F494449

General Info

Members Datasets Scaffolds Average Seq Length
1508 604 3017 252

Family's Representative Sequence

Representative Sequence 3300003773|Ga0055537_1005980|Ga0055537_10059803
Length 301
Sequence MPANARSVTNCGPCAASVTRSSVGEDRQRAAERPPTETSRHSARSTDTDLILYEYPFNERIRTLLRLEDLFDRLDYFLGQEHPLQHHVAITTIFEIIDVAGRADLKTDLIKELERQRQALAPLRANPQIDQDALVSVITEIEQGIAALNQTVGKAGQLLTDNEWLTSIRSRAIIPGGTCEFDLPAYYAWQHRPADDRRADILKWARPLASLRMGAMIVLRLLRESGQSGKVIATGGSYQQMLSXXXXQLMQVYLDESLLAFIPEMSANKYMLWVRFTQQDGDMRPRSVDADIPFLLKLCNF

Samples

Sample ID Description Type Environment
1 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
23 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
24 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
25 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
26 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
29 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
30 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
31 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
36 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
42 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
43 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
44 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
50 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
103 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
104 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
119 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
120 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
139 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
140 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
147 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
149 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
150 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
157 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
159 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
160 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
161 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
164 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
165 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
166 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
170 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
171 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
176 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
179 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
229 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
231 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
235 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
236 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
237 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
238 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
239 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
240 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
241 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
242 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
243 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
244 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
245 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
246 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
247 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
248 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
249 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
250 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
251 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
252 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
253 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
254 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
255 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
256 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
257 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
258 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
259 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
260 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
261 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
262 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
263 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
264 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
265 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
266 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
270 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
271 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
272 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
275 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
276 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
277 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
278 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
279 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
280 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
281 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
282 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
283 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
284 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
285 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
286 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
287 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
288 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
289 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
290 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
291 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
292 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
293 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
294 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
295 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
296 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
297 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
298 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
299 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
300 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
301 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
302 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
303 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
304 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
305 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
306 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
307 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
308 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
309 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
310 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
311 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
312 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
313 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
314 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
315 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
316 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
317 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
318 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
319 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
320 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
321 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
322 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
323 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
324 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
325 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
326 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
327 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
328 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
329 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
330 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
331 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
332 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
333 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
334 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
335 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
336 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
337 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
338 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
339 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
340 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
341 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
342 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
343 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
344 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
345 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
346 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
347 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
348 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
349 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
350 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
351 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
352 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
353 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
354 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
355 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
356 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
357 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
358 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
359 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
360 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
361 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
362 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
363 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
364 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
365 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
366 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
367 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
368 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
369 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
370 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
371 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
372 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
373 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
374 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
375 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
376 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
377 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
378 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
379 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
380 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
381 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
382 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
383 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
384 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
385 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
386 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
387 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
388 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
389 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
390 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
391 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
392 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
393 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
394 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
395 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
396 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
397 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
398 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
399 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
400 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
401 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
402 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
403 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
404 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
405 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
406 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
407 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
408 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
409 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
410 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
411 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
412 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
413 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
414 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
415 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
416 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
417 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
418 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
419 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
420 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
421 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
422 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
423 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
424 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
425 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
426 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
427 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
428 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
429 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
430 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
431 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
432 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
433 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
434 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
435 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
436 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
437 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
438 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
440 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
441 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
444 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
445 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
446 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
447 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
448 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
449 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
450 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
451 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
452 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
453 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
454 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
455 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
456 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
457 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
458 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
459 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
460 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
461 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
462 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
463 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
464 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
465 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
466 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
467 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
468 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
469 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
470 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
471 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
472 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
473 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
474 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
475 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
476 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
477 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
478 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
479 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
480 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
486 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
487 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
488 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
489 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
490 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
491 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
492 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
493 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
494 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
495 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
496 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
497 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
498 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
499 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
500 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
501 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
502 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
503 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
504 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
505 2519103095 Burkholderia sp. KJ006 Isolate Nodule
506 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
507 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
508 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
509 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
510 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
511 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
512 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
513 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
514 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
515 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
516 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
517 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
518 2643221585 Pelomonas sp. Root662 Isolate Unclassified
519 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
520 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
521 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
522 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
523 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
524 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
525 2643221656 Pelomonas sp. Root405 Isolate Unclassified
526 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
527 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
528 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
529 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
530 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
531 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
532 2738541337 Pelomonas sp. BT06 Isolate Unclassified
533 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
534 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
535 2738543013 Variovorax sp. BT01 Isolate Unclassified
536 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
537 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
538 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
539 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
540 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
541 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
542 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
543 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
544 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
545 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
546 2818991450 Burkholderia sp. 604 Isolate Unclassified
547 2818991452 Burkholderia cepacia 561 Isolate Unclassified
548 2831864461 Roseateles noduli HZ7 Isolate Nodule
549 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
550 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
551 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
552 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
553 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
554 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
555 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
556 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
557 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
558 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
559 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
560 2885266251 Ralstonia sp. SET104 Isolate Nodule
561 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
562 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
563 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
564 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
565 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
566 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
567 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
568 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
569 2904564687 Burkholderia sp. 571 Isolate Unclassified
570 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
571 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
572 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
573 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
574 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
575 2928058823 Ralstonia sp. 1138 Isolate Unclassified
576 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
577 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
578 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
579 2928163908 Burkholderia sp. 567 Isolate Unclassified
580 2928170801 Burkholderia sp. 572 Isolate Unclassified
581 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
582 2928536128 Burkholderia sola 565 Isolate Unclassified
583 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
584 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
585 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
586 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
587 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
588 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
589 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
590 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
591 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
592 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
593 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
594 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
595 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
596 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
597 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
598 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
599 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
600 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
601 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
602 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
603 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
604 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.25
Metatranscriptomes 0.86
Isolates 7.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.61
Nodule 2.06
Rhizoplane 4.77
Rhizosphere 59.48
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055537_1005980 3300003773 Bacteria 3161
2 JGI24741J21665_1000283 3300001915 Bacteria 15331
3 JGI24740J21852_10000515 3300001979 Bacteria 16646
4 JGI24740J21852_10000746 3300001979 Bacteria 14194
5 JGI24740J21852_10001108 3300001979 Bacteria 12171
6 JGI24740J21852_10009684 3300001979 Bacteria 3756
7 JGI24740J21852_10041650 3300001979 Bacteria 1382
8 JGI24739J22299_10002065 3300001989 Bacteria 7689
9 JGI24739J22299_10031281 3300001989 Bacteria 1839
10 JGI24739J22299_10042269 3300001989 Bacteria 1512
11 JGI24735J21928_10000452 3300002067 Bacteria 14409
12 JGI24735J21928_10011624 3300002067 Bacteria 2788
13 JGI24735J21928_10035479 3300002067 Bacteria 1466
14 JGI24738J21930_10003232 3300002075 Bacteria 4155
15 JGI25155J39150_1000022 3300002704 Bacteria 142950
16 JGI25156J39149_1000005 3300002705 Bacteria 263980
17 JGI25156J39149_1001653 3300002705 Bacteria 9037
18 JGI25156J39149_1002435 3300002705 Bacteria 6675
19 JGI25156J39149_1002891 3300002705 Bacteria 5885
20 JGI25156J39149_1005295 3300002705 Bacteria 3761
21 JGI25154J39366_1000017 3300002738 Bacteria 252448
22 JGI25158J39367_1002236 3300002739 Bacteria 3213
23 JGI25157J39369_1000003 3300002741 Bacteria 274935
24 JGI25152J39213_1013920 3300002773 Bacteria 1653
25 JGI25152J39213_1016999 3300002773 Bacteria 1385
26 JGI25150J39212_1001013 3300002774 Bacteria 8697
27 JGI25150J39212_1007308 3300002774 Bacteria 2224
28 JGI25150J39212_1016857 3300002774 Bacteria 1191
29 JGI25150J39212_1018546 3300002774 Bacteria 1105
30 JGI25159J45721_1000990 3300002987 Bacteria 12274
31 JGI25159J45721_1001144 3300002987 Bacteria 11340
32 JGI25151J46595_10003048 3300003187 Bacteria 9477
33 JGI25151J46595_10005037 3300003187 Bacteria 6877
34 JGI25151J46595_10007571 3300003187 Bacteria 5305
35 JGI25151J46595_10026649 3300003187 Bacteria 2328
36 JGI25151J46595_10067336 3300003187 Bacteria 1104
37 JGI25165J46597_1001016 3300003214 Bacteria 18508
38 JGI25153J46596_10000420 3300003215 Bacteria 27768
39 JGI25153J46596_10001641 3300003215 Bacteria 13278
40 JGI25153J46596_10003017 3300003215 Bacteria 9528
41 JGI25153J46596_10003453 3300003215 Bacteria 8849
42 rootH1_10005825 3300003316 Bacteria 3095
43 rootH2_10020860 3300003320 Bacteria 3744
44 rootH2_10117659 3300003320 Bacteria 2393
45 rootH1_10008605 3300003323 Bacteria 5110
46 rootH1_10041182 3300003316 Bacteria 1303
47 rootH1_10041182 3300003323 Bacteria 1456
48 rootH1_10110046 3300003323 Bacteria 1477
49 rootH1_10195324 3300003323 Bacteria 2869
50 JGI25160J50197_1000155 3300003354 Bacteria 60424
51 JGI25160J50197_1000273 3300003354 Bacteria 38119
52 JGI25161J50226_1000095 3300003374 Bacteria 72343
53 Ga0006562J51391_1021614 3300003578 Bacteria 6092
54 Ga0055539_1000188 3300003752 Bacteria 50872
55 Ga0055539_1002965 3300003752 Bacteria 2454
56 Ga0055533_1001338 3300003756 Bacteria 6675
57 Ga0055533_1003294 3300003756 Bacteria 3296
58 Ga0055533_1003917 3300003756 Bacteria 2824
59 Ga0055532_1000072 3300003758 Bacteria 131787
60 Ga0055532_1000318 3300003758 Bacteria 28387
61 Ga0055532_1001078 3300003758 Bacteria 8431
62 Ga0055525_1000004 3300003759 Bacteria 888039
63 Ga0055525_1000168 3300003759 Bacteria 83935
64 Ga0055525_1004544 3300003759 Bacteria 1191
65 Ga0055527_1000296 3300003760 Bacteria 28387
66 Ga0055527_1000586 3300003760 Bacteria 11871
67 Ga0055527_1001512 3300003760 Bacteria 4783
68 Ga0055527_1002285 3300003760 Bacteria 3332
69 Ga0055535_1000053 3300003761 Bacteria 131787
70 Ga0055535_1000094 3300003761 Bacteria 97073
71 Ga0055535_1001469 3300003761 Bacteria 11871
72 Ga0055535_1001478 3300003761 Bacteria 11777
73 Ga0055542_1000131 3300003762 Bacteria 97073
74 Ga0055542_1000793 3300003762 Bacteria 23412
75 Ga0055542_1001405 3300003762 Bacteria 12156
76 Ga0055542_1001797 3300003762 Bacteria 8887
77 Ga0055542_1004457 3300003762 Bacteria 3396
78 Ga0055529_1000099 3300003763 Bacteria 131775
79 Ga0055529_1000592 3300003763 Bacteria 28387
80 Ga0055529_1000875 3300003763 Bacteria 17252
81 Ga0055529_1001282 3300003763 Bacteria 8891
82 Ga0055526_1002203 3300003771 Bacteria 13346
83 Ga0055526_1006651 3300003771 Bacteria 6206
84 Ga0055526_1014651 3300003771 Bacteria 3206
85 Ga0055526_1014725 3300003771 Bacteria 3192
86 Ga0055537_1000483 3300003773 Bacteria 24708
87 Ga0055537_1013834 3300003773 Bacteria 1494
88 Ga0055524_1000073 3300003775 Bacteria 123033
89 Ga0055524_1001815 3300003775 Bacteria 11700
90 Ga0055524_1002320 3300003775 Bacteria 9903
91 Ga0055524_1003058 3300003775 Bacteria 8280
92 Ga0055524_1007833 3300003775 Bacteria 4498
93 Ga0055536_1000386 3300003781 Bacteria 32324
94 Ga0055536_1001517 3300003781 Bacteria 13926
95 Ga0055536_1003433 3300003781 Bacteria 8505
96 Ga0055536_1032466 3300003781 Bacteria 1349
97 Ga0055534_1000537 3300003784 Bacteria 20323
98 Ga0055534_1000994 3300003784 Bacteria 12461
99 Ga0055534_1001899 3300003784 Bacteria 7714
100 Ga0055534_1003367 3300003784 Bacteria 5043
101 Ga0055534_1003382 3300003784 Bacteria 5028
102 Ga0055534_1003675 3300003784 Bacteria 4746
103 Ga0055528_1000289 3300003790 Bacteria 42964
104 Ga0055528_1006492 3300003790 Bacteria 5301
105 Ga0055528_1007354 3300003790 Bacteria 4875
106 Ga0055528_1008897 3300003790 Bacteria 4243
107 Ga0055530_10001136 3300003791 Bacteria 20712
108 Ga0055530_10001363 3300003791 Bacteria 18109
109 Ga0055530_10001971 3300003791 Bacteria 13967
110 Ga0055530_10002524 3300003791 Bacteria 11680
111 Ga0055530_10043550 3300003791 Bacteria 1081
112 Ga0055540_1000013 3300003792 Bacteria 262274
113 Ga0055540_1000037 3300003792 Bacteria 162957
114 Ga0055531_10000112 3300003794 Bacteria 89016
115 Ga0055531_10000500 3300003794 Bacteria 35897
116 Ga0055531_10007794 3300003794 Bacteria 5767
117 Ga0055531_10009798 3300003794 Bacteria 4856
118 Ga0055531_10017694 3300003794 Bacteria 2992
119 Ga0055541_1000432 3300003841 Bacteria 12202
120 Ga0055541_1005995 3300003841 Bacteria 2097
121 Ga0058692_1000925 3300003856 Bacteria 11590
122 Ga0055543_1000218 3300004625 Bacteria 46120
123 Ga0055543_1002676 3300004625 Bacteria 5717
124 Ga0055543_1002886 3300004625 Bacteria 5406
125 Ga0065165_1000290 3300005262 Bacteria 85623
126 Ga0065165_1000502 3300005262 Bacteria 60462
127 Ga0065165_1004909 3300005262 Bacteria 7899
128 Ga0065165_1005723 3300005262 Bacteria 6838
129 Ga0065165_1005753 3300005262 Bacteria 6806
130 Ga0065165_1006006 3300005262 Bacteria 6546
131 Ga0065165_1018740 3300005262 Bacteria 2494
132 Ga0065714_10003595 3300005288 Bacteria 6625
133 Ga0070658_10000514 3300005327 Bacteria 33573
134 Ga0070658_10014502 3300005327 Bacteria 6325
135 Ga0070658_10147360 3300005327 Bacteria 1969
136 Ga0070658_10254962 3300005327 Bacteria 1489
137 Ga0070676_10020247 3300005328 Bacteria 3711
138 Ga0070683_100023598 3300005329 Bacteria 5503
139 Ga0070683_100228845 3300005329 Bacteria 1767
140 Ga0070670_100064962 3300005331 Bacteria 3131
141 Ga0070670_100264594 3300005331 Bacteria 1500
142 Ga0070677_10005133 3300005333 Bacteria 4303
143 Ga0070677_10041967 3300005333 Bacteria 1809
144 Ga0068869_100002210 3300005334 Bacteria 11707
145 Ga0068869_100131954 3300005334 Bacteria 1921
146 Ga0070682_100048124 3300005337 Bacteria 2654
147 Ga0068868_100001584 3300005338 Bacteria 15507
148 Ga0068868_100019660 3300005338 Bacteria 5064
149 Ga0068868_100037899 3300005338 Bacteria 3740
150 Ga0068868_100217618 3300005338 Bacteria 1598
151 Ga0070660_100000030 3300005339 Bacteria 86675
152 Ga0070660_100001389 3300005339 Bacteria 16467
153 Ga0070660_100019132 3300005339 Bacteria 5014
154 Ga0070660_100019997 3300005339 Bacteria 4913
155 Ga0070660_100086747 3300005339 Bacteria 2463
156 Ga0070660_100105248 3300005339 Bacteria 2239
157 Ga0070689_100158211 3300005340 Bacteria 1830
158 Ga0070661_100000097 3300005344 Bacteria 71801
159 Ga0070661_100015458 3300005344 Bacteria 5386
160 Ga0070661_100078642 3300005344 Bacteria 2433
161 Ga0070661_100082860 3300005344 Bacteria 2369
162 Ga0070661_100164659 3300005344 Unclassified 1681
163 Ga0070669_100013295 3300005353 Bacteria 5850
164 Ga0070669_100063487 3300005353 Bacteria 2718
165 Ga0070669_100075707 3300005353 Bacteria 2497
166 Ga0070675_100003464 3300005354 Bacteria 11959
167 Ga0070675_100032377 3300005354 Bacteria 4231
168 Ga0070675_100051356 3300005354 Bacteria 3388
169 Ga0070671_100009294 3300005355 Bacteria 7895
170 Ga0070671_100016897 3300005355 Bacteria 5902
171 Ga0070671_100156517 3300005355 Bacteria 1925
172 Ga0070673_100138379 3300005364 Bacteria 2052
173 Ga0070673_100230443 3300005364 Bacteria 1607
174 Ga0070673_100365684 3300005364 Bacteria 1283
175 Ga0070659_100000359 3300005366 Bacteria 34654
176 Ga0070659_100006742 3300005366 Bacteria 8303
177 Ga0070659_100039804 3300005366 Bacteria 3671
178 Ga0070659_100048077 3300005366 Bacteria 3349
179 Ga0070667_100025243 3300005367 Bacteria 4940
180 Ga0070667_100040384 3300005367 Bacteria 3913
181 Ga0070667_100188812 3300005367 Bacteria 1825
182 Ga0070663_100000016 3300005455 Bacteria 126268
183 Ga0070663_100010954 3300005455 Bacteria 5670
184 Ga0070663_100014328 3300005455 Bacteria 5087
185 Ga0070663_100434204 3300005455 Bacteria 1079
186 Ga0070678_100003986 3300005456 Bacteria 8301
187 Ga0070678_100031226 3300005456 Bacteria 3672
188 Ga0070678_100056818 3300005456 Bacteria 2864
189 Ga0070678_100059117 3300005456 Bacteria 2816
190 Ga0070662_100000321 3300005457 Bacteria 28578
191 Ga0070662_100051593 3300005457 Bacteria 2971
192 Ga0070662_100065895 3300005457 Bacteria 2656
193 Ga0070662_100113275 3300005457 Bacteria 2069
194 Ga0070662_100206436 3300005457 Bacteria 1561
195 Ga0070681_10020347 3300005458 Bacteria 6652
196 Ga0068867_100061132 3300005459 Bacteria 2796
197 Ga0068867_100400179 3300005459 Bacteria 1158
198 Ga0070707_100023808 3300005468 Bacteria 5793
199 Ga0070679_100000726 3300005530 Bacteria 28453
200 Ga0070684_100057533 3300005535 Bacteria 3395
201 Ga0068853_100005236 3300005539 Bacteria 10151
202 Ga0068853_100054404 3300005539 Bacteria 3449
203 Ga0068853_100183276 3300005539 Bacteria 1899
204 Ga0068853_100734967 3300005539 Bacteria 943
205 Ga0070672_100016993 3300005543 Bacteria 5224
206 Ga0070672_100044042 3300005543 Bacteria 3445
207 Ga0070686_100298010 3300005544 Bacteria 1195
208 Ga0070693_100033298 3300005547 Bacteria 2843
209 Ga0070693_100074620 3300005547 Bacteria 2007
210 Ga0070665_100103472 3300005548 Bacteria 2850
211 Ga0070665_100231076 3300005548 Bacteria 1849
212 Ga0068855_100003793 3300005563 Bacteria 18476
213 Ga0068855_100053702 3300005563 Bacteria 4739
214 Ga0068855_100244814 3300005563 Bacteria 2002
215 Ga0070664_100000017 3300005564 Bacteria 125713
216 Ga0070664_100003718 3300005564 Bacteria 12293
217 Ga0070664_100060999 3300005564 Bacteria 3213
218 Ga0070664_100099333 3300005564 Bacteria 2529
219 Ga0070664_100210064 3300005564 Bacteria 1739
220 Ga0068857_100026945 3300005577 Bacteria 5068
221 Ga0068857_100066363 3300005577 Bacteria 3210
222 Ga0068857_100074198 3300005577 Bacteria 3032
223 Ga0068857_100091481 3300005577 Bacteria 2723
224 Ga0068854_100000416 3300005578 Bacteria 26703
225 Ga0068854_100239935 3300005578 Bacteria 1443
226 Ga0068856_100000450 3300005614 Bacteria 45444
227 Ga0068856_100082275 3300005614 Bacteria 3195
228 Ga0068856_100200395 3300005614 Bacteria 2010
229 Ga0070702_100043620 3300005615 Bacteria 2528
230 Ga0068852_100015123 3300005616 Bacteria 5971
231 Ga0068852_100025824 3300005616 Bacteria 4765
232 Ga0068852_100044868 3300005616 Bacteria 3757
233 Ga0068852_100236978 3300005616 Bacteria 1742
234 Ga0068859_100052468 3300005617 Bacteria 4100
235 Ga0068864_100014003 3300005618 Bacteria 6649
236 Ga0068864_100034295 3300005618 Bacteria 4317
237 Ga0068864_100112722 3300005618 Bacteria 2424
238 Ga0068861_100007081 3300005719 Bacteria 7673
239 Ga0068851_10025736 3300005834 Bacteria 2887
240 Ga0068863_100169968 3300005841 Bacteria 2091
241 Ga0068863_100642976 3300005841 Bacteria 1052
242 Ga0068858_100004761 3300005842 Bacteria 13288
243 Ga0068858_100036277 3300005842 Bacteria 4571
244 Ga0068858_100161771 3300005842 Bacteria 2108
245 Ga0068860_100010883 3300005843 Bacteria 8971
246 Ga0068860_100243618 3300005843 Bacteria 1749
247 Ga0068862_100407620 3300005844 Bacteria 1273
248 Ga0075365_10219155 3300006038 Bacteria 1335
249 Ga0075368_10050541 3300006042 Bacteria 1651
250 Ga0075368_10055972 3300006042 Bacteria 1573
251 Ga0075363_100013051 3300006048 Bacteria 4016
252 Ga0075363_100196662 3300006048 Bacteria 1151
253 Ga0075364_10001615 3300006051 Bacteria 12330
254 Ga0075364_10005356 3300006051 Bacteria 7452
255 Ga0075362_10003588 3300006177 Bacteria 5452
256 Ga0075362_10040555 3300006177 Bacteria 2050
257 Ga0075362_10042308 3300006177 Bacteria 2013
258 Ga0075362_10043093 3300006177 Bacteria 1997
259 Ga0075367_10002511 3300006178 Bacteria 8410
260 Ga0075367_10027419 3300006178 Bacteria 3241
261 Ga0075367_10174365 3300006178 Bacteria 1340
262 Ga0075367_10252392 3300006178 Bacteria 1106
263 Ga0075366_10001564 3300006195 Bacteria 11440
264 Ga0075366_10013284 3300006195 Bacteria 4684
265 Ga0075366_10013313 3300006195 Bacteria 4679
266 Ga0075366_10019854 3300006195 Bacteria 3893
267 Ga0075366_10024281 3300006195 Bacteria 3535
268 Ga0075366_10024526 3300006195 Bacteria 3517
269 Ga0075366_10072666 3300006195 Bacteria 2050
270 Ga0075366_10087187 3300006195 Bacteria 1868
271 Ga0075366_10090345 3300006195 Bacteria 1834
272 Ga0075366_10112236 3300006195 Bacteria 1640
273 Ga0075366_10127869 3300006195 Bacteria 1533
274 Ga0075366_10213632 3300006195 Bacteria 1174
275 Ga0097621_100029411 3300006237 Bacteria 4339
276 Ga0097621_100090991 3300006237 Bacteria 2554
277 Ga0075370_10002323 3300006353 Bacteria 8784
278 Ga0075370_10002909 3300006353 Bacteria 8042
279 Ga0075370_10015127 3300006353 Bacteria 4124
280 Ga0075370_10016288 3300006353 Bacteria 3999
281 Ga0075370_10047956 3300006353 Bacteria 2419
282 Ga0075370_10071240 3300006353 Bacteria 1988
283 Ga0075429_100048012 3300006880 Bacteria 3713
284 Ga0068865_100028208 3300006881 Bacteria 3716
285 Ga0068865_100121036 3300006881 Bacteria 1946
286 Ga0068865_100269703 3300006881 Bacteria 1351
287 Ga0097620_100052468 3300006931 Bacteria 4100
288 Ga0099823_1008020 3300006944 Bacteria 10750
289 Ga0079104_1011971 3300006946 Bacteria 2753
290 Ga0099826_10000064 3300006948 Bacteria 60663
291 Ga0099826_10044047 3300006948 Bacteria 3065
292 Ga0105251_10000527 3300009011 Bacteria 36056
293 Ga0105251_10001573 3300009011 Bacteria 19532
294 Ga0105251_10006550 3300009011 Bacteria 7384
295 Ga0105244_10043171 3300009036 Bacteria 2328
296 Ga0105250_10000884 3300009092 Bacteria 17716
297 Ga0105250_10159519 3300009092 Bacteria 941
298 Ga0105240_10005235 3300009093 Bacteria 19386
299 Ga0105240_10005792 3300009093 Bacteria 18325
300 Ga0105240_10014381 3300009093 Bacteria 10807
301 Ga0105240_10029867 3300009093 Bacteria 7094
302 Ga0105240_10052469 3300009093 Bacteria 5125
303 Ga0105240_10063160 3300009093 Bacteria 4608
304 Ga0105240_10065840 3300009093 Bacteria 4497
305 Ga0105240_10213503 3300009093 Bacteria 2253
306 Ga0105240_10259814 3300009093 Bacteria 2004
307 Ga0105240_10358866 3300009093 Bacteria 1651
308 Ga0105240_10434823 3300009093 Bacteria 1472
309 Ga0105245_10028127 3300009098 Bacteria 4956
310 Ga0114129_10247999 3300009147 Bacteria 2391
311 Ga0105241_10154668 3300009174 Bacteria 1879
312 Ga0105241_10182206 3300009174 Bacteria 1743
313 Ga0105241_10204181 3300009174 Bacteria 1652
314 Ga0105248_10008801 3300009177 Bacteria 11085
315 Ga0105248_10033741 3300009177 Bacteria 5720
316 Ga0105248_10052778 3300009177 Bacteria 4562
317 Ga0105248_10300345 3300009177 Bacteria 1808
318 Ga0105248_10532971 3300009177 Bacteria 1324
319 Ga0105237_10002475 3300009545 Bacteria 22923
320 Ga0105237_10006702 3300009545 Bacteria 12730
321 Ga0105237_10028471 3300009545 Bacteria 5690
322 Ga0105237_10029734 3300009545 Bacteria 5551
323 Ga0105237_10032254 3300009545 Bacteria 5304
324 Ga0105237_10038844 3300009545 Bacteria 4807
325 Ga0105237_10575627 3300009545 Bacteria 1133
326 Ga0105238_10001839 3300009551 Bacteria 21271
327 Ga0105238_10007028 3300009551 Bacteria 11255
328 Ga0105238_10039786 3300009551 Bacteria 4767
329 Ga0105238_10044173 3300009551 Bacteria 4506
330 Ga0105238_10115790 3300009551 Bacteria 2660
331 Ga0105238_10271378 3300009551 Bacteria 1677
332 Ga0105238_10340460 3300009551 Bacteria 1488
333 Ga0105249_10062813 3300009553 Bacteria 3410
334 Ga0105239_10001374 3300010375 Bacteria 32644
335 Ga0105239_10086349 3300010375 Bacteria 3458
336 Ga0105239_10179098 3300010375 Bacteria 2371
337 Ga0105246_10030645 3300011119 Bacteria 3554
338 Ga0105246_10165764 3300011119 Bacteria 1687
339 Ga0157319_1000005 3300012497 Bacteria 372810
340 Ga0157324_1003648 3300012506 Bacteria 1021
341 Ga0157326_1000855 3300012513 Bacteria 3510
342 Ga0157373_10000474 3300013100 Bacteria 31838
343 Ga0157371_10000440 3300013102 Bacteria 50875
344 Ga0157371_10038319 3300013102 Bacteria 3430
345 Ga0157371_10066293 3300013102 Bacteria 2556
346 Ga0157370_10000447 3300013104 Bacteria 51488
347 Ga0157370_10001380 3300013104 Bacteria 30036
348 Ga0157370_10006484 3300013104 Bacteria 12900
349 Ga0157370_10017368 3300013104 Bacteria 7262
350 Ga0157370_10628093 3300013104 Unclassified 982
351 Ga0157369_10001896 3300013105 Bacteria 25209
352 Ga0157369_10003307 3300013105 Bacteria 19159
353 Ga0157369_10008737 3300013105 Bacteria 11606
354 Ga0157369_10009949 3300013105 Bacteria 10865
355 Ga0157369_10037705 3300013105 Bacteria 5291
356 Ga0157369_10040174 3300013105 Bacteria 5108
357 Ga0157369_10107149 3300013105 Bacteria 2973
358 Ga0157369_10673156 3300013105 Bacteria 1066
359 Ga0157369_10939355 3300013105 Bacteria 886
360 Ga0157374_10000055 3300013296 Bacteria 120079
361 Ga0157374_10019867 3300013296 Bacteria 5953
362 Ga0157374_10030579 3300013296 Bacteria 4891
363 Ga0157374_10133087 3300013296 Bacteria 2408
364 Ga0157374_10358811 3300013296 Bacteria 1449
365 Ga0157374_10439724 3300013296 Bacteria 1304
366 Ga0157378_10578909 3300013297 Unclassified 1131
367 Ga0163162_10000659 3300013306 Bacteria 31955
368 Ga0163162_10038809 3300013306 Bacteria 4754
369 Ga0163162_10055378 3300013306 Bacteria 3992
370 Ga0163162_10128504 3300013306 Bacteria 2642
371 Ga0157372_10000348 3300013307 Bacteria 50939
372 Ga0157372_10020596 3300013307 Bacteria 7119
373 Ga0157372_10041911 3300013307 Bacteria 5062
374 Ga0157372_10748294 3300013307 Bacteria 1136
375 Ga0157375_10013668 3300013308 Bacteria 7237
376 Ga0157375_10038391 3300013308 Bacteria 4598
377 Ga0157375_10055204 3300013308 Bacteria 3916
378 Ga0157375_10081080 3300013308 Bacteria 3284
379 Ga0157375_10103704 3300013308 Bacteria 2931
380 Ga0157375_10462156 3300013308 Bacteria 1435
381 Ga0163163_10142949 3300014325 Bacteria 2435
382 Ga0163163_10690204 3300014325 Bacteria 1084
383 Ga0157380_10007872 3300014326 Bacteria 7583
384 Ga0182008_10003049 3300014497 Bacteria 10280
385 Ga0182008_10047221 3300014497 Bacteria 2139
386 Ga0182008_10083487 3300014497 Bacteria 1573
387 Ga0157377_10007064 3300014745 Bacteria 5394
388 Ga0157379_10015896 3300014968 Bacteria 6616
389 Ga0157379_10016463 3300014968 Bacteria 6503
390 Ga0157376_10031275 3300014969 Bacteria 4259
391 Ga0157376_10056797 3300014969 Bacteria 3272
392 Ga0157376_10247556 3300014969 Bacteria 1663
393 Ga0182006_1001066 3300015261 Bacteria 17656
394 Ga0182006_1001585 3300015261 Bacteria 13499
395 Ga0182006_1010909 3300015261 Bacteria 4020
396 Ga0182006_1089923 3300015261 Bacteria 1106
397 Ga0182007_10001230 3300015262 Bacteria 13908
398 Ga0182007_10002485 3300015262 Bacteria 9137
399 Ga0182007_10002754 3300015262 Bacteria 8591
400 Ga0182005_1040160 3300015265 Bacteria 1272
401 Ga0182005_1045312 3300015265 Bacteria 1195
402 Ga0183362_10003 3300015683 Bacteria 977584
403 Ga0183361_10037 3300016635 Bacteria 40970
404 Ga0163161_10018630 3300017792 Bacteria 4866
405 Ga0163161_10030806 3300017792 Bacteria 3820
406 Ga0163161_10032747 3300017792 Bacteria 3713
407 Ga0163161_10056934 3300017792 Bacteria 2840
408 Ga0206356_10229810 3300020070 Bacteria 2654
409 Ga0206351_10894528 3300020077 Bacteria 16139
410 Ga0206350_11190805 3300020080 Bacteria 1300
411 Ga0206350_11327716 3300020080 Bacteria 1387
412 Ga0154015_1371877 3300020610 Bacteria 22951
413 Ga0213872_10000067 3300021361 Bacteria 92410
414 Ga0213872_10000104 3300021361 Bacteria 78306
415 Ga0213872_10000131 3300021361 Bacteria 68632
416 Ga0213872_10058914 3300021361 Bacteria 1738
417 Ga0224712_10000047 3300022467 Bacteria 19062
418 Ga0209435_100002 3300025206 Bacteria 794178
419 Ga0209436_103243 3300025208 Bacteria 4414
420 Ga0209784_100063 3300025224 Bacteria 159576
421 Ga0209784_100812 3300025224 Bacteria 7148
422 Ga0209566_100048 3300025225 Bacteria 241570
423 Ga0209566_100410 3300025225 Bacteria 33986
424 Ga0209566_100738 3300025225 Bacteria 18319
425 Ga0209674_100013 3300025226 Bacteria 813140
426 Ga0209674_100071 3300025226 Bacteria 241568
427 Ga0209674_100151 3300025226 Bacteria 95725
428 Ga0209674_100275 3300025226 Bacteria 38966
429 Ga0209674_100809 3300025226 Bacteria 10420
430 Ga0209674_108241 3300025226 Bacteria 1248
431 Ga0209672_100010 3300025228 Bacteria 873151
432 Ga0209672_100241 3300025228 Bacteria 41063
433 Ga0209672_100243 3300025228 Bacteria 40964
434 Ga0209672_101464 3300025228 Bacteria 8368
435 Ga0209672_101467 3300025228 Bacteria 8363
436 Ga0209672_104258 3300025228 Bacteria 2706
437 Ga0209147_100002 3300025229 Bacteria 2158988
438 Ga0209147_100006 3300025229 Bacteria 873276
439 Ga0209147_100638 3300025229 Bacteria 18770
440 Ga0209147_100711 3300025229 Bacteria 16944
441 Ga0209563_100013 3300025230 Bacteria 941463
442 Ga0209563_100163 3300025230 Bacteria 55116
443 Ga0209563_100382 3300025230 Bacteria 16042
444 Ga0207427_100753 3300025231 Bacteria 14856
445 Ga0209258_100002 3300025242 Bacteria 2158988
446 Ga0209258_100010 3300025242 Bacteria 873276
447 Ga0209258_100486 3300025242 Bacteria 41063
448 Ga0209258_100530 3300025242 Bacteria 36370
449 Ga0207425_1000221 3300025245 Bacteria 44837
450 Ga0207425_1001010 3300025245 Bacteria 13177
451 Ga0207425_1001487 3300025245 Bacteria 9742
452 Ga0207425_1002959 3300025245 Bacteria 5685
453 Ga0209646_1000001 3300025246 Bacteria 3092932
454 Ga0209646_1000123 3300025246 Bacteria 142437
455 Ga0209026_1000001 3300025250 Bacteria 1228671
456 Ga0209026_1003916 3300025250 Bacteria 4673
457 Ga0209677_100040 3300025253 Bacteria 241568
458 Ga0209677_106217 3300025253 Bacteria 2887
459 Ga0209148_1000077 3300025254 Bacteria 298133
460 Ga0209148_1000081 3300025254 Bacteria 273676
461 Ga0209148_1000189 3300025254 Bacteria 116838
462 Ga0209148_1001056 3300025254 Bacteria 16972
463 Ga0209148_1004348 3300025254 Bacteria 3517
464 Ga0209759_1000001 3300025256 Bacteria 2799452
465 Ga0209759_1000349 3300025256 Bacteria 60115
466 Ga0209759_1000630 3300025256 Bacteria 33452
467 Ga0209759_1001039 3300025256 Bacteria 18583
468 Ga0209759_1001595 3300025256 Bacteria 12279
469 Ga0209759_1007552 3300025256 Bacteria 3483
470 Ga0209759_1027361 3300025256 Bacteria 1179
471 Ga0209129_1000012 3300025258 Bacteria 541516
472 Ga0209129_1000054 3300025258 Bacteria 261997
473 Ga0209129_1005563 3300025258 Bacteria 4400
474 Ga0209129_1010165 3300025258 Bacteria 2381
475 Ga0209129_1010980 3300025258 Bacteria 2206
476 Ga0209233_1000244 3300025261 Bacteria 90133
477 Ga0209565_1000128 3300025263 Bacteria 108959
478 Ga0209565_1000503 3300025263 Bacteria 28463
479 Ga0209565_1000708 3300025263 Bacteria 20409
480 Ga0209565_1000861 3300025263 Bacteria 16824
481 Ga0209565_1001443 3300025263 Bacteria 10500
482 Ga0209565_1006974 3300025263 Bacteria 3100
483 Ga0209565_1008211 3300025263 Bacteria 2750
484 Ga0209455_1000050 3300025272 Bacteria 373239
485 Ga0209455_1000149 3300025272 Bacteria 131876
486 Ga0209455_1000162 3300025272 Bacteria 116963
487 Ga0209673_1000008 3300025273 Bacteria 626013
488 Ga0209673_1000038 3300025273 Bacteria 312957
489 Ga0209673_1000172 3300025273 Bacteria 133472
490 Ga0209673_1002759 3300025273 Bacteria 11484
491 Ga0209673_1002773 3300025273 Bacteria 11415
492 Ga0209673_1005034 3300025273 Bacteria 6820
493 Ga0209673_1016201 3300025273 Bacteria 2798
494 Ga0209673_1030846 3300025273 Bacteria 1680
495 Ga0209673_1033566 3300025273 Bacteria 1562
496 Ga0209130_1000072 3300025284 Bacteria 175726
497 Ga0209130_1000315 3300025284 Bacteria 56958
498 Ga0209130_1000832 3300025284 Bacteria 25922
499 Ga0209130_1001095 3300025284 Bacteria 20107
500 Ga0209130_1001276 3300025284 Bacteria 17456
501 Ga0207673_1016052 3300025290 Bacteria 994
502 Ga0209675_1000208 3300025291 Bacteria 61872
503 Ga0209675_1000221 3300025291 Bacteria 59141
504 Ga0209675_1000431 3300025291 Bacteria 33567
505 Ga0209675_1000527 3300025291 Bacteria 28098
506 Ga0209675_1001172 3300025291 Bacteria 15904
507 Ga0209675_1005904 3300025291 Bacteria 5024
508 Ga0209675_1008733 3300025291 Bacteria 3674
509 Ga0209676_1000023 3300025292 Bacteria 589732
510 Ga0209676_1000048 3300025292 Bacteria 403716
511 Ga0209676_1000141 3300025292 Bacteria 175894
512 Ga0209676_1004490 3300025292 Bacteria 7750
513 Ga0209676_1005062 3300025292 Bacteria 7045
514 Ga0209676_1017231 3300025292 Bacteria 2567
515 Ga0209025_1000538 3300025294 Bacteria 71789
516 Ga0209025_1000657 3300025294 Bacteria 59935
517 Ga0209025_1000790 3300025294 Bacteria 51927
518 Ga0209025_1000906 3300025294 Bacteria 45842
519 Ga0209025_1001066 3300025294 Bacteria 39849
520 Ga0209025_1001733 3300025294 Bacteria 26305
521 Ga0209025_1002220 3300025294 Bacteria 21403
522 Ga0209025_1003614 3300025294 Bacteria 14402
523 Ga0209025_1007588 3300025294 Bacteria 8035
524 Ga0209025_1008309 3300025294 Bacteria 7491
525 Ga0209025_1035062 3300025294 Bacteria 2274
526 Ga0209025_1036254 3300025294 Bacteria 2212
527 Ga0209564_1000008 3300025295 Bacteria 953227
528 Ga0209564_1000022 3300025295 Bacteria 555109
529 Ga0209564_1000241 3300025295 Bacteria 118237
530 Ga0209564_1000435 3300025295 Bacteria 72434
531 Ga0209564_1000998 3300025295 Bacteria 35364
532 Ga0209564_1001686 3300025295 Bacteria 20996
533 Ga0209564_1001921 3300025295 Bacteria 18573
534 Ga0209564_1001928 3300025295 Bacteria 18518
535 Ga0209564_1002084 3300025295 Bacteria 17145
536 Ga0209564_1005341 3300025295 Bacteria 7375
537 Ga0209564_1010534 3300025295 Bacteria 4243
538 Ga0209564_1016087 3300025295 Bacteria 3001
539 Ga0209758_1000034 3300025297 Bacteria 467637
540 Ga0209758_1000124 3300025297 Bacteria 189933
541 Ga0209758_1000659 3300025297 Bacteria 51717
542 Ga0209758_1002271 3300025297 Bacteria 19909
543 Ga0209758_1006790 3300025297 Bacteria 8035
544 Ga0209758_1020103 3300025297 Bacteria 3179
545 Ga0209050_1000012 3300025298 Bacteria 813717
546 Ga0209050_1000022 3300025298 Bacteria 565239
547 Ga0209050_1000567 3300025298 Bacteria 60093
548 Ga0209050_1001940 3300025298 Bacteria 19661
549 Ga0209050_1002988 3300025298 Bacteria 13162
550 Ga0209050_1004091 3300025298 Bacteria 10194
551 Ga0209050_1017756 3300025298 Bacteria 2811
552 Ga0209256_1000001 3300025299 Bacteria 2166974
553 Ga0209256_1000015 3300025299 Bacteria 622953
554 Ga0209256_1000103 3300025299 Bacteria 193900
555 Ga0209256_1000165 3300025299 Bacteria 135104
556 Ga0209256_1001079 3300025299 Bacteria 31509
557 Ga0209256_1002459 3300025299 Bacteria 15065
558 Ga0209256_1004469 3300025299 Bacteria 8750
559 Ga0209256_1014429 3300025299 Bacteria 2843
560 Ga0207426_1000037 3300025302 Bacteria 442735
561 Ga0207426_1000058 3300025302 Bacteria 363857
562 Ga0207426_1000067 3300025302 Bacteria 342108
563 Ga0207426_1000319 3300025302 Bacteria 92696
564 Ga0207426_1002802 3300025302 Bacteria 10454
565 Ga0207426_1011680 3300025302 Bacteria 3332
566 Ga0207426_1042288 3300025302 Bacteria 1407
567 Ga0209051_1000013 3300025303 Bacteria 565239
568 Ga0209051_1000019 3300025303 Bacteria 511268
569 Ga0209051_1000022 3300025303 Bacteria 474879
570 Ga0209051_1001491 3300025303 Bacteria 19599
571 Ga0209051_1002503 3300025303 Bacteria 13078
572 Ga0209051_1009063 3300025303 Bacteria 5176
573 Ga0209051_1011708 3300025303 Bacteria 4308
574 Ga0209051_1018809 3300025303 Bacteria 3041
575 Ga0209051_1029945 3300025303 Bacteria 2122
576 Ga0209257_1000024 3300025304 Bacteria 726068
577 Ga0209257_1000030 3300025304 Bacteria 689812
578 Ga0209257_1000042 3300025304 Bacteria 537149
579 Ga0209257_1000131 3300025304 Bacteria 211464
580 Ga0209257_1002950 3300025304 Bacteria 15605
581 Ga0209257_1004714 3300025304 Bacteria 10228
582 Ga0209257_1006654 3300025304 Bacteria 7336
583 Ga0209257_1008508 3300025304 Bacteria 5804
584 Ga0209257_1013217 3300025304 Bacteria 3704
585 Ga0207696_1003867 3300025711 Bacteria 6632
586 Ga0207713_1000247 3300025735 Bacteria 68982
587 Ga0207713_1001909 3300025735 Bacteria 15784
588 Ga0207713_1015784 3300025735 Bacteria 3860
589 Ga0207713_1122170 3300025735 Bacteria 872
590 Ga0207682_10092400 3300025893 Bacteria 1314
591 Ga0207688_10019604 3300025901 Bacteria 3686
592 Ga0207647_10000728 3300025904 Bacteria 25824
593 Ga0207647_10004850 3300025904 Bacteria 9949
594 Ga0207647_10014229 3300025904 Bacteria 5490
595 Ga0207647_10018420 3300025904 Bacteria 4723
596 Ga0207645_10009688 3300025907 Bacteria 6654
597 Ga0207645_10029379 3300025907 Bacteria 3545
598 Ga0207645_10138031 3300025907 Bacteria 1588
599 Ga0207705_10000221 3300025909 Bacteria 56813
600 Ga0207684_10004207 3300025910 Bacteria 13660
601 Ga0207654_10090130 3300025911 Bacteria 1867
602 Ga0207654_10151054 3300025911 Bacteria 1491
603 Ga0207654_10214712 3300025911 Bacteria 1273
604 Ga0207695_10001311 3300025913 Bacteria 42171
605 Ga0207695_10004434 3300025913 Bacteria 19152
606 Ga0207695_10005617 3300025913 Bacteria 16572
607 Ga0207695_10012572 3300025913 Bacteria 10144
608 Ga0207695_10016930 3300025913 Bacteria 8506
609 Ga0207695_10148173 3300025913 Bacteria 2288
610 Ga0207695_10150890 3300025913 Bacteria 2263
611 Ga0207695_10173632 3300025913 Bacteria 2079
612 Ga0207695_10321026 3300025913 Bacteria 1438
613 Ga0207695_10540924 3300025913 Bacteria 1046
614 Ga0207671_10009202 3300025914 Bacteria 8285
615 Ga0207671_10043849 3300025914 Bacteria 3307
616 Ga0207671_10044911 3300025914 Bacteria 3267
617 Ga0207671_10133981 3300025914 Bacteria 1904
618 Ga0207660_10005400 3300025917 Bacteria 8297
619 Ga0207657_10000064 3300025919 Bacteria 99069
620 Ga0207657_10002927 3300025919 Bacteria 18325
621 Ga0207657_10019808 3300025919 Bacteria 6377
622 Ga0207657_10037483 3300025919 Bacteria 4328
623 Ga0207657_10053387 3300025919 Bacteria 3501
624 Ga0207649_10000051 3300025920 Bacteria 108386
625 Ga0207649_10010478 3300025920 Bacteria 5095
626 Ga0207649_10020909 3300025920 Bacteria 3758
627 Ga0207652_10022278 3300025921 Bacteria 5239
628 Ga0207694_10020839 3300025924 Bacteria 4962
629 Ga0207694_10093044 3300025924 Bacteria 2380
630 Ga0207650_10022128 3300025925 Bacteria 4499
631 Ga0207650_10030590 3300025925 Bacteria 3879
632 Ga0207650_10073756 3300025925 Bacteria 2571
633 Ga0207650_10247737 3300025925 Bacteria 1442
634 Ga0207659_10003450 3300025926 Bacteria 9475
635 Ga0207659_10068328 3300025926 Bacteria 2584
636 Ga0207659_10103325 3300025926 Bacteria 2153
637 Ga0207687_10052045 3300025927 Bacteria 2857
638 Ga0207687_10096601 3300025927 Bacteria 2166
639 Ga0207644_10009711 3300025931 Bacteria 6325
640 Ga0207644_10045713 3300025931 Bacteria 3116
641 Ga0207644_10124175 3300025931 Bacteria 1968
642 Ga0207690_10000060 3300025932 Bacteria 99148
643 Ga0207690_10004656 3300025932 Bacteria 8112
644 Ga0207690_10087952 3300025932 Bacteria 2187
645 Ga0207690_10088625 3300025932 Bacteria 2180
646 Ga0207706_10003929 3300025933 Bacteria 14099
647 Ga0207706_10019459 3300025933 Bacteria 6108
648 Ga0207706_10052728 3300025933 Bacteria 3591
649 Ga0207706_10246458 3300025933 Bacteria 1561
650 Ga0207686_10048223 3300025934 Bacteria 2637
651 Ga0207686_10102468 3300025934 Bacteria 1914
652 Ga0207669_10511165 3300025937 Bacteria 963
653 Ga0207704_10250848 3300025938 Bacteria 1328
654 Ga0207704_10418052 3300025938 Bacteria 1062
655 Ga0207691_10003014 3300025940 Bacteria 16441
656 Ga0207691_10035883 3300025940 Bacteria 4597
657 Ga0207691_10042355 3300025940 Bacteria 4198
658 Ga0207691_10043344 3300025940 Bacteria 4147
659 Ga0207691_10184957 3300025940 Bacteria 1819
660 Ga0207711_10012713 3300025941 Bacteria 6990
661 Ga0207711_10353752 3300025941 Bacteria 1360
662 Ga0207689_10000709 3300025942 Bacteria 31888
663 Ga0207689_10055613 3300025942 Bacteria 3257
664 Ga0207661_10018007 3300025944 Bacteria 5243
665 Ga0207661_10412159 3300025944 Bacteria 1226
666 Ga0207679_10000042 3300025945 Bacteria 126099
667 Ga0207679_10019919 3300025945 Bacteria 4518
668 Ga0207679_10044123 3300025945 Bacteria 3215
669 Ga0207667_10001823 3300025949 Bacteria 26817
670 Ga0207667_10041642 3300025949 Bacteria 4884
671 Ga0207667_10338206 3300025949 Bacteria 1536
672 Ga0207667_10443713 3300025949 Bacteria 1319
673 Ga0207651_10177511 3300025960 Bacteria 1686
674 Ga0207712_10121590 3300025961 Bacteria 1976
675 Ga0207640_10011577 3300025981 Bacteria 4999
676 Ga0207640_10124807 3300025981 Bacteria 1851
677 Ga0207658_10091223 3300025986 Bacteria 2363
678 Ga0207658_10215809 3300025986 Bacteria 1611
679 Ga0207658_10301885 3300025986 Bacteria 1380
680 Ga0207658_10399012 3300025986 Bacteria 1208
681 Ga0207677_10031459 3300026023 Bacteria 3399
682 Ga0207677_10046664 3300026023 Unclassified 2902
683 Ga0207677_10087241 3300026023 Bacteria 2258
684 Ga0207677_10409901 3300026023 Bacteria 1152
685 Ga0207703_10110682 3300026035 Bacteria 2343
686 Ga0207703_10119762 3300026035 Bacteria 2258
687 Ga0207703_10257371 3300026035 Bacteria 1576
688 Ga0207639_10006281 3300026041 Bacteria 8069
689 Ga0207639_10030891 3300026041 Bacteria 3933
690 Ga0207639_10052919 3300026041 Bacteria 3096
691 Ga0207639_10090042 3300026041 Bacteria 2453
692 Ga0207678_10000055 3300026067 Bacteria 87202
693 Ga0207678_10000367 3300026067 Bacteria 41058
694 Ga0207678_10027999 3300026067 Bacteria 4921
695 Ga0207678_10080470 3300026067 Bacteria 2789
696 Ga0207678_10106068 3300026067 Bacteria 2397
697 Ga0207678_10309336 3300026067 Bacteria 1358
698 Ga0207702_10000156 3300026078 Bacteria 80626
699 Ga0207702_10048251 3300026078 Bacteria 3591
700 Ga0207702_10122998 3300026078 Bacteria 2325
701 Ga0207641_10013425 3300026088 Bacteria 6718
702 Ga0207648_10006990 3300026089 Bacteria 11158
703 Ga0207648_10020382 3300026089 Bacteria 5971
704 Ga0207648_10042356 3300026089 Bacteria 3996
705 Ga0207648_10401476 3300026089 Bacteria 1242
706 Ga0207676_10067746 3300026095 Bacteria 2852
707 Ga0207676_10072019 3300026095 Bacteria 2776
708 Ga0207676_10226529 3300026095 Bacteria 1668
709 Ga0207674_10008473 3300026116 Bacteria 11873
710 Ga0207674_10009895 3300026116 Bacteria 10849
711 Ga0207674_10017562 3300026116 Bacteria 7805
712 Ga0207674_10062595 3300026116 Bacteria 3758
713 Ga0207674_10095092 3300026116 Bacteria 2966
714 Ga0207674_10162240 3300026116 Bacteria 2189
715 Ga0207675_100000563 3300026118 Bacteria 36307
716 Ga0207675_100279921 3300026118 Bacteria 1621
717 Ga0207683_10051569 3300026121 Bacteria 3605
718 Ga0207683_10077198 3300026121 Bacteria 2949
719 Ga0207683_10108581 3300026121 Bacteria 2483
720 Ga0207683_10206681 3300026121 Bacteria 1786
721 Ga0207683_10242690 3300026121 Bacteria 1643
722 Ga0207683_10243802 3300026121 Bacteria 1639
723 Ga0207683_10553938 3300026121 Bacteria 1063
724 Ga0207698_10004414 3300026142 Bacteria 8572
725 Ga0207698_10013933 3300026142 Bacteria 5325
726 Ga0207698_10027903 3300026142 Bacteria 4016
727 Ga0207698_10070834 3300026142 Bacteria 2764
728 Ga0207698_10096596 3300026142 Bacteria 2436
729 Ga0207698_10241659 3300026142 Bacteria 1646
730 Ga0207698_10260808 3300026142 Bacteria 1592
731 Ga0207698_10275558 3300026142 Bacteria 1553
732 Ga0209389_1023782 3300027296 Bacteria 5394
733 Ga0209371_1000114 3300027312 Bacteria 139090
734 Ga0209371_1003581 3300027312 Bacteria 7430
735 Ga0209371_1008658 3300027312 Bacteria 3343
736 Ga0209282_1000508 3300027666 Bacteria 18904
737 Ga0209974_10000240 3300027876 Bacteria 17737
738 Ga0268266_10046025 3300028379 Bacteria 3735
739 Ga0268266_10111920 3300028379 Bacteria 2419
740 Ga0268266_10141336 3300028379 Bacteria 2161
741 Ga0268266_10359077 3300028379 Bacteria 1370
742 Ga0268264_10104563 3300028381 Bacteria 2468
743 Ga0268264_10114013 3300028381 Bacteria 2372
744 Ga0307515_10000062 3300028794 Bacteria 247284
745 Ga0307515_10000084 3300028794 Bacteria 221434
746 Ga0307515_10028135 3300028794 Bacteria 9566
747 Ga0307515_10146493 3300028794 Bacteria 2497
748 Ga0307515_10180161 3300028794 Bacteria 2066
749 Ga0265338_10000409 3300028800 Bacteria 76989
750 Ga0268256_1000177 3300030500 Bacteria 75500
751 Ga0268256_1002558 3300030500 Bacteria 9115
752 Ga0268256_1004946 3300030500 Bacteria 5378
753 Ga0265332_10000027 3300031238 Bacteria 190796
754 Ga0265332_10042535 3300031238 Bacteria 1964
755 Ga0265328_10003344 3300031239 Bacteria 7091
756 Ga0265340_10071231 3300031247 Bacteria 1648
757 Ga0265331_10010440 3300031250 Bacteria 5139
758 Ga0265327_10000035 3300031251 Bacteria 314419
759 Ga0265327_10001654 3300031251 Bacteria 26845
760 Ga0307513_10000117 3300031456 Bacteria 110951
761 Ga0307513_10002583 3300031456 Bacteria 25034
762 Ga0307513_10165455 3300031456 Bacteria 2097
763 Ga0307513_10225329 3300031456 Bacteria 1692
764 Ga0307509_10471514 3300031507 Bacteria 945
765 Ga0307408_100021370 3300031548 Bacteria 4380
766 Ga0307408_100046444 3300031548 Bacteria 3106
767 Ga0307514_10000319 3300031649 Bacteria 115327
768 Ga0307514_10000522 3300031649 Bacteria 75925
769 Ga0307516_10006887 3300031730 Bacteria 13236
770 Ga0307516_10018452 3300031730 Bacteria 7250
771 Ga0307405_10292104 3300031731 Bacteria 1232
772 Ga0307413_10284125 3300031824 Bacteria 1246
773 Ga0307410_10130513 3300031852 Bacteria 1845
774 Ga0307410_10148438 3300031852 Bacteria 1743
775 Ga0307406_10047831 3300031901 Bacteria 2698
776 Ga0307406_10120657 3300031901 Bacteria 1822
777 Ga0307406_10164842 3300031901 Bacteria 1597
778 Ga0307406_10205177 3300031901 Bacteria 1454
779 Ga0307412_10000044 3300031911 Bacteria 165237
780 Ga0307412_10006093 3300031911 Bacteria 6792
781 Ga0307412_10072770 3300031911 Bacteria 2350
782 Ga0307412_10169928 3300031911 Bacteria 1629
783 Ga0307412_10203301 3300031911 Bacteria 1506
784 Ga0307409_100002068 3300031995 Bacteria 10317
785 Ga0307409_100163739 3300031995 Bacteria 1949
786 Ga0307416_100006260 3300032002 Bacteria 7433
787 Ga0307416_100017569 3300032002 Bacteria 5010
788 Ga0307416_100135265 3300032002 Bacteria 2228
789 Ga0307416_100283086 3300032002 Bacteria 1636
790 Ga0307416_100617881 3300032002 Bacteria 1165
791 Ga0307414_10009164 3300032004 Bacteria 5669
792 Ga0307411_10064575 3300032005 Bacteria 2451
793 Ga0307415_100406599 3300032126 Bacteria 1164
794 Ga0307510_10228393 3300033180 Bacteria 1366
795 Ga0373950_0018527 3300034818 Bacteria 1209
796 Ga0373958_0052811 3300034819 Bacteria 862
797 Ga0373959_0012052 3300034820 Bacteria 1537
798 Ga0373949_0042101 3300035090 Bacteria 1126
799 Ga0373932_0021909 3300035112 Bacteria 1692
800 Ga0373939_0000049 3300035114 Bacteria 42693
801 Ga0373941_0082671 3300035115 Bacteria 1087
802 Ga0373962_0003198 3300035242 Bacteria 3929
803 Ga0373931_0000092 3300035691 Bacteria 41580
804 Ga0373931_0011515 3300035691 Bacteria 4275
805 Ga0373933_0056999 3300035724 Bacteria 2347
806 Ga0373925_0004978 3300037068 Bacteria 9975
807 Ga0373925_0012376 3300037068 Bacteria 6178
808 Ga0373925_0491345 3300037068 Bacteria 1007
809 Ga0395899_0000008 3300037312 Bacteria 567572
810 Ga0395899_0059193 3300037312 Bacteria 2824
811 Ga0395899_0185360 3300037312 Bacteria 1458
812 Ga0395900_0000055 3300037418 Bacteria 219875
813 Ga0395900_0000455 3300037418 Bacteria 58706
814 Ga0395900_0004501 3300037418 Bacteria 14751
815 Ga0395900_0115586 3300037418 Bacteria 2753
816 Ga0395900_0250639 3300037418 Bacteria 1772
817 Ga0395898_0001141 3300037466 Bacteria 40544
818 Ga0395898_0003577 3300037466 Bacteria 17319
819 Ga0395898_0184573 3300037466 Bacteria 1993
820 Ga0395905_0000151 3300037471 Bacteria 115485
821 Ga0395905_0000201 3300037471 Bacteria 92923
822 Ga0395905_0000483 3300037471 Bacteria 54915
823 Ga0395905_0040362 3300037471 Bacteria 4378
824 Ga0395905_0068759 3300037471 Bacteria 3317
825 Ga0395905_0298567 3300037471 Bacteria 1498
826 Ga0395905_0647360 3300037471 Bacteria 959
827 Ga0395901_0000003 3300038443 Bacteria 701538
828 Ga0395901_0002516 3300038443 Bacteria 18555
829 Ga0395901_0009622 3300038443 Bacteria 9805
830 Ga0395901_0036083 3300038443 Bacteria 5108
831 Ga0395901_0253094 3300038443 Bacteria 1835
832 Ga0436361_0098627 3300039447 Bacteria 9243
833 Ga0436361_0099983 3300039447 Bacteria 4571
834 Ga0436361_0378401 3300039447 Bacteria 33354
835 Ga0436361_0745691 3300039447 Bacteria 89622
836 Ga0436361_0750298 3300039447 Bacteria 51036
837 Ga0436361_0843250 3300039447 Bacteria 7126
838 Ga0436361_1036771 3300039447 Bacteria 1757
839 Ga0439436_0004261 3300041404 Bacteria 4382
840 Ga0439436_0032485 3300041404 Bacteria 1513
841 Ga0439436_0062608 3300041404 Bacteria 1040
842 Ga0439439_0008709 3300041406 Bacteria 2401
843 Ga0439466_0001987 3300041411 Bacteria 8014
844 Ga0439466_0010063 3300041411 Bacteria 3517
845 Ga0439465_0007307 3300041413 Bacteria 3509
846 Ga0439465_0028985 3300041413 Bacteria 1758
847 Ga0439465_0040736 3300041413 Bacteria 1502
848 Ga0451789_1235407 3300041443 Bacteria 1492
849 Ga0451791_0764014 3300041451 Bacteria 1038
850 Ga0451800_1207179 3300041459 Bacteria 1314
851 Ga0451802_1337943 3300041460 Bacteria 1403
852 Ga0451851_0278468 3300041507 Bacteria 1829
853 Ga0439431_0001298 3300041997 Bacteria 5493
854 Ga0439431_0007001 3300041997 Bacteria 2509
855 Ga0439442_001044 3300042002 Bacteria 5582
856 Ga0439445_0062565 3300042004 Bacteria 1020
857 Ga0439432_016725 3300042006 Bacteria 2467
858 Ga0439449_0007455 3300042007 Bacteria 4159
859 Ga0439449_0033847 3300042007 Bacteria 1903
860 Ga0439449_0035762 3300042007 Bacteria 1848
861 Ga0439452_004236 3300042010 Bacteria 4855
862 Ga0439457_013151 3300042014 Bacteria 1860
863 Ga0439462_0000676 3300042015 Bacteria 6924
864 Ga0450917_001825 3300042120 Bacteria 1512
865 Ga0450888_000038 3300042126 Bacteria 9334
866 Ga0450890_002364 3300042127 Bacteria 2602
867 Ga0450891_000454 3300042129 Bacteria 4281
868 Ga0450892_001627 3300042130 Bacteria 2106
869 Ga0450896_025458 3300042133 Bacteria 880
870 Ga0450899_000698 3300042135 Bacteria 3834
871 Ga0450903_025003 3300042138 Bacteria 914
872 Ga0450889_000272 3300042144 Bacteria 5774
873 Ga0450906_000190 3300042145 Bacteria 11646
874 Ga0450906_033942 3300042145 Bacteria 901
875 Ga0450910_001656 3300042147 Bacteria 2852
876 Ga0439446_0054046 3300042156 Bacteria 1204
877 Ga0450908_001735 3300042184 Bacteria 4250
878 Ga0439434_0001931 3300042435 Bacteria 6001
879 Ga0439434_0006816 3300042435 Bacteria 3338
880 Ga0439434_0006907 3300042435 Bacteria 3317
881 Ga0439459_0000910 3300042438 Bacteria 4156
882 Ga0439459_0074205 3300042438 Bacteria 792
883 Ga0450916_003230 3300042530 Bacteria 1779
884 Ga0450918_000341 3300042531 Bacteria 10376
885 Ga0450918_029681 3300042531 Bacteria 964
886 Ga0450893_0002485 3300042532 Bacteria 2876
887 Ga0450893_0028726 3300042532 Bacteria 984
888 Ga0451577_0000276 3300042876 Bacteria 99531
889 Ga0451577_0171453 3300042876 Bacteria 1955
890 Ga0451577_0189020 3300042876 Bacteria 1857
891 Ga0466986_0292597 3300044650 Bacteria 1016
892 Ga0466969_0000070 3300044656 Bacteria 53343
893 Ga0466969_0029784 3300044656 Bacteria 2785
894 Ga0466969_0037167 3300044656 Bacteria 2457
895 Ga0466972_0045437 3300044658 Bacteria 2128
896 Ga0466972_0146439 3300044658 Bacteria 1111
897 Ga0466973_0007979 3300044659 Bacteria 9531
898 Ga0466965_0000679 3300044683 Bacteria 12545
899 Ga0466965_0006575 3300044683 Bacteria 5293
900 Ga0466966_0000364 3300044684 Bacteria 29455
901 Ga0466966_0027752 3300044684 Bacteria 3691
902 Ga0466961_0000097 3300044693 Bacteria 56628
903 Ga0466961_0000249 3300044693 Bacteria 36132
904 Ga0466961_0000777 3300044693 Bacteria 20001
905 Ga0466961_0040018 3300044693 Bacteria 3004
906 Ga0466961_0163881 3300044693 Bacteria 1385
907 Ga0466963_0000630 3300044694 Bacteria 16926
908 Ga0466963_0003521 3300044694 Bacteria 8990
909 Ga0466963_0018183 3300044694 Bacteria 4390
910 Ga0466963_0125094 3300044694 Bacteria 1772
911 Ga0466963_0297216 3300044694 Bacteria 1135
912 Ga0466964_0039814 3300044706 Bacteria 1895
913 Ga0453684_0000891 3300044712 Bacteria 99637
914 Ga0453684_0102707 3300044712 Bacteria 3495
915 Ga0453684_0840749 3300044712 Bacteria 987
916 Ga0453684_0924240 3300044712 Bacteria 933
917 Ga0466971_0000724 3300044719 Bacteria 13192
918 Ga0466971_0004128 3300044719 Bacteria 6255
919 Ga0466971_0014567 3300044719 Bacteria 3461
920 Ga0466971_0030528 3300044719 Bacteria 2411
921 Ga0466971_0189818 3300044719 Bacteria 968
922 Ga0466968_0019312 3300044735 Bacteria 2744
923 Ga0466968_0061701 3300044735 Bacteria 1617
924 Ga0466970_0021271 3300044765 Bacteria 3378
925 Ga0466970_0251976 3300044765 Bacteria 989
926 Ga0466957_0001503 3300044842 Bacteria 12237
927 Ga0466957_0025031 3300044842 Bacteria 3535
928 Ga0466957_0049430 3300044842 Bacteria 2557
929 Ga0466957_0170798 3300044842 Bacteria 1416
930 Ga0466959_0009002 3300045049 Bacteria 7081
931 Ga0466959_0019964 3300045049 Bacteria 4931
932 Ga0466959_0022675 3300045049 Bacteria 4642
933 Ga0466959_0045970 3300045049 Bacteria 3213
934 Ga0466959_0049091 3300045049 Bacteria 3100
935 Ga0451576_0002088 3300045051 Bacteria 31196
936 Ga0451576_0002533 3300045051 Bacteria 27062
937 Ga0451576_0005708 3300045051 Bacteria 15524
938 Ga0451576_0039872 3300045051 Bacteria 4972
939 Ga0451576_0114061 3300045051 Bacteria 2813
940 Ga0451576_0262904 3300045051 Bacteria 1804
941 Ga0451576_0593237 3300045051 Bacteria 1164
942 Ga0466958_0003481 3300045836 Bacteria 8172
943 Ga0466958_0026349 3300045836 Bacteria 3435
944 Ga0466967_0208720 3300045976 Bacteria 1852
945 Ga0495592_0001360 3300046454 Bacteria 16896
946 Ga0495592_0008165 3300046454 Bacteria 7865
947 Ga0495603_0000637 3300046455 Bacteria 19738
948 Ga0495603_0008206 3300046455 Bacteria 6313
949 Ga0495603_0035116 3300046455 Bacteria 3013
950 Ga0495603_0258574 3300046455 Bacteria 1002
951 Ga0495590_0001856 3300046457 Bacteria 8935
952 Ga0495590_0010461 3300046457 Bacteria 3487
953 Ga0495590_0035975 3300046457 Bacteria 1727
954 Ga0495591_006538 3300046458 Bacteria 5134
955 Ga0495591_075024 3300046458 Bacteria 871
956 Ga0495629_0001796 3300046459 Bacteria 16817
957 Ga0495629_0002715 3300046459 Bacteria 13547
958 Ga0495629_0004967 3300046459 Bacteria 9975
959 Ga0495629_0006553 3300046459 Bacteria 8622
960 Ga0495629_0054000 3300046459 Bacteria 2810
961 Ga0495629_0070566 3300046459 Bacteria 2437
962 Ga0495629_0167649 3300046459 Bacteria 1525
963 Ga0495638_0050399 3300046460 Bacteria 2600
964 Ga0495641_0025721 3300046461 Bacteria 2885
965 Ga0495641_0080928 3300046461 Bacteria 1455
966 Ga0495651_0002998 3300046462 Bacteria 13032
967 Ga0495651_0101064 3300046462 Bacteria 2147
968 Ga0495653_0001364 3300046463 Bacteria 18976
969 Ga0495653_0002775 3300046463 Bacteria 13966
970 Ga0495653_0012839 3300046463 Bacteria 6838
971 Ga0495653_0093745 3300046463 Bacteria 2189
972 Ga0495650_0013809 3300046471 Bacteria 4246
973 Ga0495650_0039369 3300046471 Bacteria 2040
974 Ga0495650_0063060 3300046471 Bacteria 1479
975 Ga0495650_0067136 3300046471 Bacteria 1418
976 Ga0495580_0000360 3300046472 Bacteria 37126
977 Ga0495580_0003221 3300046472 Bacteria 13965
978 Ga0495580_0007349 3300046472 Bacteria 8859
979 Ga0495580_0011585 3300046472 Bacteria 6821
980 Ga0495580_0032907 3300046472 Bacteria 3736
981 Ga0495580_0043963 3300046472 Bacteria 3178
982 Ga0495580_0059448 3300046472 Bacteria 2686
983 Ga0495582_0001761 3300046473 Bacteria 12225
984 Ga0495582_0004092 3300046473 Bacteria 8194
985 Ga0495582_0061944 3300046473 Bacteria 2066
986 Ga0495605_0004277 3300046474 Bacteria 8414
987 Ga0495605_0035764 3300046474 Bacteria 2508
988 Ga0495639_0060951 3300046475 Bacteria 1729
989 Ga0495662_0052454 3300046476 Bacteria 1969
990 Ga0495662_0254649 3300046476 Bacteria 864
991 Ga0495664_0006958 3300046477 Bacteria 6263
992 Ga0495664_0023649 3300046477 Bacteria 3566
993 Ga0495584_0016239 3300046491 Bacteria 3797
994 Ga0495584_0209786 3300046491 Bacteria 990
995 Ga0495596_0005970 3300046500 Bacteria 5681
996 Ga0495596_0016340 3300046500 Bacteria 3085
997 Ga0495607_0000050 3300046501 Bacteria 120052
998 Ga0495583_0002415 3300046506 Bacteria 16044
999 Ga0495583_0008033 3300046506 Bacteria 6510
1000 Ga0495606_0007560 3300046507 Bacteria 9685
1001 Ga0495606_0024821 3300046507 Bacteria 4308
1002 Ga0495606_0036991 3300046507 Bacteria 3319
1003 Ga0495606_0071412 3300046507 Bacteria 2186
1004 Ga0495606_0125815 3300046507 Bacteria 1528
1005 Ga0495608_0002314 3300046511 Bacteria 13748
1006 Ga0495610_0002465 3300046512 Bacteria 15550
1007 Ga0495610_0003149 3300046512 Bacteria 13097
1008 Ga0495610_0060616 3300046512 Bacteria 1801
1009 Ga0495616_0018272 3300046513 Bacteria 3851
1010 Ga0495618_0001823 3300046514 Bacteria 14050
1011 Ga0495618_0103010 3300046514 Bacteria 1827
1012 Ga0495620_0096060 3300046515 Bacteria 1185
1013 Ga0495620_0179846 3300046515 Bacteria 818
1014 Ga0495628_0004568 3300046516 Bacteria 12252
1015 Ga0495628_0005314 3300046516 Bacteria 11296
1016 Ga0495628_0006372 3300046516 Bacteria 10314
1017 Ga0495628_0012966 3300046516 Bacteria 7018
1018 Ga0495628_0018672 3300046516 Bacteria 5738
1019 Ga0495628_0305596 3300046516 Bacteria 1176
1020 Ga0495628_0349878 3300046516 Bacteria 1086
1021 Ga0495630_0001913 3300046517 Bacteria 14515
1022 Ga0495630_0003603 3300046517 Bacteria 10792
1023 Ga0495630_0006958 3300046517 Bacteria 8062
1024 Ga0495632_0004456 3300046519 Bacteria 9514
1025 Ga0495632_0061279 3300046519 Bacteria 1826
1026 Ga0495643_0041475 3300046522 Bacteria 2509
1027 Ga0495644_0045171 3300046523 Bacteria 1657
1028 Ga0495648_0010873 3300046524 Bacteria 6904
1029 Ga0495648_0042133 3300046524 Bacteria 2874
1030 Ga0495648_0042947 3300046524 Bacteria 2839
1031 Ga0495648_0078930 3300046524 Bacteria 1880
1032 Ga0495648_0084863 3300046524 Bacteria 1791
1033 Ga0495666_0002016 3300046526 Bacteria 10043
1034 Ga0495666_0003155 3300046526 Bacteria 8294
1035 Ga0495666_0023124 3300046526 Bacteria 3074
1036 Ga0495642_0004085 3300046528 Bacteria 5693
1037 Ga0495642_0084663 3300046528 Bacteria 1338
1038 Ga0495642_0090473 3300046528 Bacteria 1295
1039 Ga0495652_0008857 3300046529 Bacteria 9157
1040 Ga0495652_0009220 3300046529 Bacteria 8971
1041 Ga0495652_0010294 3300046529 Bacteria 8476
1042 Ga0495652_0397695 3300046529 Bacteria 976
1043 Ga0495654_0034770 3300046530 Bacteria 2541
1044 Ga0495654_0115980 3300046530 Bacteria 1217
1045 Ga0495665_0001549 3300046531 Bacteria 12267
1046 Ga0495665_0066482 3300046531 Bacteria 1902
1047 Ga0495665_0104613 3300046531 Bacteria 1485
1048 Ga0495665_0105652 3300046531 Bacteria 1477
1049 Ga0495665_0118856 3300046531 Bacteria 1384
1050 Ga0495640_0002375 3300046533 Bacteria 15103
1051 Ga0495640_0004512 3300046533 Bacteria 11100
1052 Ga0495640_0009358 3300046533 Bacteria 7630
1053 Ga0495586_0002087 3300046535 Bacteria 10859
1054 Ga0495586_0062368 3300046535 Bacteria 2029
1055 Ga0495587_0003990 3300046536 Bacteria 9783
1056 Ga0495587_0004360 3300046536 Bacteria 9338
1057 Ga0495598_0046683 3300046537 Bacteria 1288
1058 Ga0495609_0016595 3300046538 Bacteria 3430
1059 Ga0495621_0005072 3300046539 Bacteria 3757
1060 Ga0495597_0018012 3300046542 Bacteria 3318
1061 Ga0495645_0001225 3300046543 Bacteria 17528
1062 Ga0495645_0005885 3300046543 Bacteria 8470
1063 Ga0495645_0101479 3300046543 Bacteria 2045
1064 Ga0495622_0000857 3300046557 Bacteria 16678
1065 Ga0495622_0033309 3300046557 Bacteria 2405
1066 Ga0495656_0059706 3300046615 Bacteria 1660
1067 Ga0495634_0006117 3300046642 Bacteria 9167
1068 Ga0495634_0007843 3300046642 Bacteria 7978
1069 Ga0495634_0013419 3300046642 Bacteria 5919
1070 Ga0495611_0020938 3300046648 Bacteria 2820
1071 Ga0495611_0120483 3300046648 Bacteria 1223
1072 Ga0495635_0001779 3300046663 Bacteria 14553
1073 Ga0495635_0002386 3300046663 Bacteria 12795
1074 Ga0495635_0031877 3300046663 Bacteria 3657
1075 Ga0495661_0002135 3300046665 Bacteria 15494
1076 Ga0495661_0069226 3300046665 Bacteria 2068
1077 Ga0495661_0071367 3300046665 Bacteria 2029
1078 Ga0495588_0026374 3300046674 Bacteria 2900
1079 Ga0495588_0034239 3300046674 Bacteria 2570
1080 Ga0495588_0051544 3300046674 Bacteria 2120
1081 Ga0495657_0008521 3300046675 Bacteria 7837
1082 Ga0495599_0116948 3300046678 Bacteria 1658
1083 Ga0495623_0008137 3300046679 Bacteria 6816
1084 Ga0495623_0023790 3300046679 Bacteria 3952
1085 Ga0495623_0030720 3300046679 Bacteria 3455
1086 Ga0495623_0208639 3300046679 Bacteria 1119
1087 Ga0495646_0001089 3300046680 Bacteria 15777
1088 Ga0495646_0001375 3300046680 Bacteria 14425
1089 Ga0495646_0004333 3300046680 Bacteria 8941
1090 Ga0495646_0023517 3300046680 Bacteria 3878
1091 Ga0495646_0046867 3300046680 Bacteria 2633
1092 Ga0495646_0304315 3300046680 Bacteria 843
1093 Ga0495658_0119253 3300046683 Bacteria 1594
1094 Ga0495669_0034206 3300046684 Bacteria 2240
1095 Ga0495669_0076019 3300046684 Bacteria 1537
1096 Ga0495613_0001858 3300046689 Bacteria 16065
1097 Ga0495613_0010986 3300046689 Bacteria 6724
1098 Ga0495613_0311536 3300046689 Bacteria 1088
1099 Ga0495624_0004250 3300046690 Bacteria 10524
1100 Ga0495624_0004792 3300046690 Bacteria 9834
1101 Ga0495624_0037516 3300046690 Bacteria 3116
1102 Ga0495624_0055474 3300046690 Bacteria 2496
1103 Ga0495624_0056658 3300046690 Bacteria 2465
1104 Ga0495624_0076129 3300046690 Bacteria 2082
1105 Ga0495624_0099605 3300046690 Bacteria 1790
1106 Ga0495670_0039891 3300046691 Bacteria 2342
1107 Ga0495671_0030161 3300046692 Bacteria 2779
1108 Ga0495671_0086362 3300046692 Bacteria 1537
1109 Ga0495671_0134544 3300046692 Bacteria 1205
1110 Ga0495649_0007290 3300046694 Bacteria 6764
1111 Ga0495649_0028113 3300046694 Bacteria 3116
1112 Ga0495649_0028393 3300046694 Bacteria 3101
1113 Ga0495649_0037917 3300046694 Bacteria 2645
1114 Ga0495589_0060208 3300046794 Bacteria 1865
1115 Ga0495589_0062344 3300046794 Bacteria 1829
1116 Ga0495589_0072151 3300046794 Bacteria 1686
1117 Ga0495589_0218701 3300046794 Bacteria 895
1118 Ga0495600_0003180 3300046809 Bacteria 9607
1119 Ga0495600_0010840 3300046809 Bacteria 5668
1120 Ga0495581_0002302 3300047315 Bacteria 10752
1121 Ga0495581_0004144 3300047315 Bacteria 8356
1122 Ga0495581_0011362 3300047315 Bacteria 5152
1123 Ga0495604_0005809 3300047317 Bacteria 9787
1124 Ga0495604_0029551 3300047317 Bacteria 4359
1125 Ga0495604_0032118 3300047317 Bacteria 4162
1126 Ga0495674_0001972 3300047319 Bacteria 20194
1127 Ga0495674_0005846 3300047319 Bacteria 11799
1128 Ga0495674_0005865 3300047319 Bacteria 11783
1129 Ga0495674_0008585 3300047319 Bacteria 9723
1130 Ga0495674_0008765 3300047319 Bacteria 9622
1131 Ga0495674_0022974 3300047319 Bacteria 5745
1132 Ga0495674_0106052 3300047319 Bacteria 2387
1133 Ga0495674_0123376 3300047319 Bacteria 2187
1134 Ga0495674_0176622 3300047319 Bacteria 1779
1135 Ga0495672_0010779 3300047320 Bacteria 6487
1136 Ga0495672_0022404 3300047320 Bacteria 4107
1137 Ga0495672_0028373 3300047320 Bacteria 3543
1138 Ga0495676_0006779 3300047321 Bacteria 10531
1139 Ga0495676_0137360 3300047321 Bacteria 1756
1140 Ga0495676_0302813 3300047321 Bacteria 1077
1141 Ga0495680_0005149 3300047322 Bacteria 12344
1142 Ga0495680_0008859 3300047322 Bacteria 9099
1143 Ga0495680_0028182 3300047322 Bacteria 4606
1144 Ga0495680_0082991 3300047322 Bacteria 2417
1145 Ga0495683_0006391 3300047323 Bacteria 6439
1146 Ga0495683_0007878 3300047323 Bacteria 5716
1147 Ga0495683_0009176 3300047323 Bacteria 5272
1148 Ga0495683_0016653 3300047323 Bacteria 3814
1149 Ga0495683_0036386 3300047323 Bacteria 2498
1150 Ga0495683_0066351 3300047323 Bacteria 1778
1151 Ga0495683_0071504 3300047323 Bacteria 1702
1152 Ga0495687_000032 3300047443 Bacteria 273607
1153 Ga0495687_010105 3300047443 Bacteria 5203
1154 Ga0495687_010935 3300047443 Bacteria 4924
1155 Ga0495687_017689 3300047443 Bacteria 3544
1156 Ga0495687_049590 3300047443 Bacteria 1793
1157 Ga0495675_0003900 3300047444 Bacteria 9032
1158 Ga0495675_0007705 3300047444 Bacteria 6639
1159 Ga0495679_000279 3300047446 Bacteria 42753
1160 Ga0495679_001130 3300047446 Bacteria 16007
1161 Ga0495679_003299 3300047446 Bacteria 7814
1162 Ga0495685_034443 3300047447 Bacteria 1740
1163 Ga0495673_0015379 3300047469 Bacteria 3945
1164 Ga0495673_0106928 3300047469 Bacteria 1123
1165 Ga0495681_0120541 3300047470 Bacteria 1126
1166 Ga0495684_0053577 3300047471 Bacteria 3078
1167 Ga0495686_0000038 3300047472 Bacteria 306383
1168 Ga0495686_0022202 3300047472 Bacteria 4201
1169 Ga0495593_0003909 3300047673 Bacteria 8901
1170 Ga0495593_0005171 3300047673 Bacteria 7714
1171 Ga0495593_0009786 3300047673 Bacteria 5560
1172 Ga0495602_0007124 3300048088 Bacteria 11725
1173 Ga0495602_0013730 3300048088 Bacteria 8260
1174 Ga0495602_0014618 3300048088 Bacteria 7964
1175 Ga0495602_0019701 3300048088 Bacteria 6687
1176 Ga0495602_0022563 3300048088 Bacteria 6157
1177 Ga0495602_0091457 3300048088 Bacteria 2523
1178 Ga0495602_0153084 3300048088 Bacteria 1809
1179 Ga0495614_0000307 3300048089 Bacteria 19395
1180 Ga0495614_0001094 3300048089 Bacteria 11598
1181 Ga0495614_0036945 3300048089 Bacteria 2096
1182 Ga0495626_0021814 3300048091 Bacteria 3171
1183 Ga0495626_0027024 3300048091 Bacteria 2792
1184 Ga0495626_0050986 3300048091 Bacteria 1910
1185 Ga0495626_0114759 3300048091 Bacteria 1163
1186 Ga0496100_0004031 3300048903 Bacteria 7734
1187 Ga0496100_0061875 3300048903 Bacteria 2468
1188 Ga0496100_0085810 3300048903 Bacteria 2137
1189 Ga0496100_0148996 3300048903 Bacteria 1666
1190 Ga0496100_0312650 3300048903 Bacteria 1178
1191 Ga0496100_0495788 3300048903 Bacteria 941
1192 Ga0496100_0537027 3300048903 Bacteria 903
1193 Ga0496101_0001757 3300048904 Bacteria 12992
1194 Ga0496101_0003462 3300048904 Bacteria 9847
1195 Ga0496101_0004695 3300048904 Bacteria 8650
1196 Ga0496101_0050687 3300048904 Bacteria 2989
1197 Ga0496101_0051414 3300048904 Bacteria 2969
1198 Ga0496101_0089629 3300048904 Bacteria 2286
1199 Ga0496101_0286774 3300048904 Bacteria 1288
1200 Ga0496102_0003965 3300048905 Bacteria 12541
1201 Ga0496102_0017818 3300048905 Bacteria 6227
1202 Ga0496102_0080883 3300048905 Bacteria 2994
1203 Ga0496102_0188176 3300048905 Bacteria 1945
1204 Ga0496102_0232853 3300048905 Bacteria 1736
1205 Ga0496103_0014958 3300048906 Bacteria 4612
1206 Ga0496103_0018822 3300048906 Bacteria 4146
1207 Ga0496103_0038439 3300048906 Bacteria 2936
1208 Ga0496104_0045497 3300048907 Bacteria 4128
1209 Ga0496104_0183082 3300048907 Bacteria 2005
1210 Ga0496104_0329705 3300048907 Bacteria 1439
1211 Ga0496105_0012402 3300048908 Bacteria 6747
1212 Ga0496105_0050553 3300048908 Bacteria 3433
1213 Ga0496105_0098671 3300048908 Bacteria 2412
1214 Ga0496106_0001092 3300048909 Bacteria 20052
1215 Ga0496106_0014093 3300048909 Bacteria 5907
1216 Ga0496106_0104455 3300048909 Bacteria 2200
1217 Ga0496107_0001400 3300048910 Bacteria 14864
1218 Ga0496107_0014249 3300048910 Bacteria 5567
1219 Ga0496107_0043769 3300048910 Bacteria 3217
1220 Ga0496107_0053977 3300048910 Bacteria 2900
1221 Ga0496108_0040343 3300048911 Bacteria 3891
1222 Ga0496108_0052401 3300048911 Bacteria 3419
1223 Ga0496108_0350450 3300048911 Bacteria 1288
1224 Ga0496109_0057913 3300048912 Bacteria 3539
1225 Ga0496109_0149376 3300048912 Bacteria 2187
1226 Ga0496109_0159360 3300048912 Bacteria 2114
1227 Ga0496109_0353715 3300048912 Bacteria 1388
1228 Ga0496110_0087056 3300048913 Bacteria 2790
1229 Ga0496110_0107726 3300048913 Bacteria 2501
1230 Ga0496110_0150887 3300048913 Bacteria 2104
1231 Ga0496110_0214771 3300048913 Bacteria 1749
1232 Ga0496110_0228106 3300048913 Bacteria 1694
1233 Ga0496110_0277938 3300048913 Bacteria 1525
1234 Ga0496110_0648820 3300048913 Bacteria 955
1235 Ga0496111_0035208 3300048914 Bacteria 3577
1236 Ga0496112_0113251 3300048915 Bacteria 2683
1237 Ga0496112_0186716 3300048915 Bacteria 2036
1238 Ga0496112_0287232 3300048915 Bacteria 1591
1239 Ga0496113_0064812 3300048916 Bacteria 2764
1240 Ga0496113_0072871 3300048916 Bacteria 2615
1241 Ga0496114_0004222 3300048917 Bacteria 11135
1242 Ga0496114_0033859 3300048917 Bacteria 4212
1243 Ga0496114_0035850 3300048917 Bacteria 4098
1244 Ga0496114_0127227 3300048917 Bacteria 2197
1245 Ga0496115_0067520 3300048918 Bacteria 2892
1246 Ga0496115_0266786 3300048918 Bacteria 1407
1247 Ga0496115_0402834 3300048918 Bacteria 1110
1248 Ga0496116_0014648 3300048919 Bacteria 6248
1249 Ga0496116_0022566 3300048919 Bacteria 4714
1250 Ga0496117_0004682 3300048920 Bacteria 14859
1251 Ga0496117_0006694 3300048920 Bacteria 11523
1252 Ga0496117_0008860 3300048920 Bacteria 9494
1253 Ga0496117_0018778 3300048920 Bacteria 5711
1254 Ga0496117_0019891 3300048920 Bacteria 5493
1255 Ga0496117_0027849 3300048920 Bacteria 4389
1256 Ga0496117_0035760 3300048920 Bacteria 3724
1257 Ga0496117_0130823 3300048920 Bacteria 1521
1258 Ga0496118_0004448 3300048921 Bacteria 16619
1259 Ga0496118_0005388 3300048921 Bacteria 14570
1260 Ga0496118_0006094 3300048921 Bacteria 13403
1261 Ga0496118_0010308 3300048921 Bacteria 9269
1262 Ga0496118_0014361 3300048921 Bacteria 7422
1263 Ga0496118_0028282 3300048921 Bacteria 4726
1264 Ga0496118_0139628 3300048921 Bacteria 1539
1265 Ga0496121_0002998 3300048924 Bacteria 24523
1266 Ga0496121_0007189 3300048924 Bacteria 13483
1267 Ga0496121_0010687 3300048924 Bacteria 10302
1268 Ga0496121_0013332 3300048924 Bacteria 8844
1269 Ga0496121_0019186 3300048924 Bacteria 6851
1270 Ga0496121_0021945 3300048924 Bacteria 6227
1271 Ga0496121_0027253 3300048924 Bacteria 5351
1272 Ga0496121_0038159 3300048924 Bacteria 4259
1273 Ga0496121_0052696 3300048924 Bacteria 3413
1274 Ga0496121_0093376 3300048924 Bacteria 2343
1275 Ga0496122_0019409 3300048925 Bacteria 6211
1276 Ga0496122_0131377 3300048925 Bacteria 1590
1277 Ga0496123_0026576 3300048926 Bacteria 4331
1278 Ga0496123_0056274 3300048926 Bacteria 2572
1279 Ga0496123_0164844 3300048926 Bacteria 1177
1280 Ga0496124_0000458 3300048927 Bacteria 70719
1281 Ga0496124_0005813 3300048927 Bacteria 13713
1282 Ga0496124_0027218 3300048927 Bacteria 5138
1283 Ga0496124_0082258 3300048927 Bacteria 2644
1284 Ga0496124_0127321 3300048927 Bacteria 2027
1285 Ga0496124_0150365 3300048927 Bacteria 1827
1286 Ga0496125_0005139 3300048928 Bacteria 14720
1287 Ga0496125_0006414 3300048928 Bacteria 12716
1288 Ga0496125_0013614 3300048928 Bacteria 7986
1289 Ga0496125_0023944 3300048928 Bacteria 5626
1290 Ga0496125_0027268 3300048928 Bacteria 5182
1291 Ga0496125_0030022 3300048928 Bacteria 4871
1292 Ga0496126_0000838 3300048929 Bacteria 54525
1293 Ga0496126_0000974 3300048929 Bacteria 49119
1294 Ga0496126_0008991 3300048929 Bacteria 10689
1295 Ga0496126_0010460 3300048929 Bacteria 9718
1296 Ga0496126_0037192 3300048929 Bacteria 4545
1297 Ga0496126_0285761 3300048929 Bacteria 1365
1298 Ga0496126_0295883 3300048929 Bacteria 1337
1299 Ga0501309_002043 3300049129 Bacteria 2115
1300 Ga0495678_007729 3300049459 Bacteria 5540
1301 Ga0495682_0011763 3300049460 Bacteria 3363
1302 Ga0501034_0003350 3300049571 Bacteria 18284
1303 Ga0501047_0353576 3300049581 Bacteria 1306
1304 Ga0501233_044805 3300049668 Bacteria 1053
1305 Ga0501249_016855 3300049679 Bacteria 1571
1306 Ga0501255_006249 3300049684 Bacteria 1223
1307 Ga0501262_000096 3300049759 Bacteria 11056
1308 Ga0501262_003511 3300049759 Bacteria 1799
1309 Ga0501035_0187553 3300049822 Bacteria 1779
1310 nmdc:mga03683_14981_c1 3300050489 Bacteria 2883
1311 nmdc:mga03683_2962_c1 3300050489 Bacteria 5368
1312 nmdc:mga03683_34916_c1 3300050489 Bacteria 2037
1313 nmdc:mga03683_52868_c1 3300050489 Bacteria 1699
1314 nmdc:mga03683_8241_c1 3300050489 Bacteria 3654
1315 nmdc:mga03683_91819_c1 3300050489 Bacteria 1325
1316 nmdc:mga03n38_104917_c1 3300050490 Bacteria 1368
1317 nmdc:mga03n38_15237_c1 3300050490 Bacteria 2964
1318 nmdc:mga03n38_18183_c1 3300050490 Bacteria 2770
1319 nmdc:mga03n38_53922_c1 3300050490 Bacteria 1805
1320 nmdc:mga03n38_80240_c1 3300050490 Bacteria 1532
1321 nmdc:mga00v17_13382_c1 3300050491 Bacteria 4554
1322 nmdc:mga00v17_135903_c1 3300050491 Bacteria 1574
1323 nmdc:mga0yw44_17520_c1 3300050492 Bacteria 3900
1324 nmdc:mga0yw44_41696_c1 3300050492 Bacteria 2733
1325 nmdc:mga0k408_103917_c1 3300050493 Bacteria 1676
1326 nmdc:mga0k408_1168_c1 3300050493 Bacteria 14359
1327 nmdc:mga0k408_122978_c1 3300050493 Bacteria 1538
1328 nmdc:mga0k408_143735_c1 3300050493 Bacteria 1420
1329 nmdc:mga0k408_15220_c1 3300050493 Bacteria 4250
1330 nmdc:mga0k408_15729_c1 3300050493 Bacteria 4188
1331 nmdc:mga0k408_1809_c1 3300050493 Bacteria 11476
1332 nmdc:mga0k408_188735_c1 3300050493 Bacteria 1230
1333 nmdc:mga0k408_18966_c1 3300050493 Bacteria 3840
1334 nmdc:mga0k408_20633_c1 3300050493 Bacteria 3694
1335 nmdc:mga0k408_2385_c2 3300050493 Bacteria 8224
1336 nmdc:mga0k408_378632_c1 3300050493 Bacteria 843
1337 nmdc:mga0k408_61134_c1 3300050493 Bacteria 2189
1338 nmdc:mga0k408_7723_c1 3300050493 Bacteria 5749
1339 nmdc:mga0k408_95672_c1 3300050493 Bacteria 1748
1340 nmdc:mga06z11_19574_c1 3300050494 Bacteria 3115
1341 nmdc:mga06z11_203882_c1 3300050494 Bacteria 1150
1342 nmdc:mga06z11_205679_c1 3300050494 Bacteria 1145
1343 nmdc:mga06z11_55242_c1 3300050494 Bacteria 2050
1344 nmdc:mga06z11_75675_c1 3300050494 Bacteria 1793
1345 nmdc:mga04h51_1437_c1 3300050495 Bacteria 5513
1346 nmdc:mga04h51_36182_c1 3300050495 Bacteria 1587
1347 nmdc:mga07m45_12161_c1 3300050496 Bacteria 4542
1348 nmdc:mga07m45_122156_c1 3300050496 Bacteria 1504
1349 nmdc:mga07m45_1257_c1 3300050496 Bacteria 11522
1350 nmdc:mga07m45_156641_c1 3300050496 Bacteria 1322
1351 nmdc:mga07m45_17278_c1 3300050496 Bacteria 3871
1352 nmdc:mga07m45_210875_c1 3300050496 Bacteria 1130
1353 nmdc:mga07m45_24913_c1 3300050496 Bacteria 3280
1354 nmdc:mga07m45_44355_c1 3300050496 Bacteria 2496
1355 nmdc:mga07m45_84416_c1 3300050496 Bacteria 1816
1356 nmdc:mga09592_3416_c1 3300050508 Bacteria 12836
1357 nmdc:mga0qj67_109537_c1 3300050509 Bacteria 2229
1358 nmdc:mga08y16_174723_c1 3300050511 Bacteria 2230
1359 nmdc:mga0n895_846091_c1 3300050512 Bacteria 903
1360 Ga0495612_0140283 3300053078 Bacteria 1048
1361 Ga0500578_0001060 3300053086 Bacteria 29908
1362 Ga0500644_0000720 3300053088 Bacteria 11694
1363 Ga0500583_0231931 3300053092 Bacteria 914
1364 Ga0500651_0011159 3300053093 Bacteria 5408
1365 Ga0500651_0156326 3300053093 Bacteria 1366
1366 Ga0500641_0192776 3300053096 Bacteria 872
1367 Ga0500650_0091278 3300053098 Bacteria 1426
1368 Ga0500650_0110429 3300053098 Bacteria 1283
1369 Ga0500569_008563 3300053109 Bacteria 2344
1370 Ga0500593_003259 3300053117 Bacteria 6110
1371 Ga0500618_002350 3300053125 Bacteria 7229
1372 Ga0500628_002616 3300053129 Bacteria 2967
1373 Ga0500652_000299 3300053131 Bacteria 18083
1374 Ga0500658_0001952 3300053134 Bacteria 8074
1375 Ga0500604_0028499 3300053151 Bacteria 1622
1376 Ga0500619_000127 3300053154 Bacteria 19880
1377 Ga0500622_0000125 3300053156 Bacteria 81109
1378 Ga0500622_0001196 3300053156 Bacteria 21359
1379 Ga0500634_0100654 3300053161 Bacteria 1446
1380 Ga0500645_001282 3300053730 Bacteria 13131
1381 Ga0500645_030801 3300053730 Bacteria 1613
1382 Ga0500656_013156 3300053732 Bacteria 944
1383 Ga0500661_003454 3300055283 Bacteria 2964
1384 Ga0587084_008578 3300059477 Bacteria 1298
1385 Ga0587106_010391 3300059605 Bacteria 1206
1386 Ga0587067_007300 3300059640 Bacteria 1574
1387 Ga0587072_000013 3300059643 Bacteria 12056
1388 Ga0587076_003718 3300059645 Bacteria 1845
1389 Ga0466962_0001957 3300061719 Bacteria 9704
1390 Ga0466962_0034264 3300061719 Bacteria 2430
1391 2501070125 2501025501 Bacteria 7768574
1392 2501081562 2501025502 Bacteria 9641094
1393 2501407897 2501025504 Bacteria 8008976
1394 2509131115 2508501125 Bacteria 7208311
1395 2510252403 2510065045 Bacteria 7761063
1396 2511085503 2510917013 Bacteria 9951648
1397 2511095644 2510917014 Bacteria 8296963
1398 2511103614 2510917015 Bacteria 7950052
1399 2511244616 2511231002 Bacteria 5042903
1400 2512344672 2512047030 Bacteria 9031815
1401 2513557011 2513237082 Bacteria 8640282
1402 2513564543 2513237083 Bacteria 8410967
1403 2513954221 2513237150 Bacteria 6553639
1404 2513962979 2513237151 Bacteria 6309801
1405 2514042963 2513237165 Bacteria 6771773
1406 2514046123 2513237166 Bacteria 10373764
1407 2515682456 2515154122 Bacteria 8609520
1408 2515692353 2515154123 Bacteria 6387382
1409 2516023722 2515154189 Bacteria 9629850
1410 2519457721 2519103095 Bacteria 6629912
1411 2527080093 2526164713 Bacteria 6780608
1412 2563061693 2562617112 Bacteria 10918404
1413 2585294588 2582581311 Bacteria 6763856
1414 2587725336 2585428057 Bacteria 6737412
1415 2587731305 2585428058 Bacteria 6853932
1416 2597031725 2596583598 Bacteria 5251611
1417 2599446420 2599185178 Bacteria 5365746
1418 2599736845 2599185239 Bacteria 8686614
1419 2599743035 2599185240 Bacteria 7968121
1420 2600205153 2599185355 Bacteria 7968906
1421 2600813753 2600255067 Bacteria 6795583
1422 2643743068 2643221544 Bacteria 5886209
1423 2643932907 2643221585 Bacteria 5812563
1424 2643972781 2643221592 Bacteria 6608788
1425 2644143372 2643221625 Bacteria 6512927
1426 2644218515 2643221639 Bacteria 6649903
1427 2644260410 2643221646 Bacteria 6433402
1428 2644276191 2643221648 Bacteria 6521465
1429 2644301266 2643221654 Bacteria 5273570
1430 2644314157 2643221656 Bacteria 5809961
1431 2676742143 2675903129 Bacteria 7964495
1432 2713478436 2711768613 Bacteria 11048459
1433 2719641494 2718217991 Bacteria 7829542
1434 2738824398 2738541296 Bacteria 7285013
1435 2738836807 2738541298 Bacteria 7286732
1436 2738878338 2738541306 Bacteria 7284992
1437 2739055929 2738541337 Bacteria 6183410
1438 2739190030 2738543002 Bacteria 7284546
1439 2739224931 2738543008 Bacteria 7282815
1440 2739250030 2738543013 Bacteria 5618633
1441 2746088912 2744054900 Bacteria 8399525
1442 2746096462 2744054901 Bacteria 8397047
1443 2753569637 2751185846 Bacteria 7242164
1444 2792835793 2791355137 Bacteria 9654227
1445 2808971741 2808606384 Bacteria 8474373
1446 2809006570 2808606390 Bacteria 8476311
1447 2809013512 2808606391 Bacteria 8308166
1448 2817259911 2816332253 Bacteria 6764532
1449 2817277573 2816332256 Bacteria 6891714
1450 2817457014 2816332286 Bacteria 6853759
1451 2819623489 2818991450 Bacteria 6962147
1452 2819632345 2818991452 Bacteria 8442785
1453 2831864645 2831864461 Bacteria 6502356
1454 2834642951 2834641062 Bacteria 5559922
1455 2842324533 2842324504 Bacteria 9364110
1456 2842348812 2842348783 Bacteria 9002918
1457 2842457482 2842454564 Bacteria 8730687
1458 2856290905 2856287931 Bacteria 7223934
1459 2857363651 2857357740 Bacteria 9937880
1460 2857577870 2857576091 Bacteria 5465855
1461 2858693330 2858688981 Bacteria 8184122
1462 2863421390 2863421361 Bacteria 7300805
1463 2870069184 2870068957 Bacteria 8925310
1464 2883095360 2883087390 Bacteria 9532701
1465 2885270218 2885266251 Bacteria 4796748
1466 2885279698 2885270888 Bacteria 9831543
1467 2886852215 2886848708 Bacteria 5632523
1468 2900581833 2900577576 Bacteria 5438534
1469 2900637248 2900634093 Bacteria 10263517
1470 2902691277 2902682994 Bacteria 8951596
1471 2904438504 2904434214 Bacteria 6230908
1472 2904487918 2904483920 Bacteria 7545285
1473 2904545151 2904541872 Bacteria 8915136
1474 2904571416 2904564687 Bacteria 7609577
1475 2904578509 2904571731 Bacteria 7608790
1476 2904619042 2904615490 Bacteria 10047340
1477 2919529223 2919527303 Bacteria 7718827
1478 2919707121 2919704043 Bacteria 5560311
1479 2921646699 2921643360 Bacteria 11448031
1480 2928061485 2928058823 Bacteria 5520022
1481 2928113634 2928108538 Bacteria 7360024
1482 2928140653 2928135762 Bacteria 7259641
1483 2928160021 2928157003 Bacteria 7522202
1484 2928163938 2928163908 Bacteria 7561269
1485 2928177207 2928170801 Bacteria 8785406
1486 2928506231 2928503688 Bacteria 7268108
1487 2928538863 2928536128 Bacteria 7657547
1488 2929165329 2929160207 Bacteria 9075316
1489 2945938199 2945934425 Bacteria 7444609
1490 2981994463 2981990288 Bacteria 7590678
1491 2990705084 2990703756 Bacteria 7715990
1492 642426138 641736151 Bacteria 7477263
1493 642419748 641736154 Bacteria 7689995
1494 642594449 642555112 Bacteria 8676562
1495 642623030 642555113 Bacteria 8214658
1496 644749030 644736347 Bacteria 6476522
1497 8003400904 8003400568 Bacteria 5535898
1498 8003961008 8003955200 Bacteria 8601927
1499 8018849479 8018845410 Bacteria 8933938
1500 8020809973 8020807995 Bacteria 6801506
1501 8020939476 8020938398 Bacteria 7472757
1502 8020952076 8020945358 Bacteria 8467355
1503 8020953943 8020953355 Bacteria 7439080
1504 8021126914 8021120328 Bacteria 8782274
1505 8039099803 8039098773 Bacteria 6602928
1506 8040170833 8040167225 Bacteria 6542727
1507 8040175254 8040173305 Bacteria 6827067
1508 8055267504 8055266321 Bacteria 7999742
1509 8055308167 8055301274 Bacteria 8587385
1510 Ga0055537_1005980
1511 JGI24741J21665_1000283
1512 JGI24740J21852_10000515
1513 JGI24740J21852_10000746
1514 JGI24740J21852_10001108
1515 JGI24740J21852_10009684
1516 JGI24740J21852_10041650
1517 JGI24739J22299_10002065
1518 JGI24739J22299_10031281
1519 JGI24739J22299_10042269
1520 JGI24735J21928_10000452
1521 JGI24735J21928_10011624
1522 JGI24735J21928_10035479
1523 JGI24738J21930_10003232
1524 JGI25155J39150_1000022
1525 JGI25156J39149_1000005
1526 JGI25156J39149_1001653
1527 JGI25156J39149_1002435
1528 JGI25156J39149_1002891
1529 JGI25156J39149_1005295
1530 JGI25154J39366_1000017
1531 JGI25158J39367_1002236
1532 JGI25157J39369_1000003
1533 JGI25152J39213_1013920
1534 JGI25152J39213_1016999
1535 JGI25150J39212_1001013
1536 JGI25150J39212_1007308
1537 JGI25150J39212_1016857
1538 JGI25150J39212_1018546
1539 JGI25159J45721_1000990
1540 JGI25159J45721_1001144
1541 JGI25151J46595_10003048
1542 JGI25151J46595_10005037
1543 JGI25151J46595_10007571
1544 JGI25151J46595_10026649
1545 JGI25151J46595_10067336
1546 JGI25165J46597_1001016
1547 JGI25153J46596_10000420
1548 JGI25153J46596_10001641
1549 JGI25153J46596_10003017
1550 JGI25153J46596_10003453
1551 rootH1_10005825
1552 rootH2_10020860
1553 rootH2_10117659
1554 rootH1_10008605
1555 rootH1_10041182
1556 rootH1_10110046
1557 rootH1_10195324
1558 JGI25160J50197_1000155
1559 JGI25160J50197_1000273
1560 JGI25161J50226_1000095
1561 Ga0006562J51391_1021614
1562 Ga0055539_1000188
1563 Ga0055539_1002965
1564 Ga0055533_1001338
1565 Ga0055533_1003294
1566 Ga0055533_1003917
1567 Ga0055532_1000072
1568 Ga0055532_1000318
1569 Ga0055532_1001078
1570 Ga0055525_1000004
1571 Ga0055525_1000168
1572 Ga0055525_1004544
1573 Ga0055527_1000296
1574 Ga0055527_1000586
1575 Ga0055527_1001512
1576 Ga0055527_1002285
1577 Ga0055535_1000053
1578 Ga0055535_1000094
1579 Ga0055535_1001469
1580 Ga0055535_1001478
1581 Ga0055542_1000131
1582 Ga0055542_1000793
1583 Ga0055542_1001405
1584 Ga0055542_1001797
1585 Ga0055542_1004457
1586 Ga0055529_1000099
1587 Ga0055529_1000592
1588 Ga0055529_1000875
1589 Ga0055529_1001282
1590 Ga0055526_1002203
1591 Ga0055526_1006651
1592 Ga0055526_1014651
1593 Ga0055526_1014725
1594 Ga0055537_1000483
1595 Ga0055537_1013834
1596 Ga0055524_1000073
1597 Ga0055524_1001815
1598 Ga0055524_1002320
1599 Ga0055524_1003058
1600 Ga0055524_1007833
1601 Ga0055536_1000386
1602 Ga0055536_1001517
1603 Ga0055536_1003433
1604 Ga0055536_1032466
1605 Ga0055534_1000537
1606 Ga0055534_1000994
1607 Ga0055534_1001899
1608 Ga0055534_1003367
1609 Ga0055534_1003382
1610 Ga0055534_1003675
1611 Ga0055528_1000289
1612 Ga0055528_1006492
1613 Ga0055528_1007354
1614 Ga0055528_1008897
1615 Ga0055530_10001136
1616 Ga0055530_10001363
1617 Ga0055530_10001971
1618 Ga0055530_10002524
1619 Ga0055530_10043550
1620 Ga0055540_1000013
1621 Ga0055540_1000037
1622 Ga0055531_10000112
1623 Ga0055531_10000500
1624 Ga0055531_10007794
1625 Ga0055531_10009798
1626 Ga0055531_10017694
1627 Ga0055541_1000432
1628 Ga0055541_1005995
1629 Ga0058692_1000925
1630 Ga0055543_1000218
1631 Ga0055543_1002676
1632 Ga0055543_1002886
1633 Ga0065165_1000290
1634 Ga0065165_1000502
1635 Ga0065165_1004909
1636 Ga0065165_1005723
1637 Ga0065165_1005753
1638 Ga0065165_1006006
1639 Ga0065165_1018740
1640 Ga0065714_10003595
1641 Ga0070658_10000514
1642 Ga0070658_10014502
1643 Ga0070658_10147360
1644 Ga0070658_10254962
1645 Ga0070676_10020247
1646 Ga0070683_100023598
1647 Ga0070683_100228845
1648 Ga0070670_100064962
1649 Ga0070670_100264594
1650 Ga0070677_10005133
1651 Ga0070677_10041967
1652 Ga0068869_100002210
1653 Ga0068869_100131954
1654 Ga0070682_100048124
1655 Ga0068868_100001584
1656 Ga0068868_100019660
1657 Ga0068868_100037899
1658 Ga0068868_100217618
1659 Ga0070660_100000030
1660 Ga0070660_100001389
1661 Ga0070660_100019132
1662 Ga0070660_100019997
1663 Ga0070660_100086747
1664 Ga0070660_100105248
1665 Ga0070689_100158211
1666 Ga0070661_100000097
1667 Ga0070661_100015458
1668 Ga0070661_100078642
1669 Ga0070661_100082860
1670 Ga0070661_100164659
1671 Ga0070669_100013295
1672 Ga0070669_100063487
1673 Ga0070669_100075707
1674 Ga0070675_100003464
1675 Ga0070675_100032377
1676 Ga0070675_100051356
1677 Ga0070671_100009294
1678 Ga0070671_100016897
1679 Ga0070671_100156517
1680 Ga0070673_100138379
1681 Ga0070673_100230443
1682 Ga0070673_100365684
1683 Ga0070659_100000359
1684 Ga0070659_100006742
1685 Ga0070659_100039804
1686 Ga0070659_100048077
1687 Ga0070667_100025243
1688 Ga0070667_100040384
1689 Ga0070667_100188812
1690 Ga0070663_100000016
1691 Ga0070663_100010954
1692 Ga0070663_100014328
1693 Ga0070663_100434204
1694 Ga0070678_100003986
1695 Ga0070678_100031226
1696 Ga0070678_100056818
1697 Ga0070678_100059117
1698 Ga0070662_100000321
1699 Ga0070662_100051593
1700 Ga0070662_100065895
1701 Ga0070662_100113275
1702 Ga0070662_100206436
1703 Ga0070681_10020347
1704 Ga0068867_100061132
1705 Ga0068867_100400179
1706 Ga0070707_100023808
1707 Ga0070679_100000726
1708 Ga0070684_100057533
1709 Ga0068853_100005236
1710 Ga0068853_100054404
1711 Ga0068853_100183276
1712 Ga0068853_100734967
1713 Ga0070672_100016993
1714 Ga0070672_100044042
1715 Ga0070686_100298010
1716 Ga0070693_100033298
1717 Ga0070693_100074620
1718 Ga0070665_100103472
1719 Ga0070665_100231076
1720 Ga0068855_100003793
1721 Ga0068855_100053702
1722 Ga0068855_100244814
1723 Ga0070664_100000017
1724 Ga0070664_100003718
1725 Ga0070664_100060999
1726 Ga0070664_100099333
1727 Ga0070664_100210064
1728 Ga0068857_100026945
1729 Ga0068857_100066363
1730 Ga0068857_100074198
1731 Ga0068857_100091481
1732 Ga0068854_100000416
1733 Ga0068854_100239935
1734 Ga0068856_100000450
1735 Ga0068856_100082275
1736 Ga0068856_100200395
1737 Ga0070702_100043620
1738 Ga0068852_100015123
1739 Ga0068852_100025824
1740 Ga0068852_100044868
1741 Ga0068852_100236978
1742 Ga0068859_100052468
1743 Ga0068864_100014003
1744 Ga0068864_100034295
1745 Ga0068864_100112722
1746 Ga0068861_100007081
1747 Ga0068851_10025736
1748 Ga0068863_100169968
1749 Ga0068863_100642976
1750 Ga0068858_100004761
1751 Ga0068858_100036277
1752 Ga0068858_100161771
1753 Ga0068860_100010883
1754 Ga0068860_100243618
1755 Ga0068862_100407620
1756 Ga0075365_10219155
1757 Ga0075368_10050541
1758 Ga0075368_10055972
1759 Ga0075363_100013051
1760 Ga0075363_100196662
1761 Ga0075364_10001615
1762 Ga0075364_10005356
1763 Ga0075362_10003588
1764 Ga0075362_10040555
1765 Ga0075362_10042308
1766 Ga0075362_10043093
1767 Ga0075367_10002511
1768 Ga0075367_10027419
1769 Ga0075367_10174365
1770 Ga0075367_10252392
1771 Ga0075366_10001564
1772 Ga0075366_10013284
1773 Ga0075366_10013313
1774 Ga0075366_10019854
1775 Ga0075366_10024281
1776 Ga0075366_10024526
1777 Ga0075366_10072666
1778 Ga0075366_10087187
1779 Ga0075366_10090345
1780 Ga0075366_10112236
1781 Ga0075366_10127869
1782 Ga0075366_10213632
1783 Ga0097621_100029411
1784 Ga0097621_100090991
1785 Ga0075370_10002323
1786 Ga0075370_10002909
1787 Ga0075370_10015127
1788 Ga0075370_10016288
1789 Ga0075370_10047956
1790 Ga0075370_10071240
1791 Ga0075429_100048012
1792 Ga0068865_100028208
1793 Ga0068865_100121036
1794 Ga0068865_100269703
1795 Ga0097620_100052468
1796 Ga0099823_1008020
1797 Ga0079104_1011971
1798 Ga0099826_10000064
1799 Ga0099826_10044047
1800 Ga0105251_10000527
1801 Ga0105251_10001573
1802 Ga0105251_10006550
1803 Ga0105244_10043171
1804 Ga0105250_10000884
1805 Ga0105250_10159519
1806 Ga0105240_10005235
1807 Ga0105240_10005792
1808 Ga0105240_10014381
1809 Ga0105240_10029867
1810 Ga0105240_10052469
1811 Ga0105240_10063160
1812 Ga0105240_10065840
1813 Ga0105240_10213503
1814 Ga0105240_10259814
1815 Ga0105240_10358866
1816 Ga0105240_10434823
1817 Ga0105245_10028127
1818 Ga0114129_10247999
1819 Ga0105241_10154668
1820 Ga0105241_10182206
1821 Ga0105241_10204181
1822 Ga0105248_10008801
1823 Ga0105248_10033741
1824 Ga0105248_10052778
1825 Ga0105248_10300345
1826 Ga0105248_10532971
1827 Ga0105237_10002475
1828 Ga0105237_10006702
1829 Ga0105237_10028471
1830 Ga0105237_10029734
1831 Ga0105237_10032254
1832 Ga0105237_10038844
1833 Ga0105237_10575627
1834 Ga0105238_10001839
1835 Ga0105238_10007028
1836 Ga0105238_10039786
1837 Ga0105238_10044173
1838 Ga0105238_10115790
1839 Ga0105238_10271378
1840 Ga0105238_10340460
1841 Ga0105249_10062813
1842 Ga0105239_10001374
1843 Ga0105239_10086349
1844 Ga0105239_10179098
1845 Ga0105246_10030645
1846 Ga0105246_10165764
1847 Ga0157319_1000005
1848 Ga0157324_1003648
1849 Ga0157326_1000855
1850 Ga0157373_10000474
1851 Ga0157371_10000440
1852 Ga0157371_10038319
1853 Ga0157371_10066293
1854 Ga0157370_10000447
1855 Ga0157370_10001380
1856 Ga0157370_10006484
1857 Ga0157370_10017368
1858 Ga0157370_10628093
1859 Ga0157369_10001896
1860 Ga0157369_10003307
1861 Ga0157369_10008737
1862 Ga0157369_10009949
1863 Ga0157369_10037705
1864 Ga0157369_10040174
1865 Ga0157369_10107149
1866 Ga0157369_10673156
1867 Ga0157369_10939355
1868 Ga0157374_10000055
1869 Ga0157374_10019867
1870 Ga0157374_10030579
1871 Ga0157374_10133087
1872 Ga0157374_10358811
1873 Ga0157374_10439724
1874 Ga0157378_10578909
1875 Ga0163162_10000659
1876 Ga0163162_10038809
1877 Ga0163162_10055378
1878 Ga0163162_10128504
1879 Ga0157372_10000348
1880 Ga0157372_10020596
1881 Ga0157372_10041911
1882 Ga0157372_10748294
1883 Ga0157375_10013668
1884 Ga0157375_10038391
1885 Ga0157375_10055204
1886 Ga0157375_10081080
1887 Ga0157375_10103704
1888 Ga0157375_10462156
1889 Ga0163163_10142949
1890 Ga0163163_10690204
1891 Ga0157380_10007872
1892 Ga0182008_10003049
1893 Ga0182008_10047221
1894 Ga0182008_10083487
1895 Ga0157377_10007064
1896 Ga0157379_10015896
1897 Ga0157379_10016463
1898 Ga0157376_10031275
1899 Ga0157376_10056797
1900 Ga0157376_10247556
1901 Ga0182006_1001066
1902 Ga0182006_1001585
1903 Ga0182006_1010909
1904 Ga0182006_1089923
1905 Ga0182007_10001230
1906 Ga0182007_10002485
1907 Ga0182007_10002754
1908 Ga0182005_1040160
1909 Ga0182005_1045312
1910 Ga0183362_10003
1911 Ga0183361_10037
1912 Ga0163161_10018630
1913 Ga0163161_10030806
1914 Ga0163161_10032747
1915 Ga0163161_10056934
1916 Ga0206356_10229810
1917 Ga0206351_10894528
1918 Ga0206350_11190805
1919 Ga0206350_11327716
1920 Ga0154015_1371877
1921 Ga0213872_10000067
1922 Ga0213872_10000104
1923 Ga0213872_10000131
1924 Ga0213872_10058914
1925 Ga0224712_10000047
1926 Ga0209435_100002
1927 Ga0209436_103243
1928 Ga0209784_100063
1929 Ga0209784_100812
1930 Ga0209566_100048
1931 Ga0209566_100410
1932 Ga0209566_100738
1933 Ga0209674_100013
1934 Ga0209674_100071
1935 Ga0209674_100151
1936 Ga0209674_100275
1937 Ga0209674_100809
1938 Ga0209674_108241
1939 Ga0209672_100010
1940 Ga0209672_100241
1941 Ga0209672_100243
1942 Ga0209672_101464
1943 Ga0209672_101467
1944 Ga0209672_104258
1945 Ga0209147_100002
1946 Ga0209147_100006
1947 Ga0209147_100638
1948 Ga0209147_100711
1949 Ga0209563_100013
1950 Ga0209563_100163
1951 Ga0209563_100382
1952 Ga0207427_100753
1953 Ga0209258_100002
1954 Ga0209258_100010
1955 Ga0209258_100486
1956 Ga0209258_100530
1957 Ga0207425_1000221
1958 Ga0207425_1001010
1959 Ga0207425_1001487
1960 Ga0207425_1002959
1961 Ga0209646_1000001
1962 Ga0209646_1000123
1963 Ga0209026_1000001
1964 Ga0209026_1003916
1965 Ga0209677_100040
1966 Ga0209677_106217
1967 Ga0209148_1000077
1968 Ga0209148_1000081
1969 Ga0209148_1000189
1970 Ga0209148_1001056
1971 Ga0209148_1004348
1972 Ga0209759_1000001
1973 Ga0209759_1000349
1974 Ga0209759_1000630
1975 Ga0209759_1001039
1976 Ga0209759_1001595
1977 Ga0209759_1007552
1978 Ga0209759_1027361
1979 Ga0209129_1000012
1980 Ga0209129_1000054
1981 Ga0209129_1005563
1982 Ga0209129_1010165
1983 Ga0209129_1010980
1984 Ga0209233_1000244
1985 Ga0209565_1000128
1986 Ga0209565_1000503
1987 Ga0209565_1000708
1988 Ga0209565_1000861
1989 Ga0209565_1001443
1990 Ga0209565_1006974
1991 Ga0209565_1008211
1992 Ga0209455_1000050
1993 Ga0209455_1000149
1994 Ga0209455_1000162
1995 Ga0209673_1000008
1996 Ga0209673_1000038
1997 Ga0209673_1000172
1998 Ga0209673_1002759
1999 Ga0209673_1002773
2000 Ga0209673_1005034
2001 Ga0209673_1016201
2002 Ga0209673_1030846
2003 Ga0209673_1033566
2004 Ga0209130_1000072
2005 Ga0209130_1000315
2006 Ga0209130_1000832
2007 Ga0209130_1001095
2008 Ga0209130_1001276
2009 Ga0207673_1016052
2010 Ga0209675_1000208
2011 Ga0209675_1000221
2012 Ga0209675_1000431
2013 Ga0209675_1000527
2014 Ga0209675_1001172
2015 Ga0209675_1005904
2016 Ga0209675_1008733
2017 Ga0209676_1000023
2018 Ga0209676_1000048
2019 Ga0209676_1000141
2020 Ga0209676_1004490
2021 Ga0209676_1005062
2022 Ga0209676_1017231
2023 Ga0209025_1000538
2024 Ga0209025_1000657
2025 Ga0209025_1000790
2026 Ga0209025_1000906
2027 Ga0209025_1001066
2028 Ga0209025_1001733
2029 Ga0209025_1002220
2030 Ga0209025_1003614
2031 Ga0209025_1007588
2032 Ga0209025_1008309
2033 Ga0209025_1035062
2034 Ga0209025_1036254
2035 Ga0209564_1000008
2036 Ga0209564_1000022
2037 Ga0209564_1000241
2038 Ga0209564_1000435
2039 Ga0209564_1000998
2040 Ga0209564_1001686
2041 Ga0209564_1001921
2042 Ga0209564_1001928
2043 Ga0209564_1002084
2044 Ga0209564_1005341
2045 Ga0209564_1010534
2046 Ga0209564_1016087
2047 Ga0209758_1000034
2048 Ga0209758_1000124
2049 Ga0209758_1000659
2050 Ga0209758_1002271
2051 Ga0209758_1006790
2052 Ga0209758_1020103
2053 Ga0209050_1000012
2054 Ga0209050_1000022
2055 Ga0209050_1000567
2056 Ga0209050_1001940
2057 Ga0209050_1002988
2058 Ga0209050_1004091
2059 Ga0209050_1017756
2060 Ga0209256_1000001
2061 Ga0209256_1000015
2062 Ga0209256_1000103
2063 Ga0209256_1000165
2064 Ga0209256_1001079
2065 Ga0209256_1002459
2066 Ga0209256_1004469
2067 Ga0209256_1014429
2068 Ga0207426_1000037
2069 Ga0207426_1000058
2070 Ga0207426_1000067
2071 Ga0207426_1000319
2072 Ga0207426_1002802
2073 Ga0207426_1011680
2074 Ga0207426_1042288
2075 Ga0209051_1000013
2076 Ga0209051_1000019
2077 Ga0209051_1000022
2078 Ga0209051_1001491
2079 Ga0209051_1002503
2080 Ga0209051_1009063
2081 Ga0209051_1011708
2082 Ga0209051_1018809
2083 Ga0209051_1029945
2084 Ga0209257_1000024
2085 Ga0209257_1000030
2086 Ga0209257_1000042
2087 Ga0209257_1000131
2088 Ga0209257_1002950
2089 Ga0209257_1004714
2090 Ga0209257_1006654
2091 Ga0209257_1008508
2092 Ga0209257_1013217
2093 Ga0207696_1003867
2094 Ga0207713_1000247
2095 Ga0207713_1001909
2096 Ga0207713_1015784
2097 Ga0207713_1122170
2098 Ga0207682_10092400
2099 Ga0207688_10019604
2100 Ga0207647_10000728
2101 Ga0207647_10004850
2102 Ga0207647_10014229
2103 Ga0207647_10018420
2104 Ga0207645_10009688
2105 Ga0207645_10029379
2106 Ga0207645_10138031
2107 Ga0207705_10000221
2108 Ga0207684_10004207
2109 Ga0207654_10090130
2110 Ga0207654_10151054
2111 Ga0207654_10214712
2112 Ga0207695_10001311
2113 Ga0207695_10004434
2114 Ga0207695_10005617
2115 Ga0207695_10012572
2116 Ga0207695_10016930
2117 Ga0207695_10148173
2118 Ga0207695_10150890
2119 Ga0207695_10173632
2120 Ga0207695_10321026
2121 Ga0207695_10540924
2122 Ga0207671_10009202
2123 Ga0207671_10043849
2124 Ga0207671_10044911
2125 Ga0207671_10133981
2126 Ga0207660_10005400
2127 Ga0207657_10000064
2128 Ga0207657_10002927
2129 Ga0207657_10019808
2130 Ga0207657_10037483
2131 Ga0207657_10053387
2132 Ga0207649_10000051
2133 Ga0207649_10010478
2134 Ga0207649_10020909
2135 Ga0207652_10022278
2136 Ga0207694_10020839
2137 Ga0207694_10093044
2138 Ga0207650_10022128
2139 Ga0207650_10030590
2140 Ga0207650_10073756
2141 Ga0207650_10247737
2142 Ga0207659_10003450
2143 Ga0207659_10068328
2144 Ga0207659_10103325
2145 Ga0207687_10052045
2146 Ga0207687_10096601
2147 Ga0207644_10009711
2148 Ga0207644_10045713
2149 Ga0207644_10124175
2150 Ga0207690_10000060
2151 Ga0207690_10004656
2152 Ga0207690_10087952
2153 Ga0207690_10088625
2154 Ga0207706_10003929
2155 Ga0207706_10019459
2156 Ga0207706_10052728
2157 Ga0207706_10246458
2158 Ga0207686_10048223
2159 Ga0207686_10102468
2160 Ga0207669_10511165
2161 Ga0207704_10250848
2162 Ga0207704_10418052
2163 Ga0207691_10003014
2164 Ga0207691_10035883
2165 Ga0207691_10042355
2166 Ga0207691_10043344
2167 Ga0207691_10184957
2168 Ga0207711_10012713
2169 Ga0207711_10353752
2170 Ga0207689_10000709
2171 Ga0207689_10055613
2172 Ga0207661_10018007
2173 Ga0207661_10412159
2174 Ga0207679_10000042
2175 Ga0207679_10019919
2176 Ga0207679_10044123
2177 Ga0207667_10001823
2178 Ga0207667_10041642
2179 Ga0207667_10338206
2180 Ga0207667_10443713
2181 Ga0207651_10177511
2182 Ga0207712_10121590
2183 Ga0207640_10011577
2184 Ga0207640_10124807
2185 Ga0207658_10091223
2186 Ga0207658_10215809
2187 Ga0207658_10301885
2188 Ga0207658_10399012
2189 Ga0207677_10031459
2190 Ga0207677_10046664
2191 Ga0207677_10087241
2192 Ga0207677_10409901
2193 Ga0207703_10110682
2194 Ga0207703_10119762
2195 Ga0207703_10257371
2196 Ga0207639_10006281
2197 Ga0207639_10030891
2198 Ga0207639_10052919
2199 Ga0207639_10090042
2200 Ga0207678_10000055
2201 Ga0207678_10000367
2202 Ga0207678_10027999
2203 Ga0207678_10080470
2204 Ga0207678_10106068
2205 Ga0207678_10309336
2206 Ga0207702_10000156
2207 Ga0207702_10048251
2208 Ga0207702_10122998
2209 Ga0207641_10013425
2210 Ga0207648_10006990
2211 Ga0207648_10020382
2212 Ga0207648_10042356
2213 Ga0207648_10401476
2214 Ga0207676_10067746
2215 Ga0207676_10072019
2216 Ga0207676_10226529
2217 Ga0207674_10008473
2218 Ga0207674_10009895
2219 Ga0207674_10017562
2220 Ga0207674_10062595
2221 Ga0207674_10095092
2222 Ga0207674_10162240
2223 Ga0207675_100000563
2224 Ga0207675_100279921
2225 Ga0207683_10051569
2226 Ga0207683_10077198
2227 Ga0207683_10108581
2228 Ga0207683_10206681
2229 Ga0207683_10242690
2230 Ga0207683_10243802
2231 Ga0207683_10553938
2232 Ga0207698_10004414
2233 Ga0207698_10013933
2234 Ga0207698_10027903
2235 Ga0207698_10070834
2236 Ga0207698_10096596
2237 Ga0207698_10241659
2238 Ga0207698_10260808
2239 Ga0207698_10275558
2240 Ga0209389_1023782
2241 Ga0209371_1000114
2242 Ga0209371_1003581
2243 Ga0209371_1008658
2244 Ga0209282_1000508
2245 Ga0209974_10000240
2246 Ga0268266_10046025
2247 Ga0268266_10111920
2248 Ga0268266_10141336
2249 Ga0268266_10359077
2250 Ga0268264_10104563
2251 Ga0268264_10114013
2252 Ga0307515_10000062
2253 Ga0307515_10000084
2254 Ga0307515_10028135
2255 Ga0307515_10146493
2256 Ga0307515_10180161
2257 Ga0265338_10000409
2258 Ga0268256_1000177
2259 Ga0268256_1002558
2260 Ga0268256_1004946
2261 Ga0265332_10000027
2262 Ga0265332_10042535
2263 Ga0265328_10003344
2264 Ga0265340_10071231
2265 Ga0265331_10010440
2266 Ga0265327_10000035
2267 Ga0265327_10001654
2268 Ga0307513_10000117
2269 Ga0307513_10002583
2270 Ga0307513_10165455
2271 Ga0307513_10225329
2272 Ga0307509_10471514
2273 Ga0307408_100021370
2274 Ga0307408_100046444
2275 Ga0307514_10000319
2276 Ga0307514_10000522
2277 Ga0307516_10006887
2278 Ga0307516_10018452
2279 Ga0307405_10292104
2280 Ga0307413_10284125
2281 Ga0307410_10130513
2282 Ga0307410_10148438
2283 Ga0307406_10047831
2284 Ga0307406_10120657
2285 Ga0307406_10164842
2286 Ga0307406_10205177
2287 Ga0307412_10000044
2288 Ga0307412_10006093
2289 Ga0307412_10072770
2290 Ga0307412_10169928
2291 Ga0307412_10203301
2292 Ga0307409_100002068
2293 Ga0307409_100163739
2294 Ga0307416_100006260
2295 Ga0307416_100017569
2296 Ga0307416_100135265
2297 Ga0307416_100283086
2298 Ga0307416_100617881
2299 Ga0307414_10009164
2300 Ga0307411_10064575
2301 Ga0307415_100406599
2302 Ga0307510_10228393
2303 Ga0373950_0018527
2304 Ga0373958_0052811
2305 Ga0373959_0012052
2306 Ga0373949_0042101
2307 Ga0373932_0021909
2308 Ga0373939_0000049
2309 Ga0373941_0082671
2310 Ga0373962_0003198
2311 Ga0373931_0000092
2312 Ga0373931_0011515
2313 Ga0373933_0056999
2314 Ga0373925_0004978
2315 Ga0373925_0012376
2316 Ga0373925_0491345
2317 Ga0395899_0000008
2318 Ga0395899_0059193
2319 Ga0395899_0185360
2320 Ga0395900_0000055
2321 Ga0395900_0000455
2322 Ga0395900_0004501
2323 Ga0395900_0115586
2324 Ga0395900_0250639
2325 Ga0395898_0001141
2326 Ga0395898_0003577
2327 Ga0395898_0184573
2328 Ga0395905_0000151
2329 Ga0395905_0000201
2330 Ga0395905_0000483
2331 Ga0395905_0040362
2332 Ga0395905_0068759
2333 Ga0395905_0298567
2334 Ga0395905_0647360
2335 Ga0395901_0000003
2336 Ga0395901_0002516
2337 Ga0395901_0009622
2338 Ga0395901_0036083
2339 Ga0395901_0253094
2340 Ga0436361_0098627
2341 Ga0436361_0099983
2342 Ga0436361_0378401
2343 Ga0436361_0745691
2344 Ga0436361_0750298
2345 Ga0436361_0843250
2346 Ga0436361_1036771
2347 Ga0439436_0004261
2348 Ga0439436_0032485
2349 Ga0439436_0062608
2350 Ga0439439_0008709
2351 Ga0439466_0001987
2352 Ga0439466_0010063
2353 Ga0439465_0007307
2354 Ga0439465_0028985
2355 Ga0439465_0040736
2356 Ga0451789_1235407
2357 Ga0451791_0764014
2358 Ga0451800_1207179
2359 Ga0451802_1337943
2360 Ga0451851_0278468
2361 Ga0439431_0001298
2362 Ga0439431_0007001
2363 Ga0439442_001044
2364 Ga0439445_0062565
2365 Ga0439432_016725
2366 Ga0439449_0007455
2367 Ga0439449_0033847
2368 Ga0439449_0035762
2369 Ga0439452_004236
2370 Ga0439457_013151
2371 Ga0439462_0000676
2372 Ga0450917_001825
2373 Ga0450888_000038
2374 Ga0450890_002364
2375 Ga0450891_000454
2376 Ga0450892_001627
2377 Ga0450896_025458
2378 Ga0450899_000698
2379 Ga0450903_025003
2380 Ga0450889_000272
2381 Ga0450906_000190
2382 Ga0450906_033942
2383 Ga0450910_001656
2384 Ga0439446_0054046
2385 Ga0450908_001735
2386 Ga0439434_0001931
2387 Ga0439434_0006816
2388 Ga0439434_0006907
2389 Ga0439459_0000910
2390 Ga0439459_0074205
2391 Ga0450916_003230
2392 Ga0450918_000341
2393 Ga0450918_029681
2394 Ga0450893_0002485
2395 Ga0450893_0028726
2396 Ga0451577_0000276
2397 Ga0451577_0171453
2398 Ga0451577_0189020
2399 Ga0466986_0292597
2400 Ga0466969_0000070
2401 Ga0466969_0029784
2402 Ga0466969_0037167
2403 Ga0466972_0045437
2404 Ga0466972_0146439
2405 Ga0466973_0007979
2406 Ga0466965_0000679
2407 Ga0466965_0006575
2408 Ga0466966_0000364
2409 Ga0466966_0027752
2410 Ga0466961_0000097
2411 Ga0466961_0000249
2412 Ga0466961_0000777
2413 Ga0466961_0040018
2414 Ga0466961_0163881
2415 Ga0466963_0000630
2416 Ga0466963_0003521
2417 Ga0466963_0018183
2418 Ga0466963_0125094
2419 Ga0466963_0297216
2420 Ga0466964_0039814
2421 Ga0453684_0000891
2422 Ga0453684_0102707
2423 Ga0453684_0840749
2424 Ga0453684_0924240
2425 Ga0466971_0000724
2426 Ga0466971_0004128
2427 Ga0466971_0014567
2428 Ga0466971_0030528
2429 Ga0466971_0189818
2430 Ga0466968_0019312
2431 Ga0466968_0061701
2432 Ga0466970_0021271
2433 Ga0466970_0251976
2434 Ga0466957_0001503
2435 Ga0466957_0025031
2436 Ga0466957_0049430
2437 Ga0466957_0170798
2438 Ga0466959_0009002
2439 Ga0466959_0019964
2440 Ga0466959_0022675
2441 Ga0466959_0045970
2442 Ga0466959_0049091
2443 Ga0451576_0002088
2444 Ga0451576_0002533
2445 Ga0451576_0005708
2446 Ga0451576_0039872
2447 Ga0451576_0114061
2448 Ga0451576_0262904
2449 Ga0451576_0593237
2450 Ga0466958_0003481
2451 Ga0466958_0026349
2452 Ga0466967_0208720
2453 Ga0495592_0001360
2454 Ga0495592_0008165
2455 Ga0495603_0000637
2456 Ga0495603_0008206
2457 Ga0495603_0035116
2458 Ga0495603_0258574
2459 Ga0495590_0001856
2460 Ga0495590_0010461
2461 Ga0495590_0035975
2462 Ga0495591_006538
2463 Ga0495591_075024
2464 Ga0495629_0001796
2465 Ga0495629_0002715
2466 Ga0495629_0004967
2467 Ga0495629_0006553
2468 Ga0495629_0054000
2469 Ga0495629_0070566
2470 Ga0495629_0167649
2471 Ga0495638_0050399
2472 Ga0495641_0025721
2473 Ga0495641_0080928
2474 Ga0495651_0002998
2475 Ga0495651_0101064
2476 Ga0495653_0001364
2477 Ga0495653_0002775
2478 Ga0495653_0012839
2479 Ga0495653_0093745
2480 Ga0495650_0013809
2481 Ga0495650_0039369
2482 Ga0495650_0063060
2483 Ga0495650_0067136
2484 Ga0495580_0000360
2485 Ga0495580_0003221
2486 Ga0495580_0007349
2487 Ga0495580_0011585
2488 Ga0495580_0032907
2489 Ga0495580_0043963
2490 Ga0495580_0059448
2491 Ga0495582_0001761
2492 Ga0495582_0004092
2493 Ga0495582_0061944
2494 Ga0495605_0004277
2495 Ga0495605_0035764
2496 Ga0495639_0060951
2497 Ga0495662_0052454
2498 Ga0495662_0254649
2499 Ga0495664_0006958
2500 Ga0495664_0023649
2501 Ga0495584_0016239
2502 Ga0495584_0209786
2503 Ga0495596_0005970
2504 Ga0495596_0016340
2505 Ga0495607_0000050
2506 Ga0495583_0002415
2507 Ga0495583_0008033
2508 Ga0495606_0007560
2509 Ga0495606_0024821
2510 Ga0495606_0036991
2511 Ga0495606_0071412
2512 Ga0495606_0125815
2513 Ga0495608_0002314
2514 Ga0495610_0002465
2515 Ga0495610_0003149
2516 Ga0495610_0060616
2517 Ga0495616_0018272
2518 Ga0495618_0001823
2519 Ga0495618_0103010
2520 Ga0495620_0096060
2521 Ga0495620_0179846
2522 Ga0495628_0004568
2523 Ga0495628_0005314
2524 Ga0495628_0006372
2525 Ga0495628_0012966
2526 Ga0495628_0018672
2527 Ga0495628_0305596
2528 Ga0495628_0349878
2529 Ga0495630_0001913
2530 Ga0495630_0003603
2531 Ga0495630_0006958
2532 Ga0495632_0004456
2533 Ga0495632_0061279
2534 Ga0495643_0041475
2535 Ga0495644_0045171
2536 Ga0495648_0010873
2537 Ga0495648_0042133
2538 Ga0495648_0042947
2539 Ga0495648_0078930
2540 Ga0495648_0084863
2541 Ga0495666_0002016
2542 Ga0495666_0003155
2543 Ga0495666_0023124
2544 Ga0495642_0004085
2545 Ga0495642_0084663
2546 Ga0495642_0090473
2547 Ga0495652_0008857
2548 Ga0495652_0009220
2549 Ga0495652_0010294
2550 Ga0495652_0397695
2551 Ga0495654_0034770
2552 Ga0495654_0115980
2553 Ga0495665_0001549
2554 Ga0495665_0066482
2555 Ga0495665_0104613
2556 Ga0495665_0105652
2557 Ga0495665_0118856
2558 Ga0495640_0002375
2559 Ga0495640_0004512
2560 Ga0495640_0009358
2561 Ga0495586_0002087
2562 Ga0495586_0062368
2563 Ga0495587_0003990
2564 Ga0495587_0004360
2565 Ga0495598_0046683
2566 Ga0495609_0016595
2567 Ga0495621_0005072
2568 Ga0495597_0018012
2569 Ga0495645_0001225
2570 Ga0495645_0005885
2571 Ga0495645_0101479
2572 Ga0495622_0000857
2573 Ga0495622_0033309
2574 Ga0495656_0059706
2575 Ga0495634_0006117
2576 Ga0495634_0007843
2577 Ga0495634_0013419
2578 Ga0495611_0020938
2579 Ga0495611_0120483
2580 Ga0495635_0001779
2581 Ga0495635_0002386
2582 Ga0495635_0031877
2583 Ga0495661_0002135
2584 Ga0495661_0069226
2585 Ga0495661_0071367
2586 Ga0495588_0026374
2587 Ga0495588_0034239
2588 Ga0495588_0051544
2589 Ga0495657_0008521
2590 Ga0495599_0116948
2591 Ga0495623_0008137
2592 Ga0495623_0023790
2593 Ga0495623_0030720
2594 Ga0495623_0208639
2595 Ga0495646_0001089
2596 Ga0495646_0001375
2597 Ga0495646_0004333
2598 Ga0495646_0023517
2599 Ga0495646_0046867
2600 Ga0495646_0304315
2601 Ga0495658_0119253
2602 Ga0495669_0034206
2603 Ga0495669_0076019
2604 Ga0495613_0001858
2605 Ga0495613_0010986
2606 Ga0495613_0311536
2607 Ga0495624_0004250
2608 Ga0495624_0004792
2609 Ga0495624_0037516
2610 Ga0495624_0055474
2611 Ga0495624_0056658
2612 Ga0495624_0076129
2613 Ga0495624_0099605
2614 Ga0495670_0039891
2615 Ga0495671_0030161
2616 Ga0495671_0086362
2617 Ga0495671_0134544
2618 Ga0495649_0007290
2619 Ga0495649_0028113
2620 Ga0495649_0028393
2621 Ga0495649_0037917
2622 Ga0495589_0060208
2623 Ga0495589_0062344
2624 Ga0495589_0072151
2625 Ga0495589_0218701
2626 Ga0495600_0003180
2627 Ga0495600_0010840
2628 Ga0495581_0002302
2629 Ga0495581_0004144
2630 Ga0495581_0011362
2631 Ga0495604_0005809
2632 Ga0495604_0029551
2633 Ga0495604_0032118
2634 Ga0495674_0001972
2635 Ga0495674_0005846
2636 Ga0495674_0005865
2637 Ga0495674_0008585
2638 Ga0495674_0008765
2639 Ga0495674_0022974
2640 Ga0495674_0106052
2641 Ga0495674_0123376
2642 Ga0495674_0176622
2643 Ga0495672_0010779
2644 Ga0495672_0022404
2645 Ga0495672_0028373
2646 Ga0495676_0006779
2647 Ga0495676_0137360
2648 Ga0495676_0302813
2649 Ga0495680_0005149
2650 Ga0495680_0008859
2651 Ga0495680_0028182
2652 Ga0495680_0082991
2653 Ga0495683_0006391
2654 Ga0495683_0007878
2655 Ga0495683_0009176
2656 Ga0495683_0016653
2657 Ga0495683_0036386
2658 Ga0495683_0066351
2659 Ga0495683_0071504
2660 Ga0495687_000032
2661 Ga0495687_010105
2662 Ga0495687_010935
2663 Ga0495687_017689
2664 Ga0495687_049590
2665 Ga0495675_0003900
2666 Ga0495675_0007705
2667 Ga0495679_000279
2668 Ga0495679_001130
2669 Ga0495679_003299
2670 Ga0495685_034443
2671 Ga0495673_0015379
2672 Ga0495673_0106928
2673 Ga0495681_0120541
2674 Ga0495684_0053577
2675 Ga0495686_0000038
2676 Ga0495686_0022202
2677 Ga0495593_0003909
2678 Ga0495593_0005171
2679 Ga0495593_0009786
2680 Ga0495602_0007124
2681 Ga0495602_0013730
2682 Ga0495602_0014618
2683 Ga0495602_0019701
2684 Ga0495602_0022563
2685 Ga0495602_0091457
2686 Ga0495602_0153084
2687 Ga0495614_0000307
2688 Ga0495614_0001094
2689 Ga0495614_0036945
2690 Ga0495626_0021814
2691 Ga0495626_0027024
2692 Ga0495626_0050986
2693 Ga0495626_0114759
2694 Ga0496100_0004031
2695 Ga0496100_0061875
2696 Ga0496100_0085810
2697 Ga0496100_0148996
2698 Ga0496100_0312650
2699 Ga0496100_0495788
2700 Ga0496100_0537027
2701 Ga0496101_0001757
2702 Ga0496101_0003462
2703 Ga0496101_0004695
2704 Ga0496101_0050687
2705 Ga0496101_0051414
2706 Ga0496101_0089629
2707 Ga0496101_0286774
2708 Ga0496102_0003965
2709 Ga0496102_0017818
2710 Ga0496102_0080883
2711 Ga0496102_0188176
2712 Ga0496102_0232853
2713 Ga0496103_0014958
2714 Ga0496103_0018822
2715 Ga0496103_0038439
2716 Ga0496104_0045497
2717 Ga0496104_0183082
2718 Ga0496104_0329705
2719 Ga0496105_0012402
2720 Ga0496105_0050553
2721 Ga0496105_0098671
2722 Ga0496106_0001092
2723 Ga0496106_0014093
2724 Ga0496106_0104455
2725 Ga0496107_0001400
2726 Ga0496107_0014249
2727 Ga0496107_0043769
2728 Ga0496107_0053977
2729 Ga0496108_0040343
2730 Ga0496108_0052401
2731 Ga0496108_0350450
2732 Ga0496109_0057913
2733 Ga0496109_0149376
2734 Ga0496109_0159360
2735 Ga0496109_0353715
2736 Ga0496110_0087056
2737 Ga0496110_0107726
2738 Ga0496110_0150887
2739 Ga0496110_0214771
2740 Ga0496110_0228106
2741 Ga0496110_0277938
2742 Ga0496110_0648820
2743 Ga0496111_0035208
2744 Ga0496112_0113251
2745 Ga0496112_0186716
2746 Ga0496112_0287232
2747 Ga0496113_0064812
2748 Ga0496113_0072871
2749 Ga0496114_0004222
2750 Ga0496114_0033859
2751 Ga0496114_0035850
2752 Ga0496114_0127227
2753 Ga0496115_0067520
2754 Ga0496115_0266786
2755 Ga0496115_0402834
2756 Ga0496116_0014648
2757 Ga0496116_0022566
2758 Ga0496117_0004682
2759 Ga0496117_0006694
2760 Ga0496117_0008860
2761 Ga0496117_0018778
2762 Ga0496117_0019891
2763 Ga0496117_0027849
2764 Ga0496117_0035760
2765 Ga0496117_0130823
2766 Ga0496118_0004448
2767 Ga0496118_0005388
2768 Ga0496118_0006094
2769 Ga0496118_0010308
2770 Ga0496118_0014361
2771 Ga0496118_0028282
2772 Ga0496118_0139628
2773 Ga0496121_0002998
2774 Ga0496121_0007189
2775 Ga0496121_0010687
2776 Ga0496121_0013332
2777 Ga0496121_0019186
2778 Ga0496121_0021945
2779 Ga0496121_0027253
2780 Ga0496121_0038159
2781 Ga0496121_0052696
2782 Ga0496121_0093376
2783 Ga0496122_0019409
2784 Ga0496122_0131377
2785 Ga0496123_0026576
2786 Ga0496123_0056274
2787 Ga0496123_0164844
2788 Ga0496124_0000458
2789 Ga0496124_0005813
2790 Ga0496124_0027218
2791 Ga0496124_0082258
2792 Ga0496124_0127321
2793 Ga0496124_0150365
2794 Ga0496125_0005139
2795 Ga0496125_0006414
2796 Ga0496125_0013614
2797 Ga0496125_0023944
2798 Ga0496125_0027268
2799 Ga0496125_0030022
2800 Ga0496126_0000838
2801 Ga0496126_0000974
2802 Ga0496126_0008991
2803 Ga0496126_0010460
2804 Ga0496126_0037192
2805 Ga0496126_0285761
2806 Ga0496126_0295883
2807 Ga0501309_002043
2808 Ga0495678_007729
2809 Ga0495682_0011763
2810 Ga0501034_0003350
2811 Ga0501047_0353576
2812 Ga0501233_044805
2813 Ga0501249_016855
2814 Ga0501255_006249
2815 Ga0501262_000096
2816 Ga0501262_003511
2817 Ga0501035_0187553
2818 nmdc:mga03683_14981_c1
2819 nmdc:mga03683_2962_c1
2820 nmdc:mga03683_34916_c1
2821 nmdc:mga03683_52868_c1
2822 nmdc:mga03683_8241_c1
2823 nmdc:mga03683_91819_c1
2824 nmdc:mga03n38_104917_c1
2825 nmdc:mga03n38_15237_c1
2826 nmdc:mga03n38_18183_c1
2827 nmdc:mga03n38_53922_c1
2828 nmdc:mga03n38_80240_c1
2829 nmdc:mga00v17_13382_c1
2830 nmdc:mga00v17_135903_c1
2831 nmdc:mga0yw44_17520_c1
2832 nmdc:mga0yw44_41696_c1
2833 nmdc:mga0k408_103917_c1
2834 nmdc:mga0k408_1168_c1
2835 nmdc:mga0k408_122978_c1
2836 nmdc:mga0k408_143735_c1
2837 nmdc:mga0k408_15220_c1
2838 nmdc:mga0k408_15729_c1
2839 nmdc:mga0k408_1809_c1
2840 nmdc:mga0k408_188735_c1
2841 nmdc:mga0k408_18966_c1
2842 nmdc:mga0k408_20633_c1
2843 nmdc:mga0k408_2385_c2
2844 nmdc:mga0k408_378632_c1
2845 nmdc:mga0k408_61134_c1
2846 nmdc:mga0k408_7723_c1
2847 nmdc:mga0k408_95672_c1
2848 nmdc:mga06z11_19574_c1
2849 nmdc:mga06z11_203882_c1
2850 nmdc:mga06z11_205679_c1
2851 nmdc:mga06z11_55242_c1
2852 nmdc:mga06z11_75675_c1
2853 nmdc:mga04h51_1437_c1
2854 nmdc:mga04h51_36182_c1
2855 nmdc:mga07m45_12161_c1
2856 nmdc:mga07m45_122156_c1
2857 nmdc:mga07m45_1257_c1
2858 nmdc:mga07m45_156641_c1
2859 nmdc:mga07m45_17278_c1
2860 nmdc:mga07m45_210875_c1
2861 nmdc:mga07m45_24913_c1
2862 nmdc:mga07m45_44355_c1
2863 nmdc:mga07m45_84416_c1
2864 nmdc:mga09592_3416_c1
2865 nmdc:mga0qj67_109537_c1
2866 nmdc:mga08y16_174723_c1
2867 nmdc:mga0n895_846091_c1
2868 Ga0495612_0140283
2869 Ga0500578_0001060
2870 Ga0500644_0000720
2871 Ga0500583_0231931
2872 Ga0500651_0011159
2873 Ga0500651_0156326
2874 Ga0500641_0192776
2875 Ga0500650_0091278
2876 Ga0500650_0110429
2877 Ga0500569_008563
2878 Ga0500593_003259
2879 Ga0500618_002350
2880 Ga0500628_002616
2881 Ga0500652_000299
2882 Ga0500658_0001952
2883 Ga0500604_0028499
2884 Ga0500619_000127
2885 Ga0500622_0000125
2886 Ga0500622_0001196
2887 Ga0500634_0100654
2888 Ga0500645_001282
2889 Ga0500645_030801
2890 Ga0500656_013156
2891 Ga0500661_003454
2892 Ga0587084_008578
2893 Ga0587106_010391
2894 Ga0587067_007300
2895 Ga0587072_000013
2896 Ga0587076_003718
2897 Ga0466962_0001957
2898 Ga0466962_0034264
2899 2501070125
2900 2501081562
2901 2501407897
2902 2509131115
2903 2510252403
2904 2511085503
2905 2511095644
2906 2511103614
2907 2511244616
2908 2512344672
2909 2513557011
2910 2513564543
2911 2513954221
2912 2513962979
2913 2514042963
2914 2514046123
2915 2515682456
2916 2515692353
2917 2516023722
2918 2519457721
2919 2527080093
2920 2563061693
2921 2585294588
2922 2587725336
2923 2587731305
2924 2597031725
2925 2599446420
2926 2599736845
2927 2599743035
2928 2600205153
2929 2600813753
2930 2643743068
2931 2643932907
2932 2643972781
2933 2644143372
2934 2644218515
2935 2644260410
2936 2644276191
2937 2644301266
2938 2644314157
2939 2676742143
2940 2713478436
2941 2719641494
2942 2738824398
2943 2738836807
2944 2738878338
2945 2739055929
2946 2739190030
2947 2739224931
2948 2739250030
2949 2746088912
2950 2746096462
2951 2753569637
2952 2792835793
2953 2808971741
2954 2809006570
2955 2809013512
2956 2817259911
2957 2817277573
2958 2817457014
2959 2819623489
2960 2819632345
2961 2831864645
2962 2834642951
2963 2842324533
2964 2842348812
2965 2842457482
2966 2856290905
2967 2857363651
2968 2857577870
2969 2858693330
2970 2863421390
2971 2870069184
2972 2883095360
2973 2885270218
2974 2885279698
2975 2886852215
2976 2900581833
2977 2900637248
2978 2902691277
2979 2904438504
2980 2904487918
2981 2904545151
2982 2904571416
2983 2904578509
2984 2904619042
2985 2919529223
2986 2919707121
2987 2921646699
2988 2928061485
2989 2928113634
2990 2928140653
2991 2928160021
2992 2928163938
2993 2928177207
2994 2928506231
2995 2928538863
2996 2929165329
2997 2945938199
2998 2981994463
2999 2990705084
3000 642426138
3001 642419748
3002 642594449
3003 642623030
3004 644749030
3005 8003400904
3006 8003961008
3007 8018849479
3008 8020809973
3009 8020939476
3010 8020952076
3011 8020953943
3012 8021126914
3013 8039099803
3014 8040170833
3015 8040175254
3016 8055267504
3017 8055308167

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07072

ZapD

Cell division protein

65

275

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5koa-assembly1.cif.gz_B structure of escherichia coli zapd bound to the c-terminal tail of ftsz 0.9097 2 250
2oez-assembly1.cif.gz_A protein of unknown function (duf1342) from vibrio parahaemolyticus 0.9046 2 250
2oez-assembly1.cif.gz_B protein of unknown function (duf1342) from vibrio parahaemolyticus 0.8965 2 250
5dko-assembly1.cif.gz_A-2 the structure of escherichia coli zapd 0.896 2 250
5koa-assembly1.cif.gz_B structure of escherichia coli zapd bound to the c-terminal tail of ftsz 0.8959 2 250
ID Description Score Start End Superfamily
2oezA02 Mainly Alpha;Orthogonal Bundle;YacF-like;YacF-like 0.9155 10 175 1.10.3900.10
2oezA02 Mainly Alpha;Orthogonal Bundle;YacF-like;YacF-like 0.8994 10 175 1.10.3900.10
af_P36680_13_175_1.10.3900.10 Mainly Alpha;Orthogonal Bundle;YacF-like;YacF-like 0.8867 10 172 1.10.3900.10
5imjB02 Mainly Alpha;Orthogonal Bundle;YacF-like;YacF-like 0.8825 10 176 1.10.3900.10
af_P36680_13_175_1.10.3900.10 Mainly Alpha;Orthogonal Bundle;YacF-like;YacF-like 0.8766 10 172 1.10.3900.10
ID Description Score Start End GO Terms
AF-A0A494GA06-F1-model_v4 Dephospho-CoA kinase 0.9828 1 252 GO:0004140
GO:0005524
GO:0005737
GO:0015937
GO:0051301
AF-A0A7T5CDE0-F1-model_v4 Cell division protein ZapD (Z ring-associated protein D) 0.9819 1 252 GO:0000917
GO:0005737
GO:0032153
GO:0043093
AF-A0A4Q7S5X8-F1-model_v4 Cell division protein ZapD (Z ring-associated protein D) 0.9819 1 252 GO:0000917
GO:0005737
GO:0032153
GO:0043093
AF-A0A2W5Q309-F1-model_v4 Cell division protein ZapD 0.9801 1 92 GO:0032153
GO:0043093
AF-W7WA72-F1-model_v4 Z ring-associated protein D 0.9792 1 164 GO:0032153
GO:0043093

Map