| 55 | Ga0070660_100069127 | 3300005339 | Bacteria | 2753 |
| 56 | Ga0070660_100245986 | 3300005339 | Bacteria | 1457 |
| 57 | Ga0070660_100725806 | 3300005339 | Bacteria | 834 |
| 58 | Ga0070689_100005620 | 3300005340 | Bacteria | 8583 |
| 59 | Ga0070689_100008280 | 3300005340 | Bacteria | 7316 |
| 60 | Ga0070689_100049288 | 3300005340 | Bacteria | 3251 |
| 61 | Ga0070689_100209773 | 3300005340 | Bacteria | 1594 |
| 62 | Ga0070689_100267632 | 3300005340 | Bacteria | 1414 |
| 63 | Ga0070689_100395251 | 3300005340 | Bacteria | 1167 |
| 64 | Ga0070689_100868643 | 3300005340 | Bacteria | 796 |
| 65 | Ga0070691_10000424 | 3300005341 | Bacteria | 15512 |
| 66 | Ga0070687_100000070 | 3300005343 | Bacteria | 33041 |
| 67 | Ga0070687_100026386 | 3300005343 | Bacteria | 2797 |
| 68 | Ga0070687_100125820 | 3300005343 | Bacteria | 1473 |
| 69 | Ga0070687_100126903 | 3300005343 | Bacteria | 1468 |
| 70 | Ga0070687_100599323 | 3300005343 | Bacteria | 757 |
| 71 | Ga0070687_100835024 | 3300005343 | Bacteria | 656 |
| 72 | Ga0070661_100001889 | 3300005344 | Bacteria | 14506 |
| 73 | Ga0070661_100070625 | 3300005344 | Bacteria | 2568 |
| 74 | Ga0070661_100285902 | 3300005344 | Bacteria | 1280 |
| 75 | Ga0070661_100491845 | 3300005344 | Bacteria | 981 |
| 76 | Ga0070692_10003621 | 3300005345 | Bacteria | 6306 |
| 77 | Ga0070692_10141185 | 3300005345 | Bacteria | 1363 |
| 78 | Ga0070668_100017254 | 3300005347 | Bacteria | 5405 |
| 79 | Ga0070668_100155309 | 3300005347 | Bacteria | 1853 |
| 80 | Ga0070668_100318058 | 3300005347 | Bacteria | 1309 |
| 81 | Ga0070668_100463440 | 3300005347 | Bacteria | 1091 |
| 82 | Ga0070668_101144151 | 3300005347 | Bacteria | 704 |
| 83 | Ga0070669_100001468 | 3300005353 | Bacteria | 17062 |
| 84 | Ga0070669_100159340 | 3300005353 | Bacteria | 1752 |
| 85 | Ga0070669_100176116 | 3300005353 | Bacteria | 1670 |
| 86 | Ga0070669_100403643 | 3300005353 | Bacteria | 1119 |
| 87 | Ga0070669_100533857 | 3300005353 | Bacteria | 976 |
| 88 | Ga0070669_100574985 | 3300005353 | Bacteria | 942 |
| 89 | Ga0070675_100009053 | 3300005354 | Bacteria | 7735 |
| 90 | Ga0070675_100361041 | 3300005354 | Bacteria | 1290 |
| 91 | Ga0070675_100975905 | 3300005354 | Bacteria | 778 |
| 92 | Ga0070675_100993373 | 3300005354 | Bacteria | 770 |
| 93 | Ga0070675_101247644 | 3300005354 | Bacteria | 684 |
| 94 | Ga0070671_100003908 | 3300005355 | Bacteria | 11719 |
| 95 | Ga0070671_100085878 | 3300005355 | Bacteria | 2632 |
| 96 | Ga0070671_100281100 | 3300005355 | Bacteria | 1415 |
| 97 | Ga0070671_100503709 | 3300005355 | Bacteria | 1042 |
| 98 | Ga0070671_100666350 | 3300005355 | Bacteria | 901 |
| 99 | Ga0070671_101703464 | 3300005355 | Bacteria | 559 |
| 100 | Ga0070674_100002697 | 3300005356 | Bacteria | 9817 |
| 101 | Ga0070674_100014002 | 3300005356 | Bacteria | 4976 |
| 102 | Ga0070674_100037392 | 3300005356 | Bacteria | 3265 |
| 103 | Ga0070674_100078744 | 3300005356 | Bacteria | 2349 |
| 104 | Ga0070673_100015782 | 3300005364 | Bacteria | 5318 |
| 105 | Ga0070673_100034438 | 3300005364 | Bacteria | 3833 |
| 106 | Ga0070673_100096978 | 3300005364 | Bacteria | 2420 |
| 107 | Ga0070673_100114289 | 3300005364 | Bacteria | 2243 |
| 108 | Ga0070673_100690315 | 3300005364 | Bacteria | 937 |
| 109 | Ga0070688_100499687 | 3300005365 | Bacteria | 917 |
| 110 | Ga0070688_100557793 | 3300005365 | Bacteria | 872 |
| 111 | Ga0070688_100865594 | 3300005365 | Bacteria | 711 |
| 112 | Ga0070659_100051777 | 3300005366 | Bacteria | 3229 |
| 113 | Ga0070659_100081052 | 3300005366 | Bacteria | 2592 |
| 114 | Ga0070659_100381688 | 3300005366 | Bacteria | 1187 |
| 115 | Ga0070667_100007696 | 3300005367 | Bacteria | 8933 |
| 116 | Ga0070667_100061678 | 3300005367 | Bacteria | 3175 |
| 117 | Ga0070667_100070247 | 3300005367 | Bacteria | 2980 |
| 118 | Ga0070667_100141487 | 3300005367 | Bacteria | 2107 |
| 119 | Ga0070703_10099978 | 3300005406 | Bacteria | 1021 |
| 120 | Ga0070709_10058148 | 3300005434 | Bacteria | 2451 |
| 121 | Ga0070709_10145483 | 3300005434 | Bacteria | 1633 |
| 122 | Ga0070709_10153545 | 3300005434 | Bacteria | 1594 |
| 123 | Ga0070709_10178377 | 3300005434 | Bacteria | 1490 |
| 124 | Ga0070709_10379426 | 3300005434 | Bacteria | 1051 |
| 125 | Ga0070714_100005848 | 3300005435 | Bacteria | 9438 |
| 126 | Ga0070714_100027567 | 3300005435 | Bacteria | 4705 |
| 127 | Ga0070714_100045447 | 3300005435 | Bacteria | 3722 |
| 128 | Ga0070714_100057298 | 3300005435 | Bacteria | 3335 |
| 129 | Ga0070714_100166403 | 3300005435 | Bacteria | 1998 |
| 130 | Ga0070714_100204124 | 3300005435 | Bacteria | 1809 |
| 131 | Ga0070714_100233930 | 3300005435 | Bacteria | 1694 |
| 132 | Ga0070714_100267051 | 3300005435 | Bacteria | 1586 |
| 133 | Ga0070714_100406768 | 3300005435 | Bacteria | 1287 |
| 134 | Ga0070713_100002660 | 3300005436 | Bacteria | 11645 |
| 135 | Ga0070713_100051664 | 3300005436 | Bacteria | 3400 |
| 136 | Ga0070713_100086927 | 3300005436 | Bacteria | 2681 |
| 137 | Ga0070710_10001294 | 3300005437 | Bacteria | 11857 |
| 138 | Ga0070710_10002482 | 3300005437 | Bacteria | 8739 |
| 139 | Ga0070710_10016968 | 3300005437 | Bacteria | 3717 |
| 140 | Ga0070710_10185300 | 3300005437 | Bacteria | 1306 |
| 141 | Ga0070710_10273357 | 3300005437 | Bacteria | 1094 |
| 142 | Ga0070701_10000661 | 3300005438 | Bacteria | 12109 |
| 143 | Ga0070701_10012854 | 3300005438 | Bacteria | 3789 |
| 144 | Ga0070701_10103345 | 3300005438 | Bacteria | 1582 |
| 145 | Ga0070711_100001151 | 3300005439 | Bacteria | 14210 |
| 146 | Ga0070711_100110979 | 3300005439 | Bacteria | 2013 |
| 147 | Ga0070711_100122578 | 3300005439 | Bacteria | 1925 |
| 148 | Ga0070711_100555706 | 3300005439 | Bacteria | 953 |
| 149 | Ga0070711_100556001 | 3300005439 | Bacteria | 953 |
| 150 | Ga0070705_100001132 | 3300005440 | Bacteria | 14728 |
| 151 | Ga0070705_100124126 | 3300005440 | Bacteria | 1672 |
| 152 | Ga0070705_100183316 | 3300005440 | Bacteria | 1420 |
| 153 | Ga0070700_100000651 | 3300005441 | Bacteria | 17154 |
| 154 | Ga0070700_100025003 | 3300005441 | Bacteria | 3513 |
| 155 | Ga0070700_100173283 | 3300005441 | Bacteria | 1496 |
| 156 | Ga0070694_100000669 | 3300005444 | Bacteria | 18977 |
| 157 | Ga0070694_100010076 | 3300005444 | Bacteria | 5812 |
| 158 | Ga0070694_100078205 | 3300005444 | Bacteria | 2294 |
| 159 | Ga0070708_100164107 | 3300005445 | Bacteria | 2071 |
| 160 | Ga0070708_100867733 | 3300005445 | Bacteria | 848 |
| 161 | Ga0070663_100006342 | 3300005455 | Bacteria | 7102 |
| 162 | Ga0070663_100018980 | 3300005455 | Bacteria | 4521 |
| 163 | Ga0070663_101815155 | 3300005455 | Bacteria | 547 |
| 164 | Ga0070678_100153793 | 3300005456 | Bacteria | 1856 |
| 165 | Ga0070678_100402533 | 3300005456 | Bacteria | 1189 |
| 166 | Ga0070662_100000213 | 3300005457 | Bacteria | 33995 |
| 167 | Ga0070662_100128084 | 3300005457 | Bacteria | 1954 |
| 168 | Ga0070662_100277789 | 3300005457 | Bacteria | 1355 |
| 169 | Ga0070662_100569245 | 3300005457 | Bacteria | 951 |
| 170 | Ga0070662_101019226 | 3300005457 | Bacteria | 709 |
| 171 | Ga0070662_101273185 | 3300005457 | Bacteria | 633 |
| 172 | Ga0070662_101372709 | 3300005457 | Bacteria | 609 |
| 173 | Ga0070662_101955176 | 3300005457 | Bacteria | 507 |
| 174 | Ga0070681_10146333 | 3300005458 | Bacteria | 2292 |
| 175 | Ga0070681_10174957 | 3300005458 | Bacteria | 2068 |
| 176 | Ga0070681_10211627 | 3300005458 | Bacteria | 1855 |
| 177 | Ga0070681_10232896 | 3300005458 | Bacteria | 1756 |
| 178 | Ga0068867_100002241 | 3300005459 | Bacteria | 13590 |
| 179 | Ga0068867_100026348 | 3300005459 | Bacteria | 4174 |
| 180 | Ga0068867_100070809 | 3300005459 | Bacteria | 2607 |
| 181 | Ga0068867_100209452 | 3300005459 | Bacteria | 1565 |
| 182 | Ga0068867_101136359 | 3300005459 | Bacteria | 715 |
| 183 | Ga0070685_10008574 | 3300005466 | Bacteria | 5262 |
| 184 | Ga0070685_10014591 | 3300005466 | Bacteria | 4163 |
| 185 | Ga0070706_100520352 | 3300005467 | Bacteria | 1107 |
| 186 | Ga0070698_100360875 | 3300005471 | Bacteria | 1385 |
| 187 | Ga0070698_100478213 | 3300005471 | Bacteria | 1182 |
| 188 | Ga0070698_100742365 | 3300005471 | Bacteria | 924 |
| 189 | Ga0070699_100013067 | 3300005518 | Bacteria | 7155 |
| 190 | Ga0070699_100176113 | 3300005518 | Bacteria | 1897 |
| 191 | Ga0070699_100855114 | 3300005518 | Bacteria | 833 |
| 192 | Ga0070679_100007583 | 3300005530 | Bacteria | 10151 |
| 193 | Ga0070679_100093990 | 3300005530 | Bacteria | 2986 |
| 194 | Ga0070679_100158919 | 3300005530 | Bacteria | 2234 |
| 195 | Ga0070679_100282888 | 3300005530 | Bacteria | 1611 |
| 196 | Ga0070679_100343952 | 3300005530 | Bacteria | 1440 |
| 197 | Ga0070679_100474284 | 3300005530 | Bacteria | 1195 |
| 198 | Ga0070684_100044288 | 3300005535 | Bacteria | 3849 |
| 199 | Ga0070684_100366942 | 3300005535 | Bacteria | 1325 |
| 200 | Ga0070697_100022929 | 3300005536 | Bacteria | 4964 |
| 201 | Ga0068853_100006369 | 3300005539 | Bacteria | 9373 |
| 202 | Ga0068853_100106579 | 3300005539 | Bacteria | 2484 |
| 203 | Ga0068853_100235539 | 3300005539 | Bacteria | 1676 |
| 204 | Ga0068853_100576458 | 3300005539 | Bacteria | 1067 |
| 205 | Ga0068853_101593276 | 3300005539 | Bacteria | 633 |
| 206 | Ga0070672_100000549 | 3300005543 | Bacteria | 22048 |
| 207 | Ga0070672_100001925 | 3300005543 | Bacteria | 13029 |
| 208 | Ga0070672_100008206 | 3300005543 | Bacteria | 7136 |
| 209 | Ga0070672_100188651 | 3300005543 | Bacteria | 1720 |
| 210 | Ga0070672_100471141 | 3300005543 | Bacteria | 1084 |
| 211 | Ga0070686_100002595 | 3300005544 | Bacteria | 9973 |
| 212 | Ga0070686_100006070 | 3300005544 | Bacteria | 6702 |
| 213 | Ga0070686_100042460 | 3300005544 | Bacteria | 2848 |
| 214 | Ga0070686_100587846 | 3300005544 | Bacteria | 876 |
| 215 | Ga0070695_100000808 | 3300005545 | Bacteria | 16831 |
| 216 | Ga0070695_100137634 | 3300005545 | Bacteria | 1689 |
| 217 | Ga0070696_100000441 | 3300005546 | Bacteria | 25931 |
| 218 | Ga0070696_100257650 | 3300005546 | Bacteria | 1321 |
| 219 | Ga0070696_100291239 | 3300005546 | Bacteria | 1247 |
| 220 | Ga0070696_100378515 | 3300005546 | Bacteria | 1103 |
| 221 | Ga0070696_100534371 | 3300005546 | Bacteria | 937 |
| 222 | Ga0070693_100000574 | 3300005547 | Bacteria | 16325 |
| 223 | Ga0070693_100091125 | 3300005547 | Bacteria | 1838 |
| 224 | Ga0070693_100920014 | 3300005547 | Bacteria | 657 |
| 225 | Ga0070665_100108756 | 3300005548 | Bacteria | 2775 |
| 226 | Ga0070665_100226571 | 3300005548 | Bacteria | 1869 |
| 227 | Ga0070665_100302154 | 3300005548 | Bacteria | 1603 |
| 228 | Ga0070665_101486067 | 3300005548 | Bacteria | 686 |
| 229 | Ga0070704_100000617 | 3300005549 | Bacteria | 17151 |
| 230 | Ga0070704_100054392 | 3300005549 | Bacteria | 2832 |
| 231 | Ga0070704_100095571 | 3300005549 | Bacteria | 2226 |
| 232 | Ga0070704_100188068 | 3300005549 | Bacteria | 1657 |
| 233 | Ga0070704_100238680 | 3300005549 | Bacteria | 1486 |
| 234 | Ga0070704_100423248 | 3300005549 | Bacteria | 1141 |
| 235 | Ga0068855_100000606 | 3300005563 | Bacteria | 43933 |
| 236 | Ga0068855_100010150 | 3300005563 | Bacteria | 11350 |
| 237 | Ga0068855_100013117 | 3300005563 | Bacteria | 9994 |
| 238 | Ga0068855_100283202 | 3300005563 | Bacteria | 1840 |
| 239 | Ga0068855_100365630 | 3300005563 | Bacteria | 1587 |
| 240 | Ga0070664_100001419 | 3300005564 | Bacteria | 19108 |
| 241 | Ga0070664_100026130 | 3300005564 | Bacteria | 4841 |
| 242 | Ga0070664_100105074 | 3300005564 | Bacteria | 2459 |
| 243 | Ga0070664_100166809 | 3300005564 | Bacteria | 1951 |
| 244 | Ga0070664_101184549 | 3300005564 | Bacteria | 720 |
| 245 | Ga0068857_100009173 | 3300005577 | Bacteria | 8588 |
| 246 | Ga0068857_100201424 | 3300005577 | Bacteria | 1815 |
| 247 | Ga0068857_100426228 | 3300005577 | Bacteria | 1237 |
| 248 | Ga0068857_101285587 | 3300005577 | Bacteria | 710 |
| 249 | Ga0068857_101775231 | 3300005577 | Bacteria | 604 |
| 250 | Ga0068854_100002203 | 3300005578 | Bacteria | 11988 |
| 251 | Ga0068854_100006160 | 3300005578 | Bacteria | 7614 |
| 252 | Ga0068856_100001525 | 3300005614 | Bacteria | 24270 |
| 253 | Ga0068856_100008271 | 3300005614 | Bacteria | 10142 |
| 254 | Ga0068856_100051047 | 3300005614 | Bacteria | 4078 |
| 255 | Ga0068856_100074478 | 3300005614 | Bacteria | 3361 |
| 256 | Ga0068856_100198323 | 3300005614 | Bacteria | 2022 |
| 257 | Ga0068856_100209412 | 3300005614 | Bacteria | 1965 |
| 258 | Ga0070702_100000349 | 3300005615 | Bacteria | 16123 |
| 259 | Ga0070702_100098605 | 3300005615 | Bacteria | 1788 |
| 260 | Ga0068852_100002715 | 3300005616 | Bacteria | 12233 |
| 261 | Ga0068852_100261512 | 3300005616 | Bacteria | 1662 |
| 262 | Ga0068852_100318145 | 3300005616 | Bacteria | 1510 |
| 263 | Ga0068852_100411322 | 3300005616 | Bacteria | 1332 |
| 264 | Ga0068859_100000445 | 3300005617 | Bacteria | 41359 |
| 265 | Ga0068859_100350188 | 3300005617 | Bacteria | 1572 |
| 266 | Ga0068864_100032507 | 3300005618 | Bacteria | 4433 |
| 267 | Ga0068864_100129378 | 3300005618 | Bacteria | 2266 |
| 268 | Ga0068864_100481280 | 3300005618 | Bacteria | 1191 |
| 269 | Ga0068864_100509716 | 3300005618 | Bacteria | 1158 |
| 270 | Ga0068864_100621995 | 3300005618 | Bacteria | 1049 |
| 271 | Ga0068866_10000640 | 3300005718 | Bacteria | 15843 |
| 272 | Ga0068866_10028466 | 3300005718 | Bacteria | 2663 |
| 273 | Ga0068866_10060889 | 3300005718 | Bacteria | 1958 |
| 274 | Ga0068866_10382455 | 3300005718 | Bacteria | 903 |
| 275 | Ga0068861_100000246 | 3300005719 | Bacteria | 29867 |
| 276 | Ga0068861_100171684 | 3300005719 | Bacteria | 1798 |
| 277 | Ga0068861_100207144 | 3300005719 | Bacteria | 1650 |
| 278 | Ga0068861_100231409 | 3300005719 | Bacteria | 1568 |
| 279 | Ga0068861_100307477 | 3300005719 | Bacteria | 1376 |
| 280 | Ga0068861_100368245 | 3300005719 | Bacteria | 1266 |
| 281 | Ga0068851_10031275 | 3300005834 | Bacteria | 2643 |
| 282 | Ga0068870_10082065 | 3300005840 | Bacteria | 1784 |
| 283 | Ga0068863_100110791 | 3300005841 | Bacteria | 2614 |
| 284 | Ga0068863_100504604 | 3300005841 | Bacteria | 1191 |
| 285 | Ga0068863_100590437 | 3300005841 | Bacteria | 1099 |
| 286 | Ga0068863_100767672 | 3300005841 | Bacteria | 960 |
| 287 | Ga0068863_101716005 | 3300005841 | Bacteria | 638 |
| 288 | Ga0068858_100005536 | 3300005842 | Bacteria | 12365 |
| 289 | Ga0068858_100095652 | 3300005842 | Bacteria | 2768 |
| 290 | Ga0068858_100100838 | 3300005842 | Bacteria | 2693 |
| 291 | Ga0068858_100197202 | 3300005842 | Bacteria | 1903 |
| 292 | Ga0068858_100780719 | 3300005842 | Bacteria | 932 |
| 293 | Ga0068860_100016800 | 3300005843 | Bacteria | 7134 |
| 294 | Ga0068860_100020458 | 3300005843 | Bacteria | 6410 |
| 295 | Ga0068860_100029056 | 3300005843 | Bacteria | 5318 |
| 296 | Ga0068860_100206580 | 3300005843 | Bacteria | 1905 |
| 297 | Ga0068860_101147188 | 3300005843 | Bacteria | 797 |
| 298 | Ga0068862_100000668 | 3300005844 | Bacteria | 35204 |
| 299 | Ga0068862_100064503 | 3300005844 | Bacteria | 3153 |
| 300 | Ga0068862_100174409 | 3300005844 | Bacteria | 1926 |
| 301 | Ga0068862_101148160 | 3300005844 | Bacteria | 773 |
| 302 | Ga0068862_101544973 | 3300005844 | Bacteria | 670 |
| 303 | Ga0081455_10022859 | 3300005937 | Bacteria | 5831 |
| 304 | Ga0081455_10034387 | 3300005937 | Bacteria | 4541 |
| 305 | Ga0081455_10878260 | 3300005937 | Bacteria | 559 |
| 306 | Ga0081538_10023230 | 3300005981 | Bacteria | 4464 |
| 307 | Ga0081538_10057385 | 3300005981 | Bacteria | 2269 |
| 308 | Ga0081540_1014625 | 3300005983 | Bacteria | 5016 |
| 309 | Ga0081539_10000668 | 3300005985 | Bacteria | 68754 |
| 310 | Ga0081539_10010842 | 3300005985 | Bacteria | 7323 |
| 311 | Ga0081539_10062170 | 3300005985 | Bacteria | 2042 |
| 312 | Ga0070717_10004842 | 3300006028 | Bacteria | 9791 |
| 313 | Ga0070717_10120445 | 3300006028 | Bacteria | 2247 |
| 314 | Ga0070717_10531282 | 3300006028 | Bacteria | 1064 |
| 315 | Ga0075365_10000927 | 3300006038 | Bacteria | 12378 |
| 316 | Ga0075365_10299154 | 3300006038 | Bacteria | 1132 |
| 317 | Ga0075368_10001598 | 3300006042 | Bacteria | 7279 |
| 318 | Ga0075363_100003287 | 3300006048 | Bacteria | 6844 |
| 319 | Ga0075364_10000041 | 3300006051 | Bacteria | 45457 |
| 320 | Ga0075364_10011581 | 3300006051 | Bacteria | 5360 |
| 321 | Ga0075432_10107619 | 3300006058 | Bacteria | 1036 |
| 322 | Ga0070715_10000182 | 3300006163 | Bacteria | 14731 |
| 323 | Ga0070715_10000437 | 3300006163 | Bacteria | 10688 |
| 324 | Ga0070716_100003522 | 3300006173 | Bacteria | 7379 |
| 325 | Ga0070716_100080005 | 3300006173 | Bacteria | 1947 |
| 326 | Ga0070712_100002706 | 3300006175 | Bacteria | 10946 |
| 327 | Ga0070712_100007781 | 3300006175 | Bacteria | 6706 |
| 328 | Ga0075362_10008189 | 3300006177 | Bacteria | 3989 |
| 329 | Ga0075367_10005610 | 3300006178 | Bacteria | 6255 |
| 330 | Ga0097621_100001417 | 3300006237 | Bacteria | 16484 |
| 331 | Ga0097621_100020377 | 3300006237 | Bacteria | 5108 |
| 332 | Ga0097621_100022117 | 3300006237 | Bacteria | 4932 |
| 333 | Ga0097621_100083136 | 3300006237 | Bacteria | 2667 |
| 334 | Ga0097621_100097077 | 3300006237 | Bacteria | 2473 |
| 335 | Ga0097621_101080174 | 3300006237 | Bacteria | 753 |
| 336 | Ga0068871_100001297 | 3300006358 | Bacteria | 16703 |
| 337 | Ga0068871_100007981 | 3300006358 | Bacteria | 7594 |
| 338 | Ga0068871_100008656 | 3300006358 | Bacteria | 7319 |
| 339 | Ga0068871_100042675 | 3300006358 | Bacteria | 3642 |
| 340 | Ga0068871_100073999 | 3300006358 | Bacteria | 2809 |
| 341 | Ga0075428_100052937 | 3300006844 | Bacteria | 4448 |
| 342 | Ga0075428_100282077 | 3300006844 | Bacteria | 1787 |
| 343 | Ga0075428_100385998 | 3300006844 | Bacteria | 1501 |
| 344 | Ga0075428_100651616 | 3300006844 | Bacteria | 1123 |
| 345 | Ga0075430_100002128 | 3300006846 | Bacteria | 16396 |
| 346 | Ga0075430_100455550 | 3300006846 | Bacteria | 1056 |
| 347 | Ga0075430_100867491 | 3300006846 | Bacteria | 744 |
| 348 | Ga0075431_100214374 | 3300006847 | Bacteria | 1966 |
| 349 | Ga0075431_100248531 | 3300006847 | Bacteria | 1808 |
| 350 | Ga0075431_100366561 | 3300006847 | Bacteria | 1446 |
| 351 | Ga0075431_100621348 | 3300006847 | Bacteria | 1063 |
| 352 | Ga0075433_10005804 | 3300006852 | Bacteria | 9719 |
| 353 | Ga0075433_10370533 | 3300006852 | Bacteria | 1265 |
| 354 | Ga0075433_10494810 | 3300006852 | Bacteria | 1076 |
| 355 | Ga0075433_10708434 | 3300006852 | Bacteria | 881 |
| 356 | Ga0075434_100000078 | 3300006871 | Bacteria | 52232 |
| 357 | Ga0075434_100005507 | 3300006871 | Bacteria | 11531 |
| 358 | Ga0075434_100251027 | 3300006871 | Bacteria | 1788 |
| 359 | Ga0075434_100398224 | 3300006871 | Bacteria | 1398 |
| 360 | Ga0075434_100529973 | 3300006871 | Bacteria | 1198 |
| 361 | Ga0075434_100770625 | 3300006871 | Bacteria | 979 |
| 362 | Ga0075434_101059080 | 3300006871 | Bacteria | 825 |
| 363 | Ga0075434_101078082 | 3300006871 | Bacteria | 817 |
| 364 | Ga0075429_100016021 | 3300006880 | Bacteria | 6493 |
| 365 | Ga0068865_100001575 | 3300006881 | Bacteria | 13328 |
| 366 | Ga0068865_100027289 | 3300006881 | Bacteria | 3770 |
| 367 | Ga0068865_101009682 | 3300006881 | Bacteria | 729 |
| 368 | Ga0075436_100021839 | 3300006914 | Bacteria | 4394 |
| 369 | Ga0075436_100034523 | 3300006914 | Bacteria | 3488 |
| 370 | Ga0075436_100048582 | 3300006914 | Bacteria | 2927 |
| 371 | Ga0075436_100108509 | 3300006914 | Bacteria | 1936 |
| 372 | Ga0075436_101243502 | 3300006914 | Bacteria | 563 |
| 373 | Ga0097620_100000445 | 3300006931 | Bacteria | 41359 |
| 374 | Ga0097620_100350212 | 3300006931 | Bacteria | 1572 |
| 375 | Ga0075435_100010161 | 3300007076 | Bacteria | 6874 |
| 376 | Ga0075435_100014627 | 3300007076 | Bacteria | 5875 |
| 377 | Ga0075435_100034163 | 3300007076 | Bacteria | 4026 |
| 378 | Ga0075435_100063542 | 3300007076 | Bacteria | 2998 |
| 379 | Ga0075435_100091182 | 3300007076 | Bacteria | 2515 |
| 380 | Ga0075435_100173042 | 3300007076 | Bacteria | 1822 |
| 381 | Ga0075435_100197770 | 3300007076 | Bacteria | 1703 |
| 382 | Ga0075435_100550978 | 3300007076 | Bacteria | 999 |
| 383 | Ga0075435_100669088 | 3300007076 | Bacteria | 902 |
| 384 | Ga0105251_10116809 | 3300009011 | Bacteria | 1213 |
| 385 | Ga0105240_10008246 | 3300009093 | Bacteria | 14923 |
| 386 | Ga0105240_10127951 | 3300009093 | Bacteria | 3049 |
| 387 | Ga0105240_10205645 | 3300009093 | Bacteria | 2304 |
| 388 | Ga0105240_10734918 | 3300009093 | Bacteria | 1074 |
| 389 | Ga0105240_11685905 | 3300009093 | Bacteria | 662 |
| 390 | Ga0111539_10013658 | 3300009094 | Bacteria | 10144 |
| 391 | Ga0111539_10026456 | 3300009094 | Bacteria | 7092 |
| 392 | Ga0111539_10109700 | 3300009094 | Bacteria | 3238 |
| 393 | Ga0111539_10119315 | 3300009094 | Bacteria | 3091 |
| 394 | Ga0111539_10243656 | 3300009094 | Bacteria | 2093 |
| 395 | Ga0111539_10341626 | 3300009094 | Bacteria | 1742 |
| 396 | Ga0111539_10413601 | 3300009094 | Bacteria | 1571 |
| 397 | Ga0111539_10417775 | 3300009094 | Bacteria | 1562 |
| 398 | Ga0111539_10737902 | 3300009094 | Bacteria | 1146 |
| 399 | Ga0105245_10003710 | 3300009098 | Bacteria | 13618 |
| 400 | Ga0105245_10164719 | 3300009098 | Bacteria | 2106 |
| 401 | Ga0105245_10302682 | 3300009098 | Bacteria | 1569 |
| 402 | Ga0105245_11380977 | 3300009098 | Bacteria | 754 |
| 403 | Ga0105245_11441723 | 3300009098 | Bacteria | 739 |
| 404 | Ga0105247_10021649 | 3300009101 | Bacteria | 3869 |
| 405 | Ga0105247_11001745 | 3300009101 | Bacteria | 652 |
| 406 | Ga0105247_11147045 | 3300009101 | Bacteria | 616 |
| 407 | Ga0114129_10009272 | 3300009147 | Bacteria | 14034 |
| 408 | Ga0114129_10107675 | 3300009147 | Bacteria | 3849 |
| 409 | Ga0114129_10207604 | 3300009147 | Bacteria | 2650 |
| 410 | Ga0114129_10268489 | 3300009147 | Bacteria | 2283 |
| 411 | Ga0105243_10001954 | 3300009148 | Bacteria | 17554 |
| 412 | Ga0105243_10074020 | 3300009148 | Bacteria | 2762 |
| 413 | Ga0105243_10136991 | 3300009148 | Bacteria | 2084 |
| 414 | Ga0105243_10309300 | 3300009148 | Bacteria | 1435 |
| 415 | Ga0105243_10510528 | 3300009148 | Bacteria | 1141 |
| 416 | Ga0105243_10586419 | 3300009148 | Bacteria | 1071 |
| 417 | Ga0105243_12742008 | 3300009148 | Bacteria | 533 |
| 418 | Ga0105241_10012048 | 3300009174 | Bacteria | 6352 |
| 419 | Ga0105241_10026716 | 3300009174 | Bacteria | 4296 |
| 420 | Ga0105241_10038739 | 3300009174 | Bacteria | 3594 |
| 421 | Ga0105241_10226728 | 3300009174 | Bacteria | 1573 |
| 422 | Ga0105242_10002505 | 3300009176 | Bacteria | 14406 |
| 423 | Ga0105242_10029479 | 3300009176 | Bacteria | 4378 |
| 424 | Ga0105242_10053049 | 3300009176 | Bacteria | 3310 |
| 425 | Ga0105242_10064199 | 3300009176 | Bacteria | 3026 |
| 426 | Ga0105242_10602692 | 3300009176 | Bacteria | 1061 |
| 427 | Ga0105242_10707290 | 3300009176 | Bacteria | 987 |
| 428 | Ga0105242_11202355 | 3300009176 | Bacteria | 777 |
| 429 | Ga0105242_11252819 | 3300009176 | Bacteria | 763 |
| 430 | Ga0105242_12318532 | 3300009176 | Bacteria | 583 |
| 431 | Ga0105248_10017431 | 3300009177 | Bacteria | 7919 |
| 432 | Ga0105248_10029612 | 3300009177 | Bacteria | 6108 |
| 433 | Ga0105248_10047993 | 3300009177 | Bacteria | 4789 |
| 434 | Ga0105248_10173528 | 3300009177 | Bacteria | 2430 |
| 435 | Ga0105237_10013134 | 3300009545 | Bacteria | 8691 |
| 436 | Ga0105237_10034871 | 3300009545 | Bacteria | 5092 |
| 437 | Ga0105237_10074539 | 3300009545 | Bacteria | 3386 |
| 438 | Ga0105237_10253874 | 3300009545 | Bacteria | 1761 |
| 439 | Ga0105237_10758446 | 3300009545 | Bacteria | 977 |
| 440 | Ga0105237_10780658 | 3300009545 | Bacteria | 962 |
| 441 | Ga0105238_10067129 | 3300009551 | Bacteria | 3588 |
| 442 | Ga0105238_11629773 | 3300009551 | Bacteria | 675 |
| 443 | Ga0105249_10026793 | 3300009553 | Bacteria | 5198 |
| 444 | Ga0105249_10287423 | 3300009553 | Bacteria | 1645 |
| 445 | Ga0105249_10377924 | 3300009553 | Bacteria | 1442 |
| 446 | Ga0105249_10902334 | 3300009553 | Bacteria | 951 |
| 447 | Ga0105249_10992345 | 3300009553 | Bacteria | 908 |
| 448 | Ga0105249_11231650 | 3300009553 | Bacteria | 819 |
| 449 | Ga0105249_12672747 | 3300009553 | Bacteria | 571 |
| 450 | Ga0105239_10013511 | 3300010375 | Bacteria | 9065 |
| 451 | Ga0105239_10641648 | 3300010375 | Bacteria | 1212 |
| 452 | Ga0105239_12034082 | 3300010375 | Bacteria | 667 |
| 453 | Ga0105246_10147383 | 3300011119 | Bacteria | 1778 |
| 454 | Ga0105246_10389000 | 3300011119 | Bacteria | 1155 |
| 455 | Ga0105246_10878288 | 3300011119 | Bacteria | 802 |
| 456 | Ga0157321_1027039 | 3300012487 | Bacteria | 563 |
| 457 | Ga0157341_1002427 | 3300012494 | Bacteria | 1229 |
| 458 | Ga0157341_1018867 | 3300012494 | Bacteria | 663 |
| 459 | Ga0157338_1013841 | 3300012515 | Bacteria | 862 |
| 460 | Ga0157373_10004556 | 3300013100 | Bacteria | 10421 |
| 461 | Ga0157373_10006641 | 3300013100 | Bacteria | 8617 |
| 462 | Ga0157373_10020207 | 3300013100 | Bacteria | 4843 |
| 463 | Ga0157373_10030071 | 3300013100 | Bacteria | 3909 |
| 464 | Ga0157373_10189694 | 3300013100 | Bacteria | 1448 |
| 465 | Ga0157373_10355042 | 3300013100 | Bacteria | 1046 |
| 466 | Ga0157371_10001833 | 3300013102 | Bacteria | 21422 |
| 467 | Ga0157371_10040213 | 3300013102 | Bacteria | 3341 |
| 468 | Ga0157371_10793364 | 3300013102 | Bacteria | 713 |
| 469 | Ga0157371_10837067 | 3300013102 | Bacteria | 695 |
| 470 | Ga0157371_10891512 | 3300013102 | Bacteria | 674 |
| 471 | Ga0157370_10006051 | 3300013104 | Bacteria | 13437 |
| 472 | Ga0157370_10009625 | 3300013104 | Bacteria | 10285 |
| 473 | Ga0157370_10020601 | 3300013104 | Bacteria | 6582 |
| 474 | Ga0157370_10022043 | 3300013104 | Bacteria | 6342 |
| 475 | Ga0157370_10038915 | 3300013104 | Bacteria | 4599 |
| 476 | Ga0157370_10047399 | 3300013104 | Bacteria | 4120 |
| 477 | Ga0157370_10121653 | 3300013104 | Bacteria | 2437 |
| 478 | Ga0157370_10318958 | 3300013104 | Bacteria | 1434 |
| 479 | Ga0157370_10359999 | 3300013104 | Bacteria | 1341 |
| 480 | Ga0157369_10008592 | 3300013105 | Bacteria | 11716 |
| 481 | Ga0157369_10015589 | 3300013105 | Bacteria | 8564 |
| 482 | Ga0157369_10117184 | 3300013105 | Bacteria | 2827 |
| 483 | Ga0157369_10796483 | 3300013105 | Bacteria | 971 |
| 484 | Ga0157369_10829158 | 3300013105 | Bacteria | 950 |
| 485 | Ga0157369_11146261 | 3300013105 | Bacteria | 794 |
| 486 | Ga0157369_12615031 | 3300013105 | Bacteria | 510 |
| 487 | Ga0157374_10047543 | 3300013296 | Bacteria | 3979 |
| 488 | Ga0157374_10194222 | 3300013296 | Bacteria | 1986 |
| 489 | Ga0157374_10685817 | 3300013296 | Bacteria | 1037 |
| 490 | Ga0157378_10001142 | 3300013297 | Bacteria | 24153 |
| 491 | Ga0157378_10004789 | 3300013297 | Bacteria | 11859 |
| 492 | Ga0157378_10057867 | 3300013297 | Bacteria | 3456 |
| 493 | Ga0157378_10371469 | 3300013297 | Bacteria | 1402 |
| 494 | Ga0157378_10970178 | 3300013297 | Bacteria | 883 |
| 495 | Ga0163162_10045373 | 3300013306 | Bacteria | 4403 |
| 496 | Ga0163162_10100801 | 3300013306 | Bacteria | 2979 |
| 497 | Ga0163162_10221834 | 3300013306 | Bacteria | 2020 |
| 498 | Ga0163162_10483176 | 3300013306 | Bacteria | 1370 |
| 499 | Ga0163162_11862376 | 3300013306 | Bacteria | 688 |
| 500 | Ga0157372_10155810 | 3300013307 | Bacteria | 2638 |
| 501 | Ga0157372_10343546 | 3300013307 | Bacteria | 1739 |
| 502 | Ga0157372_10372700 | 3300013307 | Bacteria | 1663 |
| 503 | Ga0157372_10430496 | 3300013307 | Bacteria | 1538 |
| 504 | Ga0157372_10614669 | 3300013307 | Bacteria | 1267 |
| 505 | Ga0157372_11146448 | 3300013307 | Bacteria | 899 |
| 506 | Ga0157372_12251908 | 3300013307 | Bacteria | 626 |
| 507 | Ga0157375_10009737 | 3300013308 | Bacteria | 8448 |
| 508 | Ga0157375_10236624 | 3300013308 | Bacteria | 1985 |
| 509 | Ga0157375_10758569 | 3300013308 | Bacteria | 1121 |
| 510 | Ga0157375_11186320 | 3300013308 | Bacteria | 895 |
| 511 | Ga0157375_11210412 | 3300013308 | Bacteria | 886 |
| 512 | Ga0163163_10122200 | 3300014325 | Bacteria | 2638 |
| 513 | Ga0163163_10249903 | 3300014325 | Bacteria | 1824 |
| 514 | Ga0163163_10495263 | 3300014325 | Bacteria | 1284 |
| 515 | Ga0163163_10668280 | 3300014325 | Bacteria | 1102 |
| 516 | Ga0163163_10904119 | 3300014325 | Bacteria | 946 |
| 517 | Ga0157380_10022847 | 3300014326 | Bacteria | 4716 |
| 518 | Ga0157380_10168744 | 3300014326 | Bacteria | 1909 |
| 519 | Ga0157380_10359519 | 3300014326 | Bacteria | 1365 |
| 520 | Ga0157380_10789224 | 3300014326 | Bacteria | 965 |
| 521 | Ga0157380_12263456 | 3300014326 | Bacteria | 608 |
| 522 | Ga0182008_10260096 | 3300014497 | Bacteria | 897 |
| 523 | Ga0157377_10099694 | 3300014745 | Bacteria | 1728 |
| 524 | Ga0157377_11331231 | 3300014745 | Bacteria | 563 |
| 525 | Ga0157379_10049777 | 3300014968 | Bacteria | 3741 |
| 526 | Ga0157379_10260529 | 3300014968 | Bacteria | 1575 |
| 527 | Ga0157379_10611967 | 3300014968 | Bacteria | 1018 |
| 528 | Ga0157376_10003476 | 3300014969 | Bacteria | 10858 |
| 529 | Ga0157376_10008293 | 3300014969 | Bacteria | 7488 |
| 530 | Ga0157376_10015215 | 3300014969 | Bacteria | 5805 |
| 531 | Ga0157376_10210607 | 3300014969 | Bacteria | 1794 |
| 532 | Ga0157376_10359721 | 3300014969 | Bacteria | 1395 |
| 533 | Ga0157376_10668041 | 3300014969 | Bacteria | 1041 |
| 534 | Ga0163161_10025300 | 3300017792 | Bacteria | 4200 |
| 535 | Ga0163161_10029236 | 3300017792 | Bacteria | 3917 |
| 536 | Ga0163161_10246347 | 3300017792 | Bacteria | 1391 |
| 537 | Ga0163161_10569868 | 3300017792 | Bacteria | 930 |
| 538 | Ga0206356_11413287 | 3300020070 | Bacteria | 870 |
| 539 | Ga0213874_10005027 | 3300021377 | Bacteria | 3060 |
| 540 | Ga0224572_1097226 | 3300024225 | Bacteria | 543 |
| 541 | Ga0207666_1060908 | 3300025271 | Bacteria | 603 |
| 542 | Ga0207697_10030659 | 3300025315 | Bacteria | 2200 |
| 543 | Ga0207697_10358773 | 3300025315 | Bacteria | 647 |
| 544 | Ga0207656_10039789 | 3300025321 | Bacteria | 1991 |
| 545 | Ga0207682_10003597 | 3300025893 | Bacteria | 6697 |
| 546 | Ga0207682_10051678 | 3300025893 | Bacteria | 1703 |
| 547 | Ga0207682_10130280 | 3300025893 | Bacteria | 1122 |
| 548 | Ga0207682_10279103 | 3300025893 | Bacteria | 781 |
| 549 | Ga0207692_10000503 | 3300025898 | Bacteria | 13785 |
| 550 | Ga0207692_10066469 | 3300025898 | Bacteria | 1885 |
| 551 | Ga0207692_10067436 | 3300025898 | Bacteria | 1873 |
| 552 | Ga0207692_10133987 | 3300025898 | Bacteria | 1402 |
| 553 | Ga0207692_10141416 | 3300025898 | Bacteria | 1369 |
| 554 | Ga0207692_10269474 | 3300025898 | Bacteria | 1026 |
| 555 | Ga0207642_10005995 | 3300025899 | Bacteria | 4012 |
| 556 | Ga0207642_10016410 | 3300025899 | Bacteria | 2788 |
| 557 | Ga0207642_10177760 | 3300025899 | Bacteria | 1157 |
| 558 | Ga0207710_10017641 | 3300025900 | Bacteria | 3028 |
| 559 | Ga0207710_10538858 | 3300025900 | Bacteria | 607 |
| 560 | Ga0207688_10037295 | 3300025901 | Bacteria | 2695 |
| 561 | Ga0207688_10532938 | 3300025901 | Bacteria | 737 |
| 562 | Ga0207688_10748326 | 3300025901 | Bacteria | 619 |
| 563 | Ga0207680_10064395 | 3300025903 | Bacteria | 2247 |
| 564 | Ga0207680_10211366 | 3300025903 | Bacteria | 1326 |
| 565 | Ga0207680_10257182 | 3300025903 | Bacteria | 1207 |
| 566 | Ga0207680_10483588 | 3300025903 | Bacteria | 881 |
| 567 | Ga0207647_10267324 | 3300025904 | Bacteria | 978 |
| 568 | Ga0207647_10425684 | 3300025904 | Bacteria | 746 |
| 569 | Ga0207685_10000354 | 3300025905 | Bacteria | 7477 |
| 570 | Ga0207685_10001723 | 3300025905 | Bacteria | 4743 |
| 571 | Ga0207699_10008044 | 3300025906 | Bacteria | 5181 |
| 572 | Ga0207699_10050010 | 3300025906 | Bacteria | 2463 |
| 573 | Ga0207699_10070422 | 3300025906 | Bacteria | 2135 |
| 574 | Ga0207699_10260587 | 3300025906 | Bacteria | 1198 |
| 575 | Ga0207699_10516612 | 3300025906 | Bacteria | 863 |
| 576 | Ga0207699_10739805 | 3300025906 | Bacteria | 721 |
| 577 | Ga0207645_10011966 | 3300025907 | Bacteria | 5901 |
| 578 | Ga0207645_10017690 | 3300025907 | Bacteria | 4700 |
| 579 | Ga0207645_10167044 | 3300025907 | Bacteria | 1441 |
| 580 | Ga0207645_10755000 | 3300025907 | Bacteria | 661 |
| 581 | Ga0207643_10042451 | 3300025908 | Bacteria | 2565 |
| 582 | Ga0207643_10044017 | 3300025908 | Bacteria | 2520 |
| 583 | Ga0207643_10638283 | 3300025908 | Bacteria | 687 |
| 584 | Ga0207705_10090548 | 3300025909 | Bacteria | 2239 |
| 585 | Ga0207684_10032273 | 3300025910 | Bacteria | 4454 |
| 586 | Ga0207684_10474107 | 3300025910 | Bacteria | 1074 |
| 587 | Ga0207684_10583138 | 3300025910 | Bacteria | 956 |
| 588 | Ga0207654_10022974 | 3300025911 | Bacteria | 3335 |
| 589 | Ga0207654_10789850 | 3300025911 | Bacteria | 685 |
| 590 | Ga0207707_10008482 | 3300025912 | Bacteria | 8911 |
| 591 | Ga0207707_10063930 | 3300025912 | Bacteria | 3203 |
| 592 | Ga0207707_10068209 | 3300025912 | Bacteria | 3099 |
| 593 | Ga0207707_10269295 | 3300025912 | Bacteria | 1476 |
| 594 | Ga0207695_10060956 | 3300025913 | Bacteria | 3902 |
| 595 | Ga0207695_10074182 | 3300025913 | Bacteria | 3464 |
| 596 | Ga0207695_10783581 | 3300025913 | Bacteria | 833 |
| 597 | Ga0207671_10133472 | 3300025914 | Bacteria | 1907 |
| 598 | Ga0207693_10001609 | 3300025915 | Bacteria | 19964 |
| 599 | Ga0207693_10006450 | 3300025915 | Bacteria | 9723 |
| 600 | Ga0207693_10008687 | 3300025915 | Bacteria | 8308 |
| 601 | Ga0207663_10003480 | 3300025916 | Bacteria | 7705 |
| 602 | Ga0207663_10028048 | 3300025916 | Bacteria | 3290 |
| 603 | Ga0207663_10080798 | 3300025916 | Bacteria | 2127 |
| 604 | Ga0207663_10158531 | 3300025916 | Bacteria | 1595 |
| 605 | Ga0207663_10276417 | 3300025916 | Bacteria | 1246 |
| 606 | Ga0207663_10474103 | 3300025916 | Bacteria | 969 |
| 607 | Ga0207663_10931511 | 3300025916 | Bacteria | 695 |
| 608 | Ga0207663_11362910 | 3300025916 | Bacteria | 571 |
| 609 | Ga0207660_10003216 | 3300025917 | Bacteria | 10688 |
| 610 | Ga0207660_10080418 | 3300025917 | Bacteria | 2393 |
| 611 | Ga0207660_11008534 | 3300025917 | Bacteria | 679 |
| 612 | Ga0207662_10000088 | 3300025918 | Bacteria | 43438 |
| 613 | Ga0207662_10000710 | 3300025918 | Bacteria | 15232 |
| 614 | Ga0207662_10030460 | 3300025918 | Bacteria | 3131 |
| 615 | Ga0207662_10614424 | 3300025918 | Bacteria | 757 |
| 616 | Ga0207657_10001097 | 3300025919 | Bacteria | 28742 |
| 617 | Ga0207657_10223773 | 3300025919 | Bacteria | 1507 |
| 618 | Ga0207657_10526580 | 3300025919 | Bacteria | 925 |
| 619 | Ga0207649_10022621 | 3300025920 | Bacteria | 3632 |
| 620 | Ga0207649_10035292 | 3300025920 | Bacteria | 3004 |
| 621 | Ga0207649_10331019 | 3300025920 | Bacteria | 1122 |
| 622 | Ga0207649_10692986 | 3300025920 | Bacteria | 790 |
| 623 | Ga0207652_10069270 | 3300025921 | Bacteria | 3063 |
| 624 | Ga0207652_10075338 | 3300025921 | Bacteria | 2941 |
| 625 | Ga0207652_10098416 | 3300025921 | Bacteria | 2580 |
| 626 | Ga0207652_10487175 | 3300025921 | Bacteria | 1110 |
| 627 | Ga0207652_11002316 | 3300025921 | Bacteria | 734 |
| 628 | Ga0207652_11224468 | 3300025921 | Bacteria | 653 |
| 629 | Ga0207681_10013794 | 3300025923 | Bacteria | 5006 |
| 630 | Ga0207681_10044539 | 3300025923 | Bacteria | 2974 |
| 631 | Ga0207681_10101018 | 3300025923 | Bacteria | 2080 |
| 632 | Ga0207681_10227382 | 3300025923 | Bacteria | 1446 |
| 633 | Ga0207681_10333104 | 3300025923 | Bacteria | 1210 |
| 634 | Ga0207681_10371902 | 3300025923 | Bacteria | 1149 |
| 635 | Ga0207681_10718317 | 3300025923 | Bacteria | 831 |
| 636 | Ga0207694_10012843 | 3300025924 | Bacteria | 6307 |
| 637 | Ga0207694_10051639 | 3300025924 | Bacteria | 3187 |
| 638 | Ga0207650_10042140 | 3300025925 | Bacteria | 3348 |
| 639 | Ga0207650_10050535 | 3300025925 | Bacteria | 3075 |
| 640 | Ga0207650_10193945 | 3300025925 | Bacteria | 1624 |
| 641 | Ga0207650_10209174 | 3300025925 | Bacteria | 1566 |
| 642 | Ga0207650_10288046 | 3300025925 | Bacteria | 1339 |
| 643 | Ga0207650_10554211 | 3300025925 | Bacteria | 964 |
| 644 | Ga0207650_10648084 | 3300025925 | Bacteria | 890 |
| 645 | Ga0207650_10808347 | 3300025925 | Bacteria | 795 |
| 646 | Ga0207659_10011330 | 3300025926 | Bacteria | 5632 |
| 647 | Ga0207659_10184628 | 3300025926 | Bacteria | 1655 |
| 648 | Ga0207659_10191881 | 3300025926 | Bacteria | 1626 |
| 649 | Ga0207659_10250026 | 3300025926 | Bacteria | 1438 |
| 650 | Ga0207659_10559502 | 3300025926 | Bacteria | 973 |
| 651 | Ga0207687_10000349 | 3300025927 | Bacteria | 30723 |
| 652 | Ga0207687_10006704 | 3300025927 | Bacteria | 7597 |
| 653 | Ga0207687_11696229 | 3300025927 | Bacteria | 542 |
| 654 | Ga0207700_10001216 | 3300025928 | Bacteria | 14755 |
| 655 | Ga0207700_10027694 | 3300025928 | Bacteria | 3973 |
| 656 | Ga0207700_10263217 | 3300025928 | Bacteria | 1477 |
| 657 | Ga0207700_10783358 | 3300025928 | Bacteria | 853 |
| 658 | Ga0207664_10001209 | 3300025929 | Bacteria | 17138 |
| 659 | Ga0207664_10005216 | 3300025929 | Bacteria | 8861 |
| 660 | Ga0207664_10012693 | 3300025929 | Bacteria | 6029 |
| 661 | Ga0207664_10058051 | 3300025929 | Bacteria | 3077 |
| 662 | Ga0207664_10220252 | 3300025929 | Bacteria | 1645 |
| 663 | Ga0207664_10304665 | 3300025929 | Bacteria | 1402 |
| 664 | Ga0207664_10719320 | 3300025929 | Bacteria | 898 |
| 665 | Ga0207644_10003039 | 3300025931 | Bacteria | 10785 |
| 666 | Ga0207644_10046278 | 3300025931 | Bacteria | 3098 |
| 667 | Ga0207644_10104444 | 3300025931 | Bacteria | 2133 |
| 668 | Ga0207644_10470154 | 3300025931 | Bacteria | 1034 |
| 669 | Ga0207690_10000661 | 3300025932 | Bacteria | 22057 |
| 670 | Ga0207690_10034139 | 3300025932 | Bacteria | 3276 |
| 671 | Ga0207690_10140537 | 3300025932 | Bacteria | 1779 |
| 672 | Ga0207690_10624912 | 3300025932 | Bacteria | 881 |
| 673 | Ga0207690_10684600 | 3300025932 | Bacteria | 842 |
| 674 | Ga0207706_10000040 | 3300025933 | Bacteria | 132285 |
| 675 | Ga0207706_10029338 | 3300025933 | Bacteria | 4911 |
| 676 | Ga0207706_10070688 | 3300025933 | Bacteria | 3070 |
| 677 | Ga0207706_10137397 | 3300025933 | Bacteria | 2150 |
| 678 | Ga0207706_10287595 | 3300025933 | Bacteria | 1433 |
| 679 | Ga0207706_10452261 | 3300025933 | Bacteria | 1111 |
| 680 | Ga0207686_10035803 | 3300025934 | Bacteria | 2982 |
| 681 | Ga0207686_10111571 | 3300025934 | Bacteria | 1845 |
| 682 | Ga0207686_10840042 | 3300025934 | Bacteria | 738 |
| 683 | Ga0207686_10971743 | 3300025934 | Bacteria | 688 |
| 684 | Ga0207709_10001642 | 3300025935 | Bacteria | 15151 |
| 685 | Ga0207709_10039687 | 3300025935 | Bacteria | 2814 |
| 686 | Ga0207709_10114217 | 3300025935 | Bacteria | 1812 |
| 687 | Ga0207709_10336355 | 3300025935 | Bacteria | 1135 |
| 688 | Ga0207670_10002235 | 3300025936 | Bacteria | 10121 |
| 689 | Ga0207670_10049431 | 3300025936 | Bacteria | 2813 |
| 690 | Ga0207670_10087023 | 3300025936 | Bacteria | 2200 |
| 691 | Ga0207670_10282033 | 3300025936 | Bacteria | 1295 |
| 692 | Ga0207670_10600332 | 3300025936 | Bacteria | 904 |
| 693 | Ga0207670_11205798 | 3300025936 | Bacteria | 641 |
| 694 | Ga0207669_10003857 | 3300025937 | Bacteria | 6535 |
| 695 | Ga0207669_10046628 | 3300025937 | Bacteria | 2562 |
| 696 | Ga0207669_10097906 | 3300025937 | Bacteria | 1930 |
| 697 | Ga0207669_10218926 | 3300025937 | Bacteria | 1396 |
| 698 | Ga0207704_10002194 | 3300025938 | Bacteria | 8752 |
| 699 | Ga0207704_10094979 | 3300025938 | Bacteria | 1970 |
| 700 | Ga0207665_10000223 | 3300025939 | Bacteria | 38647 |
| 701 | Ga0207665_10002070 | 3300025939 | Bacteria | 13532 |
| 702 | Ga0207665_10305481 | 3300025939 | Bacteria | 1190 |
| 703 | Ga0207691_10006790 | 3300025940 | Bacteria | 11034 |
| 704 | Ga0207691_10015784 | 3300025940 | Bacteria | 7178 |
| 705 | Ga0207691_10073946 | 3300025940 | Bacteria | 3074 |
| 706 | Ga0207691_10130871 | 3300025940 | Bacteria | 2217 |
| 707 | Ga0207691_10267643 | 3300025940 | Bacteria | 1472 |
| 708 | Ga0207711_10022647 | 3300025941 | Bacteria | 5255 |
| 709 | Ga0207711_10042318 | 3300025941 | Bacteria | 3881 |
| 710 | Ga0207689_10002986 | 3300025942 | Bacteria | 15609 |
| 711 | Ga0207689_10009370 | 3300025942 | Bacteria | 8461 |
| 712 | Ga0207689_10037694 | 3300025942 | Bacteria | 4008 |
| 713 | Ga0207689_10197924 | 3300025942 | Bacteria | 1658 |
| 714 | Ga0207689_10274249 | 3300025942 | Bacteria | 1396 |
| 715 | Ga0207661_10021055 | 3300025944 | Bacteria | 4884 |
| 716 | Ga0207661_10735404 | 3300025944 | Bacteria | 908 |
| 717 | Ga0207679_10011215 | 3300025945 | Bacteria | 5792 |
| 718 | Ga0207679_10013523 | 3300025945 | Bacteria | 5350 |
| 719 | Ga0207679_10223379 | 3300025945 | Bacteria | 1586 |
| 720 | Ga0207679_10404645 | 3300025945 | Bacteria | 1201 |
| 721 | Ga0207679_10943827 | 3300025945 | Bacteria | 790 |
| 722 | Ga0207667_10011779 | 3300025949 | Bacteria | 10133 |
| 723 | Ga0207667_10023839 | 3300025949 | Bacteria | 6735 |
| 724 | Ga0207667_10191445 | 3300025949 | Bacteria | 2099 |
| 725 | Ga0207667_10356339 | 3300025949 | Bacteria | 1492 |
| 726 | Ga0207667_10913291 | 3300025949 | Bacteria | 869 |
| 727 | Ga0207667_11360981 | 3300025949 | Bacteria | 684 |
| 728 | Ga0207651_10002402 | 3300025960 | Bacteria | 8947 |
| 729 | Ga0207651_10019559 | 3300025960 | Bacteria | 4061 |
| 730 | Ga0207651_10116632 | 3300025960 | Bacteria | 2016 |
| 731 | Ga0207651_10151539 | 3300025960 | Bacteria | 1805 |
| 732 | Ga0207712_10103552 | 3300025961 | Bacteria | 2121 |
| 733 | Ga0207712_10361265 | 3300025961 | Bacteria | 1210 |
| 734 | Ga0207668_10072871 | 3300025972 | Bacteria | 2459 |
| 735 | Ga0207668_10225583 | 3300025972 | Bacteria | 1507 |
| 736 | Ga0207668_10531546 | 3300025972 | Bacteria | 1016 |
| 737 | Ga0207668_10563571 | 3300025972 | Bacteria | 988 |
| 738 | Ga0207668_10805313 | 3300025972 | Bacteria | 832 |
| 739 | Ga0207668_11593604 | 3300025972 | Bacteria | 589 |
| 740 | Ga0207640_10011788 | 3300025981 | Bacteria | 4961 |
| 741 | Ga0207640_10012718 | 3300025981 | Bacteria | 4802 |
| 742 | Ga0207658_10010103 | 3300025986 | Bacteria | 6411 |
| 743 | Ga0207658_10146371 | 3300025986 | Bacteria | 1919 |
| 744 | Ga0207658_10193322 | 3300025986 | Bacteria | 1693 |
| 745 | Ga0207658_10249536 | 3300025986 | Bacteria | 1507 |
| 746 | Ga0207658_10459407 | 3300025986 | Bacteria | 1128 |
| 747 | Ga0207677_10096263 | 3300026023 | Bacteria | 2165 |
| 748 | Ga0207677_10417021 | 3300026023 | Bacteria | 1143 |
| 749 | Ga0207677_11238728 | 3300026023 | Bacteria | 684 |
| 750 | Ga0207703_10003517 | 3300026035 | Bacteria | 13105 |
| 751 | Ga0207703_10037996 | 3300026035 | Bacteria | 3839 |
| 752 | Ga0207703_10129896 | 3300026035 | Bacteria | 2174 |
| 753 | Ga0207703_10163974 | 3300026035 | Bacteria | 1948 |
| 754 | Ga0207639_10034249 | 3300026041 | Bacteria | 3753 |
| 755 | Ga0207639_10056193 | 3300026041 | Bacteria | 3016 |
| 756 | Ga0207639_10356725 | 3300026041 | Bacteria | 1307 |
| 757 | Ga0207639_10463505 | 3300026041 | Bacteria | 1152 |
| 758 | Ga0207639_11410573 | 3300026041 | Bacteria | 654 |
| 759 | Ga0207678_10007871 | 3300026067 | Bacteria | 9403 |
| 760 | Ga0207678_10008883 | 3300026067 | Bacteria | 8849 |
| 761 | Ga0207678_10889890 | 3300026067 | Bacteria | 787 |
| 762 | Ga0207678_11039933 | 3300026067 | Bacteria | 725 |
| 763 | Ga0207708_10000326 | 3300026075 | Bacteria | 37674 |
| 764 | Ga0207708_10001430 | 3300026075 | Bacteria | 17905 |
| 765 | Ga0207708_10280709 | 3300026075 | Bacteria | 1350 |
| 766 | Ga0207702_10014584 | 3300026078 | Bacteria | 6522 |
| 767 | Ga0207702_10048686 | 3300026078 | Bacteria | 3575 |
| 768 | Ga0207702_10058542 | 3300026078 | Bacteria | 3279 |
| 769 | Ga0207702_10108244 | 3300026078 | Bacteria | 2466 |
| 770 | Ga0207702_10279895 | 3300026078 | Bacteria | 1577 |
| 771 | Ga0207702_10637779 | 3300026078 | Bacteria | 1047 |
| 772 | Ga0207702_12295361 | 3300026078 | Bacteria | 527 |
| 773 | Ga0207641_10053430 | 3300026088 | Bacteria | 3424 |
| 774 | Ga0207641_10083806 | 3300026088 | Bacteria | 2773 |
| 775 | Ga0207641_10110446 | 3300026088 | Bacteria | 2436 |
| 776 | Ga0207641_10268230 | 3300026088 | Bacteria | 1601 |
| 777 | Ga0207641_10666197 | 3300026088 | Bacteria | 1023 |
| 778 | Ga0207641_10869063 | 3300026088 | Bacteria | 894 |
| 779 | Ga0207641_12027521 | 3300026088 | Bacteria | 576 |
| 780 | Ga0207641_12087896 | 3300026088 | Bacteria | 567 |
| 781 | Ga0207648_10000071 | 3300026089 | Bacteria | 95176 |
| 782 | Ga0207648_10002303 | 3300026089 | Bacteria | 20622 |
| 783 | Ga0207648_10019841 | 3300026089 | Bacteria | 6066 |
| 784 | Ga0207648_10240593 | 3300026089 | Bacteria | 1611 |
| 785 | Ga0207648_10466324 | 3300026089 | Bacteria | 1152 |
| 786 | Ga0207676_10025129 | 3300026095 | Bacteria | 4417 |
| 787 | Ga0207676_10069259 | 3300026095 | Bacteria | 2824 |
| 788 | Ga0207676_10102174 | 3300026095 | Bacteria | 2379 |
| 789 | Ga0207676_10152579 | 3300026095 | Bacteria | 1991 |
| 790 | Ga0207676_10417792 | 3300026095 | Bacteria | 1257 |
| 791 | Ga0207676_10810932 | 3300026095 | Bacteria | 913 |
| 792 | Ga0207676_12164412 | 3300026095 | Bacteria | 554 |
| 793 | Ga0207674_10000155 | 3300026116 | Bacteria | 80715 |
| 794 | Ga0207674_10448512 | 3300026116 | Bacteria | 1247 |
| 795 | Ga0207674_10469949 | 3300026116 | Bacteria | 1215 |
| 796 | Ga0207674_10671961 | 3300026116 | Bacteria | 1000 |
| 797 | Ga0207675_100000040 | 3300026118 | Bacteria | 91299 |
| 798 | Ga0207675_100018658 | 3300026118 | Bacteria | 6475 |
| 799 | Ga0207675_100035478 | 3300026118 | Bacteria | 4652 |
| 800 | Ga0207675_100053014 | 3300026118 | Bacteria | 3785 |
| 801 | Ga0207675_100069717 | 3300026118 | Bacteria | 3286 |
| 802 | Ga0207675_100274651 | 3300026118 | Bacteria | 1636 |
| 803 | Ga0207675_100364166 | 3300026118 | Bacteria | 1419 |
| 804 | Ga0207683_10005993 | 3300026121 | Bacteria | 10411 |
| 805 | Ga0207683_10010627 | 3300026121 | Bacteria | 7850 |
| 806 | Ga0207683_10059677 | 3300026121 | Bacteria | 3351 |
| 807 | Ga0207683_10102434 | 3300026121 | Unclassified | 2556 |
| 808 | Ga0207683_10127013 | 3300026121 | Bacteria | 2292 |
| 809 | Ga0207683_10156286 | 3300026121 | Bacteria | 2060 |
| 810 | Ga0207683_10187204 | 3300026121 | Bacteria | 1878 |
| 811 | Ga0207683_10677497 | 3300026121 | Bacteria | 956 |
| 812 | Ga0207698_10005283 | 3300026142 | Bacteria | 7949 |
| 813 | Ga0207698_10078529 | 3300026142 | Bacteria | 2651 |
| 814 | Ga0207698_10776052 | 3300026142 | Bacteria | 959 |
| 815 | Ga0209969_1001293 | 3300027360 | Bacteria | 3442 |
| 816 | Ga0209969_1026104 | 3300027360 | Bacteria | 882 |
| 817 | Ga0209967_1022930 | 3300027364 | Bacteria | 917 |
| 818 | Ga0209981_1003276 | 3300027378 | Bacteria | 2098 |
| 819 | Ga0209981_1018642 | 3300027378 | Bacteria | 984 |
| 820 | Ga0209996_1043490 | 3300027395 | Bacteria | 671 |
| 821 | Ga0209968_1057731 | 3300027526 | Bacteria | 681 |
| 822 | Ga0209971_1017602 | 3300027682 | Bacteria | 1694 |
| 823 | Ga0209966_1015677 | 3300027695 | Bacteria | 1425 |
| 824 | Ga0209998_10035007 | 3300027717 | Bacteria | 1125 |
| 825 | Ga0209813_10003624 | 3300027866 | Bacteria | 3629 |
| 826 | Ga0209974_10019154 | 3300027876 | Bacteria | 2269 |
| 827 | Ga0209974_10137092 | 3300027876 | Bacteria | 876 |
| 828 | Ga0207428_10003555 | 3300027907 | Bacteria | 15064 |
| 829 | Ga0207428_10187719 | 3300027907 | Bacteria | 1559 |
| 830 | Ga0268266_10027827 | 3300028379 | Bacteria | 4807 |
| 831 | Ga0268266_10038362 | 3300028379 | Bacteria | 4078 |
| 832 | Ga0268266_10253613 | 3300028379 | Bacteria | 1628 |
| 833 | Ga0268266_11095610 | 3300028379 | Bacteria | 771 |
| 834 | Ga0268265_10015432 | 3300028380 | Bacteria | 5228 |
| 835 | Ga0268265_10016234 | 3300028380 | Bacteria | 5111 |
| 836 | Ga0268265_10262872 | 3300028380 | Bacteria | 1535 |
| 837 | Ga0268265_10273866 | 3300028380 | Bacteria | 1507 |
| 838 | Ga0268264_10000527 | 3300028381 | Bacteria | 48430 |
| 839 | Ga0268264_10050378 | 3300028381 | Bacteria | 3467 |
| 840 | Ga0268264_10149206 | 3300028381 | Bacteria | 2094 |
| 841 | Ga0268264_10834279 | 3300028381 | Bacteria | 922 |
| 842 | Ga0268264_10886413 | 3300028381 | Bacteria | 895 |
| 843 | Ga0268264_11090257 | 3300028381 | Bacteria | 807 |
| 844 | Ga0268264_11242777 | 3300028381 | Bacteria | 755 |
| 845 | Ga0265337_1000657 | 3300028556 | Bacteria | 18216 |
| 846 | Ga0265334_10004658 | 3300028573 | Bacteria | 6053 |
| 847 | Ga0265338_10014806 | 3300028800 | Bacteria | 8632 |
| 848 | Ga0265338_10168184 | 3300028800 | Bacteria | 1685 |
| 849 | Ga0265765_1015225 | 3300030879 | Bacteria | 893 |
| 850 | Ga0265760_10135826 | 3300031090 | Bacteria | 798 |
| 851 | Ga0265332_10023006 | 3300031238 | Bacteria | 2749 |
| 852 | Ga0265328_10005004 | 3300031239 | Bacteria | 5712 |
| 853 | Ga0265325_10000004 | 3300031241 | Bacteria | 347347 |
| 854 | Ga0307408_100083689 | 3300031548 | Bacteria | 2391 |
| 855 | Ga0307408_100381515 | 3300031548 | Bacteria | 1205 |
| 856 | Ga0307408_100989894 | 3300031548 | Bacteria | 774 |
| 857 | Ga0307408_101481056 | 3300031548 | Bacteria | 641 |
| 858 | Ga0265313_10003348 | 3300031595 | Bacteria | 13088 |
| 859 | Ga0316579_10293234 | 3300031691 | Bacteria | 786 |
| 860 | Ga0265314_10001644 | 3300031711 | Bacteria | 24461 |
| 861 | Ga0265314_10116754 | 3300031711 | Bacteria | 1687 |
| 862 | Ga0316576_10006013 | 3300031727 | Bacteria | 7500 |
| 863 | Ga0316576_10055935 | 3300031727 | Bacteria | 2880 |
| 864 | Ga0316578_10007067 | 3300031728 | Bacteria | 5594 |
| 865 | Ga0316578_10112158 | 3300031728 | Bacteria | 1638 |
| 866 | Ga0307405_10004237 | 3300031731 | Bacteria | 6746 |
| 867 | Ga0307405_10716221 | 3300031731 | Bacteria | 830 |
| 868 | Ga0307405_10957032 | 3300031731 | Bacteria | 728 |
| 869 | Ga0307413_10000700 | 3300031824 | Bacteria | 11495 |
| 870 | Ga0307413_10055564 | 3300031824 | Bacteria | 2410 |
| 871 | Ga0307413_10811520 | 3300031824 | Bacteria | 787 |
| 872 | Ga0307410_10004286 | 3300031852 | Bacteria | 7348 |
| 873 | Ga0307406_10013188 | 3300031901 | Bacteria | 4730 |
| 874 | Ga0307406_10462944 | 3300031901 | Bacteria | 1020 |
| 875 | Ga0307407_10011597 | 3300031903 | Bacteria | 4203 |
| 876 | Ga0307412_10108155 | 3300031911 | Bacteria | 1980 |
| 877 | Ga0307409_100013370 | 3300031995 | Bacteria | 5280 |
| 878 | Ga0307416_100008987 | 3300032002 | Bacteria | 6499 |
| 879 | Ga0307416_100261457 | 3300032002 | Bacteria | 1692 |
| 880 | Ga0307416_100398283 | 3300032002 | Bacteria | 1413 |
| 881 | Ga0307416_101116004 | 3300032002 | Bacteria | 893 |
| 882 | Ga0307414_10096761 | 3300032004 | Bacteria | 2210 |
| 883 | Ga0307411_10075337 | 3300032005 | Bacteria | 2303 |
| 884 | Ga0307411_10321567 | 3300032005 | Bacteria | 1250 |
| 885 | Ga0307411_10386921 | 3300032005 | Bacteria | 1152 |
| 886 | Ga0307415_100005658 | 3300032126 | Bacteria | 6655 |
| 887 | Ga0316583_10001095 | 3300032133 | Bacteria | 8807 |
| 888 | Ga0316585_10033425 | 3300032137 | Bacteria | 1622 |
| 889 | Ga0316592_1016823 | 3300033524 | Bacteria | 1531 |
| 890 | Ga0316592_1042856 | 3300033524 | Bacteria | 1004 |
| 891 | Ga0316588_1001446 | 3300033528 | Bacteria | 3890 |
| 892 | Ga0316588_1004449 | 3300033528 | Bacteria | 2655 |
| 893 | Ga0316596_1002887 | 3300033541 | Bacteria | 3720 |
| 894 | Ga0373930_0002876 | 3300034816 | Bacteria | 2703 |
| 895 | Ga0373948_0089649 | 3300034817 | Bacteria | 712 |
| 896 | Ga0373948_0096177 | 3300034817 | Bacteria | 693 |
| 897 | Ga0373958_0025895 | 3300034819 | Bacteria | 1120 |
| 898 | Ga0373959_0014349 | 3300034820 | Bacteria | 1441 |
| 899 | Ga0373938_0006574 | 3300034957 | Bacteria | 2015 |
| 900 | Ga0373938_0195483 | 3300034957 | Bacteria | 558 |
| 901 | Ga0373926_0000062 | 3300035083 | Bacteria | 19600 |
| 902 | Ga0373926_0000873 | 3300035083 | Bacteria | 8629 |
| 903 | Ga0373926_0057063 | 3300035083 | Bacteria | 1418 |
| 904 | Ga0373928_0007308 | 3300035084 | Bacteria | 2129 |
| 905 | Ga0373929_0001916 | 3300035085 | Bacteria | 3889 |
| 906 | Ga0373929_0002103 | 3300035085 | Bacteria | 3702 |
| 907 | Ga0373934_0000061 | 3300035086 | Bacteria | 37034 |
| 908 | Ga0373934_0208055 | 3300035086 | Bacteria | 806 |
| 909 | Ga0373940_0020475 | 3300035088 | Bacteria | 1681 |
| 910 | Ga0373940_0069383 | 3300035088 | Bacteria | 1023 |
| 911 | Ga0373944_0001760 | 3300035089 | Bacteria | 5470 |
| 912 | Ga0373944_0010174 | 3300035089 | Bacteria | 2561 |
| 913 | Ga0373944_0016994 | 3300035089 | Bacteria | 2059 |
| 914 | Ga0373944_0136159 | 3300035089 | Bacteria | 857 |
| 915 | Ga0373949_0018039 | 3300035090 | Bacteria | 1596 |
| 916 | Ga0373949_0045115 | 3300035090 | Bacteria | 1095 |
| 917 | Ga0373949_0075239 | 3300035090 | Bacteria | 891 |
| 918 | Ga0373951_0165440 | 3300035091 | Bacteria | 628 |
| 919 | Ga0373952_0013241 | 3300035092 | Bacteria | 1633 |
| 920 | Ga0373952_0025205 | 3300035092 | Bacteria | 1283 |
| 921 | Ga0373952_0040038 | 3300035092 | Bacteria | 1079 |
| 922 | Ga0373932_0010654 | 3300035112 | Bacteria | 2229 |
| 923 | Ga0373932_0149864 | 3300035112 | Bacteria | 799 |
| 924 | Ga0373936_0002266 | 3300035113 | Bacteria | 7194 |
| 925 | Ga0373936_0006259 | 3300035113 | Bacteria | 4489 |
| 926 | Ga0373936_0033352 | 3300035113 | Bacteria | 2041 |
| 927 | Ga0373936_0440763 | 3300035113 | Bacteria | 601 |
| 928 | Ga0373939_0030215 | 3300035114 | Bacteria | 1556 |
| 929 | Ga0373939_0087509 | 3300035114 | Bacteria | 1047 |
| 930 | Ga0373941_0004504 | 3300035115 | Bacteria | 3224 |
| 931 | Ga0373941_0078862 | 3300035115 | Bacteria | 1108 |
| 932 | Ga0373945_0002753 | 3300035116 | Bacteria | 5521 |
| 933 | Ga0373945_0125564 | 3300035116 | Bacteria | 1024 |
| 934 | Ga0373945_0173853 | 3300035116 | Bacteria | 883 |
| 935 | Ga0373945_0365778 | 3300035116 | Bacteria | 627 |
| 936 | Ga0373954_0142478 | 3300035118 | Bacteria | 1169 |
| 937 | Ga0373956_0000003 | 3300035119 | Bacteria | 81669 |
| 938 | Ga0373956_0107578 | 3300035119 | Bacteria | 1297 |
| 939 | Ga0373957_0051231 | 3300035120 | Bacteria | 1579 |
| 940 | Ga0373957_0189182 | 3300035120 | Bacteria | 855 |
| 941 | Ga0373960_0017534 | 3300035121 | Bacteria | 1857 |
| 942 | Ga0373960_0102397 | 3300035121 | Bacteria | 930 |
| 943 | Ga0373943_0000584 | 3300035170 | Bacteria | 15774 |
| 944 | Ga0373943_0001182 | 3300035170 | Bacteria | 11660 |
| 945 | Ga0373943_0038477 | 3300035170 | Bacteria | 2300 |
| 946 | Ga0373943_0205418 | 3300035170 | Bacteria | 1092 |
| 947 | Ga0373943_0241354 | 3300035170 | Bacteria | 1012 |
| 948 | Ga0373943_0684677 | 3300035170 | Bacteria | 607 |
| 949 | Ga0373946_0001536 | 3300035171 | Bacteria | 8032 |
| 950 | Ga0373946_0002920 | 3300035171 | Bacteria | 6064 |
| 951 | Ga0373946_0015306 | 3300035171 | Bacteria | 2906 |
| 952 | Ga0373946_0053061 | 3300035171 | Bacteria | 1702 |
| 953 | Ga0373946_0059926 | 3300035171 | Bacteria | 1617 |
| 954 | Ga0373946_0569241 | 3300035171 | Bacteria | 586 |
| 955 | Ga0373955_0006439 | 3300035172 | Bacteria | 5348 |
| 956 | Ga0373955_0050034 | 3300035172 | Bacteria | 2271 |
| 957 | Ga0373942_0035658 | 3300035207 | Bacteria | 1335 |
| 958 | Ga0373961_0093166 | 3300035241 | Bacteria | 965 |
| 959 | Ga0373962_0036833 | 3300035242 | Bacteria | 1364 |
| 960 | Ga0373962_0139074 | 3300035242 | Bacteria | 787 |
| 961 | Ga0316574_0120679 | 3300035398 | Bacteria | 1683 |
| 962 | Ga0316574_0208595 | 3300035398 | Bacteria | 1254 |
| 963 | Ga0373924_0327817 | 3300035410 | Bacteria | 681 |
| 964 | Ga0373931_0000553 | 3300035691 | Bacteria | 15375 |
| 965 | Ga0373931_0055258 | 3300035691 | Bacteria | 2124 |
| 966 | Ga0373931_0076422 | 3300035691 | Bacteria | 1839 |
| 967 | Ga0373931_0240286 | 3300035691 | Bacteria | 1098 |
| 968 | Ga0373931_0668486 | 3300035691 | Bacteria | 684 |
| 969 | Ga0373931_0789383 | 3300035691 | Bacteria | 632 |
| 970 | Ga0373935_0001505 | 3300035692 | Bacteria | 12946 |
| 971 | Ga0373935_0005854 | 3300035692 | Bacteria | 7281 |
| 972 | Ga0373935_0034524 | 3300035692 | Bacteria | 3153 |
| 973 | Ga0373935_0037110 | 3300035692 | Bacteria | 3048 |
| 974 | Ga0373935_0178262 | 3300035692 | Bacteria | 1458 |
| 975 | Ga0373935_0298795 | 3300035692 | Bacteria | 1137 |
| 976 | Ga0373935_0382207 | 3300035692 | Bacteria | 1008 |
| 977 | Ga0373935_1086346 | 3300035692 | Bacteria | 595 |
| 978 | Ga0373927_0000912 | 3300035695 | Bacteria | 22465 |
| 979 | Ga0373927_0042837 | 3300035695 | Bacteria | 2933 |
| 980 | Ga0373927_0060322 | 3300035695 | Bacteria | 2454 |
| 981 | Ga0373927_0090279 | 3300035695 | Bacteria | 1990 |
| 982 | Ga0373927_0093116 | 3300035695 | Bacteria | 1958 |
| 983 | Ga0373927_0392062 | 3300035695 | Bacteria | 916 |
| 984 | Ga0373933_0005782 | 3300035724 | Bacteria | 6726 |
| 985 | Ga0373933_0211977 | 3300035724 | Bacteria | 1241 |
| 986 | Ga0373933_0228263 | 3300035724 | Bacteria | 1195 |
| 987 | Ga0373933_0240228 | 3300035724 | Bacteria | 1165 |
| 988 | Ga0373947_0002482 | 3300035725 | Bacteria | 11092 |
| 989 | Ga0373947_0003695 | 3300035725 | Bacteria | 9031 |
| 990 | Ga0373947_0012927 | 3300035725 | Bacteria | 4787 |
| 991 | Ga0373947_0014928 | 3300035725 | Bacteria | 4458 |
| 992 | Ga0373947_0025250 | 3300035725 | Bacteria | 3464 |
| 993 | Ga0373947_0026782 | 3300035725 | Bacteria | 3371 |
| 994 | Ga0373947_0122858 | 3300035725 | Bacteria | 1651 |
| 995 | Ga0373947_0245626 | 3300035725 | Bacteria | 1182 |
| 996 | Ga0373947_0982338 | 3300035725 | Bacteria | 576 |
| 997 | Ga0373947_1051989 | 3300035725 | Bacteria | 555 |
| 998 | Ga0373937_0000196 | 3300036401 | Bacteria | 59256 |
| 999 | Ga0373937_0017585 | 3300036401 | Bacteria | 6373 |
| 1000 | Ga0373937_0044504 | 3300036401 | Bacteria | 4055 |
| 1001 | Ga0373937_0069893 | 3300036401 | Bacteria | 3238 |
| 1002 | Ga0373937_0108292 | 3300036401 | Bacteria | 2584 |
| 1003 | Ga0373937_0224611 | 3300036401 | Bacteria | 1768 |
| 1004 | Ga0373937_0357799 | 3300036401 | Bacteria | 1383 |
| 1005 | Ga0373937_0726111 | 3300036401 | Bacteria | 940 |
| 1006 | Ga0316582_0001898 | 3300036647 | Bacteria | 9504 |
| 1007 | Ga0316582_0193563 | 3300036647 | Unclassified | 1386 |
| 1008 | Ga0316584_0048277 | 3300036712 | Bacteria | 3180 |
| 1009 | Ga0316584_0253297 | 3300036712 | Bacteria | 1286 |
| 1010 | Ga0373925_0004491 | 3300037068 | Bacteria | 10543 |
| 1011 | Ga0373925_0005040 | 3300037068 | Bacteria | 9910 |
| 1012 | Ga0373925_0006465 | 3300037068 | Bacteria | 8620 |
| 1013 | Ga0373925_0052700 | 3300037068 | Bacteria | 3040 |
| 1014 | Ga0373925_0060496 | 3300037068 | Bacteria | 2844 |
| 1015 | Ga0373925_0073485 | 3300037068 | Bacteria | 2588 |
| 1016 | Ga0373925_0114666 | 3300037068 | Bacteria | 2086 |
| 1017 | Ga0373925_0129742 | 3300037068 | Bacteria | 1964 |
| 1018 | Ga0373925_0156637 | 3300037068 | Bacteria | 1792 |
| 1019 | Ga0373925_0200579 | 3300037068 | Bacteria | 1586 |
| 1020 | Ga0373925_0616972 | 3300037068 | Bacteria | 893 |
| 1021 | Ga0373925_0884951 | 3300037068 | Bacteria | 736 |
| 1022 | Ga0395899_0097303 | 3300037312 | Bacteria | 2128 |
| 1023 | Ga0395900_0017617 | 3300037418 | Bacteria | 7289 |
| 1024 | Ga0395900_0181537 | 3300037418 | Bacteria | 2138 |
| 1025 | Ga0395900_1867637 | 3300037418 | Bacteria | 511 |
| 1026 | Ga0395898_0020431 | 3300037466 | Bacteria | 6725 |
| 1027 | Ga0395898_0120763 | 3300037466 | Bacteria | 2511 |
| 1028 | Ga0395898_0192133 | 3300037466 | Bacteria | 1951 |
| 1029 | Ga0395905_0085046 | 3300037471 | Bacteria | 2964 |
| 1030 | Ga0395905_0187731 | 3300037471 | Bacteria | 1940 |
| 1031 | Ga0316581_0000256 | 3300037588 | Bacteria | 9235 |
| 1032 | Ga0395901_0032467 | 3300038443 | Bacteria | 5387 |
| 1033 | Ga0395901_0197987 | 3300038443 | Bacteria | 2106 |
| 1034 | Ga0395901_0759588 | 3300038443 | Bacteria | 962 |
| 1035 | Ga0242420_060201 | 3300038996 | Bacteria | 756 |
| 1036 | Ga0400483_249032 | 3300039062 | Bacteria | 6577 |
| 1037 | Ga0436365_1483055 | 3300039437 | Bacteria | 788 |
| 1038 | Ga0436361_0966677 | 3300039447 | Bacteria | 1623 |
| 1039 | Ga0436363_0328509 | 3300039450 | Bacteria | 5149 |
| 1040 | Ga0436362_0044954 | 3300039453 | Bacteria | 619 |
| 1041 | Ga0439436_0093332 | 3300041404 | Bacteria | 838 |
| 1042 | Ga0439439_0023170 | 3300041406 | Bacteria | 1555 |
| 1043 | Ga0451787_728395 | 3300041441 | Bacteria | 788 |
| 1044 | Ga0451853_2158847 | 3300041512 | Bacteria | 1596 |
| 1045 | Ga0439441_000979 | 3300042001 | Bacteria | 3502 |
| 1046 | Ga0439441_066127 | 3300042001 | Bacteria | 769 |
| 1047 | Ga0439441_106654 | 3300042001 | Bacteria | 632 |
| 1048 | Ga0439443_003131 | 3300042003 | Bacteria | 2055 |
| 1049 | Ga0439443_033139 | 3300042003 | Bacteria | 859 |
| 1050 | Ga0439449_0420135 | 3300042007 | Bacteria | 508 |
| 1051 | Ga0439462_0091873 | 3300042015 | Bacteria | 833 |
| 1052 | Ga0450923_039057 | 3300042125 | Bacteria | 992 |
| 1053 | Ga0439458_0173336 | 3300042157 | Bacteria | 584 |
| 1054 | Ga0439434_0060064 | 3300042435 | Bacteria | 1188 |
| 1055 | Ga0439435_0000004 | 3300042436 | Bacteria | 26852 |
| 1056 | Ga0439435_0013464 | 3300042436 | Bacteria | 2000 |
| 1057 | Ga0439444_0093274 | 3300042437 | Bacteria | 674 |
| 1058 | Ga0439459_0095149 | 3300042438 | Bacteria | 722 |
| 1059 | Ga0439460_0000235 | 3300042461 | Bacteria | 11229 |
| 1060 | Ga0439460_0015727 | 3300042461 | Bacteria | 2007 |
| 1061 | Ga0439460_0134767 | 3300042461 | Bacteria | 816 |
| 1062 | Ga0451577_0008862 | 3300042876 | Bacteria | 9738 |
| 1063 | Ga0451577_0057081 | 3300042876 | Bacteria | 3481 |
| 1064 | Ga0453683_0147840 | 3300044673 | Bacteria | 1484 |
| 1065 | Ga0453683_0507009 | 3300044673 | Bacteria | 783 |
| 1066 | Ga0466963_0842857 | 3300044694 | Bacteria | 646 |
| 1067 | Ga0466957_0081969 | 3300044842 | Bacteria | 2010 |
| 1068 | Ga0451576_0003049 | 3300045051 | Bacteria | 23602 |
| 1069 | Ga0451576_0017751 | 3300045051 | Bacteria | 7819 |
| 1070 | Ga0451576_0619603 | 3300045051 | Bacteria | 1137 |
| 1071 | Ga0451576_1380122 | 3300045051 | Bacteria | 733 |
| 1072 | Ga0466958_0040320 | 3300045836 | Bacteria | 2807 |
| 1073 | Ga0466958_0718255 | 3300045836 | Bacteria | 651 |
| 1074 | Ga0466967_0021653 | 3300045976 | Bacteria | 5228 |
| 1075 | Ga0495592_0020464 | 3300046454 | Bacteria | 5032 |
| 1076 | Ga0495592_0224616 | 3300046454 | Bacteria | 1253 |
| 1077 | Ga0495603_0000752 | 3300046455 | Bacteria | 18518 |
| 1078 | Ga0495603_0009108 | 3300046455 | Bacteria | 6001 |
| 1079 | Ga0495603_0021983 | 3300046455 | Bacteria | 3862 |
| 1080 | Ga0495629_0001998 | 3300046459 | Bacteria | 15846 |
| 1081 | Ga0495629_0002312 | 3300046459 | Bacteria | 14680 |
| 1082 | Ga0495629_0015214 | 3300046459 | Bacteria | 5528 |
| 1083 | Ga0495629_0059779 | 3300046459 | Bacteria | 2664 |
| 1084 | Ga0495629_0143234 | 3300046459 | Bacteria | 1663 |
| 1085 | Ga0495651_0004749 | 3300046462 | Bacteria | 10399 |
| 1086 | Ga0495651_0016174 | 3300046462 | Bacteria | 5778 |
| 1087 | Ga0495651_0312278 | 3300046462 | Bacteria | 1051 |
| 1088 | Ga0495653_0005728 | 3300046463 | Bacteria | 10159 |
| 1089 | Ga0495580_0008537 | 3300046472 | Bacteria | 8129 |
| 1090 | Ga0495580_0016385 | 3300046472 | Bacteria | 5562 |
| 1091 | Ga0495580_0029652 | 3300046472 | Bacteria | 3969 |
| 1092 | Ga0495580_0224582 | 3300046472 | Bacteria | 1290 |
| 1093 | Ga0495580_0268638 | 3300046472 | Bacteria | 1165 |
| 1094 | Ga0495582_0014397 | 3300046473 | Bacteria | 4348 |
| 1095 | Ga0495582_0052439 | 3300046473 | Bacteria | 2249 |
| 1096 | Ga0495582_0137252 | 3300046473 | Bacteria | 1384 |
| 1097 | Ga0495639_0004241 | 3300046475 | Bacteria | 6152 |
| 1098 | Ga0495639_0093803 | 3300046475 | Bacteria | 1411 |
| 1099 | Ga0495639_0146968 | 3300046475 | Bacteria | 1135 |
| 1100 | Ga0495662_0003590 | 3300046476 | Bacteria | 7838 |
| 1101 | Ga0495662_0152433 | 3300046476 | Bacteria | 1138 |
| 1102 | Ga0495664_0029532 | 3300046477 | Bacteria | 3207 |
| 1103 | Ga0495664_0098990 | 3300046477 | Bacteria | 1756 |
| 1104 | Ga0495664_0373185 | 3300046477 | Bacteria | 858 |
| 1105 | Ga0495584_0245642 | 3300046491 | Bacteria | 910 |
| 1106 | Ga0495584_0672178 | 3300046491 | Bacteria | 528 |
| 1107 | Ga0495594_0010179 | 3300046499 | Bacteria | 4874 |
| 1108 | Ga0495594_0085149 | 3300046499 | Bacteria | 1768 |
| 1109 | Ga0495608_0001760 | 3300046511 | Bacteria | 15463 |
| 1110 | Ga0495608_0252723 | 3300046511 | Bacteria | 1099 |
| 1111 | Ga0495618_0008377 | 3300046514 | Bacteria | 6257 |
| 1112 | Ga0495618_0014032 | 3300046514 | Bacteria | 4877 |
| 1113 | Ga0495618_0521016 | 3300046514 | Bacteria | 715 |
| 1114 | Ga0495620_0286568 | 3300046515 | Bacteria | 626 |
| 1115 | Ga0495628_0016594 | 3300046516 | Bacteria | 6140 |
| 1116 | Ga0495630_0013313 | 3300046517 | Bacteria | 5986 |
| 1117 | Ga0495630_0055024 | 3300046517 | Bacteria | 2981 |
| 1118 | Ga0495630_0284177 | 3300046517 | Bacteria | 1264 |
| 1119 | Ga0495666_0041999 | 3300046526 | Bacteria | 2212 |
| 1120 | Ga0495666_0133151 | 3300046526 | Bacteria | 1161 |
| 1121 | Ga0495666_0433558 | 3300046526 | Bacteria | 589 |
| 1122 | Ga0495642_0067816 | 3300046528 | Bacteria | 1488 |
| 1123 | Ga0495642_0134426 | 3300046528 | Bacteria | 1066 |
| 1124 | Ga0495642_0290372 | 3300046528 | Bacteria | 716 |
| 1125 | Ga0495652_0006626 | 3300046529 | Bacteria | 10756 |
| 1126 | Ga0495652_0033497 | 3300046529 | Bacteria | 4485 |
| 1127 | Ga0495665_0014479 | 3300046531 | Bacteria | 4255 |
| 1128 | Ga0495665_0197180 | 3300046531 | Bacteria | 1044 |
| 1129 | Ga0495665_0285605 | 3300046531 | Bacteria | 846 |
| 1130 | Ga0495665_0576628 | 3300046531 | Bacteria | 563 |
| 1131 | Ga0495640_0022930 | 3300046533 | Bacteria | 4559 |
| 1132 | Ga0495640_0036793 | 3300046533 | Bacteria | 3456 |
| 1133 | Ga0495640_0060058 | 3300046533 | Bacteria | 2587 |
| 1134 | Ga0495640_0125380 | 3300046533 | Bacteria | 1666 |
| 1135 | Ga0495640_0519742 | 3300046533 | Bacteria | 723 |
| 1136 | Ga0495586_0002269 | 3300046535 | Bacteria | 10462 |
| 1137 | Ga0495586_0185840 | 3300046535 | Bacteria | 1176 |
| 1138 | Ga0495586_0318107 | 3300046535 | Bacteria | 892 |
| 1139 | Ga0495586_0760786 | 3300046535 | Bacteria | 559 |
| 1140 | Ga0495587_0010344 | 3300046536 | Bacteria | 5944 |
| 1141 | Ga0495598_0343615 | 3300046537 | Bacteria | 573 |
| 1142 | Ga0495621_0005915 | 3300046539 | Bacteria | 3544 |
| 1143 | Ga0495621_0023324 | 3300046539 | Bacteria | 2058 |
| 1144 | Ga0495621_0040705 | 3300046539 | Bacteria | 1629 |
| 1145 | Ga0495621_0333202 | 3300046539 | Bacteria | 634 |
| 1146 | Ga0495645_0144881 | 3300046543 | Bacteria | 1655 |
| 1147 | Ga0495622_0035325 | 3300046557 | Bacteria | 2331 |
| 1148 | Ga0495622_0043054 | 3300046557 | Bacteria | 2099 |
| 1149 | Ga0495622_0083252 | 3300046557 | Bacteria | 1472 |
| 1150 | Ga0495667_0005211 | 3300046559 | Bacteria | 8787 |
| 1151 | Ga0495667_0084907 | 3300046559 | Bacteria | 2055 |
| 1152 | Ga0495667_0209176 | 3300046559 | Bacteria | 1247 |
| 1153 | Ga0495667_0286318 | 3300046559 | Bacteria | 1046 |
| 1154 | Ga0495656_0482833 | 3300046615 | Bacteria | 656 |
| 1155 | Ga0495668_0062051 | 3300046616 | Bacteria | 2060 |
| 1156 | Ga0495634_0005555 | 3300046642 | Bacteria | 9676 |
| 1157 | Ga0495634_0026444 | 3300046642 | Bacteria | 4049 |
| 1158 | Ga0495634_0082890 | 3300046642 | Bacteria | 2094 |
| 1159 | Ga0495634_0451135 | 3300046642 | Bacteria | 759 |
| 1160 | Ga0495611_0305797 | 3300046648 | Bacteria | 733 |
| 1161 | Ga0495625_0199301 | 3300046660 | Bacteria | 1322 |
| 1162 | Ga0495635_0036970 | 3300046663 | Bacteria | 3381 |
| 1163 | Ga0495635_0254519 | 3300046663 | Bacteria | 1183 |
| 1164 | Ga0495635_0259549 | 3300046663 | Bacteria | 1170 |
| 1165 | Ga0495635_0413724 | 3300046663 | Bacteria | 894 |
| 1166 | Ga0495659_0207194 | 3300046664 | Bacteria | 806 |
| 1167 | Ga0495588_0007409 | 3300046674 | Bacteria | 4992 |
| 1168 | Ga0495588_0282083 | 3300046674 | Bacteria | 875 |
| 1169 | Ga0495657_0076174 | 3300046675 | Bacteria | 2179 |
| 1170 | Ga0495657_0286504 | 3300046675 | Bacteria | 985 |
| 1171 | Ga0495599_0014294 | 3300046678 | Bacteria | 4916 |
| 1172 | Ga0495599_0436783 | 3300046678 | Bacteria | 776 |
| 1173 | Ga0495623_0122646 | 3300046679 | Bacteria | 1563 |
| 1174 | Ga0495623_0416531 | 3300046679 | Bacteria | 720 |
| 1175 | Ga0495646_0005872 | 3300046680 | Bacteria | 7784 |
| 1176 | Ga0495647_0001142 | 3300046681 | Bacteria | 8146 |
| 1177 | Ga0495647_0001430 | 3300046681 | Bacteria | 7386 |
| 1178 | Ga0495647_0007001 | 3300046681 | Bacteria | 3758 |
| 1179 | Ga0495647_0200845 | 3300046681 | Bacteria | 874 |
| 1180 | Ga0495658_0006322 | 3300046683 | Bacteria | 5822 |
| 1181 | Ga0495658_0026289 | 3300046683 | Bacteria | 3118 |
| 1182 | Ga0495658_0299461 | 3300046683 | Bacteria | 1017 |
| 1183 | Ga0495658_1111031 | 3300046683 | Bacteria | 504 |
| 1184 | Ga0495613_0031123 | 3300046689 | Bacteria | 3963 |
| 1185 | Ga0495613_0057851 | 3300046689 | Bacteria | 2846 |
| 1186 | Ga0495613_0142592 | 3300046689 | Bacteria | 1711 |
| 1187 | Ga0495613_0215168 | 3300046689 | Bacteria | 1350 |
| 1188 | Ga0495624_0222703 | 3300046690 | Bacteria | 1144 |
| 1189 | Ga0495600_0029991 | 3300046809 | Bacteria | 3523 |
| 1190 | Ga0495600_0134740 | 3300046809 | Bacteria | 1605 |
| 1191 | Ga0495581_0010001 | 3300047315 | Bacteria | 5486 |
| 1192 | Ga0495581_0202412 | 3300047315 | Bacteria | 1161 |
| 1193 | Ga0495604_0001820 | 3300047317 | Bacteria | 17360 |
| 1194 | Ga0495604_0150797 | 3300047317 | Bacteria | 1652 |
| 1195 | Ga0495674_0004030 | 3300047319 | Bacteria | 14220 |
| 1196 | Ga0495674_0008008 | 3300047319 | Bacteria | 10088 |
| 1197 | Ga0495674_0242520 | 3300047319 | Bacteria | 1485 |
| 1198 | Ga0495676_0041416 | 3300047321 | Bacteria | 3791 |
| 1199 | Ga0495676_0048143 | 3300047321 | Bacteria | 3440 |
| 1200 | Ga0495676_0051428 | 3300047321 | Bacteria | 3296 |
| 1201 | Ga0495680_0009082 | 3300047322 | Bacteria | 8975 |
| 1202 | Ga0495680_0053072 | 3300047322 | Bacteria | 3157 |
| 1203 | Ga0495680_0094585 | 3300047322 | Bacteria | 2236 |
| 1204 | Ga0495680_0395616 | 3300047322 | Bacteria | 955 |
| 1205 | Ga0495675_0372724 | 3300047444 | Bacteria | 836 |
| 1206 | Ga0495675_0622857 | 3300047444 | Bacteria | 610 |
| 1207 | Ga0495677_0351330 | 3300047445 | Bacteria | 582 |
| 1208 | Ga0495684_0051053 | 3300047471 | Bacteria | 3157 |
| 1209 | Ga0495593_0006649 | 3300047673 | Bacteria | 6767 |
| 1210 | Ga0495593_0031319 | 3300047673 | Bacteria | 2906 |
| 1211 | Ga0495593_0118869 | 3300047673 | Bacteria | 1346 |
| 1212 | Ga0495593_0436149 | 3300047673 | Bacteria | 655 |
| 1213 | Ga0495602_0015631 | 3300048088 | Bacteria | 7653 |
| 1214 | Ga0495602_0302113 | 3300048088 | Bacteria | 1171 |
| 1215 | Ga0495602_0307597 | 3300048088 | Bacteria | 1158 |
| 1216 | Ga0495614_0210830 | 3300048089 | Bacteria | 881 |
| 1217 | Ga0496100_0282161 | 3300048903 | Bacteria | 1238 |
| 1218 | Ga0496101_0078839 | 3300048904 | Bacteria | 2430 |
| 1219 | Ga0496101_0203612 | 3300048904 | Bacteria | 1531 |
| 1220 | Ga0496101_0323614 | 3300048904 | Bacteria | 1210 |
| 1221 | Ga0496102_0006530 | 3300048905 | Bacteria | 9953 |
| 1222 | Ga0496102_0171415 | 3300048905 | Bacteria | 2043 |
| 1223 | Ga0496102_0174863 | 3300048905 | Bacteria | 2022 |
| 1224 | Ga0496102_0469931 | 3300048905 | Bacteria | 1178 |
| 1225 | Ga0496102_0649735 | 3300048905 | Bacteria | 978 |
| 1226 | Ga0496103_0401436 | 3300048906 | Bacteria | 880 |
| 1227 | Ga0496104_0023361 | 3300048907 | Bacteria | 5684 |
| 1228 | Ga0496104_0727771 | 3300048907 | Bacteria | 899 |
| 1229 | Ga0496105_0059059 | 3300048908 | Bacteria | 3164 |
| 1230 | Ga0496106_0001392 | 3300048909 | Bacteria | 18135 |
| 1231 | Ga0496106_0430748 | 3300048909 | Bacteria | 1060 |
| 1232 | Ga0496106_0982397 | 3300048909 | Bacteria | 664 |
| 1233 | Ga0496106_1583184 | 3300048909 | Bacteria | 502 |
| 1234 | Ga0496107_0151151 | 3300048910 | Bacteria | 1717 |
| 1235 | Ga0496107_0880682 | 3300048910 | Bacteria | 653 |
| 1236 | Ga0496108_0049767 | 3300048911 | Bacteria | 3505 |
| 1237 | Ga0496108_0469302 | 3300048911 | Bacteria | 1100 |
| 1238 | Ga0496108_0908654 | 3300048911 | Bacteria | 755 |
| 1239 | Ga0496109_0015325 | 3300048912 | Bacteria | 6677 |
| 1240 | Ga0496109_0127622 | 3300048912 | Bacteria | 2372 |
| 1241 | Ga0496109_0140878 | 3300048912 | Bacteria | 2254 |
| 1242 | Ga0496109_1118299 | 3300048912 | Bacteria | 725 |
| 1243 | Ga0496110_0036932 | 3300048913 | Bacteria | 4244 |
| 1244 | Ga0496110_0238421 | 3300048913 | Bacteria | 1655 |
| 1245 | Ga0496110_0593092 | 3300048913 | Bacteria | 1005 |
| 1246 | Ga0496110_0606365 | 3300048913 | Bacteria | 993 |
| 1247 | Ga0496110_0967264 | 3300048913 | Bacteria | 758 |
| 1248 | Ga0496110_1900217 | 3300048913 | Bacteria | 505 |
| 1249 | Ga0496111_0131281 | 3300048914 | Bacteria | 1853 |
| 1250 | Ga0496111_0157727 | 3300048914 | Bacteria | 1684 |
| 1251 | Ga0496111_0756016 | 3300048914 | Bacteria | 705 |
| 1252 | Ga0496111_1111670 | 3300048914 | Bacteria | 563 |
| 1253 | Ga0496112_0003253 | 3300048915 | Bacteria | 13397 |
| 1254 | Ga0496112_1264623 | 3300048915 | Bacteria | 654 |
| 1255 | Ga0496112_1385731 | 3300048915 | Bacteria | 618 |
| 1256 | Ga0496113_0028635 | 3300048916 | Bacteria | 4009 |
| 1257 | Ga0496113_0120256 | 3300048916 | Bacteria | 2052 |
| 1258 | Ga0496113_0409775 | 3300048916 | Bacteria | 1088 |
| 1259 | Ga0496113_1209526 | 3300048916 | Bacteria | 590 |
| 1260 | Ga0496114_0103681 | 3300048917 | Bacteria | 2431 |
| 1261 | Ga0496114_0435101 | 3300048917 | Bacteria | 1162 |
| 1262 | Ga0496114_0806597 | 3300048917 | Bacteria | 818 |
| 1263 | Ga0496115_0165105 | 3300048918 | Bacteria | 1831 |
| 1264 | Ga0496115_0795334 | 3300048918 | Bacteria | 736 |
| 1265 | Ga0496125_0378184 | 3300048928 | Bacteria | 836 |
| 1266 | Ga0501292_081580 | 3300049515 | Bacteria | 616 |
| 1267 | Ga0501298_034855 | 3300049521 | Bacteria | 1002 |
| 1268 | Ga0501298_098036 | 3300049521 | Bacteria | 665 |
| 1269 | Ga0501299_029061 | 3300049522 | Bacteria | 1057 |
| 1270 | Ga0501031_0213980 | 3300049568 | Bacteria | 1255 |
| 1271 | Ga0501031_0471885 | 3300049568 | Bacteria | 810 |
| 1272 | Ga0501032_0393350 | 3300049569 | Bacteria | 891 |
| 1273 | Ga0501032_0452301 | 3300049569 | Bacteria | 823 |
| 1274 | Ga0501034_0037339 | 3300049571 | Bacteria | 4918 |
| 1275 | Ga0501034_0070904 | 3300049571 | Bacteria | 3495 |
| 1276 | Ga0501034_0483758 | 3300049571 | Bacteria | 1153 |
| 1277 | Ga0501034_1389467 | 3300049571 | Bacteria | 577 |
| 1278 | Ga0501036_0162187 | 3300049572 | Bacteria | 1884 |
| 1279 | Ga0501036_0218791 | 3300049572 | Bacteria | 1599 |
| 1280 | Ga0501036_0308645 | 3300049572 | Bacteria | 1323 |
| 1281 | Ga0501036_0378978 | 3300049572 | Bacteria | 1181 |
| 1282 | Ga0501037_0205309 | 3300049573 | Bacteria | 1391 |
| 1283 | Ga0501037_0351409 | 3300049573 | Bacteria | 1017 |
| 1284 | Ga0501038_0047221 | 3300049574 | Bacteria | 3730 |
| 1285 | Ga0501038_0467653 | 3300049574 | Bacteria | 968 |
| 1286 | Ga0501039_0009254 | 3300049575 | Bacteria | 7505 |
| 1287 | Ga0501039_0022793 | 3300049575 | Bacteria | 4803 |
| 1288 | Ga0501039_0089592 | 3300049575 | Bacteria | 2397 |
| 1289 | Ga0501039_0382638 | 3300049575 | Bacteria | 1105 |
| 1290 | Ga0501039_0659625 | 3300049575 | Bacteria | 819 |
| 1291 | Ga0501039_1307404 | 3300049575 | Bacteria | 559 |
| 1292 | Ga0501040_0041439 | 3300049576 | Bacteria | 3136 |
| 1293 | Ga0501040_0105919 | 3300049576 | Bacteria | 1965 |
| 1294 | Ga0501040_0238892 | 3300049576 | Bacteria | 1295 |
| 1295 | Ga0501040_0308782 | 3300049576 | Bacteria | 1131 |
| 1296 | Ga0501040_0623235 | 3300049576 | Bacteria | 779 |
| 1297 | Ga0501040_0763689 | 3300049576 | Bacteria | 699 |
| 1298 | Ga0501040_0983560 | 3300049576 | Bacteria | 612 |
| 1299 | Ga0501041_0005794 | 3300049577 | Bacteria | 7220 |
| 1300 | Ga0501041_0085321 | 3300049577 | Bacteria | 1947 |
| 1301 | Ga0501041_0159468 | 3300049577 | Bacteria | 1410 |
| 1302 | Ga0501041_0216217 | 3300049577 | Bacteria | 1202 |
| 1303 | Ga0501042_0086669 | 3300049578 | Bacteria | 2246 |
| 1304 | Ga0501042_0277917 | 3300049578 | Bacteria | 1209 |
| 1305 | Ga0501042_0472367 | 3300049578 | Bacteria | 910 |
| 1306 | Ga0501042_0813836 | 3300049578 | Bacteria | 680 |
| 1307 | Ga0501042_1349569 | 3300049578 | Bacteria | 520 |
| 1308 | Ga0501043_0034922 | 3300049579 | Bacteria | 3955 |
| 1309 | Ga0501043_0575817 | 3300049579 | Bacteria | 834 |
| 1310 | Ga0501043_1181769 | 3300049579 | Bacteria | 538 |
| 1311 | Ga0501046_0107096 | 3300049580 | Bacteria | 2139 |
| 1312 | Ga0501046_0264329 | 3300049580 | Bacteria | 1263 |
| 1313 | Ga0501046_0697276 | 3300049580 | Bacteria | 715 |
| 1314 | Ga0501047_0007381 | 3300049581 | Bacteria | 10341 |
| 1315 | Ga0501047_0043016 | 3300049581 | Bacteria | 4364 |
| 1316 | Ga0501047_0054694 | 3300049581 | Bacteria | 3861 |
| 1317 | Ga0501048_0065342 | 3300049582 | Bacteria | 2572 |
| 1318 | Ga0501048_0562567 | 3300049582 | Bacteria | 818 |
| 1319 | Ga0501048_0819906 | 3300049582 | Bacteria | 669 |
| 1320 | Ga0501067_0028457 | 3300049583 | Bacteria | 3096 |
| 1321 | Ga0501067_0055645 | 3300049583 | Bacteria | 2192 |
| 1322 | Ga0501067_0112358 | 3300049583 | Bacteria | 1515 |
| 1323 | Ga0501067_0299812 | 3300049583 | Bacteria | 895 |
| 1324 | Ga0501067_0397242 | 3300049583 | Bacteria | 769 |
| 1325 | Ga0501067_0451750 | 3300049583 | Bacteria | 718 |
| 1326 | Ga0501067_0617117 | 3300049583 | Bacteria | 608 |
| 1327 | Ga0501068_0008133 | 3300049584 | Bacteria | 5825 |
| 1328 | Ga0501068_0419184 | 3300049584 | Bacteria | 864 |
| 1329 | Ga0501069_0017609 | 3300049585 | Bacteria | 3849 |
| 1330 | Ga0501069_0247272 | 3300049585 | Bacteria | 1040 |
| 1331 | Ga0501069_0476478 | 3300049585 | Bacteria | 743 |
| 1332 | Ga0501070_0004618 | 3300049586 | Bacteria | 11808 |
| 1333 | Ga0501070_0009796 | 3300049586 | Bacteria | 8105 |
| 1334 | Ga0501070_0251633 | 3300049586 | Bacteria | 1445 |
| 1335 | Ga0501070_0648778 | 3300049586 | Bacteria | 838 |
| 1336 | Ga0501071_0001498 | 3300049587 | Bacteria | 13582 |
| 1337 | Ga0501071_0002072 | 3300049587 | Bacteria | 12022 |
| 1338 | Ga0501071_0011658 | 3300049587 | Bacteria | 5933 |
| 1339 | Ga0501071_0462973 | 3300049587 | Bacteria | 971 |
| 1340 | Ga0501072_0027869 | 3300049588 | Bacteria | 4408 |
| 1341 | Ga0501072_0154871 | 3300049588 | Bacteria | 1827 |
| 1342 | Ga0501072_0215155 | 3300049588 | Bacteria | 1531 |
| 1343 | Ga0501072_0364873 | 3300049588 | Bacteria | 1146 |
| 1344 | Ga0501073_0002898 | 3300049589 | Bacteria | 12869 |
| 1345 | Ga0501073_0006777 | 3300049589 | Bacteria | 8520 |
| 1346 | Ga0501073_0053748 | 3300049589 | Bacteria | 2819 |
| 1347 | Ga0501073_0695868 | 3300049589 | Bacteria | 701 |
| 1348 | Ga0501074_0017221 | 3300049590 | Bacteria | 5243 |
| 1349 | Ga0501074_0030208 | 3300049590 | Bacteria | 3927 |
| 1350 | Ga0501074_0255408 | 3300049590 | Bacteria | 1246 |
| 1351 | Ga0501074_0319323 | 3300049590 | Bacteria | 1103 |
| 1352 | Ga0501074_0664584 | 3300049590 | Bacteria | 736 |
| 1353 | Ga0501074_0769779 | 3300049590 | Bacteria | 679 |
| 1354 | Ga0501074_1183224 | 3300049590 | Bacteria | 536 |
| 1355 | Ga0501075_0050707 | 3300049591 | Bacteria | 3120 |
| 1356 | Ga0501075_0158308 | 3300049591 | Bacteria | 1727 |
| 1357 | Ga0501075_0284217 | 3300049591 | Bacteria | 1260 |
| 1358 | Ga0501075_0357369 | 3300049591 | Bacteria | 1113 |
| 1359 | Ga0501075_0458307 | 3300049591 | Bacteria | 972 |
| 1360 | Ga0501075_1093183 | 3300049591 | Bacteria | 606 |
| 1361 | Ga0501075_1223619 | 3300049591 | Bacteria | 570 |
| 1362 | Ga0501076_0048224 | 3300049592 | Bacteria | 3367 |
| 1363 | Ga0501076_0113880 | 3300049592 | Bacteria | 2188 |
| 1364 | Ga0501076_0219221 | 3300049592 | Bacteria | 1555 |
| 1365 | Ga0501076_0590754 | 3300049592 | Bacteria | 916 |
| 1366 | Ga0501077_0087227 | 3300049593 | Bacteria | 1978 |
| 1367 | Ga0501077_0217860 | 3300049593 | Bacteria | 1213 |
| 1368 | Ga0501077_0238284 | 3300049593 | Bacteria | 1156 |
| 1369 | Ga0501077_1045087 | 3300049593 | Bacteria | 526 |
| 1370 | Ga0501208_147853 | 3300049655 | Bacteria | 532 |
| 1371 | Ga0501216_165927 | 3300049660 | Bacteria | 532 |
| 1372 | Ga0501217_076101 | 3300049661 | Bacteria | 921 |
| 1373 | Ga0501217_131685 | 3300049661 | Bacteria | 734 |
| 1374 | Ga0501233_069758 | 3300049668 | Bacteria | 888 |
| 1375 | Ga0501235_077175 | 3300049669 | Bacteria | 793 |
| 1376 | Ga0501246_033641 | 3300049676 | Bacteria | 587 |
| 1377 | Ga0501079_0042166 | 3300049741 | Bacteria | 3525 |
| 1378 | Ga0501079_0047536 | 3300049741 | Bacteria | 3310 |
| 1379 | Ga0501079_0284662 | 3300049741 | Bacteria | 1292 |
| 1380 | Ga0501079_0553872 | 3300049741 | Bacteria | 904 |
| 1381 | Ga0501079_0816768 | 3300049741 | Bacteria | 734 |
| 1382 | Ga0501080_0006525 | 3300049742 | Bacteria | 10481 |
| 1383 | Ga0501080_0018146 | 3300049742 | Bacteria | 6513 |
| 1384 | Ga0501080_0065999 | 3300049742 | Bacteria | 3365 |
| 1385 | Ga0501080_0091743 | 3300049742 | Bacteria | 2821 |
| 1386 | Ga0501080_0294711 | 3300049742 | Bacteria | 1472 |
| 1387 | Ga0501080_0324807 | 3300049742 | Bacteria | 1392 |
| 1388 | Ga0501080_0737786 | 3300049742 | Bacteria | 867 |
| 1389 | Ga0501081_0101725 | 3300049743 | Bacteria | 2032 |
| 1390 | Ga0501081_0234824 | 3300049743 | Bacteria | 1336 |
| 1391 | Ga0501081_0318727 | 3300049743 | Bacteria | 1142 |
| 1392 | Ga0501081_0512190 | 3300049743 | Bacteria | 895 |
| 1393 | Ga0501081_0596987 | 3300049743 | Bacteria | 826 |
| 1394 | Ga0501081_0731045 | 3300049743 | Bacteria | 743 |
| 1395 | Ga0501083_0012201 | 3300049744 | Bacteria | 6013 |
| 1396 | Ga0501083_0017852 | 3300049744 | Bacteria | 4949 |
| 1397 | Ga0501083_0139059 | 3300049744 | Bacteria | 1590 |
| 1398 | Ga0501083_0148584 | 3300049744 | Bacteria | 1534 |
| 1399 | Ga0501083_0308607 | 3300049744 | Bacteria | 1029 |
| 1400 | Ga0501083_0600626 | 3300049744 | Bacteria | 716 |
| 1401 | Ga0501270_147032 | 3300049767 | Bacteria | 534 |
| 1402 | Ga0501283_011611 | 3300049779 | Bacteria | 1313 |
| 1403 | Ga0501035_0529999 | 3300049822 | Bacteria | 967 |
| 1404 | Ga0501035_0681280 | 3300049822 | Bacteria | 831 |
| 1405 | Ga0501035_0725919 | 3300049822 | Bacteria | 799 |
| 1406 | Ga0501044_0015376 | 3300049823 | Bacteria | 8241 |
| 1407 | Ga0501044_0239820 | 3300049823 | Bacteria | 1757 |
| 1408 | Ga0501045_0071244 | 3300049824 | Bacteria | 2558 |
| 1409 | Ga0501045_0208124 | 3300049824 | Bacteria | 1457 |
| 1410 | Ga0501045_0619428 | 3300049824 | Bacteria | 801 |
| 1411 | Ga0501045_0640772 | 3300049824 | Bacteria | 786 |
| 1412 | Ga0501045_0777151 | 3300049824 | Bacteria | 705 |
| 1413 | Ga0501204_019434 | 3300049850 | Bacteria | 876 |
| 1414 | Ga0501212_049278 | 3300049851 | Bacteria | 711 |
| 1415 | nmdc:mga03683_5884_c1 | 3300050489 | Bacteria | 4170 |
| 1416 | nmdc:mga03n38_125_c1 | 3300050490 | Bacteria | 16669 |
| 1417 | nmdc:mga00v17_565_c1 | 3300050491 | Bacteria | 20718 |
| 1418 | nmdc:mga0yw44_170996_c1 | 3300050492 | Bacteria | 1427 |
| 1419 | nmdc:mga0yw44_811_c1 | 3300050492 | Bacteria | 11637 |
| 1420 | nmdc:mga06z11_1903_c1 | 3300050494 | Bacteria | 7874 |
| 1421 | nmdc:mga04h51_3880_c1 | 3300050495 | Bacteria | 3677 |
| 1422 | nmdc:mga05p37_1283494_c1 | 3300050507 | Bacteria | 748 |
| 1423 | nmdc:mga05p37_355_c1 | 3300050507 | Bacteria | 49150 |
| 1424 | nmdc:mga05p37_7114_c1 | 3300050507 | Bacteria | 13190 |
| 1425 | nmdc:mga05p37_952760_c1 | 3300050507 | Bacteria | 918 |
| 1426 | nmdc:mga09592_17223_c1 | 3300050508 | Bacteria | 5917 |
| 1427 | nmdc:mga09592_1792_c1 | 3300050508 | Bacteria | 17230 |
| 1428 | nmdc:mga09592_204680_c1 | 3300050508 | Bacteria | 1709 |
| 1429 | nmdc:mga09592_21121_c1 | 3300050508 | Bacteria | 5363 |
| 1430 | nmdc:mga09592_272438_c1 | 3300050508 | Bacteria | 1468 |
| 1431 | nmdc:mga09592_547455_c1 | 3300050508 | Bacteria | 994 |
| 1432 | nmdc:mga0qj67_284205_c1 | 3300050509 | Bacteria | 1341 |
| 1433 | nmdc:mga0qj67_336788_c1 | 3300050509 | Bacteria | 1221 |
| 1434 | nmdc:mga0qj67_360502_c1 | 3300050509 | Bacteria | 1175 |
| 1435 | nmdc:mga0qj67_853527_c1 | 3300050509 | Bacteria | 719 |
| 1436 | nmdc:mga06r32_158503_c1 | 3300050510 | Bacteria | 2245 |
| 1437 | nmdc:mga06r32_167341_c1 | 3300050510 | Bacteria | 2181 |
| 1438 | nmdc:mga06r32_293964_c1 | 3300050510 | Bacteria | 1611 |
| 1439 | nmdc:mga06r32_570574_c1 | 3300050510 | Bacteria | 1104 |
| 1440 | nmdc:mga08y16_101924_c1 | 3300050511 | Bacteria | 2988 |
| 1441 | nmdc:mga08y16_14088_c1 | 3300050511 | Bacteria | 2974 |
| 1442 | nmdc:mga08y16_18626_c1 | 3300050511 | Bacteria | 7313 |
| 1443 | nmdc:mga08y16_197067_c1 | 3300050511 | Bacteria | 2087 |
| 1444 | nmdc:mga08y16_213614_c1 | 3300050511 | Bacteria | 1998 |
| 1445 | nmdc:mga08y16_261479_c1 | 3300050511 | Bacteria | 1787 |
| 1446 | nmdc:mga08y16_423612_c1 | 3300050511 | Bacteria | 1360 |
| 1447 | nmdc:mga08y16_4258_c1 | 3300050511 | Bacteria | 14941 |
| 1448 | nmdc:mga0n895_1478842_c1 | 3300050512 | Bacteria | 646 |
| 1449 | nmdc:mga0n895_1843217_c1 | 3300050512 | Bacteria | 565 |
| 1450 | nmdc:mga0n895_36969_c1 | 3300050512 | Bacteria | 4720 |
| 1451 | nmdc:mga0n895_470256_c1 | 3300050512 | Bacteria | 1268 |
| 1452 | nmdc:mga0n895_5640_c1 | 3300050512 | Bacteria | 10489 |
| 1453 | nmdc:mga0n895_802994_c1 | 3300050512 | Bacteria | 931 |
| 1454 | nmdc:mga0rr50_1003820_c1 | 3300050513 | Bacteria | 711 |
| 1455 | nmdc:mga0rr50_101580_c1 | 3300050513 | Bacteria | 2261 |
| 1456 | nmdc:mga0rr50_133033_c1 | 3300050513 | Bacteria | 1993 |
| 1457 | nmdc:mga0rr50_1406_c1 | 3300050513 | Bacteria | 13196 |
| 1458 | nmdc:mga0rr50_172666_c1 | 3300050513 | Bacteria | 1763 |
| 1459 | nmdc:mga0rr50_267644_c1 | 3300050513 | Bacteria | 1423 |
| 1460 | nmdc:mga0rr50_541424_c1 | 3300050513 | Bacteria | 991 |
| 1461 | nmdc:mga0rr50_61731_c1 | 3300050513 | Bacteria | 2825 |
| 1462 | nmdc:mga0rr50_71538_c1 | 3300050513 | Bacteria | 2647 |
| 1463 | nmdc:mga08x19_21595_c1 | 3300050514 | Bacteria | 3977 |
| 1464 | nmdc:mga08x19_28316_c1 | 3300050514 | Bacteria | 3508 |
| 1465 | nmdc:mga08x19_431822_c1 | 3300050514 | Bacteria | 926 |
| 1466 | nmdc:mga08x19_49998_c1 | 3300050514 | Bacteria | 2682 |
| 1467 | nmdc:mga08x19_71273_c1 | 3300050514 | Bacteria | 2266 |
| 1468 | nmdc:mga08x19_9133_c1 | 3300050514 | Bacteria | 5919 |
| 1469 | nmdc:mga0a205_1205520_c1 | 3300050515 | Bacteria | 605 |
| 1470 | nmdc:mga0a205_136217_c1 | 3300050515 | Bacteria | 2356 |
| 1471 | nmdc:mga0a205_294_c1 | 3300050515 | Bacteria | 36893 |
| 1472 | Ga0495601_0002136 | 3300053077 | Bacteria | 11126 |
| 1473 | Ga0495601_0010686 | 3300053077 | Bacteria | 5474 |
| 1474 | Ga0495612_0008626 | 3300053078 | Bacteria | 4133 |
| 1475 | Ga0495612_0043466 | 3300053078 | Bacteria | 1836 |
| 1476 | Ga0495612_0210857 | 3300053078 | Bacteria | 858 |
| 1477 | Ga0495655_0373090 | 3300053083 | Bacteria | 503 |
| 1478 | Ga0495595_0000270 | 3300053084 | Bacteria | 20465 |
| 1479 | Ga0495595_0050637 | 3300053084 | Bacteria | 1924 |
| 1480 | Ga0495595_0327898 | 3300053084 | Bacteria | 771 |
| 1481 | Ga0495619_0000324 | 3300053085 | Bacteria | 33369 |
| 1482 | Ga0495619_0002457 | 3300053085 | Bacteria | 12130 |
| 1483 | Ga0495619_0022462 | 3300053085 | Bacteria | 4038 |
| 1484 | Ga0495619_0429373 | 3300053085 | Bacteria | 911 |
| 1485 | Ga0500616_0073015 | 3300053153 | Bacteria | 1743 |
| 1486 | Ga0501084_0034148 | 3300054114 | Bacteria | 4253 |
| 1487 | Ga0501084_0195928 | 3300054114 | Bacteria | 1704 |
| 1488 | Ga0501084_0351460 | 3300054114 | Bacteria | 1245 |
| 1489 | Ga0501084_0601003 | 3300054114 | Bacteria | 929 |
| 1490 | Ga0501084_0674879 | 3300054114 | Bacteria | 872 |
| 1491 | Ga0501084_0806262 | 3300054114 | Bacteria | 791 |
| 1492 | Ga0501084_0927880 | 3300054114 | Bacteria | 732 |
| 1493 | Ga0501084_1006995 | 3300054114 | Bacteria | 700 |
| 1494 | Ga0590077_055784 | 3300059426 | Bacteria | 891 |
| 1495 | Ga0501082_0058019 | 3300060353 | Bacteria | 3335 |
| 1496 | Ga0501082_0101184 | 3300060353 | Bacteria | 2493 |
| 1497 | Ga0501082_0126930 | 3300060353 | Bacteria | 2212 |
| 1498 | Ga0501082_0145715 | 3300060353 | Bacteria | 2056 |
| 1499 | Ga0501082_0363831 | 3300060353 | Bacteria | 1262 |
| 1500 | Ga0501082_0659404 | 3300060353 | Bacteria | 916 |
| 1501 | Ga0501082_0871948 | 3300060353 | Bacteria | 787 |
| 1502 | Ga0501082_1915553 | 3300060353 | Bacteria | 517 |
| 1503 | Ga0530510_0079461 | 3300061734 | Bacteria | 2385 |
| 1504 | Ga0530510_0083068 | 3300061734 | Bacteria | 2333 |
| 1505 | Ga0530510_0754718 | 3300061734 | Bacteria | 742 |
| 1506 | Ga0530510_0832149 | 3300061734 | Bacteria | 705 |
| 1507 | Ga0530510_1412585 | 3300061734 | Bacteria | 534 |
| 1508 | Ga0400483_066041 | |||
| 1509 | ARcpr5oldR_c008724 | |||
| 1510 | ARSoilOldRDRAFT_c007538 | |||
| 1511 | ARCol0yngRDRAFT_1004242 | |||
| 1512 | JGI24752J21851_1025306 | |||
| 1513 | JGI24737J22298_10095247 | |||
| 1514 | JGI24742J22300_10022069 | |||
| 1515 | JGI25406J46586_10038211 | |||
| 1516 | JGI25406J46586_10210527 | |||
| 1517 | JGI25405J52794_10008962 | |||
| 1518 | Ga0065712_10005527 | |||
| 1519 | Ga0065712_10108843 | |||
| 1520 | Ga0065715_10620808 | |||
| 1521 | Ga0065707_10002365 | |||
| 1522 | Ga0065707_10088467 | |||
| 1523 | Ga0065707_10099260 | |||
| 1524 | Ga0065707_10636557 | |||
| 1525 | Ga0070658_10102291 | |||
| 1526 | Ga0070658_10242319 | |||
| 1527 | Ga0070676_10061777 | |||
| 1528 | Ga0070676_10068148 | |||
| 1529 | Ga0070676_10097603 | |||
| 1530 | Ga0070676_10219955 | |||
| 1531 | Ga0070683_100074710 | |||
| 1532 | Ga0070683_100091214 | |||
| 1533 | Ga0070690_100000203 | |||
| 1534 | Ga0070690_100115816 | |||
| 1535 | Ga0070690_100937605 | |||
| 1536 | Ga0070670_100024117 | |||
| 1537 | Ga0070670_100025997 | |||
| 1538 | Ga0070670_100244519 | |||
| 1539 | Ga0070670_100586894 | |||
| 1540 | Ga0070677_10003307 | |||
| 1541 | Ga0070677_10183258 | |||
| 1542 | Ga0068869_100001312 | |||
| 1543 | Ga0068869_100013668 | |||
| 1544 | Ga0068869_100599159 | |||
| 1545 | Ga0068869_100898034 | |||
| 1546 | Ga0068869_101027895 | |||
| 1547 | Ga0068869_101082364 | |||
| 1548 | Ga0070666_10065140 | |||
| 1549 | Ga0070666_10235412 | |||
| 1550 | Ga0070666_10743376 | |||
| 1551 | Ga0070666_10815464 | |||
| 1552 | Ga0070680_100003010 | |||
| 1553 | Ga0070680_100050080 | |||
| 1554 | Ga0070680_100368816 | |||
| 1555 | Ga0070682_100003169 | |||
| 1556 | Ga0070682_100021852 | |||
| 1557 | Ga0070682_100352302 | |||
| 1558 | Ga0070682_100948056 | |||
| 1559 | Ga0068868_100206121 | |||
| 1560 | Ga0068868_100669108 | |||
| 1561 | Ga0070660_100013058 | |||
| 1562 | Ga0070660_100069127 | |||
| 1563 | Ga0070660_100245986 | |||
| 1564 | Ga0070660_100725806 | |||
| 1565 | Ga0070689_100005620 | |||
| 1566 | Ga0070689_100008280 | |||
| 1567 | Ga0070689_100049288 | |||
| 1568 | Ga0070689_100209773 | |||
| 1569 | Ga0070689_100267632 | |||
| 1570 | Ga0070689_100395251 | |||
| 1571 | Ga0070689_100868643 | |||
| 1572 | Ga0070691_10000424 | |||
| 1573 | Ga0070687_100000070 | |||
| 1574 | Ga0070687_100026386 | |||
| 1575 | Ga0070687_100125820 | |||
| 1576 | Ga0070687_100126903 | |||
| 1577 | Ga0070687_100599323 | |||
| 1578 | Ga0070687_100835024 | |||
| 1579 | Ga0070661_100001889 | |||
| 1580 | Ga0070661_100070625 | |||
| 1581 | Ga0070661_100285902 | |||
| 1582 | Ga0070661_100491845 | |||
| 1583 | Ga0070692_10003621 | |||
| 1584 | Ga0070692_10141185 | |||
| 1585 | Ga0070668_100017254 | |||
| 1586 | Ga0070668_100155309 | |||
| 1587 | Ga0070668_100318058 | |||
| 1588 | Ga0070668_100463440 | |||
| 1589 | Ga0070668_101144151 | |||
| 1590 | Ga0070669_100001468 | |||
| 1591 | Ga0070669_100159340 | |||
| 1592 | Ga0070669_100176116 | |||
| 1593 | Ga0070669_100403643 | |||
| 1594 | Ga0070669_100533857 | |||
| 1595 | Ga0070669_100574985 | |||
| 1596 | Ga0070675_100009053 | |||
| 1597 | Ga0070675_100361041 | |||
| 1598 | Ga0070675_100975905 | |||
| 1599 | Ga0070675_100993373 | |||
| 1600 | Ga0070675_101247644 | |||
| 1601 | Ga0070671_100003908 | |||
| 1602 | Ga0070671_100085878 | |||
| 1603 | Ga0070671_100281100 | |||
| 1604 | Ga0070671_100503709 | |||
| 1605 | Ga0070671_100666350 | |||
| 1606 | Ga0070671_101703464 | |||
| 1607 | Ga0070674_100002697 | |||
| 1608 | Ga0070674_100014002 | |||
| 1609 | Ga0070674_100037392 | |||
| 1610 | Ga0070674_100078744 | |||
| 1611 | Ga0070673_100015782 | |||
| 1612 | Ga0070673_100034438 | |||
| 1613 | Ga0070673_100096978 | |||
| 1614 | Ga0070673_100114289 | |||
| 1615 | Ga0070673_100690315 | |||
| 1616 | Ga0070688_100499687 | |||
| 1617 | Ga0070688_100557793 | |||
| 1618 | Ga0070688_100865594 | |||
| 1619 | Ga0070659_100051777 | |||
| 1620 | Ga0070659_100081052 | |||
| 1621 | Ga0070659_100381688 | |||
| 1622 | Ga0070667_100007696 | |||
| 1623 | Ga0070667_100061678 | |||
| 1624 | Ga0070667_100070247 | |||
| 1625 | Ga0070667_100141487 | |||
| 1626 | Ga0070703_10099978 | |||
| 1627 | Ga0070709_10058148 | |||
| 1628 | Ga0070709_10145483 | |||
| 1629 | Ga0070709_10153545 | |||
| 1630 | Ga0070709_10178377 | |||
| 1631 | Ga0070709_10379426 | |||
| 1632 | Ga0070714_100005848 | |||
| 1633 | Ga0070714_100027567 | |||
| 1634 | Ga0070714_100045447 | |||
| 1635 | Ga0070714_100057298 | |||
| 1636 | Ga0070714_100166403 | |||
| 1637 | Ga0070714_100204124 | |||
| 1638 | Ga0070714_100233930 | |||
| 1639 | Ga0070714_100267051 | |||
| 1640 | Ga0070714_100406768 | |||
| 1641 | Ga0070713_100002660 | |||
| 1642 | Ga0070713_100051664 | |||
| 1643 | Ga0070713_100086927 | |||
| 1644 | Ga0070710_10001294 | |||
| 1645 | Ga0070710_10002482 | |||
| 1646 | Ga0070710_10016968 | |||
| 1647 | Ga0070710_10185300 | |||
| 1648 | Ga0070710_10273357 | |||
| 1649 | Ga0070701_10000661 | |||
| 1650 | Ga0070701_10012854 | |||
| 1651 | Ga0070701_10103345 | |||
| 1652 | Ga0070711_100001151 | |||
| 1653 | Ga0070711_100110979 | |||
| 1654 | Ga0070711_100122578 | |||
| 1655 | Ga0070711_100555706 | |||
| 1656 | Ga0070711_100556001 | |||
| 1657 | Ga0070705_100001132 | |||
| 1658 | Ga0070705_100124126 | |||
| 1659 | Ga0070705_100183316 | |||
| 1660 | Ga0070700_100000651 | |||
| 1661 | Ga0070700_100025003 | |||
| 1662 | Ga0070700_100173283 | |||
| 1663 | Ga0070694_100000669 | |||
| 1664 | Ga0070694_100010076 | |||
| 1665 | Ga0070694_100078205 | |||
| 1666 | Ga0070708_100164107 | |||
| 1667 | Ga0070708_100867733 | |||
| 1668 | Ga0070663_100006342 | |||
| 1669 | Ga0070663_100018980 | |||
| 1670 | Ga0070663_101815155 | |||
| 1671 | Ga0070678_100153793 | |||
| 1672 | Ga0070678_100402533 | |||
| 1673 | Ga0070662_100000213 | |||
| 1674 | Ga0070662_100128084 | |||
| 1675 | Ga0070662_100277789 | |||
| 1676 | Ga0070662_100569245 | |||
| 1677 | Ga0070662_101019226 | |||
| 1678 | Ga0070662_101273185 | |||
| 1679 | Ga0070662_101372709 | |||
| 1680 | Ga0070662_101955176 | |||
| 1681 | Ga0070681_10146333 | |||
| 1682 | Ga0070681_10174957 | |||
| 1683 | Ga0070681_10211627 | |||
| 1684 | Ga0070681_10232896 | |||
| 1685 | Ga0068867_100002241 | |||
| 1686 | Ga0068867_100026348 | |||
| 1687 | Ga0068867_100070809 | |||
| 1688 | Ga0068867_100209452 | |||
| 1689 | Ga0068867_101136359 | |||
| 1690 | Ga0070685_10008574 | |||
| 1691 | Ga0070685_10014591 | |||
| 1692 | Ga0070706_100520352 | |||
| 1693 | Ga0070698_100360875 | |||
| 1694 | Ga0070698_100478213 | |||
| 1695 | Ga0070698_100742365 | |||
| 1696 | Ga0070699_100013067 | |||
| 1697 | Ga0070699_100176113 | |||
| 1698 | Ga0070699_100855114 | |||
| 1699 | Ga0070679_100007583 | |||
| 1700 | Ga0070679_100093990 | |||
| 1701 | Ga0070679_100158919 | |||
| 1702 | Ga0070679_100282888 | |||
| 1703 | Ga0070679_100343952 | |||
| 1704 | Ga0070679_100474284 | |||
| 1705 | Ga0070684_100044288 | |||
| 1706 | Ga0070684_100366942 | |||
| 1707 | Ga0070697_100022929 | |||
| 1708 | Ga0068853_100006369 | |||
| 1709 | Ga0068853_100106579 | |||
| 1710 | Ga0068853_100235539 | |||
| 1711 | Ga0068853_100576458 | |||
| 1712 | Ga0068853_101593276 | |||
| 1713 | Ga0070672_100000549 | |||
| 1714 | Ga0070672_100001925 | |||
| 1715 | Ga0070672_100008206 | |||
| 1716 | Ga0070672_100188651 | |||
| 1717 | Ga0070672_100471141 | |||
| 1718 | Ga0070686_100002595 | |||
| 1719 | Ga0070686_100006070 | |||
| 1720 | Ga0070686_100042460 | |||
| 1721 | Ga0070686_100587846 | |||
| 1722 | Ga0070695_100000808 | |||
| 1723 | Ga0070695_100137634 | |||
| 1724 | Ga0070696_100000441 | |||
| 1725 | Ga0070696_100257650 | |||
| 1726 | Ga0070696_100291239 | |||
| 1727 | Ga0070696_100378515 | |||
| 1728 | Ga0070696_100534371 | |||
| 1729 | Ga0070693_100000574 | |||
| 1730 | Ga0070693_100091125 | |||
| 1731 | Ga0070693_100920014 | |||
| 1732 | Ga0070665_100108756 | |||
| 1733 | Ga0070665_100226571 | |||
| 1734 | Ga0070665_100302154 | |||
| 1735 | Ga0070665_101486067 | |||
| 1736 | Ga0070704_100000617 | |||
| 1737 | Ga0070704_100054392 | |||
| 1738 | Ga0070704_100095571 | |||
| 1739 | Ga0070704_100188068 | |||
| 1740 | Ga0070704_100238680 | |||
| 1741 | Ga0070704_100423248 | |||
| 1742 | Ga0068855_100000606 | |||
| 1743 | Ga0068855_100010150 | |||
| 1744 | Ga0068855_100013117 | |||
| 1745 | Ga0068855_100283202 | |||
| 1746 | Ga0068855_100365630 | |||
| 1747 | Ga0070664_100001419 | |||
| 1748 | Ga0070664_100026130 | |||
| 1749 | Ga0070664_100105074 | |||
| 1750 | Ga0070664_100166809 | |||
| 1751 | Ga0070664_101184549 | |||
| 1752 | Ga0068857_100009173 | |||
| 1753 | Ga0068857_100201424 | |||
| 1754 | Ga0068857_100426228 | |||
| 1755 | Ga0068857_101285587 | |||
| 1756 | Ga0068857_101775231 | |||
| 1757 | Ga0068854_100002203 | |||
| 1758 | Ga0068854_100006160 | |||
| 1759 | Ga0068856_100001525 | |||
| 1760 | Ga0068856_100008271 | |||
| 1761 | Ga0068856_100051047 | |||
| 1762 | Ga0068856_100074478 | |||
| 1763 | Ga0068856_100198323 | |||
| 1764 | Ga0068856_100209412 | |||
| 1765 | Ga0070702_100000349 | |||
| 1766 | Ga0070702_100098605 | |||
| 1767 | Ga0068852_100002715 | |||
| 1768 | Ga0068852_100261512 | |||
| 1769 | Ga0068852_100318145 | |||
| 1770 | Ga0068852_100411322 | |||
| 1771 | Ga0068859_100000445 | |||
| 1772 | Ga0068859_100350188 | |||
| 1773 | Ga0068864_100032507 | |||
| 1774 | Ga0068864_100129378 | |||
| 1775 | Ga0068864_100481280 | |||
| 1776 | Ga0068864_100509716 | |||
| 1777 | Ga0068864_100621995 | |||
| 1778 | Ga0068866_10000640 | |||
| 1779 | Ga0068866_10028466 | |||
| 1780 | Ga0068866_10060889 | |||
| 1781 | Ga0068866_10382455 | |||
| 1782 | Ga0068861_100000246 | |||
| 1783 | Ga0068861_100171684 | |||
| 1784 | Ga0068861_100207144 | |||
| 1785 | Ga0068861_100231409 | |||
| 1786 | Ga0068861_100307477 | |||
| 1787 | Ga0068861_100368245 | |||
| 1788 | Ga0068851_10031275 | |||
| 1789 | Ga0068870_10082065 | |||
| 1790 | Ga0068863_100110791 | |||
| 1791 | Ga0068863_100504604 | |||
| 1792 | Ga0068863_100590437 | |||
| 1793 | Ga0068863_100767672 | |||
| 1794 | Ga0068863_101716005 | |||
| 1795 | Ga0068858_100005536 | |||
| 1796 | Ga0068858_100095652 | |||
| 1797 | Ga0068858_100100838 | |||
| 1798 | Ga0068858_100197202 | |||
| 1799 | Ga0068858_100780719 | |||
| 1800 | Ga0068860_100016800 | |||
| 1801 | Ga0068860_100020458 | |||
| 1802 | Ga0068860_100029056 | |||
| 1803 | Ga0068860_100206580 | |||
| 1804 | Ga0068860_101147188 | |||
| 1805 | Ga0068862_100000668 | |||
| 1806 | Ga0068862_100064503 | |||
| 1807 | Ga0068862_100174409 | |||
| 1808 | Ga0068862_101148160 | |||
| 1809 | Ga0068862_101544973 | |||
| 1810 | Ga0081455_10022859 | |||
| 1811 | Ga0081455_10034387 | |||
| 1812 | Ga0081455_10878260 | |||
| 1813 | Ga0081538_10023230 | |||
| 1814 | Ga0081538_10057385 | |||
| 1815 | Ga0081540_1014625 | |||
| 1816 | Ga0081539_10000668 | |||
| 1817 | Ga0081539_10010842 | |||
| 1818 | Ga0081539_10062170 | |||
| 1819 | Ga0070717_10004842 | |||
| 1820 | Ga0070717_10120445 | |||
| 1821 | Ga0070717_10531282 | |||
| 1822 | Ga0075365_10000927 | |||
| 1823 | Ga0075365_10299154 | |||
| 1824 | Ga0075368_10001598 | |||
| 1825 | Ga0075363_100003287 | |||
| 1826 | Ga0075364_10000041 | |||
| 1827 | Ga0075364_10011581 | |||
| 1828 | Ga0075432_10107619 | |||
| 1829 | Ga0070715_10000182 | |||
| 1830 | Ga0070715_10000437 | |||
| 1831 | Ga0070716_100003522 | |||
| 1832 | Ga0070716_100080005 | |||
| 1833 | Ga0070712_100002706 | |||
| 1834 | Ga0070712_100007781 | |||
| 1835 | Ga0075362_10008189 | |||
| 1836 | Ga0075367_10005610 | |||
| 1837 | Ga0097621_100001417 | |||
| 1838 | Ga0097621_100020377 | |||
| 1839 | Ga0097621_100022117 | |||
| 1840 | Ga0097621_100083136 | |||
| 1841 | Ga0097621_100097077 | |||
| 1842 | Ga0097621_101080174 | |||
| 1843 | Ga0068871_100001297 | |||
| 1844 | Ga0068871_100007981 | |||
| 1845 | Ga0068871_100008656 | |||
| 1846 | Ga0068871_100042675 | |||
| 1847 | Ga0068871_100073999 | |||
| 1848 | Ga0075428_100052937 | |||
| 1849 | Ga0075428_100282077 | |||
| 1850 | Ga0075428_100385998 | |||
| 1851 | Ga0075428_100651616 | |||
| 1852 | Ga0075430_100002128 | |||
| 1853 | Ga0075430_100455550 | |||
| 1854 | Ga0075430_100867491 | |||
| 1855 | Ga0075431_100214374 | |||
| 1856 | Ga0075431_100248531 | |||
| 1857 | Ga0075431_100366561 | |||
| 1858 | Ga0075431_100621348 | |||
| 1859 | Ga0075433_10005804 | |||
| 1860 | Ga0075433_10370533 | |||
| 1861 | Ga0075433_10494810 | |||
| 1862 | Ga0075433_10708434 | |||
| 1863 | Ga0075434_100000078 | |||
| 1864 | Ga0075434_100005507 | |||
| 1865 | Ga0075434_100251027 | |||
| 1866 | Ga0075434_100398224 | |||
| 1867 | Ga0075434_100529973 | |||
| 1868 | Ga0075434_100770625 | |||
| 1869 | Ga0075434_101059080 | |||
| 1870 | Ga0075434_101078082 | |||
| 1871 | Ga0075429_100016021 | |||
| 1872 | Ga0068865_100001575 | |||
| 1873 | Ga0068865_100027289 | |||
| 1874 | Ga0068865_101009682 | |||
| 1875 | Ga0075436_100021839 | |||
| 1876 | Ga0075436_100034523 | |||
| 1877 | Ga0075436_100048582 | |||
| 1878 | Ga0075436_100108509 | |||
| 1879 | Ga0075436_101243502 | |||
| 1880 | Ga0097620_100000445 | |||
| 1881 | Ga0097620_100350212 | |||
| 1882 | Ga0075435_100010161 | |||
| 1883 | Ga0075435_100014627 | |||
| 1884 | Ga0075435_100034163 | |||
| 1885 | Ga0075435_100063542 | |||
| 1886 | Ga0075435_100091182 | |||
| 1887 | Ga0075435_100173042 | |||
| 1888 | Ga0075435_100197770 | |||
| 1889 | Ga0075435_100550978 | |||
| 1890 | Ga0075435_100669088 | |||
| 1891 | Ga0105251_10116809 | |||
| 1892 | Ga0105240_10008246 | |||
| 1893 | Ga0105240_10127951 | |||
| 1894 | Ga0105240_10205645 | |||
| 1895 | Ga0105240_10734918 | |||
| 1896 | Ga0105240_11685905 | |||
| 1897 | Ga0111539_10013658 | |||
| 1898 | Ga0111539_10026456 | |||
| 1899 | Ga0111539_10109700 | |||
| 1900 | Ga0111539_10119315 | |||
| 1901 | Ga0111539_10243656 | |||
| 1902 | Ga0111539_10341626 | |||
| 1903 | Ga0111539_10413601 | |||
| 1904 | Ga0111539_10417775 | |||
| 1905 | Ga0111539_10737902 | |||
| 1906 | Ga0105245_10003710 | |||
| 1907 | Ga0105245_10164719 | |||
| 1908 | Ga0105245_10302682 | |||
| 1909 | Ga0105245_11380977 | |||
| 1910 | Ga0105245_11441723 | |||
| 1911 | Ga0105247_10021649 | |||
| 1912 | Ga0105247_11001745 | |||
| 1913 | Ga0105247_11147045 | |||
| 1914 | Ga0114129_10009272 | |||
| 1915 | Ga0114129_10107675 | |||
| 1916 | Ga0114129_10207604 | |||
| 1917 | Ga0114129_10268489 | |||
| 1918 | Ga0105243_10001954 | |||
| 1919 | Ga0105243_10074020 | |||
| 1920 | Ga0105243_10136991 | |||
| 1921 | Ga0105243_10309300 | |||
| 1922 | Ga0105243_10510528 | |||
| 1923 | Ga0105243_10586419 | |||
| 1924 | Ga0105243_12742008 | |||
| 1925 | Ga0105241_10012048 | |||
| 1926 | Ga0105241_10026716 | |||
| 1927 | Ga0105241_10038739 | |||
| 1928 | Ga0105241_10226728 | |||
| 1929 | Ga0105242_10002505 | |||
| 1930 | Ga0105242_10029479 | |||
| 1931 | Ga0105242_10053049 | |||
| 1932 | Ga0105242_10064199 | |||
| 1933 | Ga0105242_10602692 | |||
| 1934 | Ga0105242_10707290 | |||
| 1935 | Ga0105242_11202355 | |||
| 1936 | Ga0105242_11252819 | |||
| 1937 | Ga0105242_12318532 | |||
| 1938 | Ga0105248_10017431 | |||
| 1939 | Ga0105248_10029612 | |||
| 1940 | Ga0105248_10047993 | |||
| 1941 | Ga0105248_10173528 | |||
| 1942 | Ga0105237_10013134 | |||
| 1943 | Ga0105237_10034871 | |||
| 1944 | Ga0105237_10074539 | |||
| 1945 | Ga0105237_10253874 | |||
| 1946 | Ga0105237_10758446 | |||
| 1947 | Ga0105237_10780658 | |||
| 1948 | Ga0105238_10067129 | |||
| 1949 | Ga0105238_11629773 | |||
| 1950 | Ga0105249_10026793 | |||
| 1951 | Ga0105249_10287423 | |||
| 1952 | Ga0105249_10377924 | |||
| 1953 | Ga0105249_10902334 | |||
| 1954 | Ga0105249_10992345 | |||
| 1955 | Ga0105249_11231650 | |||
| 1956 | Ga0105249_12672747 | |||
| 1957 | Ga0105239_10013511 | |||
| 1958 | Ga0105239_10641648 | |||
| 1959 | Ga0105239_12034082 | |||
| 1960 | Ga0105246_10147383 | |||
| 1961 | Ga0105246_10389000 | |||
| 1962 | Ga0105246_10878288 | |||
| 1963 | Ga0157321_1027039 | |||
| 1964 | Ga0157341_1002427 | |||
| 1965 | Ga0157341_1018867 | |||
| 1966 | Ga0157338_1013841 | |||
| 1967 | Ga0157373_10004556 | |||
| 1968 | Ga0157373_10006641 | |||
| 1969 | Ga0157373_10020207 | |||
| 1970 | Ga0157373_10030071 | |||
| 1971 | Ga0157373_10189694 | |||
| 1972 | Ga0157373_10355042 | |||
| 1973 | Ga0157371_10001833 | |||
| 1974 | Ga0157371_10040213 | |||
| 1975 | Ga0157371_10793364 | |||
| 1976 | Ga0157371_10837067 | |||
| 1977 | Ga0157371_10891512 | |||
| 1978 | Ga0157370_10006051 | |||
| 1979 | Ga0157370_10009625 | |||
| 1980 | Ga0157370_10020601 | |||
| 1981 | Ga0157370_10022043 | |||
| 1982 | Ga0157370_10038915 | |||
| 1983 | Ga0157370_10047399 | |||
| 1984 | Ga0157370_10121653 | |||
| 1985 | Ga0157370_10318958 | |||
| 1986 | Ga0157370_10359999 | |||
| 1987 | Ga0157369_10008592 | |||
| 1988 | Ga0157369_10015589 | |||
| 1989 | Ga0157369_10117184 | |||
| 1990 | Ga0157369_10796483 | |||
| 1991 | Ga0157369_10829158 | |||
| 1992 | Ga0157369_11146261 | |||
| 1993 | Ga0157369_12615031 | |||
| 1994 | Ga0157374_10047543 | |||
| 1995 | Ga0157374_10194222 | |||
| 1996 | Ga0157374_10685817 | |||
| 1997 | Ga0157378_10001142 | |||
| 1998 | Ga0157378_10004789 | |||
| 1999 | Ga0157378_10057867 | |||
| 2000 | Ga0157378_10371469 | |||
| 2001 | Ga0157378_10970178 | |||
| 2002 | Ga0163162_10045373 | |||
| 2003 | Ga0163162_10100801 | |||
| 2004 | Ga0163162_10221834 | |||
| 2005 | Ga0163162_10483176 | |||
| 2006 | Ga0163162_11862376 | |||
| 2007 | Ga0157372_10155810 | |||
| 2008 | Ga0157372_10343546 | |||
| 2009 | Ga0157372_10372700 | |||
| 2010 | Ga0157372_10430496 | |||
| 2011 | Ga0157372_10614669 | |||
| 2012 | Ga0157372_11146448 | |||
| 2013 | Ga0157372_12251908 | |||
| 2014 | Ga0157375_10009737 | |||
| 2015 | Ga0157375_10236624 | |||
| 2016 | Ga0157375_10758569 | |||
| 2017 | Ga0157375_11186320 | |||
| 2018 | Ga0157375_11210412 | |||
| 2019 | Ga0163163_10122200 | |||
| 2020 | Ga0163163_10249903 | |||
| 2021 | Ga0163163_10495263 | |||
| 2022 | Ga0163163_10668280 | |||
| 2023 | Ga0163163_10904119 | |||
| 2024 | Ga0157380_10022847 | |||
| 2025 | Ga0157380_10168744 | |||
| 2026 | Ga0157380_10359519 | |||
| 2027 | Ga0157380_10789224 | |||
| 2028 | Ga0157380_12263456 | |||
| 2029 | Ga0182008_10260096 | |||
| 2030 | Ga0157377_10099694 | |||
| 2031 | Ga0157377_11331231 | |||
| 2032 | Ga0157379_10049777 | |||
| 2033 | Ga0157379_10260529 | |||
| 2034 | Ga0157379_10611967 | |||
| 2035 | Ga0157376_10003476 | |||
| 2036 | Ga0157376_10008293 | |||
| 2037 | Ga0157376_10015215 | |||
| 2038 | Ga0157376_10210607 | |||
| 2039 | Ga0157376_10359721 | |||
| 2040 | Ga0157376_10668041 | |||
| 2041 | Ga0163161_10025300 | |||
| 2042 | Ga0163161_10029236 | |||
| 2043 | Ga0163161_10246347 | |||
| 2044 | Ga0163161_10569868 | |||
| 2045 | Ga0206356_11413287 | |||
| 2046 | Ga0213874_10005027 | |||
| 2047 | Ga0224572_1097226 | |||
| 2048 | Ga0207666_1060908 | |||
| 2049 | Ga0207697_10030659 | |||
| 2050 | Ga0207697_10358773 | |||
| 2051 | Ga0207656_10039789 | |||
| 2052 | Ga0207682_10003597 | |||
| 2053 | Ga0207682_10051678 | |||
| 2054 | Ga0207682_10130280 | |||
| 2055 | Ga0207682_10279103 | |||
| 2056 | Ga0207692_10000503 | |||
| 2057 | Ga0207692_10066469 | |||
| 2058 | Ga0207692_10067436 | |||
| 2059 | Ga0207692_10133987 | |||
| 2060 | Ga0207692_10141416 | |||
| 2061 | Ga0207692_10269474 | |||
| 2062 | Ga0207642_10005995 | |||
| 2063 | Ga0207642_10016410 | |||
| 2064 | Ga0207642_10177760 | |||
| 2065 | Ga0207710_10017641 | |||
| 2066 | Ga0207710_10538858 | |||
| 2067 | Ga0207688_10037295 | |||
| 2068 | Ga0207688_10532938 | |||
| 2069 | Ga0207688_10748326 | |||
| 2070 | Ga0207680_10064395 | |||
| 2071 | Ga0207680_10211366 | |||
| 2072 | Ga0207680_10257182 | |||
| 2073 | Ga0207680_10483588 | |||
| 2074 | Ga0207647_10267324 | |||
| 2075 | Ga0207647_10425684 | |||
| 2076 | Ga0207685_10000354 | |||
| 2077 | Ga0207685_10001723 | |||
| 2078 | Ga0207699_10008044 | |||
| 2079 | Ga0207699_10050010 | |||
| 2080 | Ga0207699_10070422 | |||
| 2081 | Ga0207699_10260587 | |||
| 2082 | Ga0207699_10516612 | |||
| 2083 | Ga0207699_10739805 | |||
| 2084 | Ga0207645_10011966 | |||
| 2085 | Ga0207645_10017690 | |||
| 2086 | Ga0207645_10167044 | |||
| 2087 | Ga0207645_10755000 | |||
| 2088 | Ga0207643_10042451 | |||
| 2089 | Ga0207643_10044017 | |||
| 2090 | Ga0207643_10638283 | |||
| 2091 | Ga0207705_10090548 | |||
| 2092 | Ga0207684_10032273 | |||
| 2093 | Ga0207684_10474107 | |||
| 2094 | Ga0207684_10583138 | |||
| 2095 | Ga0207654_10022974 | |||
| 2096 | Ga0207654_10789850 | |||
| 2097 | Ga0207707_10008482 | |||
| 2098 | Ga0207707_10063930 | |||
| 2099 | Ga0207707_10068209 | |||
| 2100 | Ga0207707_10269295 | |||
| 2101 | Ga0207695_10060956 | |||
| 2102 | Ga0207695_10074182 | |||
| 2103 | Ga0207695_10783581 | |||
| 2104 | Ga0207671_10133472 | |||
| 2105 | Ga0207693_10001609 | |||
| 2106 | Ga0207693_10006450 | |||
| 2107 | Ga0207693_10008687 | |||
| 2108 | Ga0207663_10003480 | |||
| 2109 | Ga0207663_10028048 | |||
| 2110 | Ga0207663_10080798 | |||
| 2111 | Ga0207663_10158531 | |||
| 2112 | Ga0207663_10276417 | |||
| 2113 | Ga0207663_10474103 | |||
| 2114 | Ga0207663_10931511 | |||
| 2115 | Ga0207663_11362910 | |||
| 2116 | Ga0207660_10003216 | |||
| 2117 | Ga0207660_10080418 | |||
| 2118 | Ga0207660_11008534 | |||
| 2119 | Ga0207662_10000088 | |||
| 2120 | Ga0207662_10000710 | |||
| 2121 | Ga0207662_10030460 | |||
| 2122 | Ga0207662_10614424 | |||
| 2123 | Ga0207657_10001097 | |||
| 2124 | Ga0207657_10223773 | |||
| 2125 | Ga0207657_10526580 | |||
| 2126 | Ga0207649_10022621 | |||
| 2127 | Ga0207649_10035292 | |||
| 2128 | Ga0207649_10331019 | |||
| 2129 | Ga0207649_10692986 | |||
| 2130 | Ga0207652_10069270 | |||
| 2131 | Ga0207652_10075338 | |||
| 2132 | Ga0207652_10098416 | |||
| 2133 | Ga0207652_10487175 | |||
| 2134 | Ga0207652_11002316 | |||
| 2135 | Ga0207652_11224468 | |||
| 2136 | Ga0207681_10013794 | |||
| 2137 | Ga0207681_10044539 | |||
| 2138 | Ga0207681_10101018 | |||
| 2139 | Ga0207681_10227382 | |||
| 2140 | Ga0207681_10333104 | |||
| 2141 | Ga0207681_10371902 | |||
| 2142 | Ga0207681_10718317 | |||
| 2143 | Ga0207694_10012843 | |||
| 2144 | Ga0207694_10051639 | |||
| 2145 | Ga0207650_10042140 | |||
| 2146 | Ga0207650_10050535 | |||
| 2147 | Ga0207650_10193945 | |||
| 2148 | Ga0207650_10209174 | |||
| 2149 | Ga0207650_10288046 | |||
| 2150 | Ga0207650_10554211 | |||
| 2151 | Ga0207650_10648084 | |||
| 2152 | Ga0207650_10808347 | |||
| 2153 | Ga0207659_10011330 | |||
| 2154 | Ga0207659_10184628 | |||
| 2155 | Ga0207659_10191881 | |||
| 2156 | Ga0207659_10250026 | |||
| 2157 | Ga0207659_10559502 | |||
| 2158 | Ga0207687_10000349 | |||
| 2159 | Ga0207687_10006704 | |||
| 2160 | Ga0207687_11696229 | |||
| 2161 | Ga0207700_10001216 | |||
| 2162 | Ga0207700_10027694 | |||
| 2163 | Ga0207700_10263217 | |||
| 2164 | Ga0207700_10783358 | |||
| 2165 | Ga0207664_10001209 | |||
| 2166 | Ga0207664_10005216 | |||
| 2167 | Ga0207664_10012693 | |||
| 2168 | Ga0207664_10058051 | |||
| 2169 | Ga0207664_10220252 | |||
| 2170 | Ga0207664_10304665 | |||
| 2171 | Ga0207664_10719320 | |||
| 2172 | Ga0207644_10003039 | |||
| 2173 | Ga0207644_10046278 | |||
| 2174 | Ga0207644_10104444 | |||
| 2175 | Ga0207644_10470154 | |||
| 2176 | Ga0207690_10000661 | |||
| 2177 | Ga0207690_10034139 | |||
| 2178 | Ga0207690_10140537 | |||
| 2179 | Ga0207690_10624912 | |||
| 2180 | Ga0207690_10684600 | |||
| 2181 | Ga0207706_10000040 | |||
| 2182 | Ga0207706_10029338 | |||
| 2183 | Ga0207706_10070688 | |||
| 2184 | Ga0207706_10137397 | |||
| 2185 | Ga0207706_10287595 | |||
| 2186 | Ga0207706_10452261 | |||
| 2187 | Ga0207686_10035803 | |||
| 2188 | Ga0207686_10111571 | |||
| 2189 | Ga0207686_10840042 | |||
| 2190 | Ga0207686_10971743 | |||
| 2191 | Ga0207709_10001642 | |||
| 2192 | Ga0207709_10039687 | |||
| 2193 | Ga0207709_10114217 | |||
| 2194 | Ga0207709_10336355 | |||
| 2195 | Ga0207670_10002235 | |||
| 2196 | Ga0207670_10049431 | |||
| 2197 | Ga0207670_10087023 | |||
| 2198 | Ga0207670_10282033 | |||
| 2199 | Ga0207670_10600332 | |||
| 2200 | Ga0207670_11205798 | |||
| 2201 | Ga0207669_10003857 | |||
| 2202 | Ga0207669_10046628 | |||
| 2203 | Ga0207669_10097906 | |||
| 2204 | Ga0207669_10218926 | |||
| 2205 | Ga0207704_10002194 | |||
| 2206 | Ga0207704_10094979 | |||
| 2207 | Ga0207665_10000223 | |||
| 2208 | Ga0207665_10002070 | |||
| 2209 | Ga0207665_10305481 | |||
| 2210 | Ga0207691_10006790 | |||
| 2211 | Ga0207691_10015784 | |||
| 2212 | Ga0207691_10073946 | |||
| 2213 | Ga0207691_10130871 | |||
| 2214 | Ga0207691_10267643 | |||
| 2215 | Ga0207711_10022647 | |||
| 2216 | Ga0207711_10042318 | |||
| 2217 | Ga0207689_10002986 | |||
| 2218 | Ga0207689_10009370 | |||
| 2219 | Ga0207689_10037694 | |||
| 2220 | Ga0207689_10197924 | |||
| 2221 | Ga0207689_10274249 | |||
| 2222 | Ga0207661_10021055 | |||
| 2223 | Ga0207661_10735404 | |||
| 2224 | Ga0207679_10011215 | |||
| 2225 | Ga0207679_10013523 | |||
| 2226 | Ga0207679_10223379 | |||
| 2227 | Ga0207679_10404645 | |||
| 2228 | Ga0207679_10943827 | |||
| 2229 | Ga0207667_10011779 | |||
| 2230 | Ga0207667_10023839 | |||
| 2231 | Ga0207667_10191445 | |||
| 2232 | Ga0207667_10356339 | |||
| 2233 | Ga0207667_10913291 | |||
| 2234 | Ga0207667_11360981 | |||
| 2235 | Ga0207651_10002402 | |||
| 2236 | Ga0207651_10019559 | |||
| 2237 | Ga0207651_10116632 | |||
| 2238 | Ga0207651_10151539 | |||
| 2239 | Ga0207712_10103552 | |||
| 2240 | Ga0207712_10361265 | |||
| 2241 | Ga0207668_10072871 | |||
| 2242 | Ga0207668_10225583 | |||
| 2243 | Ga0207668_10531546 | |||
| 2244 | Ga0207668_10563571 | |||
| 2245 | Ga0207668_10805313 | |||
| 2246 | Ga0207668_11593604 | |||
| 2247 | Ga0207640_10011788 | |||
| 2248 | Ga0207640_10012718 | |||
| 2249 | Ga0207658_10010103 | |||
| 2250 | Ga0207658_10146371 | |||
| 2251 | Ga0207658_10193322 | |||
| 2252 | Ga0207658_10249536 | |||
| 2253 | Ga0207658_10459407 | |||
| 2254 | Ga0207677_10096263 | |||
| 2255 | Ga0207677_10417021 | |||
| 2256 | Ga0207677_11238728 | |||
| 2257 | Ga0207703_10003517 | |||
| 2258 | Ga0207703_10037996 | |||
| 2259 | Ga0207703_10129896 | |||
| 2260 | Ga0207703_10163974 | |||
| 2261 | Ga0207639_10034249 | |||
| 2262 | Ga0207639_10056193 | |||
| 2263 | Ga0207639_10356725 | |||
| 2264 | Ga0207639_10463505 | |||
| 2265 | Ga0207639_11410573 | |||
| 2266 | Ga0207678_10007871 | |||
| 2267 | Ga0207678_10008883 | |||
| 2268 | Ga0207678_10889890 | |||
| 2269 | Ga0207678_11039933 | |||
| 2270 | Ga0207708_10000326 | |||
| 2271 | Ga0207708_10001430 | |||
| 2272 | Ga0207708_10280709 | |||
| 2273 | Ga0207702_10014584 | |||
| 2274 | Ga0207702_10048686 | |||
| 2275 | Ga0207702_10058542 | |||
| 2276 | Ga0207702_10108244 | |||
| 2277 | Ga0207702_10279895 | |||
| 2278 | Ga0207702_10637779 | |||
| 2279 | Ga0207702_12295361 | |||
| 2280 | Ga0207641_10053430 | |||
| 2281 | Ga0207641_10083806 | |||
| 2282 | Ga0207641_10110446 | |||
| 2283 | Ga0207641_10268230 | |||
| 2284 | Ga0207641_10666197 | |||
| 2285 | Ga0207641_10869063 | |||
| 2286 | Ga0207641_12027521 | |||
| 2287 | Ga0207641_12087896 | |||
| 2288 | Ga0207648_10000071 | |||
| 2289 | Ga0207648_10002303 | |||
| 2290 | Ga0207648_10019841 | |||
| 2291 | Ga0207648_10240593 | |||
| 2292 | Ga0207648_10466324 | |||
| 2293 | Ga0207676_10025129 | |||
| 2294 | Ga0207676_10069259 | |||
| 2295 | Ga0207676_10102174 | |||
| 2296 | Ga0207676_10152579 | |||
| 2297 | Ga0207676_10417792 | |||
| 2298 | Ga0207676_10810932 | |||
| 2299 | Ga0207676_12164412 | |||
| 2300 | Ga0207674_10000155 | |||
| 2301 | Ga0207674_10448512 | |||
| 2302 | Ga0207674_10469949 | |||
| 2303 | Ga0207674_10671961 | |||
| 2304 | Ga0207675_100000040 | |||
| 2305 | Ga0207675_100018658 | |||
| 2306 | Ga0207675_100035478 | |||
| 2307 | Ga0207675_100053014 | |||
| 2308 | Ga0207675_100069717 | |||
| 2309 | Ga0207675_100274651 | |||
| 2310 | Ga0207675_100364166 | |||
| 2311 | Ga0207683_10005993 | |||
| 2312 | Ga0207683_10010627 | |||
| 2313 | Ga0207683_10059677 | |||
| 2314 | Ga0207683_10102434 | |||
| 2315 | Ga0207683_10127013 | |||
| 2316 | Ga0207683_10156286 | |||
| 2317 | Ga0207683_10187204 | |||
| 2318 | Ga0207683_10677497 | |||
| 2319 | Ga0207698_10005283 | |||
| 2320 | Ga0207698_10078529 | |||
| 2321 | Ga0207698_10776052 | |||
| 2322 | Ga0209969_1001293 | |||
| 2323 | Ga0209969_1026104 | |||
| 2324 | Ga0209967_1022930 | |||
| 2325 | Ga0209981_1003276 | |||
| 2326 | Ga0209981_1018642 | |||
| 2327 | Ga0209996_1043490 | |||
| 2328 | Ga0209968_1057731 | |||
| 2329 | Ga0209971_1017602 | |||
| 2330 | Ga0209966_1015677 | |||
| 2331 | Ga0209998_10035007 | |||
| 2332 | Ga0209813_10003624 | |||
| 2333 | Ga0209974_10019154 | |||
| 2334 | Ga0209974_10137092 | |||
| 2335 | Ga0207428_10003555 | |||
| 2336 | Ga0207428_10187719 | |||
| 2337 | Ga0268266_10027827 | |||
| 2338 | Ga0268266_10038362 | |||
| 2339 | Ga0268266_10253613 | |||
| 2340 | Ga0268266_11095610 | |||
| 2341 | Ga0268265_10015432 | |||
| 2342 | Ga0268265_10016234 | |||
| 2343 | Ga0268265_10262872 | |||
| 2344 | Ga0268265_10273866 | |||
| 2345 | Ga0268264_10000527 | |||
| 2346 | Ga0268264_10050378 | |||
| 2347 | Ga0268264_10149206 | |||
| 2348 | Ga0268264_10834279 | |||
| 2349 | Ga0268264_10886413 | |||
| 2350 | Ga0268264_11090257 | |||
| 2351 | Ga0268264_11242777 | |||
| 2352 | Ga0265337_1000657 | |||
| 2353 | Ga0265334_10004658 | |||
| 2354 | Ga0265338_10014806 | |||
| 2355 | Ga0265338_10168184 | |||
| 2356 | Ga0265765_1015225 | |||
| 2357 | Ga0265760_10135826 | |||
| 2358 | Ga0265332_10023006 | |||
| 2359 | Ga0265328_10005004 | |||
| 2360 | Ga0265325_10000004 | |||
| 2361 | Ga0307408_100083689 | |||
| 2362 | Ga0307408_100381515 | |||
| 2363 | Ga0307408_100989894 | |||
| 2364 | Ga0307408_101481056 | |||
| 2365 | Ga0265313_10003348 | |||
| 2366 | Ga0316579_10293234 | |||
| 2367 | Ga0265314_10001644 | |||
| 2368 | Ga0265314_10116754 | |||
| 2369 | Ga0316576_10006013 | |||
| 2370 | Ga0316576_10055935 | |||
| 2371 | Ga0316578_10007067 | |||
| 2372 | Ga0316578_10112158 | |||
| 2373 | Ga0307405_10004237 | |||
| 2374 | Ga0307405_10716221 | |||
| 2375 | Ga0307405_10957032 | |||
| 2376 | Ga0307413_10000700 | |||
| 2377 | Ga0307413_10055564 | |||
| 2378 | Ga0307413_10811520 | |||
| 2379 | Ga0307410_10004286 | |||
| 2380 | Ga0307406_10013188 | |||
| 2381 | Ga0307406_10462944 | |||
| 2382 | Ga0307407_10011597 | |||
| 2383 | Ga0307412_10108155 | |||
| 2384 | Ga0307409_100013370 | |||
| 2385 | Ga0307416_100008987 | |||
| 2386 | Ga0307416_100261457 | |||
| 2387 | Ga0307416_100398283 | |||
| 2388 | Ga0307416_101116004 | |||
| 2389 | Ga0307414_10096761 | |||
| 2390 | Ga0307411_10075337 | |||
| 2391 | Ga0307411_10321567 | |||
| 2392 | Ga0307411_10386921 | |||
| 2393 | Ga0307415_100005658 | |||
| 2394 | Ga0316583_10001095 | |||
| 2395 | Ga0316585_10033425 | |||
| 2396 | Ga0316592_1016823 | |||
| 2397 | Ga0316592_1042856 | |||
| 2398 | Ga0316588_1001446 | |||
| 2399 | Ga0316588_1004449 | |||
| 2400 | Ga0316596_1002887 | |||
| 2401 | Ga0373930_0002876 | |||
| 2402 | Ga0373948_0089649 | |||
| 2403 | Ga0373948_0096177 | |||
| 2404 | Ga0373958_0025895 | |||
| 2405 | Ga0373959_0014349 | |||
| 2406 | Ga0373938_0006574 | |||
| 2407 | Ga0373938_0195483 | |||
| 2408 | Ga0373926_0000062 | |||
| 2409 | Ga0373926_0000873 | |||
| 2410 | Ga0373926_0057063 | |||
| 2411 | Ga0373928_0007308 | |||
| 2412 | Ga0373929_0001916 | |||
| 2413 | Ga0373929_0002103 | |||
| 2414 | Ga0373934_0000061 | |||
| 2415 | Ga0373934_0208055 | |||
| 2416 | Ga0373940_0020475 | |||
| 2417 | Ga0373940_0069383 | |||
| 2418 | Ga0373944_0001760 | |||
| 2419 | Ga0373944_0010174 | |||
| 2420 | Ga0373944_0016994 | |||
| 2421 | Ga0373944_0136159 | |||
| 2422 | Ga0373949_0018039 | |||
| 2423 | Ga0373949_0045115 | |||
| 2424 | Ga0373949_0075239 | |||
| 2425 | Ga0373951_0165440 | |||
| 2426 | Ga0373952_0013241 | |||
| 2427 | Ga0373952_0025205 | |||
| 2428 | Ga0373952_0040038 | |||
| 2429 | Ga0373932_0010654 | |||
| 2430 | Ga0373932_0149864 | |||
| 2431 | Ga0373936_0002266 | |||
| 2432 | Ga0373936_0006259 | |||
| 2433 | Ga0373936_0033352 | |||
| 2434 | Ga0373936_0440763 | |||
| 2435 | Ga0373939_0030215 | |||
| 2436 | Ga0373939_0087509 | |||
| 2437 | Ga0373941_0004504 | |||
| 2438 | Ga0373941_0078862 | |||
| 2439 | Ga0373945_0002753 | |||
| 2440 | Ga0373945_0125564 | |||
| 2441 | Ga0373945_0173853 | |||
| 2442 | Ga0373945_0365778 | |||
| 2443 | Ga0373954_0142478 | |||
| 2444 | Ga0373956_0000003 | |||
| 2445 | Ga0373956_0107578 | |||
| 2446 | Ga0373957_0051231 | |||
| 2447 | Ga0373957_0189182 | |||
| 2448 | Ga0373960_0017534 | |||
| 2449 | Ga0373960_0102397 | |||
| 2450 | Ga0373943_0000584 | |||
| 2451 | Ga0373943_0001182 | |||
| 2452 | Ga0373943_0038477 | |||
| 2453 | Ga0373943_0205418 | |||
| 2454 | Ga0373943_0241354 | |||
| 2455 | Ga0373943_0684677 | |||
| 2456 | Ga0373946_0001536 | |||
| 2457 | Ga0373946_0002920 | |||
| 2458 | Ga0373946_0015306 | |||
| 2459 | Ga0373946_0053061 | |||
| 2460 | Ga0373946_0059926 | |||
| 2461 | Ga0373946_0569241 | |||
| 2462 | Ga0373955_0006439 | |||
| 2463 | Ga0373955_0050034 | |||
| 2464 | Ga0373942_0035658 | |||
| 2465 | Ga0373961_0093166 | |||
| 2466 | Ga0373962_0036833 | |||
| 2467 | Ga0373962_0139074 | |||
| 2468 | Ga0316574_0120679 | |||
| 2469 | Ga0316574_0208595 | |||
| 2470 | Ga0373924_0327817 | |||
| 2471 | Ga0373931_0000553 | |||
| 2472 | Ga0373931_0055258 | |||
| 2473 | Ga0373931_0076422 | |||
| 2474 | Ga0373931_0240286 | |||
| 2475 | Ga0373931_0668486 | |||
| 2476 | Ga0373931_0789383 | |||
| 2477 | Ga0373935_0001505 | |||
| 2478 | Ga0373935_0005854 | |||
| 2479 | Ga0373935_0034524 | |||
| 2480 | Ga0373935_0037110 | |||
| 2481 | Ga0373935_0178262 | |||
| 2482 | Ga0373935_0298795 | |||
| 2483 | Ga0373935_0382207 | |||
| 2484 | Ga0373935_1086346 | |||
| 2485 | Ga0373927_0000912 | |||
| 2486 | Ga0373927_0042837 | |||
| 2487 | Ga0373927_0060322 | |||
| 2488 | Ga0373927_0090279 | |||
| 2489 | Ga0373927_0093116 | |||
| 2490 | Ga0373927_0392062 | |||
| 2491 | Ga0373933_0005782 | |||
| 2492 | Ga0373933_0211977 | |||
| 2493 | Ga0373933_0228263 | |||
| 2494 | Ga0373933_0240228 | |||
| 2495 | Ga0373947_0002482 | |||
| 2496 | Ga0373947_0003695 | |||
| 2497 | Ga0373947_0012927 | |||
| 2498 | Ga0373947_0014928 | |||
| 2499 | Ga0373947_0025250 | |||
| 2500 | Ga0373947_0026782 | |||
| 2501 | Ga0373947_0122858 | |||
| 2502 | Ga0373947_0245626 | |||
| 2503 | Ga0373947_0982338 | |||
| 2504 | Ga0373947_1051989 | |||
| 2505 | Ga0373937_0000196 | |||
| 2506 | Ga0373937_0017585 | |||
| 2507 | Ga0373937_0044504 | |||
| 2508 | Ga0373937_0069893 | |||
| 2509 | Ga0373937_0108292 | |||
| 2510 | Ga0373937_0224611 | |||
| 2511 | Ga0373937_0357799 | |||
| 2512 | Ga0373937_0726111 | |||
| 2513 | Ga0316582_0001898 | |||
| 2514 | Ga0316582_0193563 | |||
| 2515 | Ga0316584_0048277 | |||
| 2516 | Ga0316584_0253297 | |||
| 2517 | Ga0373925_0004491 | |||
| 2518 | Ga0373925_0005040 | |||
| 2519 | Ga0373925_0006465 | |||
| 2520 | Ga0373925_0052700 | |||
| 2521 | Ga0373925_0060496 | |||
| 2522 | Ga0373925_0073485 | |||
| 2523 | Ga0373925_0114666 | |||
| 2524 | Ga0373925_0129742 | |||
| 2525 | Ga0373925_0156637 | |||
| 2526 | Ga0373925_0200579 | |||
| 2527 | Ga0373925_0616972 | |||
| 2528 | Ga0373925_0884951 | |||
| 2529 | Ga0395899_0097303 | |||
| 2530 | Ga0395900_0017617 | |||
| 2531 | Ga0395900_0181537 | |||
| 2532 | Ga0395900_1867637 | |||
| 2533 | Ga0395898_0020431 | |||
| 2534 | Ga0395898_0120763 | |||
| 2535 | Ga0395898_0192133 | |||
| 2536 | Ga0395905_0085046 | |||
| 2537 | Ga0395905_0187731 | |||
| 2538 | Ga0316581_0000256 | |||
| 2539 | Ga0395901_0032467 | |||
| 2540 | Ga0395901_0197987 | |||
| 2541 | Ga0395901_0759588 | |||
| 2542 | Ga0242420_060201 | |||
| 2543 | Ga0400483_249032 | |||
| 2544 | Ga0436365_1483055 | |||
| 2545 | Ga0436361_0966677 | |||
| 2546 | Ga0436363_0328509 | |||
| 2547 | Ga0436362_0044954 | |||
| 2548 | Ga0439436_0093332 | |||
| 2549 | Ga0439439_0023170 | |||
| 2550 | Ga0451787_728395 | |||
| 2551 | Ga0451853_2158847 | |||
| 2552 | Ga0439441_000979 | |||
| 2553 | Ga0439441_066127 | |||
| 2554 | Ga0439441_106654 | |||
| 2555 | Ga0439443_003131 | |||
| 2556 | Ga0439443_033139 | |||
| 2557 | Ga0439449_0420135 | |||
| 2558 | Ga0439462_0091873 | |||
| 2559 | Ga0450923_039057 | |||
| 2560 | Ga0439458_0173336 | |||
| 2561 | Ga0439434_0060064 | |||
| 2562 | Ga0439435_0000004 | |||
| 2563 | Ga0439435_0013464 | |||
| 2564 | Ga0439444_0093274 | |||
| 2565 | Ga0439459_0095149 | |||
| 2566 | Ga0439460_0000235 | |||
| 2567 | Ga0439460_0015727 | |||
| 2568 | Ga0439460_0134767 | |||
| 2569 | Ga0451577_0008862 | |||
| 2570 | Ga0451577_0057081 | |||
| 2571 | Ga0453683_0147840 | |||
| 2572 | Ga0453683_0507009 | |||
| 2573 | Ga0466963_0842857 | |||
| 2574 | Ga0466957_0081969 | |||
| 2575 | Ga0451576_0003049 | |||
| 2576 | Ga0451576_0017751 | |||
| 2577 | Ga0451576_0619603 | |||
| 2578 | Ga0451576_1380122 | |||
| 2579 | Ga0466958_0040320 | |||
| 2580 | Ga0466958_0718255 | |||
| 2581 | Ga0466967_0021653 | |||
| 2582 | Ga0495592_0020464 | |||
| 2583 | Ga0495592_0224616 | |||
| 2584 | Ga0495603_0000752 | |||
| 2585 | Ga0495603_0009108 | |||
| 2586 | Ga0495603_0021983 | |||
| 2587 | Ga0495629_0001998 | |||
| 2588 | Ga0495629_0002312 | |||
| 2589 | Ga0495629_0015214 | |||
| 2590 | Ga0495629_0059779 | |||
| 2591 | Ga0495629_0143234 | |||
| 2592 | Ga0495651_0004749 | |||
| 2593 | Ga0495651_0016174 | |||
| 2594 | Ga0495651_0312278 | |||
| 2595 | Ga0495653_0005728 | |||
| 2596 | Ga0495580_0008537 | |||
| 2597 | Ga0495580_0016385 | |||
| 2598 | Ga0495580_0029652 | |||
| 2599 | Ga0495580_0224582 | |||
| 2600 | Ga0495580_0268638 | |||
| 2601 | Ga0495582_0014397 | |||
| 2602 | Ga0495582_0052439 | |||
| 2603 | Ga0495582_0137252 | |||
| 2604 | Ga0495639_0004241 | |||
| 2605 | Ga0495639_0093803 | |||
| 2606 | Ga0495639_0146968 | |||
| 2607 | Ga0495662_0003590 | |||
| 2608 | Ga0495662_0152433 | |||
| 2609 | Ga0495664_0029532 | |||
| 2610 | Ga0495664_0098990 | |||
| 2611 | Ga0495664_0373185 | |||
| 2612 | Ga0495584_0245642 | |||
| 2613 | Ga0495584_0672178 | |||
| 2614 | Ga0495594_0010179 | |||
| 2615 | Ga0495594_0085149 | |||
| 2616 | Ga0495608_0001760 | |||
| 2617 | Ga0495608_0252723 | |||
| 2618 | Ga0495618_0008377 | |||
| 2619 | Ga0495618_0014032 | |||
| 2620 | Ga0495618_0521016 | |||
| 2621 | Ga0495620_0286568 | |||
| 2622 | Ga0495628_0016594 | |||
| 2623 | Ga0495630_0013313 | |||
| 2624 | Ga0495630_0055024 | |||
| 2625 | Ga0495630_0284177 | |||
| 2626 | Ga0495666_0041999 | |||
| 2627 | Ga0495666_0133151 | |||
| 2628 | Ga0495666_0433558 | |||
| 2629 | Ga0495642_0067816 | |||
| 2630 | Ga0495642_0134426 | |||
| 2631 | Ga0495642_0290372 | |||
| 2632 | Ga0495652_0006626 | |||
| 2633 | Ga0495652_0033497 | |||
| 2634 | Ga0495665_0014479 | |||
| 2635 | Ga0495665_0197180 | |||
| 2636 | Ga0495665_0285605 | |||
| 2637 | Ga0495665_0576628 | |||
| 2638 | Ga0495640_0022930 | |||
| 2639 | Ga0495640_0036793 | |||
| 2640 | Ga0495640_0060058 | |||
| 2641 | Ga0495640_0125380 | |||
| 2642 | Ga0495640_0519742 | |||
| 2643 | Ga0495586_0002269 | |||
| 2644 | Ga0495586_0185840 | |||
| 2645 | Ga0495586_0318107 | |||
| 2646 | Ga0495586_0760786 | |||
| 2647 | Ga0495587_0010344 | |||
| 2648 | Ga0495598_0343615 | |||
| 2649 | Ga0495621_0005915 | |||
| 2650 | Ga0495621_0023324 | |||
| 2651 | Ga0495621_0040705 | |||
| 2652 | Ga0495621_0333202 | |||
| 2653 | Ga0495645_0144881 | |||
| 2654 | Ga0495622_0035325 | |||
| 2655 | Ga0495622_0043054 | |||
| 2656 | Ga0495622_0083252 | |||
| 2657 | Ga0495667_0005211 | |||
| 2658 | Ga0495667_0084907 | |||
| 2659 | Ga0495667_0209176 | |||
| 2660 | Ga0495667_0286318 | |||
| 2661 | Ga0495656_0482833 | |||
| 2662 | Ga0495668_0062051 | |||
| 2663 | Ga0495634_0005555 | |||
| 2664 | Ga0495634_0026444 | |||
| 2665 | Ga0495634_0082890 | |||
| 2666 | Ga0495634_0451135 | |||
| 2667 | Ga0495611_0305797 | |||
| 2668 | Ga0495625_0199301 | |||
| 2669 | Ga0495635_0036970 | |||
| 2670 | Ga0495635_0254519 | |||
| 2671 | Ga0495635_0259549 | |||
| 2672 | Ga0495635_0413724 | |||
| 2673 | Ga0495659_0207194 | |||
| 2674 | Ga0495588_0007409 | |||
| 2675 | Ga0495588_0282083 | |||
| 2676 | Ga0495657_0076174 | |||
| 2677 | Ga0495657_0286504 | |||
| 2678 | Ga0495599_0014294 | |||
| 2679 | Ga0495599_0436783 | |||
| 2680 | Ga0495623_0122646 | |||
| 2681 | Ga0495623_0416531 | |||
| 2682 | Ga0495646_0005872 | |||
| 2683 | Ga0495647_0001142 | |||
| 2684 | Ga0495647_0001430 | |||
| 2685 | Ga0495647_0007001 | |||
| 2686 | Ga0495647_0200845 | |||
| 2687 | Ga0495658_0006322 | |||
| 2688 | Ga0495658_0026289 | |||
| 2689 | Ga0495658_0299461 | |||
| 2690 | Ga0495658_1111031 | |||
| 2691 | Ga0495613_0031123 | |||
| 2692 | Ga0495613_0057851 | |||
| 2693 | Ga0495613_0142592 | |||
| 2694 | Ga0495613_0215168 | |||
| 2695 | Ga0495624_0222703 | |||
| 2696 | Ga0495600_0029991 | |||
| 2697 | Ga0495600_0134740 | |||
| 2698 | Ga0495581_0010001 | |||
| 2699 | Ga0495581_0202412 | |||
| 2700 | Ga0495604_0001820 | |||
| 2701 | Ga0495604_0150797 | |||
| 2702 | Ga0495674_0004030 | |||
| 2703 | Ga0495674_0008008 | |||
| 2704 | Ga0495674_0242520 | |||
| 2705 | Ga0495676_0041416 | |||
| 2706 | Ga0495676_0048143 | |||
| 2707 | Ga0495676_0051428 | |||
| 2708 | Ga0495680_0009082 | |||
| 2709 | Ga0495680_0053072 | |||
| 2710 | Ga0495680_0094585 | |||
| 2711 | Ga0495680_0395616 | |||
| 2712 | Ga0495675_0372724 | |||
| 2713 | Ga0495675_0622857 | |||
| 2714 | Ga0495677_0351330 | |||
| 2715 | Ga0495684_0051053 | |||
| 2716 | Ga0495593_0006649 | |||
| 2717 | Ga0495593_0031319 | |||
| 2718 | Ga0495593_0118869 | |||
| 2719 | Ga0495593_0436149 | |||
| 2720 | Ga0495602_0015631 | |||
| 2721 | Ga0495602_0302113 | |||
| 2722 | Ga0495602_0307597 | |||
| 2723 | Ga0495614_0210830 | |||
| 2724 | Ga0496100_0282161 | |||
| 2725 | Ga0496101_0078839 | |||
| 2726 | Ga0496101_0203612 | |||
| 2727 | Ga0496101_0323614 | |||
| 2728 | Ga0496102_0006530 | |||
| 2729 | Ga0496102_0171415 | |||
| 2730 | Ga0496102_0174863 | |||
| 2731 | Ga0496102_0469931 | |||
| 2732 | Ga0496102_0649735 | |||
| 2733 | Ga0496103_0401436 | |||
| 2734 | Ga0496104_0023361 | |||
| 2735 | Ga0496104_0727771 | |||
| 2736 | Ga0496105_0059059 | |||
| 2737 | Ga0496106_0001392 | |||
| 2738 | Ga0496106_0430748 | |||
| 2739 | Ga0496106_0982397 | |||
| 2740 | Ga0496106_1583184 | |||
| 2741 | Ga0496107_0151151 | |||
| 2742 | Ga0496107_0880682 | |||
| 2743 | Ga0496108_0049767 | |||
| 2744 | Ga0496108_0469302 | |||
| 2745 | Ga0496108_0908654 | |||
| 2746 | Ga0496109_0015325 | |||
| 2747 | Ga0496109_0127622 | |||
| 2748 | Ga0496109_0140878 | |||
| 2749 | Ga0496109_1118299 | |||
| 2750 | Ga0496110_0036932 | |||
| 2751 | Ga0496110_0238421 | |||
| 2752 | Ga0496110_0593092 | |||
| 2753 | Ga0496110_0606365 | |||
| 2754 | Ga0496110_0967264 | |||
| 2755 | Ga0496110_1900217 | |||
| 2756 | Ga0496111_0131281 | |||
| 2757 | Ga0496111_0157727 | |||
| 2758 | Ga0496111_0756016 | |||
| 2759 | Ga0496111_1111670 | |||
| 2760 | Ga0496112_0003253 | |||
| 2761 | Ga0496112_1264623 | |||
| 2762 | Ga0496112_1385731 | |||
| 2763 | Ga0496113_0028635 | |||
| 2764 | Ga0496113_0120256 | |||
| 2765 | Ga0496113_0409775 | |||
| 2766 | Ga0496113_1209526 | |||
| 2767 | Ga0496114_0103681 | |||
| 2768 | Ga0496114_0435101 | |||
| 2769 | Ga0496114_0806597 | |||
| 2770 | Ga0496115_0165105 | |||
| 2771 | Ga0496115_0795334 | |||
| 2772 | Ga0496125_0378184 | |||
| 2773 | Ga0501292_081580 | |||
| 2774 | Ga0501298_034855 | |||
| 2775 | Ga0501298_098036 | |||
| 2776 | Ga0501299_029061 | |||
| 2777 | Ga0501031_0213980 | |||
| 2778 | Ga0501031_0471885 | |||
| 2779 | Ga0501032_0393350 | |||
| 2780 | Ga0501032_0452301 | |||
| 2781 | Ga0501034_0037339 | |||
| 2782 | Ga0501034_0070904 | |||
| 2783 | Ga0501034_0483758 | |||
| 2784 | Ga0501034_1389467 | |||
| 2785 | Ga0501036_0162187 | |||
| 2786 | Ga0501036_0218791 | |||
| 2787 | Ga0501036_0308645 | |||
| 2788 | Ga0501036_0378978 | |||
| 2789 | Ga0501037_0205309 | |||
| 2790 | Ga0501037_0351409 | |||
| 2791 | Ga0501038_0047221 | |||
| 2792 | Ga0501038_0467653 | |||
| 2793 | Ga0501039_0009254 | |||
| 2794 | Ga0501039_0022793 | |||
| 2795 | Ga0501039_0089592 | |||
| 2796 | Ga0501039_0382638 | |||
| 2797 | Ga0501039_0659625 | |||
| 2798 | Ga0501039_1307404 | |||
| 2799 | Ga0501040_0041439 | |||
| 2800 | Ga0501040_0105919 | |||
| 2801 | Ga0501040_0238892 | |||
| 2802 | Ga0501040_0308782 | |||
| 2803 | Ga0501040_0623235 | |||
| 2804 | Ga0501040_0763689 | |||
| 2805 | Ga0501040_0983560 | |||
| 2806 | Ga0501041_0005794 | |||
| 2807 | Ga0501041_0085321 | |||
| 2808 | Ga0501041_0159468 | |||
| 2809 | Ga0501041_0216217 | |||
| 2810 | Ga0501042_0086669 | |||
| 2811 | Ga0501042_0277917 | |||
| 2812 | Ga0501042_0472367 | |||
| 2813 | Ga0501042_0813836 | |||
| 2814 | Ga0501042_1349569 | |||
| 2815 | Ga0501043_0034922 | |||
| 2816 | Ga0501043_0575817 | |||
| 2817 | Ga0501043_1181769 | |||
| 2818 | Ga0501046_0107096 | |||
| 2819 | Ga0501046_0264329 | |||
| 2820 | Ga0501046_0697276 | |||
| 2821 | Ga0501047_0007381 | |||
| 2822 | Ga0501047_0043016 | |||
| 2823 | Ga0501047_0054694 | |||
| 2824 | Ga0501048_0065342 | |||
| 2825 | Ga0501048_0562567 | |||
| 2826 | Ga0501048_0819906 | |||
| 2827 | Ga0501067_0028457 | |||
| 2828 | Ga0501067_0055645 | |||
| 2829 | Ga0501067_0112358 | |||
| 2830 | Ga0501067_0299812 | |||
| 2831 | Ga0501067_0397242 | |||
| 2832 | Ga0501067_0451750 | |||
| 2833 | Ga0501067_0617117 | |||
| 2834 | Ga0501068_0008133 | |||
| 2835 | Ga0501068_0419184 | |||
| 2836 | Ga0501069_0017609 | |||
| 2837 | Ga0501069_0247272 | |||
| 2838 | Ga0501069_0476478 | |||
| 2839 | Ga0501070_0004618 | |||
| 2840 | Ga0501070_0009796 | |||
| 2841 | Ga0501070_0251633 | |||
| 2842 | Ga0501070_0648778 | |||
| 2843 | Ga0501071_0001498 | |||
| 2844 | Ga0501071_0002072 | |||
| 2845 | Ga0501071_0011658 | |||
| 2846 | Ga0501071_0462973 | |||
| 2847 | Ga0501072_0027869 | |||
| 2848 | Ga0501072_0154871 | |||
| 2849 | Ga0501072_0215155 | |||
| 2850 | Ga0501072_0364873 | |||
| 2851 | Ga0501073_0002898 | |||
| 2852 | Ga0501073_0006777 | |||
| 2853 | Ga0501073_0053748 | |||
| 2854 | Ga0501073_0695868 | |||
| 2855 | Ga0501074_0017221 | |||
| 2856 | Ga0501074_0030208 | |||
| 2857 | Ga0501074_0255408 | |||
| 2858 | Ga0501074_0319323 | |||
| 2859 | Ga0501074_0664584 | |||
| 2860 | Ga0501074_0769779 | |||
| 2861 | Ga0501074_1183224 | |||
| 2862 | Ga0501075_0050707 | |||
| 2863 | Ga0501075_0158308 | |||
| 2864 | Ga0501075_0284217 | |||
| 2865 | Ga0501075_0357369 | |||
| 2866 | Ga0501075_0458307 | |||
| 2867 | Ga0501075_1093183 | |||
| 2868 | Ga0501075_1223619 | |||
| 2869 | Ga0501076_0048224 | |||
| 2870 | Ga0501076_0113880 | |||
| 2871 | Ga0501076_0219221 | |||
| 2872 | Ga0501076_0590754 | |||
| 2873 | Ga0501077_0087227 | |||
| 2874 | Ga0501077_0217860 | |||
| 2875 | Ga0501077_0238284 | |||
| 2876 | Ga0501077_1045087 | |||
| 2877 | Ga0501208_147853 | |||
| 2878 | Ga0501216_165927 | |||
| 2879 | Ga0501217_076101 | |||
| 2880 | Ga0501217_131685 | |||
| 2881 | Ga0501233_069758 | |||
| 2882 | Ga0501235_077175 | |||
| 2883 | Ga0501246_033641 | |||
| 2884 | Ga0501079_0042166 | |||
| 2885 | Ga0501079_0047536 | |||
| 2886 | Ga0501079_0284662 | |||
| 2887 | Ga0501079_0553872 | |||
| 2888 | Ga0501079_0816768 | |||
| 2889 | Ga0501080_0006525 | |||
| 2890 | Ga0501080_0018146 | |||
| 2891 | Ga0501080_0065999 | |||
| 2892 | Ga0501080_0091743 | |||
| 2893 | Ga0501080_0294711 | |||
| 2894 | Ga0501080_0324807 | |||
| 2895 | Ga0501080_0737786 | |||
| 2896 | Ga0501081_0101725 | |||
| 2897 | Ga0501081_0234824 | |||
| 2898 | Ga0501081_0318727 | |||
| 2899 | Ga0501081_0512190 | |||
| 2900 | Ga0501081_0596987 | |||
| 2901 | Ga0501081_0731045 | |||
| 2902 | Ga0501083_0012201 | |||
| 2903 | Ga0501083_0017852 | |||
| 2904 | Ga0501083_0139059 | |||
| 2905 | Ga0501083_0148584 | |||
| 2906 | Ga0501083_0308607 | |||
| 2907 | Ga0501083_0600626 | |||
| 2908 | Ga0501270_147032 | |||
| 2909 | Ga0501283_011611 | |||
| 2910 | Ga0501035_0529999 | |||
| 2911 | Ga0501035_0681280 | |||
| 2912 | Ga0501035_0725919 | |||
| 2913 | Ga0501044_0015376 | |||
| 2914 | Ga0501044_0239820 | |||
| 2915 | Ga0501045_0071244 | |||
| 2916 | Ga0501045_0208124 | |||
| 2917 | Ga0501045_0619428 | |||
| 2918 | Ga0501045_0640772 | |||
| 2919 | Ga0501045_0777151 | |||
| 2920 | Ga0501204_019434 | |||
| 2921 | Ga0501212_049278 | |||
| 2922 | nmdc:mga03683_5884_c1 | |||
| 2923 | nmdc:mga03n38_125_c1 | |||
| 2924 | nmdc:mga00v17_565_c1 | |||
| 2925 | nmdc:mga0yw44_170996_c1 | |||
| 2926 | nmdc:mga0yw44_811_c1 | |||
| 2927 | nmdc:mga06z11_1903_c1 | |||
| 2928 | nmdc:mga04h51_3880_c1 | |||
| 2929 | nmdc:mga05p37_1283494_c1 | |||
| 2930 | nmdc:mga05p37_355_c1 | |||
| 2931 | nmdc:mga05p37_7114_c1 | |||
| 2932 | nmdc:mga05p37_952760_c1 | |||
| 2933 | nmdc:mga09592_17223_c1 | |||
| 2934 | nmdc:mga09592_1792_c1 | |||
| 2935 | nmdc:mga09592_204680_c1 | |||
| 2936 | nmdc:mga09592_21121_c1 | |||
| 2937 | nmdc:mga09592_272438_c1 | |||
| 2938 | nmdc:mga09592_547455_c1 | |||
| 2939 | nmdc:mga0qj67_284205_c1 | |||
| 2940 | nmdc:mga0qj67_336788_c1 | |||
| 2941 | nmdc:mga0qj67_360502_c1 | |||
| 2942 | nmdc:mga0qj67_853527_c1 | |||
| 2943 | nmdc:mga06r32_158503_c1 | |||
| 2944 | nmdc:mga06r32_167341_c1 | |||
| 2945 | nmdc:mga06r32_293964_c1 | |||
| 2946 | nmdc:mga06r32_570574_c1 | |||
| 2947 | nmdc:mga08y16_101924_c1 | |||
| 2948 | nmdc:mga08y16_14088_c1 | |||
| 2949 | nmdc:mga08y16_18626_c1 | |||
| 2950 | nmdc:mga08y16_197067_c1 | |||
| 2951 | nmdc:mga08y16_213614_c1 | |||
| 2952 | nmdc:mga08y16_261479_c1 | |||
| 2953 | nmdc:mga08y16_423612_c1 | |||
| 2954 | nmdc:mga08y16_4258_c1 | |||
| 2955 | nmdc:mga0n895_1478842_c1 | |||
| 2956 | nmdc:mga0n895_1843217_c1 | |||
| 2957 | nmdc:mga0n895_36969_c1 | |||
| 2958 | nmdc:mga0n895_470256_c1 | |||
| 2959 | nmdc:mga0n895_5640_c1 | |||
| 2960 | nmdc:mga0n895_802994_c1 | |||
| 2961 | nmdc:mga0rr50_1003820_c1 | |||
| 2962 | nmdc:mga0rr50_101580_c1 | |||
| 2963 | nmdc:mga0rr50_133033_c1 | |||
| 2964 | nmdc:mga0rr50_1406_c1 | |||
| 2965 | nmdc:mga0rr50_172666_c1 | |||
| 2966 | nmdc:mga0rr50_267644_c1 | |||
| 2967 | nmdc:mga0rr50_541424_c1 | |||
| 2968 | nmdc:mga0rr50_61731_c1 | |||
| 2969 | nmdc:mga0rr50_71538_c1 | |||
| 2970 | nmdc:mga08x19_21595_c1 | |||
| 2971 | nmdc:mga08x19_28316_c1 | |||
| 2972 | nmdc:mga08x19_431822_c1 | |||
| 2973 | nmdc:mga08x19_49998_c1 | |||
| 2974 | nmdc:mga08x19_71273_c1 | |||
| 2975 | nmdc:mga08x19_9133_c1 | |||
| 2976 | nmdc:mga0a205_1205520_c1 | |||
| 2977 | nmdc:mga0a205_136217_c1 | |||
| 2978 | nmdc:mga0a205_294_c1 | |||
| 2979 | Ga0495601_0002136 | |||
| 2980 | Ga0495601_0010686 | |||
| 2981 | Ga0495612_0008626 | |||
| 2982 | Ga0495612_0043466 | |||
| 2983 | Ga0495612_0210857 | |||
| 2984 | Ga0495655_0373090 | |||
| 2985 | Ga0495595_0000270 | |||
| 2986 | Ga0495595_0050637 | |||
| 2987 | Ga0495595_0327898 | |||
| 2988 | Ga0495619_0000324 | |||
| 2989 | Ga0495619_0002457 | |||
| 2990 | Ga0495619_0022462 | |||
| 2991 | Ga0495619_0429373 | |||
| 2992 | Ga0500616_0073015 | |||
| 2993 | Ga0501084_0034148 | |||
| 2994 | Ga0501084_0195928 | |||
| 2995 | Ga0501084_0351460 | |||
| 2996 | Ga0501084_0601003 | |||
| 2997 | Ga0501084_0674879 | |||
| 2998 | Ga0501084_0806262 | |||
| 2999 | Ga0501084_0927880 | |||
| 3000 | Ga0501084_1006995 | |||
| 3001 | Ga0590077_055784 | |||
| 3002 | Ga0501082_0058019 | |||
| 3003 | Ga0501082_0101184 | |||
| 3004 | Ga0501082_0126930 | |||
| 3005 | Ga0501082_0145715 | |||
| 3006 | Ga0501082_0363831 | |||
| 3007 | Ga0501082_0659404 | |||
| 3008 | Ga0501082_0871948 | |||
| 3009 | Ga0501082_1915553 | |||
| 3010 | Ga0530510_0079461 | |||
| 3011 | Ga0530510_0083068 | |||
| 3012 | Ga0530510_0754718 | |||
| 3013 | Ga0530510_0832149 | |||
| 3014 | Ga0530510_1412585 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy