F494451
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1508 | 721 | 3016 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300006881|Ga0068865_100270148|Ga0068865_1002701481 |
| Length | 250 |
| Sequence | MALSEQTLPLPSVTPPAGENFRADYRLVAEMVESGSRVLDVGCGDGDLLQLLETRGIDGRGIELSREGVNRCVAKGLAVVQGDADTDLVNYPDDAFDYVILSQTLQATRQPRAVLENLLRIGHRAIVSFPNFGFWKMRLQLLIGGHMPRTENLPATWYDTPNIHFCTIKDFVQLCDEINVKMERAVALDLYGRAVPLNLPWWVWNMFGEQGVFLLSRGGRGKLCLRASFRDGPKGPDPESRDSTMCNCTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 87 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 88 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 89 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 121 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 122 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 123 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 201 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 202 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 203 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 212 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 214 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 220 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 224 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 225 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 226 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 229 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 231 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 232 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 233 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 234 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 235 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 236 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 237 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 238 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 239 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 240 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 243 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 248 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 249 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 252 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 254 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 255 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 256 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 259 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 260 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 261 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 262 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 263 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 264 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 265 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 266 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 267 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 268 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 269 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 271 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 272 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 273 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 274 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 275 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 276 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 277 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 278 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 279 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 280 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 281 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 282 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 283 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 284 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 285 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 286 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 287 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 288 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 289 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 372 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 373 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 374 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 375 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 376 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 377 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 380 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 381 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 382 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 383 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 384 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 385 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 386 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 387 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 388 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 389 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 390 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 391 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 392 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 393 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 394 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 395 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 396 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 428 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 429 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 430 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 431 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 432 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 433 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 434 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 435 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 440 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 443 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 447 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 448 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 449 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 450 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 451 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 452 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 453 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 454 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 455 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 456 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 457 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 458 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 459 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 460 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 461 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 462 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 463 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 464 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 465 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 466 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 467 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 468 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 469 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 470 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 471 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 472 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 473 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 474 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 475 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 476 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 477 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 478 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 479 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 480 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 481 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 482 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 483 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 484 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 485 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 486 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 487 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 488 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 489 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 490 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 491 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 492 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 493 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 494 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 495 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 496 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 497 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 498 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 499 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 500 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 501 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 502 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 503 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 504 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 505 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 506 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 507 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 508 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 509 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 510 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 511 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 512 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 513 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 514 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 515 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 516 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 517 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 518 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 519 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 520 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 521 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 522 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 523 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 524 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 525 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 526 | 2791355199 | |||
| 527 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 528 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 529 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 530 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 531 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 532 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 533 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 534 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 535 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 536 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 537 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 538 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 539 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 540 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 541 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 542 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 543 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 544 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 545 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 546 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 547 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 548 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 549 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 550 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 551 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 552 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 553 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 554 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 555 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 556 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 557 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 558 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 559 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 560 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 561 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 562 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 563 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 564 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 565 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 566 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 567 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 568 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 569 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 570 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 571 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 572 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 573 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 574 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 575 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 576 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 577 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 578 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 579 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 580 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 581 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 582 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 583 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 584 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 585 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 586 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 587 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 588 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 589 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 590 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 591 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 592 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 593 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 594 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 595 | 2904699407 | |||
| 596 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 597 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 598 | 2906610324 | |||
| 599 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 600 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 601 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 602 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 603 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 604 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 605 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 606 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 607 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 608 | 2922368715 | |||
| 609 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 610 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 611 | 2922425934 | |||
| 612 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 613 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 614 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 615 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 616 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 617 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 618 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 619 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 620 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 621 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 622 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 623 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 624 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 625 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 626 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 627 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 628 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 629 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 630 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 631 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 632 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 633 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 634 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 635 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 636 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 637 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 638 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 639 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 640 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 641 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 642 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 643 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 644 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 645 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 646 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 647 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 648 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 649 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 650 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 651 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 652 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 653 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 654 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 655 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 656 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 657 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 658 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 659 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 660 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 661 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 662 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 663 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 664 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 665 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 666 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 667 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 668 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 669 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 670 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 671 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 672 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 673 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 674 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 675 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 676 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 677 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 678 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 679 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 680 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 681 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 682 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 683 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 684 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 685 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 686 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 687 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 688 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 689 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 690 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 691 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 692 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 693 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 694 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 695 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 696 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 697 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 698 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 699 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 700 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 701 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 702 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 703 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 704 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 705 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 706 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 707 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 708 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 709 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 710 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 711 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 712 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 713 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 714 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 715 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 716 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 717 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 718 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 719 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 720 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 721 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.9 |
| Metatranscriptomes | 0.07 |
| Isolates | 15.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.27 |
| Nodule | 12.14 |
| Rhizoplane | 6.3 |
| Rhizosphere | 59.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068865_100270148 | 3300006881 | Bacteria | 1350 |
| 2 | JGI24740J21852_10034575 | 3300001979 | Bacteria | 1591 |
| 3 | JGI24739J22299_10059577 | 3300001989 | Bacteria | 1209 |
| 4 | JGI24737J22298_10039047 | 3300001990 | Bacteria | 1460 |
| 5 | JGI24735J21928_10063092 | 3300002067 | Bacteria | 1064 |
| 6 | JGI24034J26672_10030416 | 3300002239 | Bacteria | 877 |
| 7 | JGI24742J22300_10030193 | 3300002244 | Bacteria | 945 |
| 8 | JGI25406J46586_10000081 | 3300003203 | Bacteria | 43450 |
| 9 | JGI25406J46586_10012034 | 3300003203 | Bacteria | 3770 |
| 10 | JGI25165J46597_1018010 | 3300003214 | Bacteria | 937 |
| 11 | JGI25153J46596_10004550 | 3300003215 | Bacteria | 7447 |
| 12 | JGI25153J46596_10025326 | 3300003215 | Bacteria | 2122 |
| 13 | JGI25153J46596_10043473 | 3300003215 | Bacteria | 1360 |
| 14 | JGI25160J50197_1000829 | 3300003354 | Bacteria | 16517 |
| 15 | JGI25160J50197_1001208 | 3300003354 | Bacteria | 13129 |
| 16 | JGI25404J52841_10007604 | 3300003659 | Bacteria | 2295 |
| 17 | Ga0055526_1052591 | 3300003771 | Bacteria | 918 |
| 18 | Ga0055531_10002243 | 3300003794 | Bacteria | 13087 |
| 19 | Ga0065165_1000370 | 3300005262 | Bacteria | 73604 |
| 20 | Ga0065165_1003163 | 3300005262 | Bacteria | 12086 |
| 21 | Ga0065165_1007682 | 3300005262 | Bacteria | 5231 |
| 22 | Ga0070658_10017799 | 3300005327 | Bacteria | 5682 |
| 23 | Ga0070658_10092636 | 3300005327 | Bacteria | 2491 |
| 24 | Ga0070658_10269959 | 3300005327 | Bacteria | 1446 |
| 25 | Ga0070658_10705812 | 3300005327 | Bacteria | 876 |
| 26 | Ga0070690_100481109 | 3300005330 | Bacteria | 926 |
| 27 | Ga0068869_100092594 | 3300005334 | Bacteria | 2275 |
| 28 | Ga0068869_100213252 | 3300005334 | Bacteria | 1527 |
| 29 | Ga0070680_100064863 | 3300005336 | Bacteria | 2993 |
| 30 | Ga0070680_100147579 | 3300005336 | Bacteria | 1974 |
| 31 | Ga0070680_100505061 | 3300005336 | Bacteria | 1035 |
| 32 | Ga0070682_100211858 | 3300005337 | Bacteria | 1373 |
| 33 | Ga0068868_100045614 | 3300005338 | Bacteria | 3429 |
| 34 | Ga0068868_100340219 | 3300005338 | Bacteria | 1283 |
| 35 | Ga0070660_100005164 | 3300005339 | Bacteria | 9027 |
| 36 | Ga0070660_100285260 | 3300005339 | Bacteria | 1351 |
| 37 | Ga0070660_100303267 | 3300005339 | Bacteria | 1310 |
| 38 | Ga0070691_10189163 | 3300005341 | Bacteria | 1076 |
| 39 | Ga0070661_100009758 | 3300005344 | Bacteria | 6657 |
| 40 | Ga0070661_100508579 | 3300005344 | Bacteria | 965 |
| 41 | Ga0070668_100102225 | 3300005347 | Bacteria | 2272 |
| 42 | Ga0070668_100118511 | 3300005347 | Bacteria | 2113 |
| 43 | Ga0070668_100498830 | 3300005347 | Bacteria | 1053 |
| 44 | Ga0070668_100593019 | 3300005347 | Bacteria | 968 |
| 45 | Ga0070668_100619190 | 3300005347 | Bacteria | 948 |
| 46 | Ga0070669_100112414 | 3300005353 | Bacteria | 2068 |
| 47 | Ga0070669_100363384 | 3300005353 | Bacteria | 1177 |
| 48 | Ga0070671_100146173 | 3300005355 | Bacteria | 1995 |
| 49 | Ga0070671_100162483 | 3300005355 | Bacteria | 1888 |
| 50 | Ga0070671_100382112 | 3300005355 | Bacteria | 1204 |
| 51 | Ga0070674_100036979 | 3300005356 | Bacteria | 3281 |
| 52 | Ga0070674_100325033 | 3300005356 | Bacteria | 1234 |
| 53 | Ga0070688_100603015 | 3300005365 | Bacteria | 841 |
| 54 | Ga0070667_100470660 | 3300005367 | Bacteria | 1150 |
| 55 | Ga0070667_100598551 | 3300005367 | Bacteria | 1016 |
| 56 | Ga0070709_10000683 | 3300005434 | Bacteria | 19271 |
| 57 | Ga0070709_10007897 | 3300005434 | Bacteria | 5843 |
| 58 | Ga0070709_10077703 | 3300005434 | Bacteria | 2158 |
| 59 | Ga0070709_10080184 | 3300005434 | Bacteria | 2128 |
| 60 | Ga0070714_100028423 | 3300005435 | Bacteria | 4639 |
| 61 | Ga0070714_100044019 | 3300005435 | Bacteria | 3778 |
| 62 | Ga0070714_100124798 | 3300005435 | Bacteria | 2294 |
| 63 | Ga0070714_100174433 | 3300005435 | Bacteria | 1953 |
| 64 | Ga0070714_100475181 | 3300005435 | Bacteria | 1190 |
| 65 | Ga0070714_100639602 | 3300005435 | Bacteria | 1023 |
| 66 | Ga0070713_100007562 | 3300005436 | Bacteria | 7638 |
| 67 | Ga0070713_100028530 | 3300005436 | Bacteria | 4407 |
| 68 | Ga0070713_100121742 | 3300005436 | Bacteria | 2289 |
| 69 | Ga0070713_100681411 | 3300005436 | Bacteria | 981 |
| 70 | Ga0070710_10007651 | 3300005437 | Bacteria | 5238 |
| 71 | Ga0070710_10012117 | 3300005437 | Bacteria | 4274 |
| 72 | Ga0070711_100016292 | 3300005439 | Bacteria | 4718 |
| 73 | Ga0070711_100024517 | 3300005439 | Bacteria | 3935 |
| 74 | Ga0070711_100041462 | 3300005439 | Bacteria | 3109 |
| 75 | Ga0070711_100366261 | 3300005439 | Bacteria | 1162 |
| 76 | Ga0070700_100121553 | 3300005441 | Bacteria | 1750 |
| 77 | Ga0070708_100354922 | 3300005445 | Bacteria | 1382 |
| 78 | Ga0070663_100011265 | 3300005455 | Bacteria | 5606 |
| 79 | Ga0070663_100011993 | 3300005455 | Bacteria | 5469 |
| 80 | Ga0070663_100061990 | 3300005455 | Bacteria | 2694 |
| 81 | Ga0070663_100062509 | 3300005455 | Bacteria | 2684 |
| 82 | Ga0070663_100127319 | 3300005455 | Bacteria | 1931 |
| 83 | Ga0070663_100145532 | 3300005455 | Bacteria | 1813 |
| 84 | Ga0070663_100225717 | 3300005455 | Bacteria | 1472 |
| 85 | Ga0070663_100233703 | 3300005455 | Bacteria | 1449 |
| 86 | Ga0070663_100368656 | 3300005455 | Bacteria | 1167 |
| 87 | Ga0070663_100377028 | 3300005455 | Bacteria | 1154 |
| 88 | Ga0070678_100089774 | 3300005456 | Bacteria | 2353 |
| 89 | Ga0070678_100105754 | 3300005456 | Bacteria | 2191 |
| 90 | Ga0070678_100335349 | 3300005456 | Bacteria | 1295 |
| 91 | Ga0070678_100430805 | 3300005456 | Bacteria | 1151 |
| 92 | Ga0070662_100030852 | 3300005457 | Bacteria | 3755 |
| 93 | Ga0070662_100110957 | 3300005457 | Bacteria | 2089 |
| 94 | Ga0070662_100118180 | 3300005457 | Bacteria | 2029 |
| 95 | Ga0070662_100420789 | 3300005457 | Bacteria | 1105 |
| 96 | Ga0070681_10007799 | 3300005458 | Bacteria | 10468 |
| 97 | Ga0070681_10093506 | 3300005458 | Bacteria | 2955 |
| 98 | Ga0068867_100262542 | 3300005459 | Bacteria | 1408 |
| 99 | Ga0068867_100617273 | 3300005459 | Bacteria | 948 |
| 100 | Ga0070707_100314508 | 3300005468 | Bacteria | 1522 |
| 101 | Ga0070698_100210588 | 3300005471 | Bacteria | 1879 |
| 102 | Ga0070679_100015888 | 3300005530 | Bacteria | 7245 |
| 103 | Ga0070679_100038175 | 3300005530 | Bacteria | 4773 |
| 104 | Ga0070679_100222276 | 3300005530 | Bacteria | 1849 |
| 105 | Ga0070679_100531808 | 3300005530 | Bacteria | 1119 |
| 106 | Ga0070684_100070098 | 3300005535 | Bacteria | 3084 |
| 107 | Ga0068853_100001993 | 3300005539 | Bacteria | 15074 |
| 108 | Ga0068853_100059849 | 3300005539 | Bacteria | 3290 |
| 109 | Ga0068853_100387598 | 3300005539 | Bacteria | 1306 |
| 110 | Ga0068853_100424306 | 3300005539 | Bacteria | 1247 |
| 111 | Ga0070686_100034196 | 3300005544 | Bacteria | 3130 |
| 112 | Ga0070665_100011107 | 3300005548 | Bacteria | 9099 |
| 113 | Ga0070665_100099117 | 3300005548 | Bacteria | 2918 |
| 114 | Ga0070665_100162314 | 3300005548 | Bacteria | 2236 |
| 115 | Ga0070665_100288534 | 3300005548 | Bacteria | 1643 |
| 116 | Ga0070665_100624496 | 3300005548 | Bacteria | 1091 |
| 117 | Ga0070665_101187924 | 3300005548 | Bacteria | 774 |
| 118 | Ga0068855_100008845 | 3300005563 | Bacteria | 12172 |
| 119 | Ga0068855_100021063 | 3300005563 | Bacteria | 7817 |
| 120 | Ga0068855_100049395 | 3300005563 | Bacteria | 4962 |
| 121 | Ga0068855_100117367 | 3300005563 | Bacteria | 3049 |
| 122 | Ga0068855_100212536 | 3300005563 | Bacteria | 2173 |
| 123 | Ga0068855_100297006 | 3300005563 | Bacteria | 1789 |
| 124 | Ga0068855_100326778 | 3300005563 | Bacteria | 1694 |
| 125 | Ga0070664_100574431 | 3300005564 | Bacteria | 1044 |
| 126 | Ga0070664_100946260 | 3300005564 | Bacteria | 809 |
| 127 | Ga0068857_100019981 | 3300005577 | Bacteria | 5887 |
| 128 | Ga0068857_100024793 | 3300005577 | Bacteria | 5283 |
| 129 | Ga0068857_100026031 | 3300005577 | Bacteria | 5153 |
| 130 | Ga0068857_100053517 | 3300005577 | Bacteria | 3581 |
| 131 | Ga0068857_100497738 | 3300005577 | Bacteria | 1143 |
| 132 | Ga0068857_100575564 | 3300005577 | Bacteria | 1063 |
| 133 | Ga0068854_100055722 | 3300005578 | Bacteria | 2847 |
| 134 | Ga0068854_100357069 | 3300005578 | Bacteria | 1198 |
| 135 | Ga0068854_100518108 | 3300005578 | Bacteria | 1007 |
| 136 | Ga0068854_100897929 | 3300005578 | Bacteria | 779 |
| 137 | Ga0068856_100000226 | 3300005614 | Bacteria | 61246 |
| 138 | Ga0068856_100013591 | 3300005614 | Bacteria | 7879 |
| 139 | Ga0068856_100173656 | 3300005614 | Bacteria | 2167 |
| 140 | Ga0068856_100336826 | 3300005614 | Bacteria | 1527 |
| 141 | Ga0068856_100565188 | 3300005614 | Bacteria | 1159 |
| 142 | Ga0068852_100043038 | 3300005616 | Bacteria | 3827 |
| 143 | Ga0068852_100065894 | 3300005616 | Bacteria | 3161 |
| 144 | Ga0068852_100107874 | 3300005616 | Bacteria | 2527 |
| 145 | Ga0068852_100236571 | 3300005616 | Bacteria | 1743 |
| 146 | Ga0068852_100273425 | 3300005616 | Bacteria | 1626 |
| 147 | Ga0068852_100404973 | 3300005616 | Bacteria | 1343 |
| 148 | Ga0068859_100534282 | 3300005617 | Bacteria | 1267 |
| 149 | Ga0068859_100682342 | 3300005617 | Bacteria | 1118 |
| 150 | Ga0068864_100128362 | 3300005618 | Bacteria | 2274 |
| 151 | Ga0068864_100193657 | 3300005618 | Bacteria | 1864 |
| 152 | Ga0068866_10246142 | 3300005718 | Bacteria | 1091 |
| 153 | Ga0068861_100044595 | 3300005719 | Bacteria | 3335 |
| 154 | Ga0068861_100206411 | 3300005719 | Bacteria | 1652 |
| 155 | Ga0068861_100550303 | 3300005719 | Bacteria | 1051 |
| 156 | Ga0068851_10016208 | 3300005834 | Bacteria | 3564 |
| 157 | Ga0068851_10053452 | 3300005834 | Bacteria | 2056 |
| 158 | Ga0068863_100066570 | 3300005841 | Bacteria | 3407 |
| 159 | Ga0068863_100226973 | 3300005841 | Bacteria | 1800 |
| 160 | Ga0068858_100171027 | 3300005842 | Bacteria | 2049 |
| 161 | Ga0068858_100176774 | 3300005842 | Bacteria | 2014 |
| 162 | Ga0068860_100244034 | 3300005843 | Bacteria | 1747 |
| 163 | Ga0068860_100452704 | 3300005843 | Bacteria | 1276 |
| 164 | Ga0068860_100999042 | 3300005843 | Bacteria | 854 |
| 165 | Ga0068862_100069837 | 3300005844 | Bacteria | 3032 |
| 166 | Ga0068862_100189575 | 3300005844 | Bacteria | 1849 |
| 167 | Ga0068862_100226244 | 3300005844 | Bacteria | 1695 |
| 168 | Ga0068862_100331902 | 3300005844 | Bacteria | 1406 |
| 169 | Ga0081455_10004766 | 3300005937 | Bacteria | 15067 |
| 170 | Ga0081455_10020570 | 3300005937 | Bacteria | 6210 |
| 171 | Ga0081455_10142581 | 3300005937 | Bacteria | 1859 |
| 172 | Ga0081538_10026047 | 3300005981 | Bacteria | 4103 |
| 173 | Ga0081540_1002522 | 3300005983 | Bacteria | 14869 |
| 174 | Ga0081540_1002586 | 3300005983 | Bacteria | 14696 |
| 175 | Ga0081540_1004666 | 3300005983 | Bacteria | 10370 |
| 176 | Ga0081540_1004860 | 3300005983 | Bacteria | 10126 |
| 177 | Ga0081540_1008255 | 3300005983 | Bacteria | 7295 |
| 178 | Ga0081540_1013787 | 3300005983 | Bacteria | 5233 |
| 179 | Ga0081540_1033364 | 3300005983 | Bacteria | 2797 |
| 180 | Ga0081540_1048561 | 3300005983 | Bacteria | 2125 |
| 181 | Ga0081540_1054280 | 3300005983 | Bacteria | 1960 |
| 182 | Ga0081540_1059367 | 3300005983 | Bacteria | 1837 |
| 183 | Ga0081539_10000461 | 3300005985 | Bacteria | 86158 |
| 184 | Ga0081539_10002797 | 3300005985 | Bacteria | 23391 |
| 185 | Ga0081539_10201860 | 3300005985 | Bacteria | 918 |
| 186 | Ga0070717_10001762 | 3300006028 | Bacteria | 15078 |
| 187 | Ga0070717_10002235 | 3300006028 | Bacteria | 13568 |
| 188 | Ga0070717_10226510 | 3300006028 | Bacteria | 1645 |
| 189 | Ga0070717_10332399 | 3300006028 | Bacteria | 1356 |
| 190 | Ga0070717_10440277 | 3300006028 | Bacteria | 1174 |
| 191 | Ga0075365_10047628 | 3300006038 | Bacteria | 2818 |
| 192 | Ga0075365_10057556 | 3300006038 | Bacteria | 2586 |
| 193 | Ga0075365_10145411 | 3300006038 | Bacteria | 1647 |
| 194 | Ga0075365_10169893 | 3300006038 | Bacteria | 1522 |
| 195 | Ga0075365_10174248 | 3300006038 | Bacteria | 1502 |
| 196 | Ga0075368_10058421 | 3300006042 | Bacteria | 1541 |
| 197 | Ga0075363_100089300 | 3300006048 | Bacteria | 1694 |
| 198 | Ga0075364_10024726 | 3300006051 | Bacteria | 3816 |
| 199 | Ga0075364_10035699 | 3300006051 | Bacteria | 3213 |
| 200 | Ga0075364_10090415 | 3300006051 | Bacteria | 2031 |
| 201 | Ga0075364_10176114 | 3300006051 | Bacteria | 1446 |
| 202 | Ga0075364_10332650 | 3300006051 | Bacteria | 1035 |
| 203 | Ga0075432_10153259 | 3300006058 | Bacteria | 887 |
| 204 | Ga0070716_100006994 | 3300006173 | Bacteria | 5533 |
| 205 | Ga0070716_100368526 | 3300006173 | Bacteria | 1022 |
| 206 | Ga0070716_100504939 | 3300006173 | Bacteria | 893 |
| 207 | Ga0070712_100028123 | 3300006175 | Bacteria | 3758 |
| 208 | Ga0070712_100037712 | 3300006175 | Bacteria | 3297 |
| 209 | Ga0070712_100112710 | 3300006175 | Bacteria | 2032 |
| 210 | Ga0070712_100334596 | 3300006175 | Bacteria | 1235 |
| 211 | Ga0070712_100413973 | 3300006175 | Bacteria | 1116 |
| 212 | Ga0075362_10142285 | 3300006177 | Bacteria | 1147 |
| 213 | Ga0075367_10050515 | 3300006178 | Bacteria | 2455 |
| 214 | Ga0075367_10114566 | 3300006178 | Bacteria | 1657 |
| 215 | Ga0075367_10240800 | 3300006178 | Bacteria | 1134 |
| 216 | Ga0075367_10290495 | 3300006178 | Bacteria | 1028 |
| 217 | Ga0075367_10292677 | 3300006178 | Bacteria | 1024 |
| 218 | Ga0075367_10328898 | 3300006178 | Bacteria | 963 |
| 219 | Ga0075369_10021181 | 3300006186 | Bacteria | 2668 |
| 220 | Ga0075369_10033402 | 3300006186 | Bacteria | 2180 |
| 221 | Ga0075369_10077695 | 3300006186 | Bacteria | 1468 |
| 222 | Ga0075369_10143784 | 3300006186 | Bacteria | 1088 |
| 223 | Ga0097621_100275598 | 3300006237 | Bacteria | 1479 |
| 224 | Ga0075370_10045185 | 3300006353 | Bacteria | 2491 |
| 225 | Ga0075370_10246806 | 3300006353 | Bacteria | 1058 |
| 226 | Ga0075370_10271456 | 3300006353 | Bacteria | 1007 |
| 227 | Ga0068871_100083760 | 3300006358 | Bacteria | 2645 |
| 228 | Ga0068871_100290074 | 3300006358 | Bacteria | 1433 |
| 229 | Ga0068871_100490232 | 3300006358 | Bacteria | 1106 |
| 230 | Ga0075428_100185896 | 3300006844 | Bacteria | 2248 |
| 231 | Ga0075429_100435594 | 3300006880 | Bacteria | 1149 |
| 232 | Ga0068865_100542538 | 3300006881 | Bacteria | 975 |
| 233 | Ga0097620_100534263 | 3300006931 | Bacteria | 1267 |
| 234 | Ga0097620_100682326 | 3300006931 | Bacteria | 1118 |
| 235 | Ga0099825_1036925 | 3300006941 | Bacteria | 1649 |
| 236 | Ga0099824_1007227 | 3300006942 | Bacteria | 14828 |
| 237 | Ga0099824_1017577 | 3300006942 | Bacteria | 6146 |
| 238 | Ga0099822_1005717 | 3300006943 | Bacteria | 16238 |
| 239 | Ga0099823_1008742 | 3300006944 | Bacteria | 10292 |
| 240 | Ga0075435_100006891 | 3300007076 | Bacteria | 8064 |
| 241 | Ga0099794_10042881 | 3300007265 | Bacteria | 2158 |
| 242 | Ga0099795_10001991 | 3300007788 | Bacteria | 4660 |
| 243 | Ga0105250_10226993 | 3300009092 | Bacteria | 793 |
| 244 | Ga0105240_10013959 | 3300009093 | Bacteria | 10997 |
| 245 | Ga0105240_10014054 | 3300009093 | Bacteria | 10948 |
| 246 | Ga0105240_10040849 | 3300009093 | Bacteria | 5927 |
| 247 | Ga0105240_10050894 | 3300009093 | Bacteria | 5217 |
| 248 | Ga0105240_10056236 | 3300009093 | Bacteria | 4924 |
| 249 | Ga0105240_10547935 | 3300009093 | Bacteria | 1280 |
| 250 | Ga0105240_10632355 | 3300009093 | Bacteria | 1175 |
| 251 | Ga0111539_10043707 | 3300009094 | Bacteria | 5370 |
| 252 | Ga0105245_10023421 | 3300009098 | Bacteria | 5420 |
| 253 | Ga0105245_10758021 | 3300009098 | Bacteria | 1007 |
| 254 | Ga0105247_10009405 | 3300009101 | Bacteria | 5931 |
| 255 | Ga0105247_10058758 | 3300009101 | Bacteria | 2380 |
| 256 | Ga0105247_10105147 | 3300009101 | Bacteria | 1809 |
| 257 | Ga0105247_10161683 | 3300009101 | Bacteria | 1483 |
| 258 | Ga0105247_10257845 | 3300009101 | Bacteria | 1194 |
| 259 | Ga0105247_10470997 | 3300009101 | Bacteria | 910 |
| 260 | Ga0114129_10550389 | 3300009147 | Bacteria | 1500 |
| 261 | Ga0105243_10087129 | 3300009148 | Bacteria | 2562 |
| 262 | Ga0105243_10374055 | 3300009148 | Bacteria | 1315 |
| 263 | Ga0105243_10641060 | 3300009148 | Bacteria | 1028 |
| 264 | Ga0105243_10645411 | 3300009148 | Bacteria | 1025 |
| 265 | Ga0105241_10004545 | 3300009174 | Bacteria | 10265 |
| 266 | Ga0105241_10149193 | 3300009174 | Bacteria | 1911 |
| 267 | Ga0105241_10195554 | 3300009174 | Bacteria | 1686 |
| 268 | Ga0105242_10351796 | 3300009176 | Bacteria | 1361 |
| 269 | Ga0105242_10717647 | 3300009176 | Bacteria | 980 |
| 270 | Ga0105248_10716530 | 3300009177 | Bacteria | 1129 |
| 271 | Ga0105237_10007960 | 3300009545 | Bacteria | 11548 |
| 272 | Ga0105237_10026951 | 3300009545 | Bacteria | 5870 |
| 273 | Ga0105237_10030213 | 3300009545 | Bacteria | 5506 |
| 274 | Ga0105237_10039289 | 3300009545 | Bacteria | 4778 |
| 275 | Ga0105237_10039787 | 3300009545 | Bacteria | 4744 |
| 276 | Ga0105237_10050359 | 3300009545 | Bacteria | 4185 |
| 277 | Ga0105237_10209106 | 3300009545 | Bacteria | 1951 |
| 278 | Ga0105237_10352445 | 3300009545 | Bacteria | 1476 |
| 279 | Ga0105237_10470755 | 3300009545 | Bacteria | 1262 |
| 280 | Ga0105237_10654564 | 3300009545 | Bacteria | 1057 |
| 281 | Ga0105238_10001176 | 3300009551 | Bacteria | 26306 |
| 282 | Ga0105238_10029351 | 3300009551 | Bacteria | 5602 |
| 283 | Ga0105238_10419376 | 3300009551 | Bacteria | 1333 |
| 284 | Ga0105238_10443781 | 3300009551 | Bacteria | 1294 |
| 285 | Ga0105249_10106290 | 3300009553 | Bacteria | 2648 |
| 286 | Ga0099796_10057177 | 3300010159 | Bacteria | 1371 |
| 287 | Ga0105239_10017508 | 3300010375 | Bacteria | 7924 |
| 288 | Ga0105239_10038465 | 3300010375 | Bacteria | 5243 |
| 289 | Ga0105239_10128447 | 3300010375 | Bacteria | 2818 |
| 290 | Ga0105239_10171193 | 3300010375 | Bacteria | 2428 |
| 291 | Ga0105239_10197232 | 3300010375 | Bacteria | 2254 |
| 292 | Ga0105239_10657049 | 3300010375 | Bacteria | 1198 |
| 293 | Ga0105239_10779251 | 3300010375 | Bacteria | 1095 |
| 294 | Ga0105246_10028115 | 3300011119 | Bacteria | 3692 |
| 295 | Ga0105246_10264285 | 3300011119 | Bacteria | 1372 |
| 296 | Ga0157343_1004575 | 3300012488 | Bacteria | 861 |
| 297 | Ga0157370_10060204 | 3300013104 | Bacteria | 3606 |
| 298 | Ga0157370_10163325 | 3300013104 | Bacteria | 2072 |
| 299 | Ga0157370_10291238 | 3300013104 | Bacteria | 1508 |
| 300 | Ga0157369_10004958 | 3300013105 | Bacteria | 15596 |
| 301 | Ga0157369_10014414 | 3300013105 | Bacteria | 8924 |
| 302 | Ga0157369_10030732 | 3300013105 | Bacteria | 5921 |
| 303 | Ga0157369_10030744 | 3300013105 | Bacteria | 5921 |
| 304 | Ga0157369_10826944 | 3300013105 | Bacteria | 951 |
| 305 | Ga0157374_10099137 | 3300013296 | Bacteria | 2790 |
| 306 | Ga0157374_11057407 | 3300013296 | Bacteria | 832 |
| 307 | Ga0163162_10027557 | 3300013306 | Bacteria | 5618 |
| 308 | Ga0163162_10279585 | 3300013306 | Bacteria | 1801 |
| 309 | Ga0163162_10527541 | 3300013306 | Bacteria | 1310 |
| 310 | Ga0157372_10361750 | 3300013307 | Bacteria | 1691 |
| 311 | Ga0163163_10192343 | 3300014325 | Bacteria | 2089 |
| 312 | Ga0163163_10327618 | 3300014325 | Bacteria | 1586 |
| 313 | Ga0163163_10332623 | 3300014325 | Bacteria | 1574 |
| 314 | Ga0163163_10662010 | 3300014325 | Bacteria | 1108 |
| 315 | Ga0163163_10874900 | 3300014325 | Bacteria | 962 |
| 316 | Ga0157380_10522411 | 3300014326 | Bacteria | 1158 |
| 317 | Ga0157379_10056635 | 3300014968 | Bacteria | 3502 |
| 318 | Ga0157379_10419728 | 3300014968 | Bacteria | 1232 |
| 319 | Ga0157376_10026136 | 3300014969 | Bacteria | 4609 |
| 320 | Ga0163161_10246013 | 3300017792 | Bacteria | 1392 |
| 321 | Ga0163161_10338792 | 3300017792 | Bacteria | 1193 |
| 322 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 323 | Ga0214542_1000003 | 3300021321 | Bacteria | 435700 |
| 324 | Ga0214545_1000004 | 3300021324 | Bacteria | 453352 |
| 325 | Ga0214543_1000007 | 3300021327 | Bacteria | 414744 |
| 326 | Ga0213872_10029016 | 3300021361 | Bacteria | 2538 |
| 327 | Ga0213874_10007521 | 3300021377 | Bacteria | 2618 |
| 328 | Ga0213876_10023140 | 3300021384 | Bacteria | 3283 |
| 329 | Ga0213876_10075715 | 3300021384 | Bacteria | 1778 |
| 330 | Ga0213871_10052440 | 3300021441 | Bacteria | 1121 |
| 331 | Ga0224712_10153828 | 3300022467 | Bacteria | 1021 |
| 332 | Ga0209563_102179 | 3300025230 | Bacteria | 4564 |
| 333 | Ga0209677_100607 | 3300025253 | Bacteria | 19268 |
| 334 | Ga0209677_106579 | 3300025253 | Bacteria | 2716 |
| 335 | Ga0209148_1000998 | 3300025254 | Bacteria | 18046 |
| 336 | Ga0209233_1012176 | 3300025261 | Bacteria | 2503 |
| 337 | Ga0209233_1015743 | 3300025261 | Bacteria | 2098 |
| 338 | Ga0209233_1016001 | 3300025261 | Bacteria | 2074 |
| 339 | Ga0209233_1017966 | 3300025261 | Bacteria | 1914 |
| 340 | Ga0209233_1020887 | 3300025261 | Bacteria | 1707 |
| 341 | Ga0209455_1000711 | 3300025272 | Bacteria | 19291 |
| 342 | Ga0209455_1005632 | 3300025272 | Bacteria | 3832 |
| 343 | Ga0209455_1015674 | 3300025272 | Bacteria | 1656 |
| 344 | Ga0209564_1001190 | 3300025295 | Bacteria | 29940 |
| 345 | Ga0209564_1016775 | 3300025295 | Bacteria | 2893 |
| 346 | Ga0209564_1018469 | 3300025295 | Bacteria | 2655 |
| 347 | Ga0209758_1000030 | 3300025297 | Bacteria | 509217 |
| 348 | Ga0209758_1000277 | 3300025297 | Bacteria | 102106 |
| 349 | Ga0209758_1001754 | 3300025297 | Bacteria | 24100 |
| 350 | Ga0209758_1004789 | 3300025297 | Bacteria | 10941 |
| 351 | Ga0209758_1028967 | 3300025297 | Bacteria | 2328 |
| 352 | Ga0209758_1057311 | 3300025297 | Bacteria | 1310 |
| 353 | Ga0209758_1075248 | 3300025297 | Bacteria | 1044 |
| 354 | Ga0209256_1011379 | 3300025299 | Bacteria | 3568 |
| 355 | Ga0209256_1020794 | 3300025299 | Bacteria | 2036 |
| 356 | Ga0207426_1000271 | 3300025302 | Bacteria | 108392 |
| 357 | Ga0207426_1000913 | 3300025302 | Bacteria | 29549 |
| 358 | Ga0207426_1021235 | 3300025302 | Bacteria | 2245 |
| 359 | Ga0207426_1039009 | 3300025302 | Bacteria | 1491 |
| 360 | Ga0209051_1077321 | 3300025303 | Bacteria | 974 |
| 361 | Ga0209257_1000947 | 3300025304 | Bacteria | 40051 |
| 362 | Ga0209257_1029045 | 3300025304 | Bacteria | 1808 |
| 363 | Ga0207697_10056662 | 3300025315 | Bacteria | 1626 |
| 364 | Ga0207656_10001009 | 3300025321 | Bacteria | 9200 |
| 365 | Ga0207656_10127230 | 3300025321 | Bacteria | 1191 |
| 366 | Ga0207656_10197500 | 3300025321 | Bacteria | 971 |
| 367 | Ga0207653_10092121 | 3300025885 | Bacteria | 1063 |
| 368 | Ga0207692_10000396 | 3300025898 | Bacteria | 15079 |
| 369 | Ga0207710_10039449 | 3300025900 | Bacteria | 2090 |
| 370 | Ga0207688_10010005 | 3300025901 | Bacteria | 5158 |
| 371 | Ga0207688_10059119 | 3300025901 | Bacteria | 2158 |
| 372 | Ga0207688_10112352 | 3300025901 | Bacteria | 1583 |
| 373 | Ga0207688_10249884 | 3300025901 | Bacteria | 1074 |
| 374 | Ga0207647_10052442 | 3300025904 | Bacteria | 2518 |
| 375 | Ga0207647_10128616 | 3300025904 | Bacteria | 1489 |
| 376 | Ga0207647_10205388 | 3300025904 | Bacteria | 1139 |
| 377 | Ga0207685_10023468 | 3300025905 | Bacteria | 2100 |
| 378 | Ga0207685_10036159 | 3300025905 | Bacteria | 1809 |
| 379 | Ga0207699_10000506 | 3300025906 | Bacteria | 19377 |
| 380 | Ga0207699_10017577 | 3300025906 | Bacteria | 3769 |
| 381 | Ga0207699_10468119 | 3300025906 | Bacteria | 906 |
| 382 | Ga0207645_10201120 | 3300025907 | Bacteria | 1311 |
| 383 | Ga0207643_10130903 | 3300025908 | Bacteria | 1493 |
| 384 | Ga0207705_10027863 | 3300025909 | Bacteria | 4029 |
| 385 | Ga0207654_10001189 | 3300025911 | Bacteria | 13962 |
| 386 | Ga0207654_10107546 | 3300025911 | Bacteria | 1729 |
| 387 | Ga0207707_10001378 | 3300025912 | Bacteria | 22538 |
| 388 | Ga0207707_10004787 | 3300025912 | Bacteria | 11871 |
| 389 | Ga0207707_10019821 | 3300025912 | Bacteria | 5871 |
| 390 | Ga0207707_10323444 | 3300025912 | Bacteria | 1331 |
| 391 | Ga0207695_10005181 | 3300025913 | Bacteria | 17451 |
| 392 | Ga0207695_10026278 | 3300025913 | Bacteria | 6499 |
| 393 | Ga0207695_10029019 | 3300025913 | Bacteria | 6122 |
| 394 | Ga0207695_10054124 | 3300025913 | Bacteria | 4193 |
| 395 | Ga0207695_10058640 | 3300025913 | Bacteria | 3995 |
| 396 | Ga0207695_10126249 | 3300025913 | Bacteria | 2520 |
| 397 | Ga0207695_10206864 | 3300025913 | Bacteria | 1875 |
| 398 | Ga0207695_10509689 | 3300025913 | Bacteria | 1085 |
| 399 | Ga0207671_10025307 | 3300025914 | Bacteria | 4458 |
| 400 | Ga0207671_10026212 | 3300025914 | Bacteria | 4370 |
| 401 | Ga0207671_10037186 | 3300025914 | Bacteria | 3611 |
| 402 | Ga0207671_10053272 | 3300025914 | Bacteria | 2998 |
| 403 | Ga0207671_10067250 | 3300025914 | Bacteria | 2668 |
| 404 | Ga0207671_10241471 | 3300025914 | Bacteria | 1419 |
| 405 | Ga0207671_10266059 | 3300025914 | Bacteria | 1350 |
| 406 | Ga0207693_10004427 | 3300025915 | Bacteria | 11879 |
| 407 | Ga0207693_10026084 | 3300025915 | Bacteria | 4627 |
| 408 | Ga0207693_10055856 | 3300025915 | Bacteria | 3097 |
| 409 | Ga0207693_10063883 | 3300025915 | Bacteria | 2884 |
| 410 | Ga0207693_10279210 | 3300025915 | Bacteria | 1309 |
| 411 | Ga0207663_10000893 | 3300025916 | Bacteria | 13589 |
| 412 | Ga0207663_10014297 | 3300025916 | Bacteria | 4340 |
| 413 | Ga0207663_10035267 | 3300025916 | Bacteria | 2999 |
| 414 | Ga0207660_10015291 | 3300025917 | Bacteria | 5062 |
| 415 | Ga0207660_10039604 | 3300025917 | Bacteria | 3295 |
| 416 | Ga0207660_10056603 | 3300025917 | Bacteria | 2806 |
| 417 | Ga0207660_10608155 | 3300025917 | Bacteria | 890 |
| 418 | Ga0207657_10004291 | 3300025919 | Bacteria | 15098 |
| 419 | Ga0207657_10011254 | 3300025919 | Bacteria | 8891 |
| 420 | Ga0207649_10398346 | 3300025920 | Bacteria | 1030 |
| 421 | Ga0207652_10034951 | 3300025921 | Bacteria | 4239 |
| 422 | Ga0207652_10044378 | 3300025921 | Bacteria | 3787 |
| 423 | Ga0207652_10454217 | 3300025921 | Bacteria | 1155 |
| 424 | Ga0207652_10517784 | 3300025921 | Bacteria | 1073 |
| 425 | Ga0207646_10485207 | 3300025922 | Bacteria | 1114 |
| 426 | Ga0207681_10118888 | 3300025923 | Bacteria | 1935 |
| 427 | Ga0207694_10000719 | 3300025924 | Bacteria | 29735 |
| 428 | Ga0207694_10032793 | 3300025924 | Bacteria | 3977 |
| 429 | Ga0207694_10048591 | 3300025924 | Bacteria | 3283 |
| 430 | Ga0207694_10145540 | 3300025924 | Bacteria | 1907 |
| 431 | Ga0207694_10261019 | 3300025924 | Bacteria | 1419 |
| 432 | Ga0207694_10283514 | 3300025924 | Bacteria | 1361 |
| 433 | Ga0207694_10347160 | 3300025924 | Bacteria | 1228 |
| 434 | Ga0207694_10349051 | 3300025924 | Bacteria | 1224 |
| 435 | Ga0207659_10488012 | 3300025926 | Bacteria | 1041 |
| 436 | Ga0207687_10015241 | 3300025927 | Bacteria | 5036 |
| 437 | Ga0207687_10156318 | 3300025927 | Bacteria | 1745 |
| 438 | Ga0207700_10004999 | 3300025928 | Bacteria | 7884 |
| 439 | Ga0207700_10029357 | 3300025928 | Bacteria | 3879 |
| 440 | Ga0207700_10089326 | 3300025928 | Bacteria | 2429 |
| 441 | Ga0207700_10515352 | 3300025928 | Bacteria | 1059 |
| 442 | Ga0207700_10922244 | 3300025928 | Bacteria | 782 |
| 443 | Ga0207664_10092659 | 3300025929 | Bacteria | 2480 |
| 444 | Ga0207664_10095627 | 3300025929 | Bacteria | 2444 |
| 445 | Ga0207664_10115426 | 3300025929 | Bacteria | 2239 |
| 446 | Ga0207664_10117454 | 3300025929 | Bacteria | 2221 |
| 447 | Ga0207664_10135274 | 3300025929 | Bacteria | 2079 |
| 448 | Ga0207664_10653140 | 3300025929 | Bacteria | 945 |
| 449 | Ga0207644_10091110 | 3300025931 | Bacteria | 2273 |
| 450 | Ga0207644_10091767 | 3300025931 | Bacteria | 2265 |
| 451 | Ga0207644_10377256 | 3300025931 | Bacteria | 1156 |
| 452 | Ga0207644_10489912 | 3300025931 | Bacteria | 1013 |
| 453 | Ga0207690_10042474 | 3300025932 | Bacteria | 2986 |
| 454 | Ga0207706_10010327 | 3300025933 | Bacteria | 8534 |
| 455 | Ga0207706_10326460 | 3300025933 | Bacteria | 1335 |
| 456 | Ga0207706_10572481 | 3300025933 | Bacteria | 971 |
| 457 | Ga0207686_10401604 | 3300025934 | Bacteria | 1044 |
| 458 | Ga0207669_10010714 | 3300025937 | Bacteria | 4426 |
| 459 | Ga0207669_10498838 | 3300025937 | Bacteria | 973 |
| 460 | Ga0207704_10311582 | 3300025938 | Bacteria | 1210 |
| 461 | Ga0207665_10076644 | 3300025939 | Bacteria | 2293 |
| 462 | Ga0207665_10118421 | 3300025939 | Bacteria | 1869 |
| 463 | Ga0207665_10342000 | 3300025939 | Bacteria | 1128 |
| 464 | Ga0207691_10022979 | 3300025940 | Bacteria | 5874 |
| 465 | Ga0207711_10030704 | 3300025941 | Bacteria | 4533 |
| 466 | Ga0207711_10325154 | 3300025941 | Bacteria | 1422 |
| 467 | Ga0207689_10096244 | 3300025942 | Bacteria | 2432 |
| 468 | Ga0207689_10119085 | 3300025942 | Bacteria | 2172 |
| 469 | Ga0207689_10157237 | 3300025942 | Bacteria | 1874 |
| 470 | Ga0207689_10250026 | 3300025942 | Bacteria | 1466 |
| 471 | Ga0207661_10011425 | 3300025944 | Bacteria | 6433 |
| 472 | Ga0207661_10016081 | 3300025944 | Bacteria | 5514 |
| 473 | Ga0207661_10018986 | 3300025944 | Bacteria | 5116 |
| 474 | Ga0207679_10408739 | 3300025945 | Bacteria | 1195 |
| 475 | Ga0207667_10008537 | 3300025949 | Bacteria | 12160 |
| 476 | Ga0207667_10008887 | 3300025949 | Bacteria | 11890 |
| 477 | Ga0207667_10011455 | 3300025949 | Bacteria | 10305 |
| 478 | Ga0207667_10071605 | 3300025949 | Bacteria | 3604 |
| 479 | Ga0207667_10211342 | 3300025949 | Bacteria | 1989 |
| 480 | Ga0207667_10491677 | 3300025949 | Bacteria | 1245 |
| 481 | Ga0207651_10246219 | 3300025960 | Bacteria | 1460 |
| 482 | Ga0207712_10144849 | 3300025961 | Bacteria | 1828 |
| 483 | Ga0207668_10055842 | 3300025972 | Bacteria | 2747 |
| 484 | Ga0207668_10089279 | 3300025972 | Bacteria | 2259 |
| 485 | Ga0207668_10095789 | 3300025972 | Bacteria | 2191 |
| 486 | Ga0207668_10505317 | 3300025972 | Bacteria | 1040 |
| 487 | Ga0207640_10008213 | 3300025981 | Bacteria | 5787 |
| 488 | Ga0207640_10057350 | 3300025981 | Bacteria | 2561 |
| 489 | Ga0207640_10304191 | 3300025981 | Bacteria | 1263 |
| 490 | Ga0207640_10329032 | 3300025981 | Bacteria | 1220 |
| 491 | Ga0207640_10889702 | 3300025981 | Bacteria | 777 |
| 492 | Ga0207677_10040604 | 3300026023 | Bacteria | 3069 |
| 493 | Ga0207677_10310611 | 3300026023 | Bacteria | 1306 |
| 494 | Ga0207677_10467410 | 3300026023 | Bacteria | 1084 |
| 495 | Ga0207703_10138867 | 3300026035 | Bacteria | 2107 |
| 496 | Ga0207703_10395872 | 3300026035 | Bacteria | 1281 |
| 497 | Ga0207639_10003011 | 3300026041 | Bacteria | 11341 |
| 498 | Ga0207639_10011122 | 3300026041 | Bacteria | 6243 |
| 499 | Ga0207639_10139409 | 3300026041 | Bacteria | 2018 |
| 500 | Ga0207639_10164748 | 3300026041 | Bacteria | 1871 |
| 501 | Ga0207639_10288181 | 3300026041 | Bacteria | 1447 |
| 502 | Ga0207678_10012518 | 3300026067 | Bacteria | 7450 |
| 503 | Ga0207678_10028890 | 3300026067 | Bacteria | 4840 |
| 504 | Ga0207678_10044475 | 3300026067 | Bacteria | 3841 |
| 505 | Ga0207678_10046223 | 3300026067 | Bacteria | 3765 |
| 506 | Ga0207678_10051151 | 3300026067 | Bacteria | 3567 |
| 507 | Ga0207678_10067071 | 3300026067 | Bacteria | 3080 |
| 508 | Ga0207678_10261061 | 3300026067 | Bacteria | 1484 |
| 509 | Ga0207678_10282689 | 3300026067 | Bacteria | 1424 |
| 510 | Ga0207678_10502784 | 3300026067 | Bacteria | 1057 |
| 511 | Ga0207678_10691587 | 3300026067 | Bacteria | 897 |
| 512 | Ga0207708_10179092 | 3300026075 | Bacteria | 1683 |
| 513 | Ga0207702_10000191 | 3300026078 | Bacteria | 72810 |
| 514 | Ga0207702_10000938 | 3300026078 | Bacteria | 30006 |
| 515 | Ga0207702_10151553 | 3300026078 | Bacteria | 2109 |
| 516 | Ga0207702_10174928 | 3300026078 | Bacteria | 1972 |
| 517 | Ga0207641_10168200 | 3300026088 | Bacteria | 1999 |
| 518 | Ga0207641_10437919 | 3300026088 | Bacteria | 1261 |
| 519 | Ga0207641_10925629 | 3300026088 | Bacteria | 866 |
| 520 | Ga0207648_10068173 | 3300026089 | Bacteria | 3100 |
| 521 | Ga0207648_10088934 | 3300026089 | Bacteria | 2697 |
| 522 | Ga0207648_10494684 | 3300026089 | Bacteria | 1118 |
| 523 | Ga0207676_10249689 | 3300026095 | Bacteria | 1596 |
| 524 | Ga0207676_10252223 | 3300026095 | Bacteria | 1589 |
| 525 | Ga0207676_10360496 | 3300026095 | Bacteria | 1347 |
| 526 | Ga0207674_10015534 | 3300026116 | Bacteria | 8363 |
| 527 | Ga0207674_10024882 | 3300026116 | Bacteria | 6390 |
| 528 | Ga0207674_10025851 | 3300026116 | Bacteria | 6250 |
| 529 | Ga0207674_10087858 | 3300026116 | Bacteria | 3102 |
| 530 | Ga0207674_10526896 | 3300026116 | Bacteria | 1141 |
| 531 | Ga0207674_10580151 | 3300026116 | Bacteria | 1083 |
| 532 | Ga0207675_100128208 | 3300026118 | Bacteria | 2404 |
| 533 | Ga0207675_100180691 | 3300026118 | Bacteria | 2020 |
| 534 | Ga0207675_100393557 | 3300026118 | Bacteria | 1364 |
| 535 | Ga0207675_100503487 | 3300026118 | Bacteria | 1206 |
| 536 | Ga0207683_10083353 | 3300026121 | Bacteria | 2841 |
| 537 | Ga0207683_10156406 | 3300026121 | Bacteria | 2059 |
| 538 | Ga0207683_10180779 | 3300026121 | Bacteria | 1912 |
| 539 | Ga0207683_10205022 | 3300026121 | Bacteria | 1793 |
| 540 | Ga0207683_10452446 | 3300026121 | Bacteria | 1184 |
| 541 | Ga0207698_10034211 | 3300026142 | Bacteria | 3702 |
| 542 | Ga0207698_10054754 | 3300026142 | Bacteria | 3071 |
| 543 | Ga0207698_10182140 | 3300026142 | Bacteria | 1862 |
| 544 | Ga0207698_10305660 | 3300026142 | Bacteria | 1483 |
| 545 | Ga0209389_1000193 | 3300027296 | Bacteria | 44705 |
| 546 | Ga0209389_1000207 | 3300027296 | Bacteria | 42300 |
| 547 | Ga0209589_1000024 | 3300027357 | Bacteria | 169886 |
| 548 | Ga0209589_1000025 | 3300027357 | Bacteria | 165546 |
| 549 | Ga0209489_100039 | 3300027361 | Bacteria | 165546 |
| 550 | Ga0209489_101741 | 3300027361 | Bacteria | 44747 |
| 551 | Ga0209489_101963 | 3300027361 | Bacteria | 42342 |
| 552 | Ga0209700_100043 | 3300027363 | Bacteria | 167890 |
| 553 | Ga0209700_100420 | 3300027363 | Bacteria | 77617 |
| 554 | Ga0209179_1054355 | 3300027512 | Bacteria | 863 |
| 555 | Ga0209588_1007005 | 3300027671 | Bacteria | 3305 |
| 556 | Ga0209813_10018664 | 3300027866 | Bacteria | 1919 |
| 557 | Ga0209813_10075582 | 3300027866 | Bacteria | 1104 |
| 558 | Ga0207428_10228213 | 3300027907 | Bacteria | 1394 |
| 559 | Ga0268266_10003056 | 3300028379 | Bacteria | 17112 |
| 560 | Ga0268266_10003703 | 3300028379 | Bacteria | 15062 |
| 561 | Ga0268266_10029112 | 3300028379 | Bacteria | 4694 |
| 562 | Ga0268266_10194830 | 3300028379 | Bacteria | 1851 |
| 563 | Ga0268266_10275029 | 3300028379 | Bacteria | 1564 |
| 564 | Ga0268266_10340770 | 3300028379 | Bacteria | 1407 |
| 565 | Ga0268265_10070116 | 3300028380 | Bacteria | 2724 |
| 566 | Ga0268265_10207239 | 3300028380 | Bacteria | 1705 |
| 567 | Ga0268265_10253413 | 3300028380 | Bacteria | 1560 |
| 568 | Ga0268265_10346048 | 3300028380 | Bacteria | 1355 |
| 569 | Ga0268264_10000051 | 3300028381 | Bacteria | 321565 |
| 570 | Ga0268264_10191049 | 3300028381 | Bacteria | 1867 |
| 571 | Ga0265337_1007383 | 3300028556 | Bacteria | 4117 |
| 572 | Ga0265319_1009743 | 3300028563 | Bacteria | 4062 |
| 573 | Ga0265334_10001692 | 3300028573 | Bacteria | 10542 |
| 574 | Ga0265323_10008924 | 3300028653 | Bacteria | 4118 |
| 575 | Ga0265336_10009566 | 3300028666 | Bacteria | 3346 |
| 576 | Ga0307517_10005748 | 3300028786 | Bacteria | 18557 |
| 577 | Ga0307515_10110960 | 3300028794 | Bacteria | 3205 |
| 578 | Ga0265338_10000231 | 3300028800 | Bacteria | 103805 |
| 579 | Ga0265330_10044930 | 3300031235 | Bacteria | 1949 |
| 580 | Ga0265340_10020047 | 3300031247 | Bacteria | 3440 |
| 581 | Ga0265339_10004944 | 3300031249 | Bacteria | 8978 |
| 582 | Ga0265339_10024066 | 3300031249 | Bacteria | 3513 |
| 583 | Ga0265331_10042928 | 3300031250 | Bacteria | 2192 |
| 584 | Ga0265331_10049490 | 3300031250 | Bacteria | 2019 |
| 585 | Ga0265316_10371105 | 3300031344 | Bacteria | 1033 |
| 586 | Ga0307513_10215645 | 3300031456 | Bacteria | 1746 |
| 587 | Ga0307509_10030718 | 3300031507 | Bacteria | 5939 |
| 588 | Ga0307509_10150798 | 3300031507 | Bacteria | 2240 |
| 589 | Ga0307509_10312717 | 3300031507 | Bacteria | 1312 |
| 590 | Ga0307509_10569584 | 3300031507 | Bacteria | 808 |
| 591 | Ga0307508_10000152 | 3300031616 | Bacteria | 82883 |
| 592 | Ga0307508_10058929 | 3300031616 | Bacteria | 3396 |
| 593 | Ga0307508_10149960 | 3300031616 | Bacteria | 1936 |
| 594 | Ga0307508_10516090 | 3300031616 | Bacteria | 791 |
| 595 | Ga0265314_10002968 | 3300031711 | Bacteria | 16811 |
| 596 | Ga0265314_10044116 | 3300031711 | Bacteria | 3163 |
| 597 | Ga0265314_10219964 | 3300031711 | Bacteria | 1109 |
| 598 | Ga0265342_10011951 | 3300031712 | Bacteria | 5900 |
| 599 | Ga0265342_10076076 | 3300031712 | Bacteria | 1946 |
| 600 | Ga0265342_10079404 | 3300031712 | Bacteria | 1897 |
| 601 | Ga0265342_10264907 | 3300031712 | Bacteria | 913 |
| 602 | Ga0307516_10001267 | 3300031730 | Bacteria | 35137 |
| 603 | Ga0307516_10031057 | 3300031730 | Bacteria | 5387 |
| 604 | Ga0307516_10073820 | 3300031730 | Bacteria | 3268 |
| 605 | Ga0307516_10074213 | 3300031730 | Bacteria | 3257 |
| 606 | Ga0307405_10059938 | 3300031731 | Bacteria | 2400 |
| 607 | Ga0307405_10237076 | 3300031731 | Bacteria | 1349 |
| 608 | Ga0307407_10150254 | 3300031903 | Bacteria | 1513 |
| 609 | Ga0307407_10622708 | 3300031903 | Bacteria | 806 |
| 610 | Ga0307409_101287410 | 3300031995 | Bacteria | 756 |
| 611 | Ga0307416_100783114 | 3300032002 | Bacteria | 1048 |
| 612 | Ga0307415_100271049 | 3300032126 | Bacteria | 1390 |
| 613 | Ga0307415_100415298 | 3300032126 | Bacteria | 1153 |
| 614 | Ga0307507_10022911 | 3300033179 | Bacteria | 6878 |
| 615 | Ga0307510_10011169 | 3300033180 | Bacteria | 10679 |
| 616 | Ga0307510_10038624 | 3300033180 | Bacteria | 5275 |
| 617 | Ga0307510_10109970 | 3300033180 | Bacteria | 2503 |
| 618 | Ga0307510_10117120 | 3300033180 | Bacteria | 2382 |
| 619 | Ga0307510_10164220 | 3300033180 | Bacteria | 1812 |
| 620 | Ga0315911_1000023 | 3300033442 | Bacteria | 110348 |
| 621 | Ga0373930_0052197 | 3300034816 | Bacteria | 895 |
| 622 | Ga0373926_0027374 | 3300035083 | Bacteria | 1998 |
| 623 | Ga0373929_0039365 | 3300035085 | Bacteria | 1044 |
| 624 | Ga0373934_0061754 | 3300035086 | Bacteria | 1493 |
| 625 | Ga0373949_0059408 | 3300035090 | Bacteria | 981 |
| 626 | Ga0373952_0012160 | 3300035092 | Bacteria | 1690 |
| 627 | Ga0373936_0018508 | 3300035113 | Bacteria | 2691 |
| 628 | Ga0373945_0007634 | 3300035116 | Bacteria | 3507 |
| 629 | Ga0373953_0042103 | 3300035117 | Bacteria | 1819 |
| 630 | Ga0373954_0008023 | 3300035118 | Bacteria | 4626 |
| 631 | Ga0373954_0140367 | 3300035118 | Bacteria | 1178 |
| 632 | Ga0373957_0018309 | 3300035120 | Bacteria | 2451 |
| 633 | Ga0373957_0022368 | 3300035120 | Bacteria | 2253 |
| 634 | Ga0373943_0013757 | 3300035170 | Bacteria | 3658 |
| 635 | Ga0373943_0148931 | 3300035170 | Bacteria | 1266 |
| 636 | Ga0373943_0150781 | 3300035170 | Bacteria | 1259 |
| 637 | Ga0373946_0017770 | 3300035171 | Bacteria | 2724 |
| 638 | Ga0373955_0017796 | 3300035172 | Bacteria | 3522 |
| 639 | Ga0373955_0021131 | 3300035172 | Bacteria | 3280 |
| 640 | Ga0373924_0013622 | 3300035410 | Bacteria | 3057 |
| 641 | Ga0373935_0181513 | 3300035692 | Bacteria | 1445 |
| 642 | Ga0373935_0547588 | 3300035692 | Bacteria | 843 |
| 643 | Ga0373927_0002222 | 3300035695 | Bacteria | 14277 |
| 644 | Ga0373927_0005329 | 3300035695 | Bacteria | 8887 |
| 645 | Ga0373927_0010638 | 3300035695 | Bacteria | 6129 |
| 646 | Ga0373927_0011810 | 3300035695 | Bacteria | 5817 |
| 647 | Ga0373927_0022460 | 3300035695 | Bacteria | 4133 |
| 648 | Ga0373927_0041347 | 3300035695 | Bacteria | 2990 |
| 649 | Ga0373927_0069624 | 3300035695 | Bacteria | 2277 |
| 650 | Ga0373933_0000018 | 3300035724 | Bacteria | 98044 |
| 651 | Ga0373933_0024431 | 3300035724 | Bacteria | 3459 |
| 652 | Ga0373947_0002696 | 3300035725 | Bacteria | 10657 |
| 653 | Ga0373947_0042175 | 3300035725 | Bacteria | 2723 |
| 654 | Ga0373947_0052878 | 3300035725 | Bacteria | 2447 |
| 655 | Ga0373947_0180540 | 3300035725 | Bacteria | 1374 |
| 656 | Ga0373947_0291999 | 3300035725 | Bacteria | 1086 |
| 657 | Ga0373937_0160231 | 3300036401 | Bacteria | 2109 |
| 658 | Ga0373937_0370114 | 3300036401 | Bacteria | 1358 |
| 659 | Ga0373937_0490218 | 3300036401 | Bacteria | 1167 |
| 660 | Ga0373937_0902749 | 3300036401 | Bacteria | 832 |
| 661 | Ga0373925_0020019 | 3300037068 | Bacteria | 4868 |
| 662 | Ga0373925_0049643 | 3300037068 | Bacteria | 3128 |
| 663 | Ga0373925_0050903 | 3300037068 | Bacteria | 3090 |
| 664 | Ga0373925_0122786 | 3300037068 | Bacteria | 2017 |
| 665 | Ga0373925_0239995 | 3300037068 | Bacteria | 1451 |
| 666 | Ga0395899_0168634 | 3300037312 | Bacteria | 1543 |
| 667 | Ga0395900_0070034 | 3300037418 | Bacteria | 3606 |
| 668 | Ga0395900_0078178 | 3300037418 | Bacteria | 3399 |
| 669 | Ga0395900_0172996 | 3300037418 | Bacteria | 2197 |
| 670 | Ga0395900_0359079 | 3300037418 | Bacteria | 1429 |
| 671 | Ga0395900_0527449 | 3300037418 | Bacteria | 1128 |
| 672 | Ga0395898_0035897 | 3300037466 | Bacteria | 4926 |
| 673 | Ga0395898_0042754 | 3300037466 | Bacteria | 4469 |
| 674 | Ga0395898_0085845 | 3300037466 | Bacteria | 3034 |
| 675 | Ga0395898_0527750 | 3300037466 | Bacteria | 1122 |
| 676 | Ga0395898_0933169 | 3300037466 | Bacteria | 805 |
| 677 | Ga0395905_0001838 | 3300037471 | Bacteria | 24511 |
| 678 | Ga0395905_0123229 | 3300037471 | Bacteria | 2437 |
| 679 | Ga0395905_0216793 | 3300037471 | Bacteria | 1792 |
| 680 | Ga0395905_0223618 | 3300037471 | Bacteria | 1762 |
| 681 | Ga0395905_0743806 | 3300037471 | Bacteria | 883 |
| 682 | Ga0436364_0120583 | 3300037853 | Bacteria | 775 |
| 683 | Ga0436364_0428944 | 3300037853 | Bacteria | 3178 |
| 684 | Ga0436364_1215160 | 3300037853 | Bacteria | 1295 |
| 685 | Ga0395901_0005769 | 3300038443 | Bacteria | 12539 |
| 686 | Ga0395901_0079476 | 3300038443 | Bacteria | 3425 |
| 687 | Ga0395901_0205585 | 3300038443 | Bacteria | 2063 |
| 688 | Ga0395901_0247426 | 3300038443 | Bacteria | 1858 |
| 689 | Ga0395901_0325248 | 3300038443 | Bacteria | 1590 |
| 690 | Ga0395901_0327270 | 3300038443 | Bacteria | 1585 |
| 691 | Ga0395901_0378597 | 3300038443 | Bacteria | 1457 |
| 692 | Ga0395901_0478536 | 3300038443 | Bacteria | 1270 |
| 693 | Ga0436365_0068950 | 3300039437 | Bacteria | 778 |
| 694 | Ga0436365_0099807 | 3300039437 | Bacteria | 5377 |
| 695 | Ga0436365_0490213 | 3300039437 | Bacteria | 7502 |
| 696 | Ga0436365_0959812 | 3300039437 | Bacteria | 1841 |
| 697 | Ga0436365_1559462 | 3300039437 | Bacteria | 1075 |
| 698 | Ga0436365_1694116 | 3300039437 | Bacteria | 1677 |
| 699 | Ga0436365_1716695 | 3300039437 | Bacteria | 989 |
| 700 | Ga0436360_0366592 | 3300039438 | Bacteria | 4915 |
| 701 | Ga0436360_1350684 | 3300039438 | Bacteria | 1789 |
| 702 | Ga0436361_0279908 | 3300039447 | Bacteria | 1009 |
| 703 | Ga0436361_0307241 | 3300039447 | Bacteria | 1780 |
| 704 | Ga0436363_0546873 | 3300039450 | Bacteria | 842 |
| 705 | Ga0436363_0941603 | 3300039450 | Bacteria | 1989 |
| 706 | Ga0436363_1088635 | 3300039450 | Bacteria | 2618 |
| 707 | Ga0436362_0434371 | 3300039453 | Bacteria | 733 |
| 708 | Ga0436362_0439678 | 3300039453 | Bacteria | 3212 |
| 709 | Ga0436362_0674594 | 3300039453 | Bacteria | 4086 |
| 710 | Ga0451797_1359922 | 3300041453 | Bacteria | 1066 |
| 711 | Ga0451839_0690549 | 3300041496 | Bacteria | 984 |
| 712 | Ga0451841_0959049 | 3300041498 | Bacteria | 1797 |
| 713 | Ga0451849_1221422 | 3300041505 | Bacteria | 1472 |
| 714 | Ga0451853_2141541 | 3300041512 | Bacteria | 977 |
| 715 | Ga0439455_0133213 | 3300042012 | Bacteria | 702 |
| 716 | Ga0439458_0012089 | 3300042157 | Bacteria | 1934 |
| 717 | Ga0439459_0068866 | 3300042438 | Bacteria | 815 |
| 718 | Ga0439440_0037718 | 3300042993 | Bacteria | 1168 |
| 719 | Ga0466972_0001082 | 3300044658 | Bacteria | 13062 |
| 720 | Ga0466972_0004060 | 3300044658 | Bacteria | 7303 |
| 721 | Ga0466965_0200006 | 3300044683 | Bacteria | 1060 |
| 722 | Ga0466966_0000514 | 3300044684 | Bacteria | 24679 |
| 723 | Ga0466966_0319860 | 3300044684 | Bacteria | 932 |
| 724 | Ga0466966_0403561 | 3300044684 | Bacteria | 821 |
| 725 | Ga0466961_0001153 | 3300044693 | Bacteria | 16232 |
| 726 | Ga0466963_0084624 | 3300044694 | Bacteria | 2152 |
| 727 | Ga0466963_0094035 | 3300044694 | Bacteria | 2044 |
| 728 | Ga0466964_0098617 | 3300044706 | Bacteria | 1284 |
| 729 | Ga0466971_0307595 | 3300044719 | Bacteria | 762 |
| 730 | Ga0466968_0014655 | 3300044735 | Bacteria | 3100 |
| 731 | Ga0466960_0058810 | 3300044901 | Bacteria | 1878 |
| 732 | Ga0466960_0318941 | 3300044901 | Bacteria | 880 |
| 733 | Ga0466959_0013468 | 3300045049 | Bacteria | 5927 |
| 734 | Ga0466959_0140778 | 3300045049 | Bacteria | 1705 |
| 735 | Ga0466967_0062222 | 3300045976 | Bacteria | 3313 |
| 736 | Ga0466967_0199509 | 3300045976 | Bacteria | 1894 |
| 737 | Ga0495617_057833 | 3300046452 | Bacteria | 1285 |
| 738 | Ga0495592_0049039 | 3300046454 | Bacteria | 3140 |
| 739 | Ga0495592_0434217 | 3300046454 | Bacteria | 826 |
| 740 | Ga0495603_0010946 | 3300046455 | Bacteria | 5502 |
| 741 | Ga0495603_0029308 | 3300046455 | Bacteria | 3319 |
| 742 | Ga0495603_0078135 | 3300046455 | Bacteria | 1941 |
| 743 | Ga0495603_0085759 | 3300046455 | Bacteria | 1843 |
| 744 | Ga0495629_0000074 | 3300046459 | Bacteria | 87355 |
| 745 | Ga0495629_0003855 | 3300046459 | Bacteria | 11309 |
| 746 | Ga0495629_0353266 | 3300046459 | Bacteria | 1002 |
| 747 | Ga0495638_0035894 | 3300046460 | Bacteria | 3158 |
| 748 | Ga0495641_0036661 | 3300046461 | Bacteria | 2303 |
| 749 | Ga0495651_0006512 | 3300046462 | Bacteria | 8920 |
| 750 | Ga0495651_0107572 | 3300046462 | Bacteria | 2066 |
| 751 | Ga0495651_0150950 | 3300046462 | Bacteria | 1675 |
| 752 | Ga0495653_0025810 | 3300046463 | Bacteria | 4714 |
| 753 | Ga0495653_0264283 | 3300046463 | Bacteria | 1136 |
| 754 | Ga0495653_0487433 | 3300046463 | Bacteria | 770 |
| 755 | Ga0495580_0003195 | 3300046472 | Bacteria | 14033 |
| 756 | Ga0495580_0063760 | 3300046472 | Bacteria | 2583 |
| 757 | Ga0495580_0271551 | 3300046472 | Bacteria | 1158 |
| 758 | Ga0495582_0000059 | 3300046473 | Bacteria | 55798 |
| 759 | Ga0495582_0018139 | 3300046473 | Bacteria | 3851 |
| 760 | Ga0495582_0202100 | 3300046473 | Bacteria | 1135 |
| 761 | Ga0495639_0000954 | 3300046475 | Bacteria | 13049 |
| 762 | Ga0495639_0041807 | 3300046475 | Bacteria | 2066 |
| 763 | Ga0495662_0010592 | 3300046476 | Bacteria | 4509 |
| 764 | Ga0495664_0182706 | 3300046477 | Bacteria | 1271 |
| 765 | Ga0495664_0266167 | 3300046477 | Bacteria | 1036 |
| 766 | Ga0495585_0193134 | 3300046492 | Bacteria | 1040 |
| 767 | Ga0495594_0002251 | 3300046499 | Bacteria | 10047 |
| 768 | Ga0495607_0208031 | 3300046501 | Bacteria | 964 |
| 769 | Ga0495583_0114575 | 3300046506 | Bacteria | 1140 |
| 770 | Ga0495606_0002903 | 3300046507 | Bacteria | 18933 |
| 771 | Ga0495606_0021783 | 3300046507 | Bacteria | 4688 |
| 772 | Ga0495606_0090304 | 3300046507 | Bacteria | 1885 |
| 773 | Ga0495608_0021279 | 3300046511 | Bacteria | 4451 |
| 774 | Ga0495608_0139118 | 3300046511 | Bacteria | 1550 |
| 775 | Ga0495608_0213931 | 3300046511 | Bacteria | 1211 |
| 776 | Ga0495608_0579796 | 3300046511 | Bacteria | 674 |
| 777 | Ga0495610_0155097 | 3300046512 | Bacteria | 973 |
| 778 | Ga0495610_0167510 | 3300046512 | Bacteria | 924 |
| 779 | Ga0495616_0065486 | 3300046513 | Bacteria | 1770 |
| 780 | Ga0495618_0173313 | 3300046514 | Bacteria | 1372 |
| 781 | Ga0495620_0146509 | 3300046515 | Bacteria | 922 |
| 782 | Ga0495620_0154292 | 3300046515 | Bacteria | 894 |
| 783 | Ga0495628_0133332 | 3300046516 | Bacteria | 1899 |
| 784 | Ga0495628_0136649 | 3300046516 | Bacteria | 1873 |
| 785 | Ga0495628_0225659 | 3300046516 | Bacteria | 1405 |
| 786 | Ga0495628_0543040 | 3300046516 | Bacteria | 835 |
| 787 | Ga0495630_0007365 | 3300046517 | Bacteria | 7860 |
| 788 | Ga0495630_0494793 | 3300046517 | Bacteria | 937 |
| 789 | Ga0495631_0073853 | 3300046518 | Bacteria | 1472 |
| 790 | Ga0495631_0077469 | 3300046518 | Bacteria | 1435 |
| 791 | Ga0495632_0072875 | 3300046519 | Bacteria | 1647 |
| 792 | Ga0495632_0146648 | 3300046519 | Bacteria | 1092 |
| 793 | Ga0495637_0023062 | 3300046520 | Bacteria | 2833 |
| 794 | Ga0495643_0083759 | 3300046522 | Bacteria | 1655 |
| 795 | Ga0495643_0218538 | 3300046522 | Bacteria | 905 |
| 796 | Ga0495648_0008568 | 3300046524 | Bacteria | 8030 |
| 797 | Ga0495648_0009770 | 3300046524 | Bacteria | 7390 |
| 798 | Ga0495648_0169962 | 3300046524 | Bacteria | 1118 |
| 799 | Ga0495663_0007571 | 3300046525 | Bacteria | 3005 |
| 800 | Ga0495652_0010788 | 3300046529 | Bacteria | 8281 |
| 801 | Ga0495652_0027010 | 3300046529 | Bacteria | 5062 |
| 802 | Ga0495652_0315001 | 3300046529 | Bacteria | 1132 |
| 803 | Ga0495652_0365300 | 3300046529 | Bacteria | 1030 |
| 804 | Ga0495654_0004466 | 3300046530 | Bacteria | 8294 |
| 805 | Ga0495665_0000395 | 3300046531 | Bacteria | 22177 |
| 806 | Ga0495665_0048944 | 3300046531 | Bacteria | 2241 |
| 807 | Ga0495665_0179137 | 3300046531 | Bacteria | 1102 |
| 808 | Ga0495640_0007796 | 3300046533 | Bacteria | 8424 |
| 809 | Ga0495640_0033703 | 3300046533 | Bacteria | 3637 |
| 810 | Ga0495640_0084710 | 3300046533 | Bacteria | 2102 |
| 811 | Ga0495640_0114632 | 3300046533 | Bacteria | 1757 |
| 812 | Ga0495598_0005932 | 3300046537 | Bacteria | 2733 |
| 813 | Ga0495609_0089477 | 3300046538 | Bacteria | 1339 |
| 814 | Ga0495609_0185301 | 3300046538 | Bacteria | 875 |
| 815 | Ga0495609_0192878 | 3300046538 | Bacteria | 854 |
| 816 | Ga0495621_0017220 | 3300046539 | Bacteria | 2332 |
| 817 | Ga0495597_0057697 | 3300046542 | Bacteria | 1698 |
| 818 | Ga0495597_0071574 | 3300046542 | Bacteria | 1493 |
| 819 | Ga0495645_0065000 | 3300046543 | Bacteria | 2639 |
| 820 | Ga0495645_0077357 | 3300046543 | Bacteria | 2392 |
| 821 | Ga0495645_0085629 | 3300046543 | Bacteria | 2256 |
| 822 | Ga0495622_0007380 | 3300046557 | Bacteria | 5099 |
| 823 | Ga0495622_0010940 | 3300046557 | Bacteria | 4186 |
| 824 | Ga0495622_0022682 | 3300046557 | Bacteria | 2925 |
| 825 | Ga0495622_0130393 | 3300046557 | Bacteria | 1145 |
| 826 | Ga0495667_0002693 | 3300046559 | Bacteria | 11884 |
| 827 | Ga0495667_0023995 | 3300046559 | Bacteria | 4107 |
| 828 | Ga0495667_0128115 | 3300046559 | Bacteria | 1637 |
| 829 | Ga0495667_0455703 | 3300046559 | Bacteria | 803 |
| 830 | Ga0495656_0066589 | 3300046615 | Bacteria | 1587 |
| 831 | Ga0495668_0101316 | 3300046616 | Bacteria | 1575 |
| 832 | Ga0495668_0161542 | 3300046616 | Bacteria | 1227 |
| 833 | Ga0495668_0286712 | 3300046616 | Bacteria | 902 |
| 834 | Ga0495668_0464696 | 3300046616 | Bacteria | 697 |
| 835 | Ga0495634_0003890 | 3300046642 | Bacteria | 11859 |
| 836 | Ga0495634_0049440 | 3300046642 | Bacteria | 2828 |
| 837 | Ga0495634_0329155 | 3300046642 | Bacteria | 918 |
| 838 | Ga0495611_0125703 | 3300046648 | Bacteria | 1196 |
| 839 | Ga0495625_0026562 | 3300046660 | Bacteria | 4373 |
| 840 | Ga0495625_0129814 | 3300046660 | Bacteria | 1708 |
| 841 | Ga0495625_0192049 | 3300046660 | Bacteria | 1352 |
| 842 | Ga0495635_0037524 | 3300046663 | Bacteria | 3354 |
| 843 | Ga0495659_0004407 | 3300046664 | Bacteria | 4433 |
| 844 | Ga0495661_0014019 | 3300046665 | Bacteria | 5373 |
| 845 | Ga0495661_0068017 | 3300046665 | Bacteria | 2091 |
| 846 | Ga0495588_0005567 | 3300046674 | Bacteria | 5614 |
| 847 | Ga0495588_0040853 | 3300046674 | Bacteria | 2367 |
| 848 | Ga0495657_0004123 | 3300046675 | Bacteria | 11637 |
| 849 | Ga0495657_0248612 | 3300046675 | Bacteria | 1071 |
| 850 | Ga0495599_0039373 | 3300046678 | Bacteria | 2970 |
| 851 | Ga0495599_0199240 | 3300046678 | Bacteria | 1230 |
| 852 | Ga0495599_0286326 | 3300046678 | Bacteria | 997 |
| 853 | Ga0495623_0027805 | 3300046679 | Bacteria | 3641 |
| 854 | Ga0495646_0048511 | 3300046680 | Bacteria | 2579 |
| 855 | Ga0495646_0049700 | 3300046680 | Bacteria | 2544 |
| 856 | Ga0495647_0015017 | 3300046681 | Bacteria | 2707 |
| 857 | Ga0495658_0001708 | 3300046683 | Bacteria | 11417 |
| 858 | Ga0495658_0117171 | 3300046683 | Bacteria | 1607 |
| 859 | Ga0495658_0149753 | 3300046683 | Bacteria | 1432 |
| 860 | Ga0495669_0016657 | 3300046684 | Bacteria | 3149 |
| 861 | Ga0495669_0062078 | 3300046684 | Bacteria | 1692 |
| 862 | Ga0495669_0224628 | 3300046684 | Bacteria | 900 |
| 863 | Ga0495669_0286021 | 3300046684 | Bacteria | 794 |
| 864 | Ga0495613_0037354 | 3300046689 | Bacteria | 3601 |
| 865 | Ga0495613_0094143 | 3300046689 | Bacteria | 2168 |
| 866 | Ga0495613_0489234 | 3300046689 | Bacteria | 829 |
| 867 | Ga0495624_0194616 | 3300046690 | Bacteria | 1233 |
| 868 | Ga0495624_0269109 | 3300046690 | Bacteria | 1029 |
| 869 | Ga0495670_0018631 | 3300046691 | Bacteria | 3419 |
| 870 | Ga0495670_0050963 | 3300046691 | Bacteria | 2072 |
| 871 | Ga0495670_0057059 | 3300046691 | Bacteria | 1960 |
| 872 | Ga0495670_0077078 | 3300046691 | Bacteria | 1694 |
| 873 | Ga0495671_0008231 | 3300046692 | Bacteria | 5881 |
| 874 | Ga0495671_0172036 | 3300046692 | Bacteria | 1053 |
| 875 | Ga0495589_0071392 | 3300046794 | Bacteria | 1697 |
| 876 | Ga0495600_0088781 | 3300046809 | Bacteria | 2016 |
| 877 | Ga0495660_0012639 | 3300046810 | Bacteria | 4900 |
| 878 | Ga0495581_0000037 | 3300047315 | Bacteria | 47930 |
| 879 | Ga0495581_0067114 | 3300047315 | Bacteria | 2074 |
| 880 | Ga0495581_0092933 | 3300047315 | Bacteria | 1751 |
| 881 | Ga0495581_0217098 | 3300047315 | Bacteria | 1118 |
| 882 | Ga0495604_0015796 | 3300047317 | Bacteria | 6025 |
| 883 | Ga0495604_0080448 | 3300047317 | Bacteria | 2441 |
| 884 | Ga0495604_0197643 | 3300047317 | Bacteria | 1397 |
| 885 | Ga0495674_0000499 | 3300047319 | Bacteria | 35905 |
| 886 | Ga0495674_0299963 | 3300047319 | Bacteria | 1312 |
| 887 | Ga0495672_0010203 | 3300047320 | Bacteria | 6713 |
| 888 | Ga0495672_0025038 | 3300047320 | Bacteria | 3829 |
| 889 | Ga0495676_0072599 | 3300047321 | Bacteria | 2642 |
| 890 | Ga0495676_0171972 | 3300047321 | Bacteria | 1524 |
| 891 | Ga0495676_0256358 | 3300047321 | Bacteria | 1191 |
| 892 | Ga0495676_0427991 | 3300047321 | Bacteria | 875 |
| 893 | Ga0495680_0007828 | 3300047322 | Bacteria | 9757 |
| 894 | Ga0495680_0047752 | 3300047322 | Bacteria | 3365 |
| 895 | Ga0495687_007460 | 3300047443 | Bacteria | 6435 |
| 896 | Ga0495687_064096 | 3300047443 | Bacteria | 1502 |
| 897 | Ga0495687_082924 | 3300047443 | Bacteria | 1250 |
| 898 | Ga0495675_0021958 | 3300047444 | Bacteria | 4065 |
| 899 | Ga0495675_0097237 | 3300047444 | Bacteria | 1845 |
| 900 | Ga0495677_0010815 | 3300047445 | Bacteria | 3343 |
| 901 | Ga0495673_0117030 | 3300047469 | Bacteria | 1059 |
| 902 | Ga0495684_0004761 | 3300047471 | Bacteria | 10604 |
| 903 | Ga0495684_0009233 | 3300047471 | Bacteria | 7615 |
| 904 | Ga0495684_0448684 | 3300047471 | Bacteria | 897 |
| 905 | Ga0495686_0161363 | 3300047472 | Bacteria | 1309 |
| 906 | Ga0495593_0005039 | 3300047673 | Bacteria | 7817 |
| 907 | Ga0495593_0088364 | 3300047673 | Bacteria | 1597 |
| 908 | Ga0495593_0233537 | 3300047673 | Bacteria | 922 |
| 909 | Ga0495602_0071161 | 3300048088 | Bacteria | 2971 |
| 910 | Ga0495602_0285083 | 3300048088 | Bacteria | 1215 |
| 911 | Ga0495626_0017446 | 3300048091 | Bacteria | 3623 |
| 912 | Ga0495626_0133501 | 3300048091 | Bacteria | 1058 |
| 913 | Ga0496100_0118302 | 3300048903 | Bacteria | 1851 |
| 914 | Ga0496100_0624594 | 3300048903 | Bacteria | 838 |
| 915 | Ga0496100_0666833 | 3300048903 | Bacteria | 810 |
| 916 | Ga0496101_0016596 | 3300048904 | Bacteria | 4980 |
| 917 | Ga0496101_0078259 | 3300048904 | Bacteria | 2438 |
| 918 | Ga0496101_0154100 | 3300048904 | Bacteria | 1759 |
| 919 | Ga0496101_0245888 | 3300048904 | Bacteria | 1393 |
| 920 | Ga0496101_0573924 | 3300048904 | Bacteria | 892 |
| 921 | Ga0496102_0007995 | 3300048905 | Bacteria | 9037 |
| 922 | Ga0496102_0105126 | 3300048905 | Bacteria | 2627 |
| 923 | Ga0496102_0114675 | 3300048905 | Bacteria | 2514 |
| 924 | Ga0496102_0133455 | 3300048905 | Bacteria | 2325 |
| 925 | Ga0496102_0435364 | 3300048905 | Bacteria | 1231 |
| 926 | Ga0496102_0480087 | 3300048905 | Bacteria | 1164 |
| 927 | Ga0496102_0608825 | 3300048905 | Bacteria | 1015 |
| 928 | Ga0496103_0021683 | 3300048906 | Bacteria | 3866 |
| 929 | Ga0496103_0026466 | 3300048906 | Bacteria | 3511 |
| 930 | Ga0496103_0287995 | 3300048906 | Bacteria | 1057 |
| 931 | Ga0496104_0002953 | 3300048907 | Bacteria | 14655 |
| 932 | Ga0496104_0019560 | 3300048907 | Bacteria | 6198 |
| 933 | Ga0496104_0064707 | 3300048907 | Bacteria | 3469 |
| 934 | Ga0496104_0195370 | 3300048907 | Bacteria | 1935 |
| 935 | Ga0496104_0237253 | 3300048907 | Bacteria | 1735 |
| 936 | Ga0496104_0282510 | 3300048907 | Bacteria | 1573 |
| 937 | Ga0496104_0561854 | 3300048907 | Bacteria | 1052 |
| 938 | Ga0496105_0004911 | 3300048908 | Bacteria | 10109 |
| 939 | Ga0496105_0006535 | 3300048908 | Bacteria | 8969 |
| 940 | Ga0496105_0092349 | 3300048908 | Bacteria | 2499 |
| 941 | Ga0496105_0364485 | 3300048908 | Bacteria | 1152 |
| 942 | Ga0496106_0001534 | 3300048909 | Bacteria | 17367 |
| 943 | Ga0496106_0002682 | 3300048909 | Bacteria | 13223 |
| 944 | Ga0496106_0165162 | 3300048909 | Bacteria | 1752 |
| 945 | Ga0496106_0205698 | 3300048909 | Bacteria | 1567 |
| 946 | Ga0496106_0362496 | 3300048909 | Bacteria | 1164 |
| 947 | Ga0496106_0526338 | 3300048909 | Bacteria | 949 |
| 948 | Ga0496106_0796895 | 3300048909 | Bacteria | 749 |
| 949 | Ga0496107_0009723 | 3300048910 | Bacteria | 6669 |
| 950 | Ga0496107_0020271 | 3300048910 | Bacteria | 4694 |
| 951 | Ga0496107_0041291 | 3300048910 | Bacteria | 3312 |
| 952 | Ga0496107_0224849 | 3300048910 | Bacteria | 1396 |
| 953 | Ga0496107_0264714 | 3300048910 | Bacteria | 1279 |
| 954 | Ga0496107_0270875 | 3300048910 | Bacteria | 1264 |
| 955 | Ga0496107_0287865 | 3300048910 | Bacteria | 1223 |
| 956 | Ga0496107_0328471 | 3300048910 | Bacteria | 1138 |
| 957 | Ga0496107_0629840 | 3300048910 | Bacteria | 791 |
| 958 | Ga0496108_0000438 | 3300048911 | Bacteria | 33500 |
| 959 | Ga0496108_0086587 | 3300048911 | Bacteria | 2660 |
| 960 | Ga0496108_0311738 | 3300048911 | Bacteria | 1371 |
| 961 | Ga0496108_0359744 | 3300048911 | Bacteria | 1270 |
| 962 | Ga0496109_0000284 | 3300048912 | Bacteria | 48342 |
| 963 | Ga0496109_0049092 | 3300048912 | Bacteria | 3841 |
| 964 | Ga0496109_0119220 | 3300048912 | Bacteria | 2457 |
| 965 | Ga0496109_0126075 | 3300048912 | Bacteria | 2387 |
| 966 | Ga0496109_0163132 | 3300048912 | Bacteria | 2088 |
| 967 | Ga0496109_0226785 | 3300048912 | Bacteria | 1757 |
| 968 | Ga0496109_0615417 | 3300048912 | Bacteria | 1022 |
| 969 | Ga0496110_0013998 | 3300048913 | Bacteria | 6649 |
| 970 | Ga0496110_0027228 | 3300048913 | Bacteria | 4899 |
| 971 | Ga0496110_0118790 | 3300048913 | Bacteria | 2381 |
| 972 | Ga0496110_0196934 | 3300048913 | Bacteria | 1830 |
| 973 | Ga0496110_0361433 | 3300048913 | Bacteria | 1323 |
| 974 | Ga0496110_0363304 | 3300048913 | Bacteria | 1319 |
| 975 | Ga0496111_0003617 | 3300048914 | Bacteria | 9584 |
| 976 | Ga0496111_0188832 | 3300048914 | Bacteria | 1532 |
| 977 | Ga0496111_0248473 | 3300048914 | Bacteria | 1320 |
| 978 | Ga0496112_0000090 | 3300048915 | Bacteria | 59721 |
| 979 | Ga0496112_0012845 | 3300048915 | Bacteria | 7709 |
| 980 | Ga0496112_0026339 | 3300048915 | Bacteria | 5593 |
| 981 | Ga0496112_0032112 | 3300048915 | Bacteria | 5096 |
| 982 | Ga0496112_0041410 | 3300048915 | Bacteria | 4507 |
| 983 | Ga0496112_0045171 | 3300048915 | Bacteria | 4318 |
| 984 | Ga0496112_0048383 | 3300048915 | Bacteria | 4169 |
| 985 | Ga0496112_0104578 | 3300048915 | Bacteria | 2801 |
| 986 | Ga0496112_0851032 | 3300048915 | Bacteria | 835 |
| 987 | Ga0496113_0021967 | 3300048916 | Bacteria | 4507 |
| 988 | Ga0496113_0032368 | 3300048916 | Bacteria | 3801 |
| 989 | Ga0496113_0178351 | 3300048916 | Bacteria | 1684 |
| 990 | Ga0496114_0074265 | 3300048917 | Bacteria | 2862 |
| 991 | Ga0496114_0085219 | 3300048917 | Bacteria | 2676 |
| 992 | Ga0496114_0100146 | 3300048917 | Bacteria | 2472 |
| 993 | Ga0496114_0353929 | 3300048917 | Bacteria | 1299 |
| 994 | Ga0496114_0429457 | 3300048917 | Bacteria | 1170 |
| 995 | Ga0496114_0709835 | 3300048917 | Bacteria | 881 |
| 996 | Ga0496115_0011512 | 3300048918 | Bacteria | 6632 |
| 997 | Ga0496115_0041650 | 3300048918 | Bacteria | 3656 |
| 998 | Ga0496115_0050637 | 3300048918 | Bacteria | 3328 |
| 999 | Ga0496115_0129251 | 3300048918 | Bacteria | 2081 |
| 1000 | Ga0496115_0140415 | 3300048918 | Bacteria | 1993 |
| 1001 | Ga0496115_0182002 | 3300048918 | Bacteria | 1737 |
| 1002 | Ga0496115_0217540 | 3300048918 | Bacteria | 1577 |
| 1003 | Ga0496115_0269887 | 3300048918 | Bacteria | 1398 |
| 1004 | Ga0496115_0308792 | 3300048918 | Bacteria | 1295 |
| 1005 | Ga0496116_0039187 | 3300048919 | Bacteria | 3278 |
| 1006 | Ga0496117_0018642 | 3300048920 | Bacteria | 5738 |
| 1007 | Ga0496117_0026927 | 3300048920 | Bacteria | 4489 |
| 1008 | Ga0496117_0127817 | 3300048920 | Bacteria | 1547 |
| 1009 | Ga0496117_0154326 | 3300048920 | Bacteria | 1354 |
| 1010 | Ga0496117_0156770 | 3300048920 | Bacteria | 1339 |
| 1011 | Ga0496118_0010937 | 3300048921 | Bacteria | 8923 |
| 1012 | Ga0496118_0013220 | 3300048921 | Bacteria | 7828 |
| 1013 | Ga0496118_0043013 | 3300048921 | Bacteria | 3556 |
| 1014 | Ga0496118_0058685 | 3300048921 | Bacteria | 2873 |
| 1015 | Ga0496119_0003665 | 3300048922 | Bacteria | 15760 |
| 1016 | Ga0496119_0037454 | 3300048922 | Bacteria | 3150 |
| 1017 | Ga0496119_0211864 | 3300048922 | Bacteria | 996 |
| 1018 | Ga0496119_0214474 | 3300048922 | Bacteria | 988 |
| 1019 | Ga0496120_0009533 | 3300048923 | Bacteria | 6874 |
| 1020 | Ga0496120_0015629 | 3300048923 | Bacteria | 4997 |
| 1021 | Ga0496120_0036659 | 3300048923 | Bacteria | 2916 |
| 1022 | Ga0496120_0061579 | 3300048923 | Bacteria | 2094 |
| 1023 | Ga0496120_0196722 | 3300048923 | Bacteria | 979 |
| 1024 | Ga0496121_0000571 | 3300048924 | Bacteria | 69504 |
| 1025 | Ga0496121_0002044 | 3300048924 | Bacteria | 31940 |
| 1026 | Ga0496121_0005698 | 3300048924 | Bacteria | 15829 |
| 1027 | Ga0496121_0009006 | 3300048924 | Bacteria | 11574 |
| 1028 | Ga0496121_0021216 | 3300048924 | Bacteria | 6375 |
| 1029 | Ga0496121_0050387 | 3300048924 | Bacteria | 3518 |
| 1030 | Ga0496121_0137009 | 3300048924 | Bacteria | 1822 |
| 1031 | Ga0496121_0143830 | 3300048924 | Bacteria | 1765 |
| 1032 | Ga0496121_0147464 | 3300048924 | Bacteria | 1736 |
| 1033 | Ga0496121_0159670 | 3300048924 | Bacteria | 1650 |
| 1034 | Ga0496122_0032311 | 3300048925 | Bacteria | 4332 |
| 1035 | Ga0496122_0279424 | 3300048925 | Bacteria | 913 |
| 1036 | Ga0496123_0027188 | 3300048926 | Bacteria | 4266 |
| 1037 | Ga0496124_0001685 | 3300048927 | Bacteria | 31301 |
| 1038 | Ga0496124_0054167 | 3300048927 | Bacteria | 3396 |
| 1039 | Ga0496124_0191030 | 3300048927 | Bacteria | 1567 |
| 1040 | Ga0496124_0315592 | 3300048927 | Bacteria | 1122 |
| 1041 | Ga0496124_0333586 | 3300048927 | Bacteria | 1080 |
| 1042 | Ga0496125_0008547 | 3300048928 | Bacteria | 10696 |
| 1043 | Ga0496125_0032470 | 3300048928 | Bacteria | 4637 |
| 1044 | Ga0496125_0044277 | 3300048928 | Bacteria | 3766 |
| 1045 | Ga0496125_0051110 | 3300048928 | Bacteria | 3412 |
| 1046 | Ga0496125_0189819 | 3300048928 | Bacteria | 1358 |
| 1047 | Ga0496125_0192476 | 3300048928 | Bacteria | 1345 |
| 1048 | Ga0496125_0434044 | 3300048928 | Bacteria | 757 |
| 1049 | Ga0496126_0001940 | 3300048929 | Bacteria | 29487 |
| 1050 | Ga0496126_0011305 | 3300048929 | Bacteria | 9260 |
| 1051 | Ga0496126_0012589 | 3300048929 | Bacteria | 8658 |
| 1052 | Ga0496126_0020579 | 3300048929 | Bacteria | 6461 |
| 1053 | Ga0496126_0034993 | 3300048929 | Bacteria | 4710 |
| 1054 | Ga0496126_0035265 | 3300048929 | Bacteria | 4690 |
| 1055 | Ga0496126_0036452 | 3300048929 | Bacteria | 4598 |
| 1056 | Ga0496126_0051743 | 3300048929 | Bacteria | 3737 |
| 1057 | Ga0496126_0054192 | 3300048929 | Bacteria | 3634 |
| 1058 | Ga0496126_0084046 | 3300048929 | Bacteria | 2808 |
| 1059 | Ga0496126_0088646 | 3300048929 | Bacteria | 2725 |
| 1060 | Ga0496126_0106344 | 3300048929 | Bacteria | 2449 |
| 1061 | Ga0496126_0215996 | 3300048929 | Bacteria | 1613 |
| 1062 | Ga0496126_0228097 | 3300048929 | Bacteria | 1561 |
| 1063 | Ga0496126_0283923 | 3300048929 | Bacteria | 1370 |
| 1064 | Ga0495682_0007587 | 3300049460 | Bacteria | 4308 |
| 1065 | Ga0495682_0090317 | 3300049460 | Bacteria | 1100 |
| 1066 | Ga0495682_0159291 | 3300049460 | Bacteria | 804 |
| 1067 | Ga0501031_0004229 | 3300049568 | Bacteria | 9276 |
| 1068 | Ga0501031_0022815 | 3300049568 | Bacteria | 4081 |
| 1069 | Ga0501032_0005576 | 3300049569 | Bacteria | 9333 |
| 1070 | Ga0501032_0008917 | 3300049569 | Bacteria | 7292 |
| 1071 | Ga0501032_0026485 | 3300049569 | Bacteria | 3987 |
| 1072 | Ga0501033_0001252 | 3300049570 | Bacteria | 22748 |
| 1073 | Ga0501033_0002138 | 3300049570 | Bacteria | 17097 |
| 1074 | Ga0501033_0010457 | 3300049570 | Bacteria | 7117 |
| 1075 | Ga0501033_0015364 | 3300049570 | Bacteria | 5809 |
| 1076 | Ga0501033_0308681 | 3300049570 | Bacteria | 1112 |
| 1077 | Ga0501034_0000417 | 3300049571 | Bacteria | 71512 |
| 1078 | Ga0501034_0091175 | 3300049571 | Bacteria | 3045 |
| 1079 | Ga0501034_0230850 | 3300049571 | Bacteria | 1800 |
| 1080 | Ga0501036_0007704 | 3300049572 | Bacteria | 8795 |
| 1081 | Ga0501036_0124734 | 3300049572 | Bacteria | 2174 |
| 1082 | Ga0501036_0126547 | 3300049572 | Bacteria | 2158 |
| 1083 | Ga0501036_0242142 | 3300049572 | Bacteria | 1513 |
| 1084 | Ga0501037_0000156 | 3300049573 | Bacteria | 63938 |
| 1085 | Ga0501037_0004921 | 3300049573 | Bacteria | 9721 |
| 1086 | Ga0501037_0103996 | 3300049573 | Bacteria | 2048 |
| 1087 | Ga0501037_0140803 | 3300049573 | Bacteria | 1726 |
| 1088 | Ga0501038_0000164 | 3300049574 | Bacteria | 56139 |
| 1089 | Ga0501038_0002067 | 3300049574 | Bacteria | 18586 |
| 1090 | Ga0501038_0038092 | 3300049574 | Bacteria | 4211 |
| 1091 | Ga0501038_0060185 | 3300049574 | Bacteria | 3250 |
| 1092 | Ga0501038_0130779 | 3300049574 | Bacteria | 2061 |
| 1093 | Ga0501038_0137484 | 3300049574 | Bacteria | 2001 |
| 1094 | Ga0501039_0000457 | 3300049575 | Bacteria | 29700 |
| 1095 | Ga0501039_0009452 | 3300049575 | Bacteria | 7432 |
| 1096 | Ga0501039_0045721 | 3300049575 | Bacteria | 3382 |
| 1097 | Ga0501039_0073043 | 3300049575 | Bacteria | 2666 |
| 1098 | Ga0501039_0108017 | 3300049575 | Bacteria | 2175 |
| 1099 | Ga0501039_0148154 | 3300049575 | Bacteria | 1844 |
| 1100 | Ga0501039_0787607 | 3300049575 | Bacteria | 742 |
| 1101 | Ga0501040_0003098 | 3300049576 | Bacteria | 10777 |
| 1102 | Ga0501041_0021842 | 3300049577 | Bacteria | 3834 |
| 1103 | Ga0501042_0076593 | 3300049578 | Bacteria | 2394 |
| 1104 | Ga0501042_0100031 | 3300049578 | Bacteria | 2084 |
| 1105 | Ga0501043_0000617 | 3300049579 | Bacteria | 31394 |
| 1106 | Ga0501043_0004274 | 3300049579 | Bacteria | 11628 |
| 1107 | Ga0501043_0023016 | 3300049579 | Bacteria | 4886 |
| 1108 | Ga0501043_0164488 | 3300049579 | Bacteria | 1732 |
| 1109 | Ga0501043_0563045 | 3300049579 | Bacteria | 845 |
| 1110 | Ga0501046_0000304 | 3300049580 | Bacteria | 49687 |
| 1111 | Ga0501046_0031928 | 3300049580 | Bacteria | 4266 |
| 1112 | Ga0501046_0049248 | 3300049580 | Bacteria | 3333 |
| 1113 | Ga0501046_0054572 | 3300049580 | Bacteria | 3142 |
| 1114 | Ga0501047_0000739 | 3300049581 | Bacteria | 34062 |
| 1115 | Ga0501047_0021855 | 3300049581 | Bacteria | 6143 |
| 1116 | Ga0501047_0342840 | 3300049581 | Bacteria | 1331 |
| 1117 | Ga0501047_0392041 | 3300049581 | Bacteria | 1222 |
| 1118 | Ga0501047_0486122 | 3300049581 | Bacteria | 1062 |
| 1119 | Ga0501048_0001982 | 3300049582 | Bacteria | 15559 |
| 1120 | Ga0501048_0071488 | 3300049582 | Bacteria | 2449 |
| 1121 | Ga0501048_0075721 | 3300049582 | Bacteria | 2375 |
| 1122 | Ga0501067_0001170 | 3300049583 | Bacteria | 14229 |
| 1123 | Ga0501067_0005434 | 3300049583 | Bacteria | 7075 |
| 1124 | Ga0501068_0000092 | 3300049584 | Bacteria | 38245 |
| 1125 | Ga0501068_0007115 | 3300049584 | Bacteria | 6193 |
| 1126 | Ga0501068_0034398 | 3300049584 | Bacteria | 3022 |
| 1127 | Ga0501069_0026949 | 3300049585 | Bacteria | 3148 |
| 1128 | Ga0501070_0003917 | 3300049586 | Bacteria | 12845 |
| 1129 | Ga0501070_0089886 | 3300049586 | Bacteria | 2541 |
| 1130 | Ga0501072_0000981 | 3300049588 | Bacteria | 21075 |
| 1131 | Ga0501072_0069835 | 3300049588 | Bacteria | 2773 |
| 1132 | Ga0501073_0000309 | 3300049589 | Bacteria | 32261 |
| 1133 | Ga0501073_0010512 | 3300049589 | Bacteria | 6782 |
| 1134 | Ga0501073_0264178 | 3300049589 | Bacteria | 1188 |
| 1135 | Ga0501073_0310870 | 3300049589 | Bacteria | 1087 |
| 1136 | Ga0501074_0000051 | 3300049590 | Bacteria | 56446 |
| 1137 | Ga0501074_0103930 | 3300049590 | Bacteria | 2033 |
| 1138 | Ga0501076_0534345 | 3300049592 | Bacteria | 967 |
| 1139 | Ga0501077_0045933 | 3300049593 | Bacteria | 2775 |
| 1140 | Ga0501079_0008257 | 3300049741 | Bacteria | 7893 |
| 1141 | Ga0501079_0012954 | 3300049741 | Bacteria | 6360 |
| 1142 | Ga0501080_0004599 | 3300049742 | Bacteria | 12301 |
| 1143 | Ga0501080_0278926 | 3300049742 | Bacteria | 1520 |
| 1144 | Ga0501083_0000276 | 3300049744 | Bacteria | 32596 |
| 1145 | Ga0501083_0024290 | 3300049744 | Bacteria | 4199 |
| 1146 | Ga0501035_0003055 | 3300049822 | Bacteria | 16049 |
| 1147 | Ga0501035_0010916 | 3300049822 | Bacteria | 8411 |
| 1148 | Ga0501035_0060737 | 3300049822 | Bacteria | 3365 |
| 1149 | Ga0501035_0136279 | 3300049822 | Bacteria | 2137 |
| 1150 | Ga0501035_0200136 | 3300049822 | Bacteria | 1713 |
| 1151 | Ga0501035_0253058 | 3300049822 | Bacteria | 1495 |
| 1152 | Ga0501035_0479898 | 3300049822 | Bacteria | 1025 |
| 1153 | Ga0501044_0005655 | 3300049823 | Bacteria | 13861 |
| 1154 | Ga0501044_0015923 | 3300049823 | Bacteria | 8091 |
| 1155 | Ga0501044_0030430 | 3300049823 | Bacteria | 5690 |
| 1156 | Ga0501044_0059675 | 3300049823 | Bacteria | 3908 |
| 1157 | Ga0501044_0071441 | 3300049823 | Bacteria | 3529 |
| 1158 | Ga0501044_0230031 | 3300049823 | Bacteria | 1802 |
| 1159 | Ga0501044_0313630 | 3300049823 | Bacteria | 1494 |
| 1160 | Ga0501044_0506812 | 3300049823 | Bacteria | 1107 |
| 1161 | Ga0501045_0006640 | 3300049824 | Bacteria | 8019 |
| 1162 | nmdc:mga03683_23142_c1 | 3300050489 | Bacteria | 2416 |
| 1163 | nmdc:mga03683_51528_c1 | 3300050489 | Bacteria | 1718 |
| 1164 | nmdc:mga03n38_14107_c1 | 3300050490 | Bacteria | 3056 |
| 1165 | nmdc:mga00v17_12435_c1 | 3300050491 | Bacteria | 4697 |
| 1166 | nmdc:mga00v17_328007_c1 | 3300050491 | Bacteria | 994 |
| 1167 | nmdc:mga0yw44_104106_c1 | 3300050492 | Bacteria | 1811 |
| 1168 | nmdc:mga0yw44_143268_c1 | 3300050492 | Bacteria | 1554 |
| 1169 | nmdc:mga0yw44_288949_c1 | 3300050492 | Bacteria | 1097 |
| 1170 | nmdc:mga0yw44_35812_c1 | 3300050492 | Bacteria | 2920 |
| 1171 | nmdc:mga0yw44_43176_c1 | 3300050492 | Bacteria | 2691 |
| 1172 | nmdc:mga0yw44_9908_c1 | 3300050492 | Bacteria | 4843 |
| 1173 | nmdc:mga0k408_31278_c1 | 3300050493 | Bacteria | 3038 |
| 1174 | nmdc:mga0k408_335517_c1 | 3300050493 | Bacteria | 902 |
| 1175 | nmdc:mga06z11_21544_c1 | 3300050494 | Bacteria | 2996 |
| 1176 | nmdc:mga04h51_18212_c1 | 3300050495 | Bacteria | 2065 |
| 1177 | nmdc:mga04h51_52527_c1 | 3300050495 | Bacteria | 1373 |
| 1178 | nmdc:mga07m45_23537_c2 | 3300050496 | Bacteria | 1267 |
| 1179 | nmdc:mga07m45_34403_c1 | 3300050496 | Bacteria | 2816 |
| 1180 | nmdc:mga09592_498483_c1 | 3300050508 | Bacteria | 1048 |
| 1181 | nmdc:mga08y16_174216_c1 | 3300050511 | Bacteria | 2234 |
| 1182 | nmdc:mga0n895_563477_c1 | 3300050512 | Bacteria | 1144 |
| 1183 | nmdc:mga0rr50_20625_c1 | 3300050513 | Bacteria | 4481 |
| 1184 | nmdc:mga0sz30_150175_c1 | 3300050516 | Bacteria | 1031 |
| 1185 | nmdc:mga0sz30_2295_c1 | 3300050516 | Bacteria | 6830 |
| 1186 | nmdc:mga0sz30_50523_c1 | 3300050516 | Bacteria | 1763 |
| 1187 | Ga0495601_0049088 | 3300053077 | Bacteria | 2660 |
| 1188 | Ga0495601_0227975 | 3300053077 | Bacteria | 1217 |
| 1189 | Ga0495612_0085023 | 3300053078 | Bacteria | 1333 |
| 1190 | Ga0500635_0016398 | 3300053080 | Bacteria | 2203 |
| 1191 | Ga0500635_0114726 | 3300053080 | Bacteria | 1003 |
| 1192 | Ga0495655_0015329 | 3300053083 | Bacteria | 1627 |
| 1193 | Ga0495595_0054793 | 3300053084 | Bacteria | 1855 |
| 1194 | Ga0495619_0003869 | 3300053085 | Bacteria | 9622 |
| 1195 | Ga0495619_0064649 | 3300053085 | Bacteria | 2439 |
| 1196 | Ga0500578_0041025 | 3300053086 | Bacteria | 2974 |
| 1197 | Ga0500643_000028 | 3300053087 | Bacteria | 245672 |
| 1198 | Ga0500643_006922 | 3300053087 | Bacteria | 4660 |
| 1199 | Ga0500644_0004653 | 3300053088 | Bacteria | 3442 |
| 1200 | Ga0500651_0027045 | 3300053093 | Bacteria | 3606 |
| 1201 | Ga0500651_0054621 | 3300053093 | Bacteria | 2502 |
| 1202 | Ga0500651_0063127 | 3300053093 | Bacteria | 2312 |
| 1203 | Ga0500566_0004102 | 3300053094 | Bacteria | 8686 |
| 1204 | Ga0500566_0023555 | 3300053094 | Bacteria | 3615 |
| 1205 | Ga0500566_0165438 | 3300053094 | Bacteria | 1148 |
| 1206 | Ga0500641_0005429 | 3300053096 | Bacteria | 4518 |
| 1207 | Ga0500641_0006195 | 3300053096 | Bacteria | 4241 |
| 1208 | Ga0500641_0013290 | 3300053096 | Bacteria | 3022 |
| 1209 | Ga0500650_0102863 | 3300053098 | Bacteria | 1336 |
| 1210 | Ga0500554_067098 | 3300053102 | Bacteria | 1161 |
| 1211 | Ga0500555_005200 | 3300053103 | Bacteria | 3691 |
| 1212 | Ga0500556_0000051 | 3300053104 | Bacteria | 119031 |
| 1213 | Ga0500556_0002319 | 3300053104 | Bacteria | 6243 |
| 1214 | Ga0500556_0082667 | 3300053104 | Bacteria | 1216 |
| 1215 | Ga0500557_000127 | 3300053105 | Bacteria | 20158 |
| 1216 | Ga0500569_049232 | 3300053109 | Bacteria | 1265 |
| 1217 | Ga0500569_055369 | 3300053109 | Bacteria | 1209 |
| 1218 | Ga0500592_001710 | 3300053116 | Bacteria | 3556 |
| 1219 | Ga0500594_0124599 | 3300053118 | Bacteria | 811 |
| 1220 | Ga0500595_000141 | 3300053119 | Bacteria | 46988 |
| 1221 | Ga0500595_008509 | 3300053119 | Bacteria | 4187 |
| 1222 | Ga0500595_012407 | 3300053119 | Bacteria | 3298 |
| 1223 | Ga0500595_013681 | 3300053119 | Bacteria | 3103 |
| 1224 | Ga0500595_030082 | 3300053119 | Bacteria | 1834 |
| 1225 | Ga0500607_016454 | 3300053121 | Bacteria | 4240 |
| 1226 | Ga0500607_142469 | 3300053121 | Bacteria | 1125 |
| 1227 | Ga0500608_000364 | 3300053122 | Bacteria | 17525 |
| 1228 | Ga0500608_092763 | 3300053122 | Bacteria | 1409 |
| 1229 | Ga0500642_0000041 | 3300053130 | Bacteria | 89564 |
| 1230 | Ga0500642_0000174 | 3300053130 | Bacteria | 26656 |
| 1231 | Ga0500642_0003706 | 3300053130 | Bacteria | 4666 |
| 1232 | Ga0500652_009360 | 3300053131 | Bacteria | 3311 |
| 1233 | Ga0500658_0058930 | 3300053134 | Bacteria | 1591 |
| 1234 | Ga0500658_0102230 | 3300053134 | Bacteria | 1252 |
| 1235 | Ga0500559_0000878 | 3300053136 | Bacteria | 19226 |
| 1236 | Ga0500559_0067464 | 3300053136 | Bacteria | 1606 |
| 1237 | Ga0500559_0132545 | 3300053136 | Bacteria | 1164 |
| 1238 | Ga0500568_0006215 | 3300053139 | Bacteria | 6031 |
| 1239 | Ga0500568_0009795 | 3300053139 | Bacteria | 4529 |
| 1240 | Ga0500568_0039918 | 3300053139 | Bacteria | 1892 |
| 1241 | Ga0500577_0003046 | 3300053142 | Bacteria | 4324 |
| 1242 | Ga0500585_100240 | 3300053144 | Bacteria | 1044 |
| 1243 | Ga0500590_199889 | 3300053148 | Bacteria | 847 |
| 1244 | Ga0500603_004904 | 3300053150 | Bacteria | 2868 |
| 1245 | Ga0500603_005027 | 3300053150 | Bacteria | 2837 |
| 1246 | Ga0500604_0028195 | 3300053151 | Bacteria | 1629 |
| 1247 | Ga0500616_0000150 | 3300053153 | Bacteria | 117918 |
| 1248 | Ga0500616_0000408 | 3300053153 | Bacteria | 58453 |
| 1249 | Ga0500616_0124189 | 3300053153 | Bacteria | 1229 |
| 1250 | Ga0500620_033895 | 3300053155 | Bacteria | 1636 |
| 1251 | Ga0500622_0004154 | 3300053156 | Bacteria | 9267 |
| 1252 | Ga0500622_0074804 | 3300053156 | Bacteria | 1705 |
| 1253 | Ga0500627_0179982 | 3300053158 | Bacteria | 951 |
| 1254 | Ga0500627_0188176 | 3300053158 | Bacteria | 927 |
| 1255 | Ga0500633_0115842 | 3300053160 | Bacteria | 995 |
| 1256 | Ga0500638_010096 | 3300053162 | Bacteria | 4115 |
| 1257 | Ga0500636_0003573 | 3300053177 | Bacteria | 8763 |
| 1258 | Ga0500636_0010474 | 3300053177 | Bacteria | 5411 |
| 1259 | Ga0500636_0032237 | 3300053177 | Bacteria | 3101 |
| 1260 | Ga0500636_0270208 | 3300053177 | Bacteria | 855 |
| 1261 | Ga0500637_0000311 | 3300053178 | Bacteria | 18186 |
| 1262 | Ga0500637_0011488 | 3300053178 | Bacteria | 4583 |
| 1263 | Ga0500637_0013210 | 3300053178 | Bacteria | 4324 |
| 1264 | Ga0500570_145036 | 3300053724 | Bacteria | 861 |
| 1265 | Ga0500657_124126 | 3300053728 | Bacteria | 1016 |
| 1266 | Ga0500625_008973 | 3300053729 | Bacteria | 4444 |
| 1267 | Ga0500645_012425 | 3300053730 | Bacteria | 2751 |
| 1268 | Ga0500552_020207 | 3300053733 | Bacteria | 940 |
| 1269 | Ga0500599_000989 | 3300053736 | Bacteria | 3182 |
| 1270 | Ga0500601_000420 | 3300053737 | Bacteria | 7101 |
| 1271 | Ga0501084_0005554 | 3300054114 | Bacteria | 10350 |
| 1272 | Ga0501084_0115581 | 3300054114 | Bacteria | 2255 |
| 1273 | Ga0500661_013901 | 3300055283 | Bacteria | 1450 |
| 1274 | Ga0500661_025906 | 3300055283 | Bacteria | 1037 |
| 1275 | Ga0501082_0026337 | 3300060353 | Bacteria | 5010 |
| 1276 | Ga0501082_0087083 | 3300060353 | Bacteria | 2694 |
| 1277 | Ga0501082_0790994 | 3300060353 | Bacteria | 830 |
| 1278 | 2507504426 | 2507262055 | Bacteria | 8048963 |
| 1279 | 2508545854 | 2508501009 | Bacteria | 7784016 |
| 1280 | 2508694681 | 2508501042 | Bacteria | 8719808 |
| 1281 | 2509146408 | 2508501128 | Bacteria | 8613869 |
| 1282 | 2511396418 | 2511231028 | Bacteria | 8046582 |
| 1283 | 2513624232 | 2513237092 | Bacteria | 8341956 |
| 1284 | 2513638720 | 2513237094 | Bacteria | 8789602 |
| 1285 | 2513649192 | 2513237095 | Bacteria | 8976980 |
| 1286 | 2513656218 | 2513237096 | Bacteria | 8722461 |
| 1287 | 2513673372 | 2513237098 | Bacteria | 9902361 |
| 1288 | 2513694637 | 2513237101 | Bacteria | 7952346 |
| 1289 | 2513702120 | 2513237102 | Bacteria | 7703324 |
| 1290 | 2513716706 | 2513237104 | Bacteria | 10034502 |
| 1291 | 2513860681 | 2513237137 | Bacteria | 9558895 |
| 1292 | 2513874191 | 2513237139 | Bacteria | 8737671 |
| 1293 | 2513892502 | 2513237141 | Bacteria | 8496279 |
| 1294 | 2513917603 | 2513237145 | Bacteria | 8979722 |
| 1295 | 2514010051 | 2513237161 | Bacteria | 8871253 |
| 1296 | 2515624400 | 2515154112 | Bacteria | 8294334 |
| 1297 | 2517103091 | 2517093001 | Bacteria | 9002274 |
| 1298 | 2517887738 | 2517572143 | Bacteria | 9484767 |
| 1299 | 2524438925 | 2524023205 | Bacteria | 8918781 |
| 1300 | 2524470912 | 2524023210 | Bacteria | 9029266 |
| 1301 | 2524535403 | 2524023228 | Bacteria | 10118060 |
| 1302 | 2528849425 | 2528768022 | Bacteria | 10457665 |
| 1303 | 2603862432 | 2602042107 | Bacteria | 6226103 |
| 1304 | 2617350310 | 2617270735 | Bacteria | 9163226 |
| 1305 | 2617374396 | 2617270741 | Bacteria | 8201522 |
| 1306 | 2644290271 | 2643221651 | Bacteria | 4798932 |
| 1307 | 2671120751 | 2667528175 | Bacteria | 7532676 |
| 1308 | 2723842451 | 2721755755 | Bacteria | 8322773 |
| 1309 | 2728748304 | 2728368998 | Bacteria | 8720350 |
| 1310 | 2745081980 | 2744054633 | Bacteria | 8678936 |
| 1311 | 2793059311 | 2791355196 | Bacteria | 7323613 |
| 1312 | 2793070475 | 2791355197 | Bacteria | 8420563 |
| 1313 | 2793078695 | |||
| 1314 | 2805920909 | 2802429603 | Bacteria | 8777136 |
| 1315 | 2818240579 | 2816332527 | Bacteria | 8933356 |
| 1316 | 2824604684 | 2824600985 | Bacteria | 8488197 |
| 1317 | 2824615397 | 2824609381 | Bacteria | 8672835 |
| 1318 | 2824618854 | 2824617872 | Bacteria | 8814715 |
| 1319 | 2824628960 | 2824626560 | Bacteria | 8813858 |
| 1320 | 2824639253 | 2824635225 | Bacteria | 8785348 |
| 1321 | 2824648827 | 2824644064 | Bacteria | 8743947 |
| 1322 | 2824658643 | 2824653114 | Bacteria | 8493680 |
| 1323 | 2824665825 | 2824661429 | Bacteria | 9877870 |
| 1324 | 2824675100 | 2824671348 | Bacteria | 8369588 |
| 1325 | 2824686249 | 2824679649 | Bacteria | 8248951 |
| 1326 | 2824692537 | 2824687955 | Bacteria | 8360029 |
| 1327 | 2824700900 | 2824696289 | Bacteria | 8335049 |
| 1328 | 2824711300 | 2824704595 | Bacteria | 9667483 |
| 1329 | 2824717538 | 2824714736 | Bacteria | 8717648 |
| 1330 | 2824726770 | 2824723954 | Bacteria | 8758240 |
| 1331 | 2824737689 | 2824732956 | Bacteria | 7810675 |
| 1332 | 2824751202 | 2824746037 | Bacteria | 7911610 |
| 1333 | 2824759684 | 2824753945 | Bacteria | 9787441 |
| 1334 | 2824769935 | 2824763712 | Bacteria | 9792355 |
| 1335 | 2824780317 | 2824773399 | Bacteria | 8360218 |
| 1336 | 2838126041 | 2838122688 | Bacteria | 8803140 |
| 1337 | 2841942565 | 2841941048 | Bacteria | 8688029 |
| 1338 | 2841953085 | 2841949485 | Bacteria | 8680857 |
| 1339 | 2841963938 | 2841957949 | Bacteria | 8652217 |
| 1340 | 2841970890 | 2841966195 | Bacteria | 8673214 |
| 1341 | 2841977850 | 2841974524 | Bacteria | 8931498 |
| 1342 | 2841984586 | 2841983080 | Bacteria | 8395090 |
| 1343 | 2842041690 | 2842038055 | Bacteria | 8002051 |
| 1344 | 2842049732 | 2842045827 | Bacteria | 8006841 |
| 1345 | 2844321420 | 2844315083 | Bacteria | 8138177 |
| 1346 | 2847931981 | 2847930680 | Bacteria | 9342022 |
| 1347 | 2847943228 | 2847939898 | Bacteria | 8606328 |
| 1348 | 2849076957 | 2849076700 | Bacteria | 7039503 |
| 1349 | 2857514774 | 2857509624 | Bacteria | 7472071 |
| 1350 | 2857525679 | 2857524615 | Bacteria | 6615449 |
| 1351 | 2874595628 | 2874590934 | Bacteria | 8299676 |
| 1352 | 2874606863 | 2874604998 | Bacteria | 7834745 |
| 1353 | 2874620377 | 2874612657 | Bacteria | 8252029 |
| 1354 | 2874621865 | 2874620515 | Bacteria | 8290088 |
| 1355 | 2874629651 | 2874628541 | Bacteria | 8630250 |
| 1356 | 2874651738 | 2874645413 | Bacteria | 8214782 |
| 1357 | 2876769219 | 2876761206 | Bacteria | 10111113 |
| 1358 | 2876775823 | 2876771140 | Bacteria | 8287509 |
| 1359 | 2876821634 | 2876818435 | Bacteria | 8274608 |
| 1360 | 2879079914 | 2879074833 | Bacteria | 8279565 |
| 1361 | 2879085663 | 2879083081 | Bacteria | 8587928 |
| 1362 | 2879104502 | 2879099564 | Bacteria | 10442239 |
| 1363 | 2879112297 | 2879110137 | Bacteria | 8907982 |
| 1364 | 2879133999 | 2879127579 | Bacteria | 8294491 |
| 1365 | 2879148484 | 2879142872 | Bacteria | 8267021 |
| 1366 | 2881364631 | 2881364244 | Bacteria | 7710352 |
| 1367 | 2881671352 | 2881665667 | Bacteria | 8175609 |
| 1368 | 2885374397 | 2885366525 | Bacteria | 8326213 |
| 1369 | 2885383288 | 2885374607 | Bacteria | 8927485 |
| 1370 | 2885391149 | 2885383462 | Bacteria | 9473874 |
| 1371 | 2885413482 | 2885409591 | Bacteria | 9235467 |
| 1372 | 2888387257 | 2888378607 | Bacteria | 9652610 |
| 1373 | 2888391444 | 2888388044 | Bacteria | 7304136 |
| 1374 | 2888426939 | 2888419890 | Bacteria | 7857137 |
| 1375 | 2889034320 | 2889033259 | Bacteria | 9099371 |
| 1376 | 2893071761 | 2893066018 | Bacteria | 6158120 |
| 1377 | 2903728001 | 2903727486 | Bacteria | 8281579 |
| 1378 | 2903755489 | 2903748898 | Bacteria | 9972761 |
| 1379 | 2903776235 | 2903768456 | Bacteria | 9749579 |
| 1380 | 2904669542 | 2904666416 | Bacteria | 8226587 |
| 1381 | 2904691869 | 2904690495 | Bacteria | 9412302 |
| 1382 | 2904709529 | |||
| 1383 | 2904713645 | 2904711408 | Bacteria | 9771557 |
| 1384 | 2906602515 | 2906602504 | Bacteria | 8295279 |
| 1385 | 2906612752 | |||
| 1386 | 2906635108 | 2906626472 | Bacteria | 8826946 |
| 1387 | 2906640578 | 2906635258 | Bacteria | 8601019 |
| 1388 | 2906649706 | 2906643746 | Bacteria | 8722424 |
| 1389 | 2906663198 | 2906660503 | Bacteria | 8595048 |
| 1390 | 2908745944 | 2908739725 | Bacteria | 8628932 |
| 1391 | 2908763972 | 2908756301 | Bacteria | 8864324 |
| 1392 | 2908776878 | 2908775508 | Bacteria | 8092255 |
| 1393 | 2919074529 | 2919073203 | Bacteria | 6531949 |
| 1394 | 2922364900 | 2922361189 | Bacteria | 7436256 |
| 1395 | 2922370319 | |||
| 1396 | 2922391636 | 2922386360 | Bacteria | 7017218 |
| 1397 | 2922398857 | 2922393267 | Bacteria | 8285685 |
| 1398 | 2922433229 | |||
| 1399 | 2929622625 | 2929615660 | Bacteria | 9193770 |
| 1400 | 2929632272 | 2929624759 | Bacteria | 9339455 |
| 1401 | 2932790032 | 2932784394 | Bacteria | 9704911 |
| 1402 | 2932800700 | 2932794094 | Bacteria | 7915132 |
| 1403 | 2932808431 | 2932801729 | Bacteria | 7987968 |
| 1404 | 2932815575 | 2932809354 | Bacteria | 9135765 |
| 1405 | 2932824849 | 2932818245 | Bacteria | 9955613 |
| 1406 | 2932829111 | 2932828146 | Bacteria | 9745859 |
| 1407 | 2933584743 | 2933577622 | Bacteria | 9116884 |
| 1408 | 2935613169 | 2935608549 | Bacteria | 8203142 |
| 1409 | 2935617587 | 2935616580 | Bacteria | 9032984 |
| 1410 | 2935630574 | 2935630451 | Bacteria | 8169952 |
| 1411 | 2935643632 | 2935638405 | Bacteria | 10015038 |
| 1412 | 2935654127 | 2935648319 | Bacteria | 8801166 |
| 1413 | 2935662771 | 2935656913 | Bacteria | 8965014 |
| 1414 | 2935671058 | 2935665750 | Bacteria | 9571747 |
| 1415 | 2935681701 | 2935675223 | Bacteria | 9928132 |
| 1416 | 2935692678 | 2935684952 | Bacteria | 9590419 |
| 1417 | 2935702665 | 2935694250 | Bacteria | 9291695 |
| 1418 | 2935711952 | 2935703347 | Bacteria | 10242284 |
| 1419 | 2935721296 | 2935713505 | Bacteria | 9608509 |
| 1420 | 2935730710 | 2935722832 | Bacteria | 9608746 |
| 1421 | 2935739986 | 2935732158 | Bacteria | 9706831 |
| 1422 | 2935749024 | 2935741537 | Bacteria | 9707219 |
| 1423 | 2935758894 | 2935750917 | Bacteria | 9590372 |
| 1424 | 2935767159 | 2935760218 | Bacteria | 9817913 |
| 1425 | 2935774811 | 2935769743 | Bacteria | 7878163 |
| 1426 | 2935780003 | 2935777560 | Bacteria | 8077691 |
| 1427 | 2935792989 | 2935785616 | Bacteria | 7962367 |
| 1428 | 2935798559 | 2935793552 | Bacteria | 8012592 |
| 1429 | 2935806923 | 2935801545 | Bacteria | 9301974 |
| 1430 | 2935818812 | 2935810662 | Bacteria | 9401221 |
| 1431 | 2935824979 | 2935819856 | Bacteria | 8261050 |
| 1432 | 2935834317 | 2935827899 | Bacteria | 10038562 |
| 1433 | 2935843958 | 2935837841 | Bacteria | 9454360 |
| 1434 | 2935852198 | 2935847175 | Bacteria | 8228321 |
| 1435 | 2935856914 | 2935855204 | Bacteria | 9035059 |
| 1436 | 2935868441 | 2935864058 | Bacteria | 9784707 |
| 1437 | 2935879751 | 2935873716 | Bacteria | 9632195 |
| 1438 | 2935883538 | 2935883170 | Bacteria | 7964738 |
| 1439 | 2935910632 | 2935908558 | Bacteria | 8568796 |
| 1440 | 2935921812 | 2935916978 | Bacteria | 9113783 |
| 1441 | 2935930049 | 2935926038 | Bacteria | 8601059 |
| 1442 | 2935937717 | 2935934488 | Bacteria | 8602579 |
| 1443 | 2935949821 | 2935942939 | Bacteria | 8599779 |
| 1444 | 2935956917 | 2935951376 | Bacteria | 8602333 |
| 1445 | 2935965374 | 2935959822 | Bacteria | 7869783 |
| 1446 | 2935970826 | 2935967501 | Bacteria | 8603075 |
| 1447 | 2935980141 | 2935975950 | Bacteria | 8347125 |
| 1448 | 2935984310 | 2935984226 | Bacteria | 8302647 |
| 1449 | 2935997258 | 2935992306 | Bacteria | 9802711 |
| 1450 | 2936010004 | 2936002035 | Bacteria | 9362176 |
| 1451 | 2936017032 | 2936011229 | Bacteria | 8801034 |
| 1452 | 2936025560 | 2936019824 | Bacteria | 8804134 |
| 1453 | 2936034402 | 2936028420 | Bacteria | 8965941 |
| 1454 | 2936045502 | 2936037263 | Bacteria | 9446081 |
| 1455 | 2936052564 | 2936046547 | Bacteria | 8903709 |
| 1456 | 2936055390 | 2936055302 | Bacteria | 8785755 |
| 1457 | 2940564516 | 2940556831 | Bacteria | 9590747 |
| 1458 | 2941507226 | 2941507105 | Bacteria | 8166816 |
| 1459 | 2941520304 | 2941515067 | Bacteria | 8166720 |
| 1460 | 2941523639 | 2941523033 | Bacteria | 8169134 |
| 1461 | 2941531996 | 2941531003 | Bacteria | 7653939 |
| 1462 | 2941545206 | 2941538514 | Bacteria | 9402094 |
| 1463 | 3005482825 | 3005474847 | Bacteria | 9259049 |
| 1464 | 3005490830 | 3005483717 | Bacteria | 7877331 |
| 1465 | 3005506578 | 3005506211 | Bacteria | 6943378 |
| 1466 | 3005588715 | 3005587118 | Bacteria | 7794411 |
| 1467 | 3005601783 | 3005594810 | Bacteria | 8716512 |
| 1468 | 3005717517 | 3005710791 | Bacteria | 7622528 |
| 1469 | 3005724464 | 3005718088 | Bacteria | 8283608 |
| 1470 | 8006927547 | 8006926726 | Bacteria | 6749210 |
| 1471 | 8006935129 | 8006933436 | Bacteria | 10410654 |
| 1472 | 8006965337 | 8006964411 | Bacteria | 8966052 |
| 1473 | 8006975097 | 8006973647 | Bacteria | 10679141 |
| 1474 | 8006993399 | 8006984368 | Bacteria | 9651211 |
| 1475 | 8006995478 | 8006994254 | Bacteria | 8309700 |
| 1476 | 8016519109 | 8016511872 | Bacteria | 9921665 |
| 1477 | 8016525205 | 8016522445 | Bacteria | 8156687 |
| 1478 | 8016538788 | 8016530956 | Bacteria | 8155261 |
| 1479 | 8016543071 | 8016539877 | Bacteria | 8155419 |
| 1480 | 8016550221 | 8016548790 | Bacteria | 8155074 |
| 1481 | 8016558627 | 8016557553 | Bacteria | 8154380 |
| 1482 | 8016581128 | 8016575299 | Bacteria | 8154085 |
| 1483 | 8016587581 | 8016583857 | Bacteria | 10421953 |
| 1484 | 8016596609 | 8016595262 | Bacteria | 8149947 |
| 1485 | 8016607479 | 8016603502 | Bacteria | 8731218 |
| 1486 | 8016619274 | 8016613128 | Bacteria | 8794220 |
| 1487 | 8016636828 | 8016630954 | Bacteria | 9217207 |
| 1488 | 8017057593 | 8017057580 | Bacteria | 10023680 |
| 1489 | 8019538454 | 8019530166 | Bacteria | 8155624 |
| 1490 | 8019541366 | 8019538911 | Bacteria | 7872763 |
| 1491 | 8019549260 | 8019547302 | Bacteria | 7996444 |
| 1492 | 8019563572 | 8019555841 | Bacteria | 9642137 |
| 1493 | 8019573641 | 8019565922 | Bacteria | 9639779 |
| 1494 | 8019578226 | 8019576017 | Bacteria | 10049540 |
| 1495 | 8019605434 | 8019597564 | Bacteria | 10041141 |
| 1496 | 8019613105 | 8019608314 | Bacteria | 10042931 |
| 1497 | 8019623793 | 8019619141 | Bacteria | 9218857 |
| 1498 | 8019638245 | 8019629233 | Bacteria | 8687553 |
| 1499 | 8019641394 | 8019638758 | Bacteria | 9062356 |
| 1500 | 8019651639 | 8019648815 | Bacteria | 10014479 |
| 1501 | 8019666164 | 8019659431 | Bacteria | 8577854 |
| 1502 | 8019675671 | 8019668869 | Bacteria | 8791617 |
| 1503 | 8019695391 | 8019687851 | Bacteria | 8712826 |
| 1504 | 8055750508 | 8055742211 | Bacteria | 9226248 |
| 1505 | 8056678993 | 8056673599 | Bacteria | 7871253 |
| 1506 | 8056681736 | 8056681323 | Bacteria | 8472857 |
| 1507 | 8056692851 | 8056689827 | Bacteria | 6712655 |
| 1508 | 8056975293 | 8056967851 | Bacteria | 9038162 |
| 1509 | Ga0068865_100270148 | |||
| 1510 | JGI24740J21852_10034575 | |||
| 1511 | JGI24739J22299_10059577 | |||
| 1512 | JGI24737J22298_10039047 | |||
| 1513 | JGI24735J21928_10063092 | |||
| 1514 | JGI24034J26672_10030416 | |||
| 1515 | JGI24742J22300_10030193 | |||
| 1516 | JGI25406J46586_10000081 | |||
| 1517 | JGI25406J46586_10012034 | |||
| 1518 | JGI25165J46597_1018010 | |||
| 1519 | JGI25153J46596_10004550 | |||
| 1520 | JGI25153J46596_10025326 | |||
| 1521 | JGI25153J46596_10043473 | |||
| 1522 | JGI25160J50197_1000829 | |||
| 1523 | JGI25160J50197_1001208 | |||
| 1524 | JGI25404J52841_10007604 | |||
| 1525 | Ga0055526_1052591 | |||
| 1526 | Ga0055531_10002243 | |||
| 1527 | Ga0065165_1000370 | |||
| 1528 | Ga0065165_1003163 | |||
| 1529 | Ga0065165_1007682 | |||
| 1530 | Ga0070658_10017799 | |||
| 1531 | Ga0070658_10092636 | |||
| 1532 | Ga0070658_10269959 | |||
| 1533 | Ga0070658_10705812 | |||
| 1534 | Ga0070690_100481109 | |||
| 1535 | Ga0068869_100092594 | |||
| 1536 | Ga0068869_100213252 | |||
| 1537 | Ga0070680_100064863 | |||
| 1538 | Ga0070680_100147579 | |||
| 1539 | Ga0070680_100505061 | |||
| 1540 | Ga0070682_100211858 | |||
| 1541 | Ga0068868_100045614 | |||
| 1542 | Ga0068868_100340219 | |||
| 1543 | Ga0070660_100005164 | |||
| 1544 | Ga0070660_100285260 | |||
| 1545 | Ga0070660_100303267 | |||
| 1546 | Ga0070691_10189163 | |||
| 1547 | Ga0070661_100009758 | |||
| 1548 | Ga0070661_100508579 | |||
| 1549 | Ga0070668_100102225 | |||
| 1550 | Ga0070668_100118511 | |||
| 1551 | Ga0070668_100498830 | |||
| 1552 | Ga0070668_100593019 | |||
| 1553 | Ga0070668_100619190 | |||
| 1554 | Ga0070669_100112414 | |||
| 1555 | Ga0070669_100363384 | |||
| 1556 | Ga0070671_100146173 | |||
| 1557 | Ga0070671_100162483 | |||
| 1558 | Ga0070671_100382112 | |||
| 1559 | Ga0070674_100036979 | |||
| 1560 | Ga0070674_100325033 | |||
| 1561 | Ga0070688_100603015 | |||
| 1562 | Ga0070667_100470660 | |||
| 1563 | Ga0070667_100598551 | |||
| 1564 | Ga0070709_10000683 | |||
| 1565 | Ga0070709_10007897 | |||
| 1566 | Ga0070709_10077703 | |||
| 1567 | Ga0070709_10080184 | |||
| 1568 | Ga0070714_100028423 | |||
| 1569 | Ga0070714_100044019 | |||
| 1570 | Ga0070714_100124798 | |||
| 1571 | Ga0070714_100174433 | |||
| 1572 | Ga0070714_100475181 | |||
| 1573 | Ga0070714_100639602 | |||
| 1574 | Ga0070713_100007562 | |||
| 1575 | Ga0070713_100028530 | |||
| 1576 | Ga0070713_100121742 | |||
| 1577 | Ga0070713_100681411 | |||
| 1578 | Ga0070710_10007651 | |||
| 1579 | Ga0070710_10012117 | |||
| 1580 | Ga0070711_100016292 | |||
| 1581 | Ga0070711_100024517 | |||
| 1582 | Ga0070711_100041462 | |||
| 1583 | Ga0070711_100366261 | |||
| 1584 | Ga0070700_100121553 | |||
| 1585 | Ga0070708_100354922 | |||
| 1586 | Ga0070663_100011265 | |||
| 1587 | Ga0070663_100011993 | |||
| 1588 | Ga0070663_100061990 | |||
| 1589 | Ga0070663_100062509 | |||
| 1590 | Ga0070663_100127319 | |||
| 1591 | Ga0070663_100145532 | |||
| 1592 | Ga0070663_100225717 | |||
| 1593 | Ga0070663_100233703 | |||
| 1594 | Ga0070663_100368656 | |||
| 1595 | Ga0070663_100377028 | |||
| 1596 | Ga0070678_100089774 | |||
| 1597 | Ga0070678_100105754 | |||
| 1598 | Ga0070678_100335349 | |||
| 1599 | Ga0070678_100430805 | |||
| 1600 | Ga0070662_100030852 | |||
| 1601 | Ga0070662_100110957 | |||
| 1602 | Ga0070662_100118180 | |||
| 1603 | Ga0070662_100420789 | |||
| 1604 | Ga0070681_10007799 | |||
| 1605 | Ga0070681_10093506 | |||
| 1606 | Ga0068867_100262542 | |||
| 1607 | Ga0068867_100617273 | |||
| 1608 | Ga0070707_100314508 | |||
| 1609 | Ga0070698_100210588 | |||
| 1610 | Ga0070679_100015888 | |||
| 1611 | Ga0070679_100038175 | |||
| 1612 | Ga0070679_100222276 | |||
| 1613 | Ga0070679_100531808 | |||
| 1614 | Ga0070684_100070098 | |||
| 1615 | Ga0068853_100001993 | |||
| 1616 | Ga0068853_100059849 | |||
| 1617 | Ga0068853_100387598 | |||
| 1618 | Ga0068853_100424306 | |||
| 1619 | Ga0070686_100034196 | |||
| 1620 | Ga0070665_100011107 | |||
| 1621 | Ga0070665_100099117 | |||
| 1622 | Ga0070665_100162314 | |||
| 1623 | Ga0070665_100288534 | |||
| 1624 | Ga0070665_100624496 | |||
| 1625 | Ga0070665_101187924 | |||
| 1626 | Ga0068855_100008845 | |||
| 1627 | Ga0068855_100021063 | |||
| 1628 | Ga0068855_100049395 | |||
| 1629 | Ga0068855_100117367 | |||
| 1630 | Ga0068855_100212536 | |||
| 1631 | Ga0068855_100297006 | |||
| 1632 | Ga0068855_100326778 | |||
| 1633 | Ga0070664_100574431 | |||
| 1634 | Ga0070664_100946260 | |||
| 1635 | Ga0068857_100019981 | |||
| 1636 | Ga0068857_100024793 | |||
| 1637 | Ga0068857_100026031 | |||
| 1638 | Ga0068857_100053517 | |||
| 1639 | Ga0068857_100497738 | |||
| 1640 | Ga0068857_100575564 | |||
| 1641 | Ga0068854_100055722 | |||
| 1642 | Ga0068854_100357069 | |||
| 1643 | Ga0068854_100518108 | |||
| 1644 | Ga0068854_100897929 | |||
| 1645 | Ga0068856_100000226 | |||
| 1646 | Ga0068856_100013591 | |||
| 1647 | Ga0068856_100173656 | |||
| 1648 | Ga0068856_100336826 | |||
| 1649 | Ga0068856_100565188 | |||
| 1650 | Ga0068852_100043038 | |||
| 1651 | Ga0068852_100065894 | |||
| 1652 | Ga0068852_100107874 | |||
| 1653 | Ga0068852_100236571 | |||
| 1654 | Ga0068852_100273425 | |||
| 1655 | Ga0068852_100404973 | |||
| 1656 | Ga0068859_100534282 | |||
| 1657 | Ga0068859_100682342 | |||
| 1658 | Ga0068864_100128362 | |||
| 1659 | Ga0068864_100193657 | |||
| 1660 | Ga0068866_10246142 | |||
| 1661 | Ga0068861_100044595 | |||
| 1662 | Ga0068861_100206411 | |||
| 1663 | Ga0068861_100550303 | |||
| 1664 | Ga0068851_10016208 | |||
| 1665 | Ga0068851_10053452 | |||
| 1666 | Ga0068863_100066570 | |||
| 1667 | Ga0068863_100226973 | |||
| 1668 | Ga0068858_100171027 | |||
| 1669 | Ga0068858_100176774 | |||
| 1670 | Ga0068860_100244034 | |||
| 1671 | Ga0068860_100452704 | |||
| 1672 | Ga0068860_100999042 | |||
| 1673 | Ga0068862_100069837 | |||
| 1674 | Ga0068862_100189575 | |||
| 1675 | Ga0068862_100226244 | |||
| 1676 | Ga0068862_100331902 | |||
| 1677 | Ga0081455_10004766 | |||
| 1678 | Ga0081455_10020570 | |||
| 1679 | Ga0081455_10142581 | |||
| 1680 | Ga0081538_10026047 | |||
| 1681 | Ga0081540_1002522 | |||
| 1682 | Ga0081540_1002586 | |||
| 1683 | Ga0081540_1004666 | |||
| 1684 | Ga0081540_1004860 | |||
| 1685 | Ga0081540_1008255 | |||
| 1686 | Ga0081540_1013787 | |||
| 1687 | Ga0081540_1033364 | |||
| 1688 | Ga0081540_1048561 | |||
| 1689 | Ga0081540_1054280 | |||
| 1690 | Ga0081540_1059367 | |||
| 1691 | Ga0081539_10000461 | |||
| 1692 | Ga0081539_10002797 | |||
| 1693 | Ga0081539_10201860 | |||
| 1694 | Ga0070717_10001762 | |||
| 1695 | Ga0070717_10002235 | |||
| 1696 | Ga0070717_10226510 | |||
| 1697 | Ga0070717_10332399 | |||
| 1698 | Ga0070717_10440277 | |||
| 1699 | Ga0075365_10047628 | |||
| 1700 | Ga0075365_10057556 | |||
| 1701 | Ga0075365_10145411 | |||
| 1702 | Ga0075365_10169893 | |||
| 1703 | Ga0075365_10174248 | |||
| 1704 | Ga0075368_10058421 | |||
| 1705 | Ga0075363_100089300 | |||
| 1706 | Ga0075364_10024726 | |||
| 1707 | Ga0075364_10035699 | |||
| 1708 | Ga0075364_10090415 | |||
| 1709 | Ga0075364_10176114 | |||
| 1710 | Ga0075364_10332650 | |||
| 1711 | Ga0075432_10153259 | |||
| 1712 | Ga0070716_100006994 | |||
| 1713 | Ga0070716_100368526 | |||
| 1714 | Ga0070716_100504939 | |||
| 1715 | Ga0070712_100028123 | |||
| 1716 | Ga0070712_100037712 | |||
| 1717 | Ga0070712_100112710 | |||
| 1718 | Ga0070712_100334596 | |||
| 1719 | Ga0070712_100413973 | |||
| 1720 | Ga0075362_10142285 | |||
| 1721 | Ga0075367_10050515 | |||
| 1722 | Ga0075367_10114566 | |||
| 1723 | Ga0075367_10240800 | |||
| 1724 | Ga0075367_10290495 | |||
| 1725 | Ga0075367_10292677 | |||
| 1726 | Ga0075367_10328898 | |||
| 1727 | Ga0075369_10021181 | |||
| 1728 | Ga0075369_10033402 | |||
| 1729 | Ga0075369_10077695 | |||
| 1730 | Ga0075369_10143784 | |||
| 1731 | Ga0097621_100275598 | |||
| 1732 | Ga0075370_10045185 | |||
| 1733 | Ga0075370_10246806 | |||
| 1734 | Ga0075370_10271456 | |||
| 1735 | Ga0068871_100083760 | |||
| 1736 | Ga0068871_100290074 | |||
| 1737 | Ga0068871_100490232 | |||
| 1738 | Ga0075428_100185896 | |||
| 1739 | Ga0075429_100435594 | |||
| 1740 | Ga0068865_100542538 | |||
| 1741 | Ga0097620_100534263 | |||
| 1742 | Ga0097620_100682326 | |||
| 1743 | Ga0099825_1036925 | |||
| 1744 | Ga0099824_1007227 | |||
| 1745 | Ga0099824_1017577 | |||
| 1746 | Ga0099822_1005717 | |||
| 1747 | Ga0099823_1008742 | |||
| 1748 | Ga0075435_100006891 | |||
| 1749 | Ga0099794_10042881 | |||
| 1750 | Ga0099795_10001991 | |||
| 1751 | Ga0105250_10226993 | |||
| 1752 | Ga0105240_10013959 | |||
| 1753 | Ga0105240_10014054 | |||
| 1754 | Ga0105240_10040849 | |||
| 1755 | Ga0105240_10050894 | |||
| 1756 | Ga0105240_10056236 | |||
| 1757 | Ga0105240_10547935 | |||
| 1758 | Ga0105240_10632355 | |||
| 1759 | Ga0111539_10043707 | |||
| 1760 | Ga0105245_10023421 | |||
| 1761 | Ga0105245_10758021 | |||
| 1762 | Ga0105247_10009405 | |||
| 1763 | Ga0105247_10058758 | |||
| 1764 | Ga0105247_10105147 | |||
| 1765 | Ga0105247_10161683 | |||
| 1766 | Ga0105247_10257845 | |||
| 1767 | Ga0105247_10470997 | |||
| 1768 | Ga0114129_10550389 | |||
| 1769 | Ga0105243_10087129 | |||
| 1770 | Ga0105243_10374055 | |||
| 1771 | Ga0105243_10641060 | |||
| 1772 | Ga0105243_10645411 | |||
| 1773 | Ga0105241_10004545 | |||
| 1774 | Ga0105241_10149193 | |||
| 1775 | Ga0105241_10195554 | |||
| 1776 | Ga0105242_10351796 | |||
| 1777 | Ga0105242_10717647 | |||
| 1778 | Ga0105248_10716530 | |||
| 1779 | Ga0105237_10007960 | |||
| 1780 | Ga0105237_10026951 | |||
| 1781 | Ga0105237_10030213 | |||
| 1782 | Ga0105237_10039289 | |||
| 1783 | Ga0105237_10039787 | |||
| 1784 | Ga0105237_10050359 | |||
| 1785 | Ga0105237_10209106 | |||
| 1786 | Ga0105237_10352445 | |||
| 1787 | Ga0105237_10470755 | |||
| 1788 | Ga0105237_10654564 | |||
| 1789 | Ga0105238_10001176 | |||
| 1790 | Ga0105238_10029351 | |||
| 1791 | Ga0105238_10419376 | |||
| 1792 | Ga0105238_10443781 | |||
| 1793 | Ga0105249_10106290 | |||
| 1794 | Ga0099796_10057177 | |||
| 1795 | Ga0105239_10017508 | |||
| 1796 | Ga0105239_10038465 | |||
| 1797 | Ga0105239_10128447 | |||
| 1798 | Ga0105239_10171193 | |||
| 1799 | Ga0105239_10197232 | |||
| 1800 | Ga0105239_10657049 | |||
| 1801 | Ga0105239_10779251 | |||
| 1802 | Ga0105246_10028115 | |||
| 1803 | Ga0105246_10264285 | |||
| 1804 | Ga0157343_1004575 | |||
| 1805 | Ga0157370_10060204 | |||
| 1806 | Ga0157370_10163325 | |||
| 1807 | Ga0157370_10291238 | |||
| 1808 | Ga0157369_10004958 | |||
| 1809 | Ga0157369_10014414 | |||
| 1810 | Ga0157369_10030732 | |||
| 1811 | Ga0157369_10030744 | |||
| 1812 | Ga0157369_10826944 | |||
| 1813 | Ga0157374_10099137 | |||
| 1814 | Ga0157374_11057407 | |||
| 1815 | Ga0163162_10027557 | |||
| 1816 | Ga0163162_10279585 | |||
| 1817 | Ga0163162_10527541 | |||
| 1818 | Ga0157372_10361750 | |||
| 1819 | Ga0163163_10192343 | |||
| 1820 | Ga0163163_10327618 | |||
| 1821 | Ga0163163_10332623 | |||
| 1822 | Ga0163163_10662010 | |||
| 1823 | Ga0163163_10874900 | |||
| 1824 | Ga0157380_10522411 | |||
| 1825 | Ga0157379_10056635 | |||
| 1826 | Ga0157379_10419728 | |||
| 1827 | Ga0157376_10026136 | |||
| 1828 | Ga0163161_10246013 | |||
| 1829 | Ga0163161_10338792 | |||
| 1830 | Ga0214544_1000003 | |||
| 1831 | Ga0214542_1000003 | |||
| 1832 | Ga0214545_1000004 | |||
| 1833 | Ga0214543_1000007 | |||
| 1834 | Ga0213872_10029016 | |||
| 1835 | Ga0213874_10007521 | |||
| 1836 | Ga0213876_10023140 | |||
| 1837 | Ga0213876_10075715 | |||
| 1838 | Ga0213871_10052440 | |||
| 1839 | Ga0224712_10153828 | |||
| 1840 | Ga0209563_102179 | |||
| 1841 | Ga0209677_100607 | |||
| 1842 | Ga0209677_106579 | |||
| 1843 | Ga0209148_1000998 | |||
| 1844 | Ga0209233_1012176 | |||
| 1845 | Ga0209233_1015743 | |||
| 1846 | Ga0209233_1016001 | |||
| 1847 | Ga0209233_1017966 | |||
| 1848 | Ga0209233_1020887 | |||
| 1849 | Ga0209455_1000711 | |||
| 1850 | Ga0209455_1005632 | |||
| 1851 | Ga0209455_1015674 | |||
| 1852 | Ga0209564_1001190 | |||
| 1853 | Ga0209564_1016775 | |||
| 1854 | Ga0209564_1018469 | |||
| 1855 | Ga0209758_1000030 | |||
| 1856 | Ga0209758_1000277 | |||
| 1857 | Ga0209758_1001754 | |||
| 1858 | Ga0209758_1004789 | |||
| 1859 | Ga0209758_1028967 | |||
| 1860 | Ga0209758_1057311 | |||
| 1861 | Ga0209758_1075248 | |||
| 1862 | Ga0209256_1011379 | |||
| 1863 | Ga0209256_1020794 | |||
| 1864 | Ga0207426_1000271 | |||
| 1865 | Ga0207426_1000913 | |||
| 1866 | Ga0207426_1021235 | |||
| 1867 | Ga0207426_1039009 | |||
| 1868 | Ga0209051_1077321 | |||
| 1869 | Ga0209257_1000947 | |||
| 1870 | Ga0209257_1029045 | |||
| 1871 | Ga0207697_10056662 | |||
| 1872 | Ga0207656_10001009 | |||
| 1873 | Ga0207656_10127230 | |||
| 1874 | Ga0207656_10197500 | |||
| 1875 | Ga0207653_10092121 | |||
| 1876 | Ga0207692_10000396 | |||
| 1877 | Ga0207710_10039449 | |||
| 1878 | Ga0207688_10010005 | |||
| 1879 | Ga0207688_10059119 | |||
| 1880 | Ga0207688_10112352 | |||
| 1881 | Ga0207688_10249884 | |||
| 1882 | Ga0207647_10052442 | |||
| 1883 | Ga0207647_10128616 | |||
| 1884 | Ga0207647_10205388 | |||
| 1885 | Ga0207685_10023468 | |||
| 1886 | Ga0207685_10036159 | |||
| 1887 | Ga0207699_10000506 | |||
| 1888 | Ga0207699_10017577 | |||
| 1889 | Ga0207699_10468119 | |||
| 1890 | Ga0207645_10201120 | |||
| 1891 | Ga0207643_10130903 | |||
| 1892 | Ga0207705_10027863 | |||
| 1893 | Ga0207654_10001189 | |||
| 1894 | Ga0207654_10107546 | |||
| 1895 | Ga0207707_10001378 | |||
| 1896 | Ga0207707_10004787 | |||
| 1897 | Ga0207707_10019821 | |||
| 1898 | Ga0207707_10323444 | |||
| 1899 | Ga0207695_10005181 | |||
| 1900 | Ga0207695_10026278 | |||
| 1901 | Ga0207695_10029019 | |||
| 1902 | Ga0207695_10054124 | |||
| 1903 | Ga0207695_10058640 | |||
| 1904 | Ga0207695_10126249 | |||
| 1905 | Ga0207695_10206864 | |||
| 1906 | Ga0207695_10509689 | |||
| 1907 | Ga0207671_10025307 | |||
| 1908 | Ga0207671_10026212 | |||
| 1909 | Ga0207671_10037186 | |||
| 1910 | Ga0207671_10053272 | |||
| 1911 | Ga0207671_10067250 | |||
| 1912 | Ga0207671_10241471 | |||
| 1913 | Ga0207671_10266059 | |||
| 1914 | Ga0207693_10004427 | |||
| 1915 | Ga0207693_10026084 | |||
| 1916 | Ga0207693_10055856 | |||
| 1917 | Ga0207693_10063883 | |||
| 1918 | Ga0207693_10279210 | |||
| 1919 | Ga0207663_10000893 | |||
| 1920 | Ga0207663_10014297 | |||
| 1921 | Ga0207663_10035267 | |||
| 1922 | Ga0207660_10015291 | |||
| 1923 | Ga0207660_10039604 | |||
| 1924 | Ga0207660_10056603 | |||
| 1925 | Ga0207660_10608155 | |||
| 1926 | Ga0207657_10004291 | |||
| 1927 | Ga0207657_10011254 | |||
| 1928 | Ga0207649_10398346 | |||
| 1929 | Ga0207652_10034951 | |||
| 1930 | Ga0207652_10044378 | |||
| 1931 | Ga0207652_10454217 | |||
| 1932 | Ga0207652_10517784 | |||
| 1933 | Ga0207646_10485207 | |||
| 1934 | Ga0207681_10118888 | |||
| 1935 | Ga0207694_10000719 | |||
| 1936 | Ga0207694_10032793 | |||
| 1937 | Ga0207694_10048591 | |||
| 1938 | Ga0207694_10145540 | |||
| 1939 | Ga0207694_10261019 | |||
| 1940 | Ga0207694_10283514 | |||
| 1941 | Ga0207694_10347160 | |||
| 1942 | Ga0207694_10349051 | |||
| 1943 | Ga0207659_10488012 | |||
| 1944 | Ga0207687_10015241 | |||
| 1945 | Ga0207687_10156318 | |||
| 1946 | Ga0207700_10004999 | |||
| 1947 | Ga0207700_10029357 | |||
| 1948 | Ga0207700_10089326 | |||
| 1949 | Ga0207700_10515352 | |||
| 1950 | Ga0207700_10922244 | |||
| 1951 | Ga0207664_10092659 | |||
| 1952 | Ga0207664_10095627 | |||
| 1953 | Ga0207664_10115426 | |||
| 1954 | Ga0207664_10117454 | |||
| 1955 | Ga0207664_10135274 | |||
| 1956 | Ga0207664_10653140 | |||
| 1957 | Ga0207644_10091110 | |||
| 1958 | Ga0207644_10091767 | |||
| 1959 | Ga0207644_10377256 | |||
| 1960 | Ga0207644_10489912 | |||
| 1961 | Ga0207690_10042474 | |||
| 1962 | Ga0207706_10010327 | |||
| 1963 | Ga0207706_10326460 | |||
| 1964 | Ga0207706_10572481 | |||
| 1965 | Ga0207686_10401604 | |||
| 1966 | Ga0207669_10010714 | |||
| 1967 | Ga0207669_10498838 | |||
| 1968 | Ga0207704_10311582 | |||
| 1969 | Ga0207665_10076644 | |||
| 1970 | Ga0207665_10118421 | |||
| 1971 | Ga0207665_10342000 | |||
| 1972 | Ga0207691_10022979 | |||
| 1973 | Ga0207711_10030704 | |||
| 1974 | Ga0207711_10325154 | |||
| 1975 | Ga0207689_10096244 | |||
| 1976 | Ga0207689_10119085 | |||
| 1977 | Ga0207689_10157237 | |||
| 1978 | Ga0207689_10250026 | |||
| 1979 | Ga0207661_10011425 | |||
| 1980 | Ga0207661_10016081 | |||
| 1981 | Ga0207661_10018986 | |||
| 1982 | Ga0207679_10408739 | |||
| 1983 | Ga0207667_10008537 | |||
| 1984 | Ga0207667_10008887 | |||
| 1985 | Ga0207667_10011455 | |||
| 1986 | Ga0207667_10071605 | |||
| 1987 | Ga0207667_10211342 | |||
| 1988 | Ga0207667_10491677 | |||
| 1989 | Ga0207651_10246219 | |||
| 1990 | Ga0207712_10144849 | |||
| 1991 | Ga0207668_10055842 | |||
| 1992 | Ga0207668_10089279 | |||
| 1993 | Ga0207668_10095789 | |||
| 1994 | Ga0207668_10505317 | |||
| 1995 | Ga0207640_10008213 | |||
| 1996 | Ga0207640_10057350 | |||
| 1997 | Ga0207640_10304191 | |||
| 1998 | Ga0207640_10329032 | |||
| 1999 | Ga0207640_10889702 | |||
| 2000 | Ga0207677_10040604 | |||
| 2001 | Ga0207677_10310611 | |||
| 2002 | Ga0207677_10467410 | |||
| 2003 | Ga0207703_10138867 | |||
| 2004 | Ga0207703_10395872 | |||
| 2005 | Ga0207639_10003011 | |||
| 2006 | Ga0207639_10011122 | |||
| 2007 | Ga0207639_10139409 | |||
| 2008 | Ga0207639_10164748 | |||
| 2009 | Ga0207639_10288181 | |||
| 2010 | Ga0207678_10012518 | |||
| 2011 | Ga0207678_10028890 | |||
| 2012 | Ga0207678_10044475 | |||
| 2013 | Ga0207678_10046223 | |||
| 2014 | Ga0207678_10051151 | |||
| 2015 | Ga0207678_10067071 | |||
| 2016 | Ga0207678_10261061 | |||
| 2017 | Ga0207678_10282689 | |||
| 2018 | Ga0207678_10502784 | |||
| 2019 | Ga0207678_10691587 | |||
| 2020 | Ga0207708_10179092 | |||
| 2021 | Ga0207702_10000191 | |||
| 2022 | Ga0207702_10000938 | |||
| 2023 | Ga0207702_10151553 | |||
| 2024 | Ga0207702_10174928 | |||
| 2025 | Ga0207641_10168200 | |||
| 2026 | Ga0207641_10437919 | |||
| 2027 | Ga0207641_10925629 | |||
| 2028 | Ga0207648_10068173 | |||
| 2029 | Ga0207648_10088934 | |||
| 2030 | Ga0207648_10494684 | |||
| 2031 | Ga0207676_10249689 | |||
| 2032 | Ga0207676_10252223 | |||
| 2033 | Ga0207676_10360496 | |||
| 2034 | Ga0207674_10015534 | |||
| 2035 | Ga0207674_10024882 | |||
| 2036 | Ga0207674_10025851 | |||
| 2037 | Ga0207674_10087858 | |||
| 2038 | Ga0207674_10526896 | |||
| 2039 | Ga0207674_10580151 | |||
| 2040 | Ga0207675_100128208 | |||
| 2041 | Ga0207675_100180691 | |||
| 2042 | Ga0207675_100393557 | |||
| 2043 | Ga0207675_100503487 | |||
| 2044 | Ga0207683_10083353 | |||
| 2045 | Ga0207683_10156406 | |||
| 2046 | Ga0207683_10180779 | |||
| 2047 | Ga0207683_10205022 | |||
| 2048 | Ga0207683_10452446 | |||
| 2049 | Ga0207698_10034211 | |||
| 2050 | Ga0207698_10054754 | |||
| 2051 | Ga0207698_10182140 | |||
| 2052 | Ga0207698_10305660 | |||
| 2053 | Ga0209389_1000193 | |||
| 2054 | Ga0209389_1000207 | |||
| 2055 | Ga0209589_1000024 | |||
| 2056 | Ga0209589_1000025 | |||
| 2057 | Ga0209489_100039 | |||
| 2058 | Ga0209489_101741 | |||
| 2059 | Ga0209489_101963 | |||
| 2060 | Ga0209700_100043 | |||
| 2061 | Ga0209700_100420 | |||
| 2062 | Ga0209179_1054355 | |||
| 2063 | Ga0209588_1007005 | |||
| 2064 | Ga0209813_10018664 | |||
| 2065 | Ga0209813_10075582 | |||
| 2066 | Ga0207428_10228213 | |||
| 2067 | Ga0268266_10003056 | |||
| 2068 | Ga0268266_10003703 | |||
| 2069 | Ga0268266_10029112 | |||
| 2070 | Ga0268266_10194830 | |||
| 2071 | Ga0268266_10275029 | |||
| 2072 | Ga0268266_10340770 | |||
| 2073 | Ga0268265_10070116 | |||
| 2074 | Ga0268265_10207239 | |||
| 2075 | Ga0268265_10253413 | |||
| 2076 | Ga0268265_10346048 | |||
| 2077 | Ga0268264_10000051 | |||
| 2078 | Ga0268264_10191049 | |||
| 2079 | Ga0265337_1007383 | |||
| 2080 | Ga0265319_1009743 | |||
| 2081 | Ga0265334_10001692 | |||
| 2082 | Ga0265323_10008924 | |||
| 2083 | Ga0265336_10009566 | |||
| 2084 | Ga0307517_10005748 | |||
| 2085 | Ga0307515_10110960 | |||
| 2086 | Ga0265338_10000231 | |||
| 2087 | Ga0265330_10044930 | |||
| 2088 | Ga0265340_10020047 | |||
| 2089 | Ga0265339_10004944 | |||
| 2090 | Ga0265339_10024066 | |||
| 2091 | Ga0265331_10042928 | |||
| 2092 | Ga0265331_10049490 | |||
| 2093 | Ga0265316_10371105 | |||
| 2094 | Ga0307513_10215645 | |||
| 2095 | Ga0307509_10030718 | |||
| 2096 | Ga0307509_10150798 | |||
| 2097 | Ga0307509_10312717 | |||
| 2098 | Ga0307509_10569584 | |||
| 2099 | Ga0307508_10000152 | |||
| 2100 | Ga0307508_10058929 | |||
| 2101 | Ga0307508_10149960 | |||
| 2102 | Ga0307508_10516090 | |||
| 2103 | Ga0265314_10002968 | |||
| 2104 | Ga0265314_10044116 | |||
| 2105 | Ga0265314_10219964 | |||
| 2106 | Ga0265342_10011951 | |||
| 2107 | Ga0265342_10076076 | |||
| 2108 | Ga0265342_10079404 | |||
| 2109 | Ga0265342_10264907 | |||
| 2110 | Ga0307516_10001267 | |||
| 2111 | Ga0307516_10031057 | |||
| 2112 | Ga0307516_10073820 | |||
| 2113 | Ga0307516_10074213 | |||
| 2114 | Ga0307405_10059938 | |||
| 2115 | Ga0307405_10237076 | |||
| 2116 | Ga0307407_10150254 | |||
| 2117 | Ga0307407_10622708 | |||
| 2118 | Ga0307409_101287410 | |||
| 2119 | Ga0307416_100783114 | |||
| 2120 | Ga0307415_100271049 | |||
| 2121 | Ga0307415_100415298 | |||
| 2122 | Ga0307507_10022911 | |||
| 2123 | Ga0307510_10011169 | |||
| 2124 | Ga0307510_10038624 | |||
| 2125 | Ga0307510_10109970 | |||
| 2126 | Ga0307510_10117120 | |||
| 2127 | Ga0307510_10164220 | |||
| 2128 | Ga0315911_1000023 | |||
| 2129 | Ga0373930_0052197 | |||
| 2130 | Ga0373926_0027374 | |||
| 2131 | Ga0373929_0039365 | |||
| 2132 | Ga0373934_0061754 | |||
| 2133 | Ga0373949_0059408 | |||
| 2134 | Ga0373952_0012160 | |||
| 2135 | Ga0373936_0018508 | |||
| 2136 | Ga0373945_0007634 | |||
| 2137 | Ga0373953_0042103 | |||
| 2138 | Ga0373954_0008023 | |||
| 2139 | Ga0373954_0140367 | |||
| 2140 | Ga0373957_0018309 | |||
| 2141 | Ga0373957_0022368 | |||
| 2142 | Ga0373943_0013757 | |||
| 2143 | Ga0373943_0148931 | |||
| 2144 | Ga0373943_0150781 | |||
| 2145 | Ga0373946_0017770 | |||
| 2146 | Ga0373955_0017796 | |||
| 2147 | Ga0373955_0021131 | |||
| 2148 | Ga0373924_0013622 | |||
| 2149 | Ga0373935_0181513 | |||
| 2150 | Ga0373935_0547588 | |||
| 2151 | Ga0373927_0002222 | |||
| 2152 | Ga0373927_0005329 | |||
| 2153 | Ga0373927_0010638 | |||
| 2154 | Ga0373927_0011810 | |||
| 2155 | Ga0373927_0022460 | |||
| 2156 | Ga0373927_0041347 | |||
| 2157 | Ga0373927_0069624 | |||
| 2158 | Ga0373933_0000018 | |||
| 2159 | Ga0373933_0024431 | |||
| 2160 | Ga0373947_0002696 | |||
| 2161 | Ga0373947_0042175 | |||
| 2162 | Ga0373947_0052878 | |||
| 2163 | Ga0373947_0180540 | |||
| 2164 | Ga0373947_0291999 | |||
| 2165 | Ga0373937_0160231 | |||
| 2166 | Ga0373937_0370114 | |||
| 2167 | Ga0373937_0490218 | |||
| 2168 | Ga0373937_0902749 | |||
| 2169 | Ga0373925_0020019 | |||
| 2170 | Ga0373925_0049643 | |||
| 2171 | Ga0373925_0050903 | |||
| 2172 | Ga0373925_0122786 | |||
| 2173 | Ga0373925_0239995 | |||
| 2174 | Ga0395899_0168634 | |||
| 2175 | Ga0395900_0070034 | |||
| 2176 | Ga0395900_0078178 | |||
| 2177 | Ga0395900_0172996 | |||
| 2178 | Ga0395900_0359079 | |||
| 2179 | Ga0395900_0527449 | |||
| 2180 | Ga0395898_0035897 | |||
| 2181 | Ga0395898_0042754 | |||
| 2182 | Ga0395898_0085845 | |||
| 2183 | Ga0395898_0527750 | |||
| 2184 | Ga0395898_0933169 | |||
| 2185 | Ga0395905_0001838 | |||
| 2186 | Ga0395905_0123229 | |||
| 2187 | Ga0395905_0216793 | |||
| 2188 | Ga0395905_0223618 | |||
| 2189 | Ga0395905_0743806 | |||
| 2190 | Ga0436364_0120583 | |||
| 2191 | Ga0436364_0428944 | |||
| 2192 | Ga0436364_1215160 | |||
| 2193 | Ga0395901_0005769 | |||
| 2194 | Ga0395901_0079476 | |||
| 2195 | Ga0395901_0205585 | |||
| 2196 | Ga0395901_0247426 | |||
| 2197 | Ga0395901_0325248 | |||
| 2198 | Ga0395901_0327270 | |||
| 2199 | Ga0395901_0378597 | |||
| 2200 | Ga0395901_0478536 | |||
| 2201 | Ga0436365_0068950 | |||
| 2202 | Ga0436365_0099807 | |||
| 2203 | Ga0436365_0490213 | |||
| 2204 | Ga0436365_0959812 | |||
| 2205 | Ga0436365_1559462 | |||
| 2206 | Ga0436365_1694116 | |||
| 2207 | Ga0436365_1716695 | |||
| 2208 | Ga0436360_0366592 | |||
| 2209 | Ga0436360_1350684 | |||
| 2210 | Ga0436361_0279908 | |||
| 2211 | Ga0436361_0307241 | |||
| 2212 | Ga0436363_0546873 | |||
| 2213 | Ga0436363_0941603 | |||
| 2214 | Ga0436363_1088635 | |||
| 2215 | Ga0436362_0434371 | |||
| 2216 | Ga0436362_0439678 | |||
| 2217 | Ga0436362_0674594 | |||
| 2218 | Ga0451797_1359922 | |||
| 2219 | Ga0451839_0690549 | |||
| 2220 | Ga0451841_0959049 | |||
| 2221 | Ga0451849_1221422 | |||
| 2222 | Ga0451853_2141541 | |||
| 2223 | Ga0439455_0133213 | |||
| 2224 | Ga0439458_0012089 | |||
| 2225 | Ga0439459_0068866 | |||
| 2226 | Ga0439440_0037718 | |||
| 2227 | Ga0466972_0001082 | |||
| 2228 | Ga0466972_0004060 | |||
| 2229 | Ga0466965_0200006 | |||
| 2230 | Ga0466966_0000514 | |||
| 2231 | Ga0466966_0319860 | |||
| 2232 | Ga0466966_0403561 | |||
| 2233 | Ga0466961_0001153 | |||
| 2234 | Ga0466963_0084624 | |||
| 2235 | Ga0466963_0094035 | |||
| 2236 | Ga0466964_0098617 | |||
| 2237 | Ga0466971_0307595 | |||
| 2238 | Ga0466968_0014655 | |||
| 2239 | Ga0466960_0058810 | |||
| 2240 | Ga0466960_0318941 | |||
| 2241 | Ga0466959_0013468 | |||
| 2242 | Ga0466959_0140778 | |||
| 2243 | Ga0466967_0062222 | |||
| 2244 | Ga0466967_0199509 | |||
| 2245 | Ga0495617_057833 | |||
| 2246 | Ga0495592_0049039 | |||
| 2247 | Ga0495592_0434217 | |||
| 2248 | Ga0495603_0010946 | |||
| 2249 | Ga0495603_0029308 | |||
| 2250 | Ga0495603_0078135 | |||
| 2251 | Ga0495603_0085759 | |||
| 2252 | Ga0495629_0000074 | |||
| 2253 | Ga0495629_0003855 | |||
| 2254 | Ga0495629_0353266 | |||
| 2255 | Ga0495638_0035894 | |||
| 2256 | Ga0495641_0036661 | |||
| 2257 | Ga0495651_0006512 | |||
| 2258 | Ga0495651_0107572 | |||
| 2259 | Ga0495651_0150950 | |||
| 2260 | Ga0495653_0025810 | |||
| 2261 | Ga0495653_0264283 | |||
| 2262 | Ga0495653_0487433 | |||
| 2263 | Ga0495580_0003195 | |||
| 2264 | Ga0495580_0063760 | |||
| 2265 | Ga0495580_0271551 | |||
| 2266 | Ga0495582_0000059 | |||
| 2267 | Ga0495582_0018139 | |||
| 2268 | Ga0495582_0202100 | |||
| 2269 | Ga0495639_0000954 | |||
| 2270 | Ga0495639_0041807 | |||
| 2271 | Ga0495662_0010592 | |||
| 2272 | Ga0495664_0182706 | |||
| 2273 | Ga0495664_0266167 | |||
| 2274 | Ga0495585_0193134 | |||
| 2275 | Ga0495594_0002251 | |||
| 2276 | Ga0495607_0208031 | |||
| 2277 | Ga0495583_0114575 | |||
| 2278 | Ga0495606_0002903 | |||
| 2279 | Ga0495606_0021783 | |||
| 2280 | Ga0495606_0090304 | |||
| 2281 | Ga0495608_0021279 | |||
| 2282 | Ga0495608_0139118 | |||
| 2283 | Ga0495608_0213931 | |||
| 2284 | Ga0495608_0579796 | |||
| 2285 | Ga0495610_0155097 | |||
| 2286 | Ga0495610_0167510 | |||
| 2287 | Ga0495616_0065486 | |||
| 2288 | Ga0495618_0173313 | |||
| 2289 | Ga0495620_0146509 | |||
| 2290 | Ga0495620_0154292 | |||
| 2291 | Ga0495628_0133332 | |||
| 2292 | Ga0495628_0136649 | |||
| 2293 | Ga0495628_0225659 | |||
| 2294 | Ga0495628_0543040 | |||
| 2295 | Ga0495630_0007365 | |||
| 2296 | Ga0495630_0494793 | |||
| 2297 | Ga0495631_0073853 | |||
| 2298 | Ga0495631_0077469 | |||
| 2299 | Ga0495632_0072875 | |||
| 2300 | Ga0495632_0146648 | |||
| 2301 | Ga0495637_0023062 | |||
| 2302 | Ga0495643_0083759 | |||
| 2303 | Ga0495643_0218538 | |||
| 2304 | Ga0495648_0008568 | |||
| 2305 | Ga0495648_0009770 | |||
| 2306 | Ga0495648_0169962 | |||
| 2307 | Ga0495663_0007571 | |||
| 2308 | Ga0495652_0010788 | |||
| 2309 | Ga0495652_0027010 | |||
| 2310 | Ga0495652_0315001 | |||
| 2311 | Ga0495652_0365300 | |||
| 2312 | Ga0495654_0004466 | |||
| 2313 | Ga0495665_0000395 | |||
| 2314 | Ga0495665_0048944 | |||
| 2315 | Ga0495665_0179137 | |||
| 2316 | Ga0495640_0007796 | |||
| 2317 | Ga0495640_0033703 | |||
| 2318 | Ga0495640_0084710 | |||
| 2319 | Ga0495640_0114632 | |||
| 2320 | Ga0495598_0005932 | |||
| 2321 | Ga0495609_0089477 | |||
| 2322 | Ga0495609_0185301 | |||
| 2323 | Ga0495609_0192878 | |||
| 2324 | Ga0495621_0017220 | |||
| 2325 | Ga0495597_0057697 | |||
| 2326 | Ga0495597_0071574 | |||
| 2327 | Ga0495645_0065000 | |||
| 2328 | Ga0495645_0077357 | |||
| 2329 | Ga0495645_0085629 | |||
| 2330 | Ga0495622_0007380 | |||
| 2331 | Ga0495622_0010940 | |||
| 2332 | Ga0495622_0022682 | |||
| 2333 | Ga0495622_0130393 | |||
| 2334 | Ga0495667_0002693 | |||
| 2335 | Ga0495667_0023995 | |||
| 2336 | Ga0495667_0128115 | |||
| 2337 | Ga0495667_0455703 | |||
| 2338 | Ga0495656_0066589 | |||
| 2339 | Ga0495668_0101316 | |||
| 2340 | Ga0495668_0161542 | |||
| 2341 | Ga0495668_0286712 | |||
| 2342 | Ga0495668_0464696 | |||
| 2343 | Ga0495634_0003890 | |||
| 2344 | Ga0495634_0049440 | |||
| 2345 | Ga0495634_0329155 | |||
| 2346 | Ga0495611_0125703 | |||
| 2347 | Ga0495625_0026562 | |||
| 2348 | Ga0495625_0129814 | |||
| 2349 | Ga0495625_0192049 | |||
| 2350 | Ga0495635_0037524 | |||
| 2351 | Ga0495659_0004407 | |||
| 2352 | Ga0495661_0014019 | |||
| 2353 | Ga0495661_0068017 | |||
| 2354 | Ga0495588_0005567 | |||
| 2355 | Ga0495588_0040853 | |||
| 2356 | Ga0495657_0004123 | |||
| 2357 | Ga0495657_0248612 | |||
| 2358 | Ga0495599_0039373 | |||
| 2359 | Ga0495599_0199240 | |||
| 2360 | Ga0495599_0286326 | |||
| 2361 | Ga0495623_0027805 | |||
| 2362 | Ga0495646_0048511 | |||
| 2363 | Ga0495646_0049700 | |||
| 2364 | Ga0495647_0015017 | |||
| 2365 | Ga0495658_0001708 | |||
| 2366 | Ga0495658_0117171 | |||
| 2367 | Ga0495658_0149753 | |||
| 2368 | Ga0495669_0016657 | |||
| 2369 | Ga0495669_0062078 | |||
| 2370 | Ga0495669_0224628 | |||
| 2371 | Ga0495669_0286021 | |||
| 2372 | Ga0495613_0037354 | |||
| 2373 | Ga0495613_0094143 | |||
| 2374 | Ga0495613_0489234 | |||
| 2375 | Ga0495624_0194616 | |||
| 2376 | Ga0495624_0269109 | |||
| 2377 | Ga0495670_0018631 | |||
| 2378 | Ga0495670_0050963 | |||
| 2379 | Ga0495670_0057059 | |||
| 2380 | Ga0495670_0077078 | |||
| 2381 | Ga0495671_0008231 | |||
| 2382 | Ga0495671_0172036 | |||
| 2383 | Ga0495589_0071392 | |||
| 2384 | Ga0495600_0088781 | |||
| 2385 | Ga0495660_0012639 | |||
| 2386 | Ga0495581_0000037 | |||
| 2387 | Ga0495581_0067114 | |||
| 2388 | Ga0495581_0092933 | |||
| 2389 | Ga0495581_0217098 | |||
| 2390 | Ga0495604_0015796 | |||
| 2391 | Ga0495604_0080448 | |||
| 2392 | Ga0495604_0197643 | |||
| 2393 | Ga0495674_0000499 | |||
| 2394 | Ga0495674_0299963 | |||
| 2395 | Ga0495672_0010203 | |||
| 2396 | Ga0495672_0025038 | |||
| 2397 | Ga0495676_0072599 | |||
| 2398 | Ga0495676_0171972 | |||
| 2399 | Ga0495676_0256358 | |||
| 2400 | Ga0495676_0427991 | |||
| 2401 | Ga0495680_0007828 | |||
| 2402 | Ga0495680_0047752 | |||
| 2403 | Ga0495687_007460 | |||
| 2404 | Ga0495687_064096 | |||
| 2405 | Ga0495687_082924 | |||
| 2406 | Ga0495675_0021958 | |||
| 2407 | Ga0495675_0097237 | |||
| 2408 | Ga0495677_0010815 | |||
| 2409 | Ga0495673_0117030 | |||
| 2410 | Ga0495684_0004761 | |||
| 2411 | Ga0495684_0009233 | |||
| 2412 | Ga0495684_0448684 | |||
| 2413 | Ga0495686_0161363 | |||
| 2414 | Ga0495593_0005039 | |||
| 2415 | Ga0495593_0088364 | |||
| 2416 | Ga0495593_0233537 | |||
| 2417 | Ga0495602_0071161 | |||
| 2418 | Ga0495602_0285083 | |||
| 2419 | Ga0495626_0017446 | |||
| 2420 | Ga0495626_0133501 | |||
| 2421 | Ga0496100_0118302 | |||
| 2422 | Ga0496100_0624594 | |||
| 2423 | Ga0496100_0666833 | |||
| 2424 | Ga0496101_0016596 | |||
| 2425 | Ga0496101_0078259 | |||
| 2426 | Ga0496101_0154100 | |||
| 2427 | Ga0496101_0245888 | |||
| 2428 | Ga0496101_0573924 | |||
| 2429 | Ga0496102_0007995 | |||
| 2430 | Ga0496102_0105126 | |||
| 2431 | Ga0496102_0114675 | |||
| 2432 | Ga0496102_0133455 | |||
| 2433 | Ga0496102_0435364 | |||
| 2434 | Ga0496102_0480087 | |||
| 2435 | Ga0496102_0608825 | |||
| 2436 | Ga0496103_0021683 | |||
| 2437 | Ga0496103_0026466 | |||
| 2438 | Ga0496103_0287995 | |||
| 2439 | Ga0496104_0002953 | |||
| 2440 | Ga0496104_0019560 | |||
| 2441 | Ga0496104_0064707 | |||
| 2442 | Ga0496104_0195370 | |||
| 2443 | Ga0496104_0237253 | |||
| 2444 | Ga0496104_0282510 | |||
| 2445 | Ga0496104_0561854 | |||
| 2446 | Ga0496105_0004911 | |||
| 2447 | Ga0496105_0006535 | |||
| 2448 | Ga0496105_0092349 | |||
| 2449 | Ga0496105_0364485 | |||
| 2450 | Ga0496106_0001534 | |||
| 2451 | Ga0496106_0002682 | |||
| 2452 | Ga0496106_0165162 | |||
| 2453 | Ga0496106_0205698 | |||
| 2454 | Ga0496106_0362496 | |||
| 2455 | Ga0496106_0526338 | |||
| 2456 | Ga0496106_0796895 | |||
| 2457 | Ga0496107_0009723 | |||
| 2458 | Ga0496107_0020271 | |||
| 2459 | Ga0496107_0041291 | |||
| 2460 | Ga0496107_0224849 | |||
| 2461 | Ga0496107_0264714 | |||
| 2462 | Ga0496107_0270875 | |||
| 2463 | Ga0496107_0287865 | |||
| 2464 | Ga0496107_0328471 | |||
| 2465 | Ga0496107_0629840 | |||
| 2466 | Ga0496108_0000438 | |||
| 2467 | Ga0496108_0086587 | |||
| 2468 | Ga0496108_0311738 | |||
| 2469 | Ga0496108_0359744 | |||
| 2470 | Ga0496109_0000284 | |||
| 2471 | Ga0496109_0049092 | |||
| 2472 | Ga0496109_0119220 | |||
| 2473 | Ga0496109_0126075 | |||
| 2474 | Ga0496109_0163132 | |||
| 2475 | Ga0496109_0226785 | |||
| 2476 | Ga0496109_0615417 | |||
| 2477 | Ga0496110_0013998 | |||
| 2478 | Ga0496110_0027228 | |||
| 2479 | Ga0496110_0118790 | |||
| 2480 | Ga0496110_0196934 | |||
| 2481 | Ga0496110_0361433 | |||
| 2482 | Ga0496110_0363304 | |||
| 2483 | Ga0496111_0003617 | |||
| 2484 | Ga0496111_0188832 | |||
| 2485 | Ga0496111_0248473 | |||
| 2486 | Ga0496112_0000090 | |||
| 2487 | Ga0496112_0012845 | |||
| 2488 | Ga0496112_0026339 | |||
| 2489 | Ga0496112_0032112 | |||
| 2490 | Ga0496112_0041410 | |||
| 2491 | Ga0496112_0045171 | |||
| 2492 | Ga0496112_0048383 | |||
| 2493 | Ga0496112_0104578 | |||
| 2494 | Ga0496112_0851032 | |||
| 2495 | Ga0496113_0021967 | |||
| 2496 | Ga0496113_0032368 | |||
| 2497 | Ga0496113_0178351 | |||
| 2498 | Ga0496114_0074265 | |||
| 2499 | Ga0496114_0085219 | |||
| 2500 | Ga0496114_0100146 | |||
| 2501 | Ga0496114_0353929 | |||
| 2502 | Ga0496114_0429457 | |||
| 2503 | Ga0496114_0709835 | |||
| 2504 | Ga0496115_0011512 | |||
| 2505 | Ga0496115_0041650 | |||
| 2506 | Ga0496115_0050637 | |||
| 2507 | Ga0496115_0129251 | |||
| 2508 | Ga0496115_0140415 | |||
| 2509 | Ga0496115_0182002 | |||
| 2510 | Ga0496115_0217540 | |||
| 2511 | Ga0496115_0269887 | |||
| 2512 | Ga0496115_0308792 | |||
| 2513 | Ga0496116_0039187 | |||
| 2514 | Ga0496117_0018642 | |||
| 2515 | Ga0496117_0026927 | |||
| 2516 | Ga0496117_0127817 | |||
| 2517 | Ga0496117_0154326 | |||
| 2518 | Ga0496117_0156770 | |||
| 2519 | Ga0496118_0010937 | |||
| 2520 | Ga0496118_0013220 | |||
| 2521 | Ga0496118_0043013 | |||
| 2522 | Ga0496118_0058685 | |||
| 2523 | Ga0496119_0003665 | |||
| 2524 | Ga0496119_0037454 | |||
| 2525 | Ga0496119_0211864 | |||
| 2526 | Ga0496119_0214474 | |||
| 2527 | Ga0496120_0009533 | |||
| 2528 | Ga0496120_0015629 | |||
| 2529 | Ga0496120_0036659 | |||
| 2530 | Ga0496120_0061579 | |||
| 2531 | Ga0496120_0196722 | |||
| 2532 | Ga0496121_0000571 | |||
| 2533 | Ga0496121_0002044 | |||
| 2534 | Ga0496121_0005698 | |||
| 2535 | Ga0496121_0009006 | |||
| 2536 | Ga0496121_0021216 | |||
| 2537 | Ga0496121_0050387 | |||
| 2538 | Ga0496121_0137009 | |||
| 2539 | Ga0496121_0143830 | |||
| 2540 | Ga0496121_0147464 | |||
| 2541 | Ga0496121_0159670 | |||
| 2542 | Ga0496122_0032311 | |||
| 2543 | Ga0496122_0279424 | |||
| 2544 | Ga0496123_0027188 | |||
| 2545 | Ga0496124_0001685 | |||
| 2546 | Ga0496124_0054167 | |||
| 2547 | Ga0496124_0191030 | |||
| 2548 | Ga0496124_0315592 | |||
| 2549 | Ga0496124_0333586 | |||
| 2550 | Ga0496125_0008547 | |||
| 2551 | Ga0496125_0032470 | |||
| 2552 | Ga0496125_0044277 | |||
| 2553 | Ga0496125_0051110 | |||
| 2554 | Ga0496125_0189819 | |||
| 2555 | Ga0496125_0192476 | |||
| 2556 | Ga0496125_0434044 | |||
| 2557 | Ga0496126_0001940 | |||
| 2558 | Ga0496126_0011305 | |||
| 2559 | Ga0496126_0012589 | |||
| 2560 | Ga0496126_0020579 | |||
| 2561 | Ga0496126_0034993 | |||
| 2562 | Ga0496126_0035265 | |||
| 2563 | Ga0496126_0036452 | |||
| 2564 | Ga0496126_0051743 | |||
| 2565 | Ga0496126_0054192 | |||
| 2566 | Ga0496126_0084046 | |||
| 2567 | Ga0496126_0088646 | |||
| 2568 | Ga0496126_0106344 | |||
| 2569 | Ga0496126_0215996 | |||
| 2570 | Ga0496126_0228097 | |||
| 2571 | Ga0496126_0283923 | |||
| 2572 | Ga0495682_0007587 | |||
| 2573 | Ga0495682_0090317 | |||
| 2574 | Ga0495682_0159291 | |||
| 2575 | Ga0501031_0004229 | |||
| 2576 | Ga0501031_0022815 | |||
| 2577 | Ga0501032_0005576 | |||
| 2578 | Ga0501032_0008917 | |||
| 2579 | Ga0501032_0026485 | |||
| 2580 | Ga0501033_0001252 | |||
| 2581 | Ga0501033_0002138 | |||
| 2582 | Ga0501033_0010457 | |||
| 2583 | Ga0501033_0015364 | |||
| 2584 | Ga0501033_0308681 | |||
| 2585 | Ga0501034_0000417 | |||
| 2586 | Ga0501034_0091175 | |||
| 2587 | Ga0501034_0230850 | |||
| 2588 | Ga0501036_0007704 | |||
| 2589 | Ga0501036_0124734 | |||
| 2590 | Ga0501036_0126547 | |||
| 2591 | Ga0501036_0242142 | |||
| 2592 | Ga0501037_0000156 | |||
| 2593 | Ga0501037_0004921 | |||
| 2594 | Ga0501037_0103996 | |||
| 2595 | Ga0501037_0140803 | |||
| 2596 | Ga0501038_0000164 | |||
| 2597 | Ga0501038_0002067 | |||
| 2598 | Ga0501038_0038092 | |||
| 2599 | Ga0501038_0060185 | |||
| 2600 | Ga0501038_0130779 | |||
| 2601 | Ga0501038_0137484 | |||
| 2602 | Ga0501039_0000457 | |||
| 2603 | Ga0501039_0009452 | |||
| 2604 | Ga0501039_0045721 | |||
| 2605 | Ga0501039_0073043 | |||
| 2606 | Ga0501039_0108017 | |||
| 2607 | Ga0501039_0148154 | |||
| 2608 | Ga0501039_0787607 | |||
| 2609 | Ga0501040_0003098 | |||
| 2610 | Ga0501041_0021842 | |||
| 2611 | Ga0501042_0076593 | |||
| 2612 | Ga0501042_0100031 | |||
| 2613 | Ga0501043_0000617 | |||
| 2614 | Ga0501043_0004274 | |||
| 2615 | Ga0501043_0023016 | |||
| 2616 | Ga0501043_0164488 | |||
| 2617 | Ga0501043_0563045 | |||
| 2618 | Ga0501046_0000304 | |||
| 2619 | Ga0501046_0031928 | |||
| 2620 | Ga0501046_0049248 | |||
| 2621 | Ga0501046_0054572 | |||
| 2622 | Ga0501047_0000739 | |||
| 2623 | Ga0501047_0021855 | |||
| 2624 | Ga0501047_0342840 | |||
| 2625 | Ga0501047_0392041 | |||
| 2626 | Ga0501047_0486122 | |||
| 2627 | Ga0501048_0001982 | |||
| 2628 | Ga0501048_0071488 | |||
| 2629 | Ga0501048_0075721 | |||
| 2630 | Ga0501067_0001170 | |||
| 2631 | Ga0501067_0005434 | |||
| 2632 | Ga0501068_0000092 | |||
| 2633 | Ga0501068_0007115 | |||
| 2634 | Ga0501068_0034398 | |||
| 2635 | Ga0501069_0026949 | |||
| 2636 | Ga0501070_0003917 | |||
| 2637 | Ga0501070_0089886 | |||
| 2638 | Ga0501072_0000981 | |||
| 2639 | Ga0501072_0069835 | |||
| 2640 | Ga0501073_0000309 | |||
| 2641 | Ga0501073_0010512 | |||
| 2642 | Ga0501073_0264178 | |||
| 2643 | Ga0501073_0310870 | |||
| 2644 | Ga0501074_0000051 | |||
| 2645 | Ga0501074_0103930 | |||
| 2646 | Ga0501076_0534345 | |||
| 2647 | Ga0501077_0045933 | |||
| 2648 | Ga0501079_0008257 | |||
| 2649 | Ga0501079_0012954 | |||
| 2650 | Ga0501080_0004599 | |||
| 2651 | Ga0501080_0278926 | |||
| 2652 | Ga0501083_0000276 | |||
| 2653 | Ga0501083_0024290 | |||
| 2654 | Ga0501035_0003055 | |||
| 2655 | Ga0501035_0010916 | |||
| 2656 | Ga0501035_0060737 | |||
| 2657 | Ga0501035_0136279 | |||
| 2658 | Ga0501035_0200136 | |||
| 2659 | Ga0501035_0253058 | |||
| 2660 | Ga0501035_0479898 | |||
| 2661 | Ga0501044_0005655 | |||
| 2662 | Ga0501044_0015923 | |||
| 2663 | Ga0501044_0030430 | |||
| 2664 | Ga0501044_0059675 | |||
| 2665 | Ga0501044_0071441 | |||
| 2666 | Ga0501044_0230031 | |||
| 2667 | Ga0501044_0313630 | |||
| 2668 | Ga0501044_0506812 | |||
| 2669 | Ga0501045_0006640 | |||
| 2670 | nmdc:mga03683_23142_c1 | |||
| 2671 | nmdc:mga03683_51528_c1 | |||
| 2672 | nmdc:mga03n38_14107_c1 | |||
| 2673 | nmdc:mga00v17_12435_c1 | |||
| 2674 | nmdc:mga00v17_328007_c1 | |||
| 2675 | nmdc:mga0yw44_104106_c1 | |||
| 2676 | nmdc:mga0yw44_143268_c1 | |||
| 2677 | nmdc:mga0yw44_288949_c1 | |||
| 2678 | nmdc:mga0yw44_35812_c1 | |||
| 2679 | nmdc:mga0yw44_43176_c1 | |||
| 2680 | nmdc:mga0yw44_9908_c1 | |||
| 2681 | nmdc:mga0k408_31278_c1 | |||
| 2682 | nmdc:mga0k408_335517_c1 | |||
| 2683 | nmdc:mga06z11_21544_c1 | |||
| 2684 | nmdc:mga04h51_18212_c1 | |||
| 2685 | nmdc:mga04h51_52527_c1 | |||
| 2686 | nmdc:mga07m45_23537_c2 | |||
| 2687 | nmdc:mga07m45_34403_c1 | |||
| 2688 | nmdc:mga09592_498483_c1 | |||
| 2689 | nmdc:mga08y16_174216_c1 | |||
| 2690 | nmdc:mga0n895_563477_c1 | |||
| 2691 | nmdc:mga0rr50_20625_c1 | |||
| 2692 | nmdc:mga0sz30_150175_c1 | |||
| 2693 | nmdc:mga0sz30_2295_c1 | |||
| 2694 | nmdc:mga0sz30_50523_c1 | |||
| 2695 | Ga0495601_0049088 | |||
| 2696 | Ga0495601_0227975 | |||
| 2697 | Ga0495612_0085023 | |||
| 2698 | Ga0500635_0016398 | |||
| 2699 | Ga0500635_0114726 | |||
| 2700 | Ga0495655_0015329 | |||
| 2701 | Ga0495595_0054793 | |||
| 2702 | Ga0495619_0003869 | |||
| 2703 | Ga0495619_0064649 | |||
| 2704 | Ga0500578_0041025 | |||
| 2705 | Ga0500643_000028 | |||
| 2706 | Ga0500643_006922 | |||
| 2707 | Ga0500644_0004653 | |||
| 2708 | Ga0500651_0027045 | |||
| 2709 | Ga0500651_0054621 | |||
| 2710 | Ga0500651_0063127 | |||
| 2711 | Ga0500566_0004102 | |||
| 2712 | Ga0500566_0023555 | |||
| 2713 | Ga0500566_0165438 | |||
| 2714 | Ga0500641_0005429 | |||
| 2715 | Ga0500641_0006195 | |||
| 2716 | Ga0500641_0013290 | |||
| 2717 | Ga0500650_0102863 | |||
| 2718 | Ga0500554_067098 | |||
| 2719 | Ga0500555_005200 | |||
| 2720 | Ga0500556_0000051 | |||
| 2721 | Ga0500556_0002319 | |||
| 2722 | Ga0500556_0082667 | |||
| 2723 | Ga0500557_000127 | |||
| 2724 | Ga0500569_049232 | |||
| 2725 | Ga0500569_055369 | |||
| 2726 | Ga0500592_001710 | |||
| 2727 | Ga0500594_0124599 | |||
| 2728 | Ga0500595_000141 | |||
| 2729 | Ga0500595_008509 | |||
| 2730 | Ga0500595_012407 | |||
| 2731 | Ga0500595_013681 | |||
| 2732 | Ga0500595_030082 | |||
| 2733 | Ga0500607_016454 | |||
| 2734 | Ga0500607_142469 | |||
| 2735 | Ga0500608_000364 | |||
| 2736 | Ga0500608_092763 | |||
| 2737 | Ga0500642_0000041 | |||
| 2738 | Ga0500642_0000174 | |||
| 2739 | Ga0500642_0003706 | |||
| 2740 | Ga0500652_009360 | |||
| 2741 | Ga0500658_0058930 | |||
| 2742 | Ga0500658_0102230 | |||
| 2743 | Ga0500559_0000878 | |||
| 2744 | Ga0500559_0067464 | |||
| 2745 | Ga0500559_0132545 | |||
| 2746 | Ga0500568_0006215 | |||
| 2747 | Ga0500568_0009795 | |||
| 2748 | Ga0500568_0039918 | |||
| 2749 | Ga0500577_0003046 | |||
| 2750 | Ga0500585_100240 | |||
| 2751 | Ga0500590_199889 | |||
| 2752 | Ga0500603_004904 | |||
| 2753 | Ga0500603_005027 | |||
| 2754 | Ga0500604_0028195 | |||
| 2755 | Ga0500616_0000150 | |||
| 2756 | Ga0500616_0000408 | |||
| 2757 | Ga0500616_0124189 | |||
| 2758 | Ga0500620_033895 | |||
| 2759 | Ga0500622_0004154 | |||
| 2760 | Ga0500622_0074804 | |||
| 2761 | Ga0500627_0179982 | |||
| 2762 | Ga0500627_0188176 | |||
| 2763 | Ga0500633_0115842 | |||
| 2764 | Ga0500638_010096 | |||
| 2765 | Ga0500636_0003573 | |||
| 2766 | Ga0500636_0010474 | |||
| 2767 | Ga0500636_0032237 | |||
| 2768 | Ga0500636_0270208 | |||
| 2769 | Ga0500637_0000311 | |||
| 2770 | Ga0500637_0011488 | |||
| 2771 | Ga0500637_0013210 | |||
| 2772 | Ga0500570_145036 | |||
| 2773 | Ga0500657_124126 | |||
| 2774 | Ga0500625_008973 | |||
| 2775 | Ga0500645_012425 | |||
| 2776 | Ga0500552_020207 | |||
| 2777 | Ga0500599_000989 | |||
| 2778 | Ga0500601_000420 | |||
| 2779 | Ga0501084_0005554 | |||
| 2780 | Ga0501084_0115581 | |||
| 2781 | Ga0500661_013901 | |||
| 2782 | Ga0500661_025906 | |||
| 2783 | Ga0501082_0026337 | |||
| 2784 | Ga0501082_0087083 | |||
| 2785 | Ga0501082_0790994 | |||
| 2786 | 2507504426 | |||
| 2787 | 2508545854 | |||
| 2788 | 2508694681 | |||
| 2789 | 2509146408 | |||
| 2790 | 2511396418 | |||
| 2791 | 2513624232 | |||
| 2792 | 2513638720 | |||
| 2793 | 2513649192 | |||
| 2794 | 2513656218 | |||
| 2795 | 2513673372 | |||
| 2796 | 2513694637 | |||
| 2797 | 2513702120 | |||
| 2798 | 2513716706 | |||
| 2799 | 2513860681 | |||
| 2800 | 2513874191 | |||
| 2801 | 2513892502 | |||
| 2802 | 2513917603 | |||
| 2803 | 2514010051 | |||
| 2804 | 2515624400 | |||
| 2805 | 2517103091 | |||
| 2806 | 2517887738 | |||
| 2807 | 2524438925 | |||
| 2808 | 2524470912 | |||
| 2809 | 2524535403 | |||
| 2810 | 2528849425 | |||
| 2811 | 2603862432 | |||
| 2812 | 2617350310 | |||
| 2813 | 2617374396 | |||
| 2814 | 2644290271 | |||
| 2815 | 2671120751 | |||
| 2816 | 2723842451 | |||
| 2817 | 2728748304 | |||
| 2818 | 2745081980 | |||
| 2819 | 2793059311 | |||
| 2820 | 2793070475 | |||
| 2821 | 2793078695 | |||
| 2822 | 2805920909 | |||
| 2823 | 2818240579 | |||
| 2824 | 2824604684 | |||
| 2825 | 2824615397 | |||
| 2826 | 2824618854 | |||
| 2827 | 2824628960 | |||
| 2828 | 2824639253 | |||
| 2829 | 2824648827 | |||
| 2830 | 2824658643 | |||
| 2831 | 2824665825 | |||
| 2832 | 2824675100 | |||
| 2833 | 2824686249 | |||
| 2834 | 2824692537 | |||
| 2835 | 2824700900 | |||
| 2836 | 2824711300 | |||
| 2837 | 2824717538 | |||
| 2838 | 2824726770 | |||
| 2839 | 2824737689 | |||
| 2840 | 2824751202 | |||
| 2841 | 2824759684 | |||
| 2842 | 2824769935 | |||
| 2843 | 2824780317 | |||
| 2844 | 2838126041 | |||
| 2845 | 2841942565 | |||
| 2846 | 2841953085 | |||
| 2847 | 2841963938 | |||
| 2848 | 2841970890 | |||
| 2849 | 2841977850 | |||
| 2850 | 2841984586 | |||
| 2851 | 2842041690 | |||
| 2852 | 2842049732 | |||
| 2853 | 2844321420 | |||
| 2854 | 2847931981 | |||
| 2855 | 2847943228 | |||
| 2856 | 2849076957 | |||
| 2857 | 2857514774 | |||
| 2858 | 2857525679 | |||
| 2859 | 2874595628 | |||
| 2860 | 2874606863 | |||
| 2861 | 2874620377 | |||
| 2862 | 2874621865 | |||
| 2863 | 2874629651 | |||
| 2864 | 2874651738 | |||
| 2865 | 2876769219 | |||
| 2866 | 2876775823 | |||
| 2867 | 2876821634 | |||
| 2868 | 2879079914 | |||
| 2869 | 2879085663 | |||
| 2870 | 2879104502 | |||
| 2871 | 2879112297 | |||
| 2872 | 2879133999 | |||
| 2873 | 2879148484 | |||
| 2874 | 2881364631 | |||
| 2875 | 2881671352 | |||
| 2876 | 2885374397 | |||
| 2877 | 2885383288 | |||
| 2878 | 2885391149 | |||
| 2879 | 2885413482 | |||
| 2880 | 2888387257 | |||
| 2881 | 2888391444 | |||
| 2882 | 2888426939 | |||
| 2883 | 2889034320 | |||
| 2884 | 2893071761 | |||
| 2885 | 2903728001 | |||
| 2886 | 2903755489 | |||
| 2887 | 2903776235 | |||
| 2888 | 2904669542 | |||
| 2889 | 2904691869 | |||
| 2890 | 2904709529 | |||
| 2891 | 2904713645 | |||
| 2892 | 2906602515 | |||
| 2893 | 2906612752 | |||
| 2894 | 2906635108 | |||
| 2895 | 2906640578 | |||
| 2896 | 2906649706 | |||
| 2897 | 2906663198 | |||
| 2898 | 2908745944 | |||
| 2899 | 2908763972 | |||
| 2900 | 2908776878 | |||
| 2901 | 2919074529 | |||
| 2902 | 2922364900 | |||
| 2903 | 2922370319 | |||
| 2904 | 2922391636 | |||
| 2905 | 2922398857 | |||
| 2906 | 2922433229 | |||
| 2907 | 2929622625 | |||
| 2908 | 2929632272 | |||
| 2909 | 2932790032 | |||
| 2910 | 2932800700 | |||
| 2911 | 2932808431 | |||
| 2912 | 2932815575 | |||
| 2913 | 2932824849 | |||
| 2914 | 2932829111 | |||
| 2915 | 2933584743 | |||
| 2916 | 2935613169 | |||
| 2917 | 2935617587 | |||
| 2918 | 2935630574 | |||
| 2919 | 2935643632 | |||
| 2920 | 2935654127 | |||
| 2921 | 2935662771 | |||
| 2922 | 2935671058 | |||
| 2923 | 2935681701 | |||
| 2924 | 2935692678 | |||
| 2925 | 2935702665 | |||
| 2926 | 2935711952 | |||
| 2927 | 2935721296 | |||
| 2928 | 2935730710 | |||
| 2929 | 2935739986 | |||
| 2930 | 2935749024 | |||
| 2931 | 2935758894 | |||
| 2932 | 2935767159 | |||
| 2933 | 2935774811 | |||
| 2934 | 2935780003 | |||
| 2935 | 2935792989 | |||
| 2936 | 2935798559 | |||
| 2937 | 2935806923 | |||
| 2938 | 2935818812 | |||
| 2939 | 2935824979 | |||
| 2940 | 2935834317 | |||
| 2941 | 2935843958 | |||
| 2942 | 2935852198 | |||
| 2943 | 2935856914 | |||
| 2944 | 2935868441 | |||
| 2945 | 2935879751 | |||
| 2946 | 2935883538 | |||
| 2947 | 2935910632 | |||
| 2948 | 2935921812 | |||
| 2949 | 2935930049 | |||
| 2950 | 2935937717 | |||
| 2951 | 2935949821 | |||
| 2952 | 2935956917 | |||
| 2953 | 2935965374 | |||
| 2954 | 2935970826 | |||
| 2955 | 2935980141 | |||
| 2956 | 2935984310 | |||
| 2957 | 2935997258 | |||
| 2958 | 2936010004 | |||
| 2959 | 2936017032 | |||
| 2960 | 2936025560 | |||
| 2961 | 2936034402 | |||
| 2962 | 2936045502 | |||
| 2963 | 2936052564 | |||
| 2964 | 2936055390 | |||
| 2965 | 2940564516 | |||
| 2966 | 2941507226 | |||
| 2967 | 2941520304 | |||
| 2968 | 2941523639 | |||
| 2969 | 2941531996 | |||
| 2970 | 2941545206 | |||
| 2971 | 3005482825 | |||
| 2972 | 3005490830 | |||
| 2973 | 3005506578 | |||
| 2974 | 3005588715 | |||
| 2975 | 3005601783 | |||
| 2976 | 3005717517 | |||
| 2977 | 3005724464 | |||
| 2978 | 8006927547 | |||
| 2979 | 8006935129 | |||
| 2980 | 8006965337 | |||
| 2981 | 8006975097 | |||
| 2982 | 8006993399 | |||
| 2983 | 8006995478 | |||
| 2984 | 8016519109 | |||
| 2985 | 8016525205 | |||
| 2986 | 8016538788 | |||
| 2987 | 8016543071 | |||
| 2988 | 8016550221 | |||
| 2989 | 8016558627 | |||
| 2990 | 8016581128 | |||
| 2991 | 8016587581 | |||
| 2992 | 8016596609 | |||
| 2993 | 8016607479 | |||
| 2994 | 8016619274 | |||
| 2995 | 8016636828 | |||
| 2996 | 8017057593 | |||
| 2997 | 8019538454 | |||
| 2998 | 8019541366 | |||
| 2999 | 8019549260 | |||
| 3000 | 8019563572 | |||
| 3001 | 8019573641 | |||
| 3002 | 8019578226 | |||
| 3003 | 8019605434 | |||
| 3004 | 8019613105 | |||
| 3005 | 8019623793 | |||
| 3006 | 8019638245 | |||
| 3007 | 8019641394 | |||
| 3008 | 8019651639 | |||
| 3009 | 8019666164 | |||
| 3010 | 8019675671 | |||
| 3011 | 8019695391 | |||
| 3012 | 8055750508 | |||
| 3013 | 8056678993 | |||
| 3014 | 8056681736 | |||
| 3015 | 8056692851 | |||
| 3016 | 8056975293 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hek-assembly2.cif.gz_A | crystal structure of m1.hpyavi | 0.8185 | 25 | 75 |
| 5hek-assembly2.cif.gz_C | crystal structure of m1.hpyavi | 0.8166 | 25 | 77 |
| 6m83-assembly1.cif.gz_A-2 | crystal structure of tylm1 s120a bound to sah and dtdp-phenol | 0.7952 | 25 | 127 |
| 6m82-assembly1.cif.gz_A | crystal structure of tylm1 y14paf bound to sah and dtdp-phenol | 0.7911 | 25 | 127 |
| 3cc8-assembly1.cif.gz_A-2 | crystal structure of a putative methyltransferase (bce_1332) from bacillus cereus atcc 10987 at 1.64 a resolution | 0.7895 | 27 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7MPH7_12_143_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8793 | 37 | 102 | 3.40.50.150 |
| af_Q50584_122_315_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8785 | 25 | 123 | 3.40.50.150 |
| af_I6X5U4_8_196_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.856 | 23 | 122 | 3.40.50.150 |
| af_Q5A3P1_25_227_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.8499 | 47 | 81 | 3.40.50.1010 |
| af_A0A1D6MEH1_3_91_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8487 | 37 | 103 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522W3Z1-F1-model_v4 | Methyltransferase domain-containing protein | 0.9778 | 16 | 125 |
GO:0008168
GO:0032259 |
| AF-A0A0F9K5A2-F1-model_v4 | Methionine biosynthesis protein MetW | 0.9736 | 20 | 99 |
|
| AF-A0A2S5LMP8-F1-model_v4 | Methionine biosynthesis protein MetW | 0.966 | 24 | 122 |
|
| AF-A0A0F9K5A2-F1-model_v4 | Methionine biosynthesis protein MetW | 0.9393 | 20 | 99 |
|
| AF-A0A522W3Z1-F1-model_v4 | Methyltransferase domain-containing protein | 0.928 | 16 | 125 |
GO:0008168
GO:0032259 |