F494451

General Info

Members Datasets Scaffolds Average Seq Length
1508 721 3016 221

Family's Representative Sequence

Representative Sequence 3300006881|Ga0068865_100270148|Ga0068865_1002701481
Length 250
Sequence MALSEQTLPLPSVTPPAGENFRADYRLVAEMVESGSRVLDVGCGDGDLLQLLETRGIDGRGIELSREGVNRCVAKGLAVVQGDADTDLVNYPDDAFDYVILSQTLQATRQPRAVLENLLRIGHRAIVSFPNFGFWKMRLQLLIGGHMPRTENLPATWYDTPNIHFCTIKDFVQLCDEINVKMERAVALDLYGRAVPLNLPWWVWNMFGEQGVFLLSRGGRGKLCLRASFRDGPKGPDPESRDSTMCNCTS

Samples

Sample ID Description Type Environment
1 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
87 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
88 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
89 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
121 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
122 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
123 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
200 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
201 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
202 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
203 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
211 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
212 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
213 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
214 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
218 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
219 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
220 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
221 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
225 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
228 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
229 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
232 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
235 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
236 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
237 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
238 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
239 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
240 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
241 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
242 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
243 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
245 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
246 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
247 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
250 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
251 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
255 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
259 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
262 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
263 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
264 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
265 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
266 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
267 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
268 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
269 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
270 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
271 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
272 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
273 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
274 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
275 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
276 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
277 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
278 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
279 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
280 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
281 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
282 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
283 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
284 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
285 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
286 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
287 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
288 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
289 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
290 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
291 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
298 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
299 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
300 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
301 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
302 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
303 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
304 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
305 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
306 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
307 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
308 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
309 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
310 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
311 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
312 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
313 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
314 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
315 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
316 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
317 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
318 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
319 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
320 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
321 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
322 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
323 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
324 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
325 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
326 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
327 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
328 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
329 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
330 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
331 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
332 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
333 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
334 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
335 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
336 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
337 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
338 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
339 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
340 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
341 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
342 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
343 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
344 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
345 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
346 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
347 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
348 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
349 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
350 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
351 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
352 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
353 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
354 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
355 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
356 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
357 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
358 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
359 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
360 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
361 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
362 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
363 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
364 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
365 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
366 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
367 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
368 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
369 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
370 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
371 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
372 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
373 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
374 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
375 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
376 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
377 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
378 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
379 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
380 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
381 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
382 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
383 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
384 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
385 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
386 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
387 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
388 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
389 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
390 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
391 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
392 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
393 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
394 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
395 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
396 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
397 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
413 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
414 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
415 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
416 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
417 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
418 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
419 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
420 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
421 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
422 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
423 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
424 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
427 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
428 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
429 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
430 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
431 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
432 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
433 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
434 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
435 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
436 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
437 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
438 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
439 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
440 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
441 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
442 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
443 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
444 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
445 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
446 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
447 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
448 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
449 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
450 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
451 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
452 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
453 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
454 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
455 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
456 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
457 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
458 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
459 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
460 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
461 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
462 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
463 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
464 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
465 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
466 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
467 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
468 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
469 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
470 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
471 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
472 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
473 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
474 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
475 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
476 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
477 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
478 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
479 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
480 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
481 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
482 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
483 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
484 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
485 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
486 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
487 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
488 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
489 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
490 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
491 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
492 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
493 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
494 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
495 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
496 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
497 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
498 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
499 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
500 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
501 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
502 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
503 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
504 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
505 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
506 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
507 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
508 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
509 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
510 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
511 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
512 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
513 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
514 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
515 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
516 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
517 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
518 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
519 2643221651 Afipia sp. Root123D2 Isolate Unclassified
520 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
521 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
522 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
523 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
524 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
525 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
526 2791355199
527 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
528 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
529 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
530 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
531 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
532 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
533 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
534 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
535 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
536 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
537 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
538 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
539 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
540 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
541 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
542 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
543 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
544 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
545 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
546 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
547 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
548 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
549 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
550 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
551 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
552 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
553 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
554 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
555 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
556 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
557 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
558 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
559 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
560 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
561 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
562 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
563 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
564 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
565 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
566 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
567 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
568 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
569 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
570 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
571 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
572 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
573 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
574 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
575 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
576 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
577 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
578 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
579 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
580 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
581 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
582 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
583 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
584 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
585 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
586 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
587 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
588 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
589 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
590 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
591 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
592 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
593 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
594 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
595 2904699407
596 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
597 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
598 2906610324
599 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
600 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
601 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
602 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
603 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
604 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
605 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
606 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
607 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
608 2922368715
609 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
610 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
611 2922425934
612 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
613 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
614 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
615 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
616 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
617 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
618 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
619 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
620 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
621 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
622 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
623 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
624 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
625 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
626 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
627 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
628 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
629 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
630 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
631 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
632 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
633 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
634 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
635 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
636 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
637 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
638 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
639 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
640 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
641 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
642 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
643 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
644 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
645 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
646 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
647 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
648 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
649 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
650 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
651 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
652 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
653 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
654 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
655 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
656 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
657 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
658 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
659 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
660 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
661 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
662 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
663 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
664 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
665 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
666 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
667 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
668 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
669 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
670 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
671 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
672 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
673 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
674 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
675 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
676 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
677 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
678 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
679 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
680 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
681 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
682 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
683 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
684 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
685 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
686 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
687 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
688 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
689 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
690 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
691 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
692 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
693 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
694 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
695 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
696 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
697 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
698 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
699 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
700 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
701 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
702 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
703 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
704 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
705 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
706 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
707 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
708 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
709 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
710 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
711 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
712 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
713 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
714 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
715 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
716 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
717 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
718 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
719 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
720 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
721 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.9
Metatranscriptomes 0.07
Isolates 15.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.27
Nodule 12.14
Rhizoplane 6.3
Rhizosphere 59.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068865_100270148 3300006881 Bacteria 1350
2 JGI24740J21852_10034575 3300001979 Bacteria 1591
3 JGI24739J22299_10059577 3300001989 Bacteria 1209
4 JGI24737J22298_10039047 3300001990 Bacteria 1460
5 JGI24735J21928_10063092 3300002067 Bacteria 1064
6 JGI24034J26672_10030416 3300002239 Bacteria 877
7 JGI24742J22300_10030193 3300002244 Bacteria 945
8 JGI25406J46586_10000081 3300003203 Bacteria 43450
9 JGI25406J46586_10012034 3300003203 Bacteria 3770
10 JGI25165J46597_1018010 3300003214 Bacteria 937
11 JGI25153J46596_10004550 3300003215 Bacteria 7447
12 JGI25153J46596_10025326 3300003215 Bacteria 2122
13 JGI25153J46596_10043473 3300003215 Bacteria 1360
14 JGI25160J50197_1000829 3300003354 Bacteria 16517
15 JGI25160J50197_1001208 3300003354 Bacteria 13129
16 JGI25404J52841_10007604 3300003659 Bacteria 2295
17 Ga0055526_1052591 3300003771 Bacteria 918
18 Ga0055531_10002243 3300003794 Bacteria 13087
19 Ga0065165_1000370 3300005262 Bacteria 73604
20 Ga0065165_1003163 3300005262 Bacteria 12086
21 Ga0065165_1007682 3300005262 Bacteria 5231
22 Ga0070658_10017799 3300005327 Bacteria 5682
23 Ga0070658_10092636 3300005327 Bacteria 2491
24 Ga0070658_10269959 3300005327 Bacteria 1446
25 Ga0070658_10705812 3300005327 Bacteria 876
26 Ga0070690_100481109 3300005330 Bacteria 926
27 Ga0068869_100092594 3300005334 Bacteria 2275
28 Ga0068869_100213252 3300005334 Bacteria 1527
29 Ga0070680_100064863 3300005336 Bacteria 2993
30 Ga0070680_100147579 3300005336 Bacteria 1974
31 Ga0070680_100505061 3300005336 Bacteria 1035
32 Ga0070682_100211858 3300005337 Bacteria 1373
33 Ga0068868_100045614 3300005338 Bacteria 3429
34 Ga0068868_100340219 3300005338 Bacteria 1283
35 Ga0070660_100005164 3300005339 Bacteria 9027
36 Ga0070660_100285260 3300005339 Bacteria 1351
37 Ga0070660_100303267 3300005339 Bacteria 1310
38 Ga0070691_10189163 3300005341 Bacteria 1076
39 Ga0070661_100009758 3300005344 Bacteria 6657
40 Ga0070661_100508579 3300005344 Bacteria 965
41 Ga0070668_100102225 3300005347 Bacteria 2272
42 Ga0070668_100118511 3300005347 Bacteria 2113
43 Ga0070668_100498830 3300005347 Bacteria 1053
44 Ga0070668_100593019 3300005347 Bacteria 968
45 Ga0070668_100619190 3300005347 Bacteria 948
46 Ga0070669_100112414 3300005353 Bacteria 2068
47 Ga0070669_100363384 3300005353 Bacteria 1177
48 Ga0070671_100146173 3300005355 Bacteria 1995
49 Ga0070671_100162483 3300005355 Bacteria 1888
50 Ga0070671_100382112 3300005355 Bacteria 1204
51 Ga0070674_100036979 3300005356 Bacteria 3281
52 Ga0070674_100325033 3300005356 Bacteria 1234
53 Ga0070688_100603015 3300005365 Bacteria 841
54 Ga0070667_100470660 3300005367 Bacteria 1150
55 Ga0070667_100598551 3300005367 Bacteria 1016
56 Ga0070709_10000683 3300005434 Bacteria 19271
57 Ga0070709_10007897 3300005434 Bacteria 5843
58 Ga0070709_10077703 3300005434 Bacteria 2158
59 Ga0070709_10080184 3300005434 Bacteria 2128
60 Ga0070714_100028423 3300005435 Bacteria 4639
61 Ga0070714_100044019 3300005435 Bacteria 3778
62 Ga0070714_100124798 3300005435 Bacteria 2294
63 Ga0070714_100174433 3300005435 Bacteria 1953
64 Ga0070714_100475181 3300005435 Bacteria 1190
65 Ga0070714_100639602 3300005435 Bacteria 1023
66 Ga0070713_100007562 3300005436 Bacteria 7638
67 Ga0070713_100028530 3300005436 Bacteria 4407
68 Ga0070713_100121742 3300005436 Bacteria 2289
69 Ga0070713_100681411 3300005436 Bacteria 981
70 Ga0070710_10007651 3300005437 Bacteria 5238
71 Ga0070710_10012117 3300005437 Bacteria 4274
72 Ga0070711_100016292 3300005439 Bacteria 4718
73 Ga0070711_100024517 3300005439 Bacteria 3935
74 Ga0070711_100041462 3300005439 Bacteria 3109
75 Ga0070711_100366261 3300005439 Bacteria 1162
76 Ga0070700_100121553 3300005441 Bacteria 1750
77 Ga0070708_100354922 3300005445 Bacteria 1382
78 Ga0070663_100011265 3300005455 Bacteria 5606
79 Ga0070663_100011993 3300005455 Bacteria 5469
80 Ga0070663_100061990 3300005455 Bacteria 2694
81 Ga0070663_100062509 3300005455 Bacteria 2684
82 Ga0070663_100127319 3300005455 Bacteria 1931
83 Ga0070663_100145532 3300005455 Bacteria 1813
84 Ga0070663_100225717 3300005455 Bacteria 1472
85 Ga0070663_100233703 3300005455 Bacteria 1449
86 Ga0070663_100368656 3300005455 Bacteria 1167
87 Ga0070663_100377028 3300005455 Bacteria 1154
88 Ga0070678_100089774 3300005456 Bacteria 2353
89 Ga0070678_100105754 3300005456 Bacteria 2191
90 Ga0070678_100335349 3300005456 Bacteria 1295
91 Ga0070678_100430805 3300005456 Bacteria 1151
92 Ga0070662_100030852 3300005457 Bacteria 3755
93 Ga0070662_100110957 3300005457 Bacteria 2089
94 Ga0070662_100118180 3300005457 Bacteria 2029
95 Ga0070662_100420789 3300005457 Bacteria 1105
96 Ga0070681_10007799 3300005458 Bacteria 10468
97 Ga0070681_10093506 3300005458 Bacteria 2955
98 Ga0068867_100262542 3300005459 Bacteria 1408
99 Ga0068867_100617273 3300005459 Bacteria 948
100 Ga0070707_100314508 3300005468 Bacteria 1522
101 Ga0070698_100210588 3300005471 Bacteria 1879
102 Ga0070679_100015888 3300005530 Bacteria 7245
103 Ga0070679_100038175 3300005530 Bacteria 4773
104 Ga0070679_100222276 3300005530 Bacteria 1849
105 Ga0070679_100531808 3300005530 Bacteria 1119
106 Ga0070684_100070098 3300005535 Bacteria 3084
107 Ga0068853_100001993 3300005539 Bacteria 15074
108 Ga0068853_100059849 3300005539 Bacteria 3290
109 Ga0068853_100387598 3300005539 Bacteria 1306
110 Ga0068853_100424306 3300005539 Bacteria 1247
111 Ga0070686_100034196 3300005544 Bacteria 3130
112 Ga0070665_100011107 3300005548 Bacteria 9099
113 Ga0070665_100099117 3300005548 Bacteria 2918
114 Ga0070665_100162314 3300005548 Bacteria 2236
115 Ga0070665_100288534 3300005548 Bacteria 1643
116 Ga0070665_100624496 3300005548 Bacteria 1091
117 Ga0070665_101187924 3300005548 Bacteria 774
118 Ga0068855_100008845 3300005563 Bacteria 12172
119 Ga0068855_100021063 3300005563 Bacteria 7817
120 Ga0068855_100049395 3300005563 Bacteria 4962
121 Ga0068855_100117367 3300005563 Bacteria 3049
122 Ga0068855_100212536 3300005563 Bacteria 2173
123 Ga0068855_100297006 3300005563 Bacteria 1789
124 Ga0068855_100326778 3300005563 Bacteria 1694
125 Ga0070664_100574431 3300005564 Bacteria 1044
126 Ga0070664_100946260 3300005564 Bacteria 809
127 Ga0068857_100019981 3300005577 Bacteria 5887
128 Ga0068857_100024793 3300005577 Bacteria 5283
129 Ga0068857_100026031 3300005577 Bacteria 5153
130 Ga0068857_100053517 3300005577 Bacteria 3581
131 Ga0068857_100497738 3300005577 Bacteria 1143
132 Ga0068857_100575564 3300005577 Bacteria 1063
133 Ga0068854_100055722 3300005578 Bacteria 2847
134 Ga0068854_100357069 3300005578 Bacteria 1198
135 Ga0068854_100518108 3300005578 Bacteria 1007
136 Ga0068854_100897929 3300005578 Bacteria 779
137 Ga0068856_100000226 3300005614 Bacteria 61246
138 Ga0068856_100013591 3300005614 Bacteria 7879
139 Ga0068856_100173656 3300005614 Bacteria 2167
140 Ga0068856_100336826 3300005614 Bacteria 1527
141 Ga0068856_100565188 3300005614 Bacteria 1159
142 Ga0068852_100043038 3300005616 Bacteria 3827
143 Ga0068852_100065894 3300005616 Bacteria 3161
144 Ga0068852_100107874 3300005616 Bacteria 2527
145 Ga0068852_100236571 3300005616 Bacteria 1743
146 Ga0068852_100273425 3300005616 Bacteria 1626
147 Ga0068852_100404973 3300005616 Bacteria 1343
148 Ga0068859_100534282 3300005617 Bacteria 1267
149 Ga0068859_100682342 3300005617 Bacteria 1118
150 Ga0068864_100128362 3300005618 Bacteria 2274
151 Ga0068864_100193657 3300005618 Bacteria 1864
152 Ga0068866_10246142 3300005718 Bacteria 1091
153 Ga0068861_100044595 3300005719 Bacteria 3335
154 Ga0068861_100206411 3300005719 Bacteria 1652
155 Ga0068861_100550303 3300005719 Bacteria 1051
156 Ga0068851_10016208 3300005834 Bacteria 3564
157 Ga0068851_10053452 3300005834 Bacteria 2056
158 Ga0068863_100066570 3300005841 Bacteria 3407
159 Ga0068863_100226973 3300005841 Bacteria 1800
160 Ga0068858_100171027 3300005842 Bacteria 2049
161 Ga0068858_100176774 3300005842 Bacteria 2014
162 Ga0068860_100244034 3300005843 Bacteria 1747
163 Ga0068860_100452704 3300005843 Bacteria 1276
164 Ga0068860_100999042 3300005843 Bacteria 854
165 Ga0068862_100069837 3300005844 Bacteria 3032
166 Ga0068862_100189575 3300005844 Bacteria 1849
167 Ga0068862_100226244 3300005844 Bacteria 1695
168 Ga0068862_100331902 3300005844 Bacteria 1406
169 Ga0081455_10004766 3300005937 Bacteria 15067
170 Ga0081455_10020570 3300005937 Bacteria 6210
171 Ga0081455_10142581 3300005937 Bacteria 1859
172 Ga0081538_10026047 3300005981 Bacteria 4103
173 Ga0081540_1002522 3300005983 Bacteria 14869
174 Ga0081540_1002586 3300005983 Bacteria 14696
175 Ga0081540_1004666 3300005983 Bacteria 10370
176 Ga0081540_1004860 3300005983 Bacteria 10126
177 Ga0081540_1008255 3300005983 Bacteria 7295
178 Ga0081540_1013787 3300005983 Bacteria 5233
179 Ga0081540_1033364 3300005983 Bacteria 2797
180 Ga0081540_1048561 3300005983 Bacteria 2125
181 Ga0081540_1054280 3300005983 Bacteria 1960
182 Ga0081540_1059367 3300005983 Bacteria 1837
183 Ga0081539_10000461 3300005985 Bacteria 86158
184 Ga0081539_10002797 3300005985 Bacteria 23391
185 Ga0081539_10201860 3300005985 Bacteria 918
186 Ga0070717_10001762 3300006028 Bacteria 15078
187 Ga0070717_10002235 3300006028 Bacteria 13568
188 Ga0070717_10226510 3300006028 Bacteria 1645
189 Ga0070717_10332399 3300006028 Bacteria 1356
190 Ga0070717_10440277 3300006028 Bacteria 1174
191 Ga0075365_10047628 3300006038 Bacteria 2818
192 Ga0075365_10057556 3300006038 Bacteria 2586
193 Ga0075365_10145411 3300006038 Bacteria 1647
194 Ga0075365_10169893 3300006038 Bacteria 1522
195 Ga0075365_10174248 3300006038 Bacteria 1502
196 Ga0075368_10058421 3300006042 Bacteria 1541
197 Ga0075363_100089300 3300006048 Bacteria 1694
198 Ga0075364_10024726 3300006051 Bacteria 3816
199 Ga0075364_10035699 3300006051 Bacteria 3213
200 Ga0075364_10090415 3300006051 Bacteria 2031
201 Ga0075364_10176114 3300006051 Bacteria 1446
202 Ga0075364_10332650 3300006051 Bacteria 1035
203 Ga0075432_10153259 3300006058 Bacteria 887
204 Ga0070716_100006994 3300006173 Bacteria 5533
205 Ga0070716_100368526 3300006173 Bacteria 1022
206 Ga0070716_100504939 3300006173 Bacteria 893
207 Ga0070712_100028123 3300006175 Bacteria 3758
208 Ga0070712_100037712 3300006175 Bacteria 3297
209 Ga0070712_100112710 3300006175 Bacteria 2032
210 Ga0070712_100334596 3300006175 Bacteria 1235
211 Ga0070712_100413973 3300006175 Bacteria 1116
212 Ga0075362_10142285 3300006177 Bacteria 1147
213 Ga0075367_10050515 3300006178 Bacteria 2455
214 Ga0075367_10114566 3300006178 Bacteria 1657
215 Ga0075367_10240800 3300006178 Bacteria 1134
216 Ga0075367_10290495 3300006178 Bacteria 1028
217 Ga0075367_10292677 3300006178 Bacteria 1024
218 Ga0075367_10328898 3300006178 Bacteria 963
219 Ga0075369_10021181 3300006186 Bacteria 2668
220 Ga0075369_10033402 3300006186 Bacteria 2180
221 Ga0075369_10077695 3300006186 Bacteria 1468
222 Ga0075369_10143784 3300006186 Bacteria 1088
223 Ga0097621_100275598 3300006237 Bacteria 1479
224 Ga0075370_10045185 3300006353 Bacteria 2491
225 Ga0075370_10246806 3300006353 Bacteria 1058
226 Ga0075370_10271456 3300006353 Bacteria 1007
227 Ga0068871_100083760 3300006358 Bacteria 2645
228 Ga0068871_100290074 3300006358 Bacteria 1433
229 Ga0068871_100490232 3300006358 Bacteria 1106
230 Ga0075428_100185896 3300006844 Bacteria 2248
231 Ga0075429_100435594 3300006880 Bacteria 1149
232 Ga0068865_100542538 3300006881 Bacteria 975
233 Ga0097620_100534263 3300006931 Bacteria 1267
234 Ga0097620_100682326 3300006931 Bacteria 1118
235 Ga0099825_1036925 3300006941 Bacteria 1649
236 Ga0099824_1007227 3300006942 Bacteria 14828
237 Ga0099824_1017577 3300006942 Bacteria 6146
238 Ga0099822_1005717 3300006943 Bacteria 16238
239 Ga0099823_1008742 3300006944 Bacteria 10292
240 Ga0075435_100006891 3300007076 Bacteria 8064
241 Ga0099794_10042881 3300007265 Bacteria 2158
242 Ga0099795_10001991 3300007788 Bacteria 4660
243 Ga0105250_10226993 3300009092 Bacteria 793
244 Ga0105240_10013959 3300009093 Bacteria 10997
245 Ga0105240_10014054 3300009093 Bacteria 10948
246 Ga0105240_10040849 3300009093 Bacteria 5927
247 Ga0105240_10050894 3300009093 Bacteria 5217
248 Ga0105240_10056236 3300009093 Bacteria 4924
249 Ga0105240_10547935 3300009093 Bacteria 1280
250 Ga0105240_10632355 3300009093 Bacteria 1175
251 Ga0111539_10043707 3300009094 Bacteria 5370
252 Ga0105245_10023421 3300009098 Bacteria 5420
253 Ga0105245_10758021 3300009098 Bacteria 1007
254 Ga0105247_10009405 3300009101 Bacteria 5931
255 Ga0105247_10058758 3300009101 Bacteria 2380
256 Ga0105247_10105147 3300009101 Bacteria 1809
257 Ga0105247_10161683 3300009101 Bacteria 1483
258 Ga0105247_10257845 3300009101 Bacteria 1194
259 Ga0105247_10470997 3300009101 Bacteria 910
260 Ga0114129_10550389 3300009147 Bacteria 1500
261 Ga0105243_10087129 3300009148 Bacteria 2562
262 Ga0105243_10374055 3300009148 Bacteria 1315
263 Ga0105243_10641060 3300009148 Bacteria 1028
264 Ga0105243_10645411 3300009148 Bacteria 1025
265 Ga0105241_10004545 3300009174 Bacteria 10265
266 Ga0105241_10149193 3300009174 Bacteria 1911
267 Ga0105241_10195554 3300009174 Bacteria 1686
268 Ga0105242_10351796 3300009176 Bacteria 1361
269 Ga0105242_10717647 3300009176 Bacteria 980
270 Ga0105248_10716530 3300009177 Bacteria 1129
271 Ga0105237_10007960 3300009545 Bacteria 11548
272 Ga0105237_10026951 3300009545 Bacteria 5870
273 Ga0105237_10030213 3300009545 Bacteria 5506
274 Ga0105237_10039289 3300009545 Bacteria 4778
275 Ga0105237_10039787 3300009545 Bacteria 4744
276 Ga0105237_10050359 3300009545 Bacteria 4185
277 Ga0105237_10209106 3300009545 Bacteria 1951
278 Ga0105237_10352445 3300009545 Bacteria 1476
279 Ga0105237_10470755 3300009545 Bacteria 1262
280 Ga0105237_10654564 3300009545 Bacteria 1057
281 Ga0105238_10001176 3300009551 Bacteria 26306
282 Ga0105238_10029351 3300009551 Bacteria 5602
283 Ga0105238_10419376 3300009551 Bacteria 1333
284 Ga0105238_10443781 3300009551 Bacteria 1294
285 Ga0105249_10106290 3300009553 Bacteria 2648
286 Ga0099796_10057177 3300010159 Bacteria 1371
287 Ga0105239_10017508 3300010375 Bacteria 7924
288 Ga0105239_10038465 3300010375 Bacteria 5243
289 Ga0105239_10128447 3300010375 Bacteria 2818
290 Ga0105239_10171193 3300010375 Bacteria 2428
291 Ga0105239_10197232 3300010375 Bacteria 2254
292 Ga0105239_10657049 3300010375 Bacteria 1198
293 Ga0105239_10779251 3300010375 Bacteria 1095
294 Ga0105246_10028115 3300011119 Bacteria 3692
295 Ga0105246_10264285 3300011119 Bacteria 1372
296 Ga0157343_1004575 3300012488 Bacteria 861
297 Ga0157370_10060204 3300013104 Bacteria 3606
298 Ga0157370_10163325 3300013104 Bacteria 2072
299 Ga0157370_10291238 3300013104 Bacteria 1508
300 Ga0157369_10004958 3300013105 Bacteria 15596
301 Ga0157369_10014414 3300013105 Bacteria 8924
302 Ga0157369_10030732 3300013105 Bacteria 5921
303 Ga0157369_10030744 3300013105 Bacteria 5921
304 Ga0157369_10826944 3300013105 Bacteria 951
305 Ga0157374_10099137 3300013296 Bacteria 2790
306 Ga0157374_11057407 3300013296 Bacteria 832
307 Ga0163162_10027557 3300013306 Bacteria 5618
308 Ga0163162_10279585 3300013306 Bacteria 1801
309 Ga0163162_10527541 3300013306 Bacteria 1310
310 Ga0157372_10361750 3300013307 Bacteria 1691
311 Ga0163163_10192343 3300014325 Bacteria 2089
312 Ga0163163_10327618 3300014325 Bacteria 1586
313 Ga0163163_10332623 3300014325 Bacteria 1574
314 Ga0163163_10662010 3300014325 Bacteria 1108
315 Ga0163163_10874900 3300014325 Bacteria 962
316 Ga0157380_10522411 3300014326 Bacteria 1158
317 Ga0157379_10056635 3300014968 Bacteria 3502
318 Ga0157379_10419728 3300014968 Bacteria 1232
319 Ga0157376_10026136 3300014969 Bacteria 4609
320 Ga0163161_10246013 3300017792 Bacteria 1392
321 Ga0163161_10338792 3300017792 Bacteria 1193
322 Ga0214544_1000003 3300021320 Bacteria 643752
323 Ga0214542_1000003 3300021321 Bacteria 435700
324 Ga0214545_1000004 3300021324 Bacteria 453352
325 Ga0214543_1000007 3300021327 Bacteria 414744
326 Ga0213872_10029016 3300021361 Bacteria 2538
327 Ga0213874_10007521 3300021377 Bacteria 2618
328 Ga0213876_10023140 3300021384 Bacteria 3283
329 Ga0213876_10075715 3300021384 Bacteria 1778
330 Ga0213871_10052440 3300021441 Bacteria 1121
331 Ga0224712_10153828 3300022467 Bacteria 1021
332 Ga0209563_102179 3300025230 Bacteria 4564
333 Ga0209677_100607 3300025253 Bacteria 19268
334 Ga0209677_106579 3300025253 Bacteria 2716
335 Ga0209148_1000998 3300025254 Bacteria 18046
336 Ga0209233_1012176 3300025261 Bacteria 2503
337 Ga0209233_1015743 3300025261 Bacteria 2098
338 Ga0209233_1016001 3300025261 Bacteria 2074
339 Ga0209233_1017966 3300025261 Bacteria 1914
340 Ga0209233_1020887 3300025261 Bacteria 1707
341 Ga0209455_1000711 3300025272 Bacteria 19291
342 Ga0209455_1005632 3300025272 Bacteria 3832
343 Ga0209455_1015674 3300025272 Bacteria 1656
344 Ga0209564_1001190 3300025295 Bacteria 29940
345 Ga0209564_1016775 3300025295 Bacteria 2893
346 Ga0209564_1018469 3300025295 Bacteria 2655
347 Ga0209758_1000030 3300025297 Bacteria 509217
348 Ga0209758_1000277 3300025297 Bacteria 102106
349 Ga0209758_1001754 3300025297 Bacteria 24100
350 Ga0209758_1004789 3300025297 Bacteria 10941
351 Ga0209758_1028967 3300025297 Bacteria 2328
352 Ga0209758_1057311 3300025297 Bacteria 1310
353 Ga0209758_1075248 3300025297 Bacteria 1044
354 Ga0209256_1011379 3300025299 Bacteria 3568
355 Ga0209256_1020794 3300025299 Bacteria 2036
356 Ga0207426_1000271 3300025302 Bacteria 108392
357 Ga0207426_1000913 3300025302 Bacteria 29549
358 Ga0207426_1021235 3300025302 Bacteria 2245
359 Ga0207426_1039009 3300025302 Bacteria 1491
360 Ga0209051_1077321 3300025303 Bacteria 974
361 Ga0209257_1000947 3300025304 Bacteria 40051
362 Ga0209257_1029045 3300025304 Bacteria 1808
363 Ga0207697_10056662 3300025315 Bacteria 1626
364 Ga0207656_10001009 3300025321 Bacteria 9200
365 Ga0207656_10127230 3300025321 Bacteria 1191
366 Ga0207656_10197500 3300025321 Bacteria 971
367 Ga0207653_10092121 3300025885 Bacteria 1063
368 Ga0207692_10000396 3300025898 Bacteria 15079
369 Ga0207710_10039449 3300025900 Bacteria 2090
370 Ga0207688_10010005 3300025901 Bacteria 5158
371 Ga0207688_10059119 3300025901 Bacteria 2158
372 Ga0207688_10112352 3300025901 Bacteria 1583
373 Ga0207688_10249884 3300025901 Bacteria 1074
374 Ga0207647_10052442 3300025904 Bacteria 2518
375 Ga0207647_10128616 3300025904 Bacteria 1489
376 Ga0207647_10205388 3300025904 Bacteria 1139
377 Ga0207685_10023468 3300025905 Bacteria 2100
378 Ga0207685_10036159 3300025905 Bacteria 1809
379 Ga0207699_10000506 3300025906 Bacteria 19377
380 Ga0207699_10017577 3300025906 Bacteria 3769
381 Ga0207699_10468119 3300025906 Bacteria 906
382 Ga0207645_10201120 3300025907 Bacteria 1311
383 Ga0207643_10130903 3300025908 Bacteria 1493
384 Ga0207705_10027863 3300025909 Bacteria 4029
385 Ga0207654_10001189 3300025911 Bacteria 13962
386 Ga0207654_10107546 3300025911 Bacteria 1729
387 Ga0207707_10001378 3300025912 Bacteria 22538
388 Ga0207707_10004787 3300025912 Bacteria 11871
389 Ga0207707_10019821 3300025912 Bacteria 5871
390 Ga0207707_10323444 3300025912 Bacteria 1331
391 Ga0207695_10005181 3300025913 Bacteria 17451
392 Ga0207695_10026278 3300025913 Bacteria 6499
393 Ga0207695_10029019 3300025913 Bacteria 6122
394 Ga0207695_10054124 3300025913 Bacteria 4193
395 Ga0207695_10058640 3300025913 Bacteria 3995
396 Ga0207695_10126249 3300025913 Bacteria 2520
397 Ga0207695_10206864 3300025913 Bacteria 1875
398 Ga0207695_10509689 3300025913 Bacteria 1085
399 Ga0207671_10025307 3300025914 Bacteria 4458
400 Ga0207671_10026212 3300025914 Bacteria 4370
401 Ga0207671_10037186 3300025914 Bacteria 3611
402 Ga0207671_10053272 3300025914 Bacteria 2998
403 Ga0207671_10067250 3300025914 Bacteria 2668
404 Ga0207671_10241471 3300025914 Bacteria 1419
405 Ga0207671_10266059 3300025914 Bacteria 1350
406 Ga0207693_10004427 3300025915 Bacteria 11879
407 Ga0207693_10026084 3300025915 Bacteria 4627
408 Ga0207693_10055856 3300025915 Bacteria 3097
409 Ga0207693_10063883 3300025915 Bacteria 2884
410 Ga0207693_10279210 3300025915 Bacteria 1309
411 Ga0207663_10000893 3300025916 Bacteria 13589
412 Ga0207663_10014297 3300025916 Bacteria 4340
413 Ga0207663_10035267 3300025916 Bacteria 2999
414 Ga0207660_10015291 3300025917 Bacteria 5062
415 Ga0207660_10039604 3300025917 Bacteria 3295
416 Ga0207660_10056603 3300025917 Bacteria 2806
417 Ga0207660_10608155 3300025917 Bacteria 890
418 Ga0207657_10004291 3300025919 Bacteria 15098
419 Ga0207657_10011254 3300025919 Bacteria 8891
420 Ga0207649_10398346 3300025920 Bacteria 1030
421 Ga0207652_10034951 3300025921 Bacteria 4239
422 Ga0207652_10044378 3300025921 Bacteria 3787
423 Ga0207652_10454217 3300025921 Bacteria 1155
424 Ga0207652_10517784 3300025921 Bacteria 1073
425 Ga0207646_10485207 3300025922 Bacteria 1114
426 Ga0207681_10118888 3300025923 Bacteria 1935
427 Ga0207694_10000719 3300025924 Bacteria 29735
428 Ga0207694_10032793 3300025924 Bacteria 3977
429 Ga0207694_10048591 3300025924 Bacteria 3283
430 Ga0207694_10145540 3300025924 Bacteria 1907
431 Ga0207694_10261019 3300025924 Bacteria 1419
432 Ga0207694_10283514 3300025924 Bacteria 1361
433 Ga0207694_10347160 3300025924 Bacteria 1228
434 Ga0207694_10349051 3300025924 Bacteria 1224
435 Ga0207659_10488012 3300025926 Bacteria 1041
436 Ga0207687_10015241 3300025927 Bacteria 5036
437 Ga0207687_10156318 3300025927 Bacteria 1745
438 Ga0207700_10004999 3300025928 Bacteria 7884
439 Ga0207700_10029357 3300025928 Bacteria 3879
440 Ga0207700_10089326 3300025928 Bacteria 2429
441 Ga0207700_10515352 3300025928 Bacteria 1059
442 Ga0207700_10922244 3300025928 Bacteria 782
443 Ga0207664_10092659 3300025929 Bacteria 2480
444 Ga0207664_10095627 3300025929 Bacteria 2444
445 Ga0207664_10115426 3300025929 Bacteria 2239
446 Ga0207664_10117454 3300025929 Bacteria 2221
447 Ga0207664_10135274 3300025929 Bacteria 2079
448 Ga0207664_10653140 3300025929 Bacteria 945
449 Ga0207644_10091110 3300025931 Bacteria 2273
450 Ga0207644_10091767 3300025931 Bacteria 2265
451 Ga0207644_10377256 3300025931 Bacteria 1156
452 Ga0207644_10489912 3300025931 Bacteria 1013
453 Ga0207690_10042474 3300025932 Bacteria 2986
454 Ga0207706_10010327 3300025933 Bacteria 8534
455 Ga0207706_10326460 3300025933 Bacteria 1335
456 Ga0207706_10572481 3300025933 Bacteria 971
457 Ga0207686_10401604 3300025934 Bacteria 1044
458 Ga0207669_10010714 3300025937 Bacteria 4426
459 Ga0207669_10498838 3300025937 Bacteria 973
460 Ga0207704_10311582 3300025938 Bacteria 1210
461 Ga0207665_10076644 3300025939 Bacteria 2293
462 Ga0207665_10118421 3300025939 Bacteria 1869
463 Ga0207665_10342000 3300025939 Bacteria 1128
464 Ga0207691_10022979 3300025940 Bacteria 5874
465 Ga0207711_10030704 3300025941 Bacteria 4533
466 Ga0207711_10325154 3300025941 Bacteria 1422
467 Ga0207689_10096244 3300025942 Bacteria 2432
468 Ga0207689_10119085 3300025942 Bacteria 2172
469 Ga0207689_10157237 3300025942 Bacteria 1874
470 Ga0207689_10250026 3300025942 Bacteria 1466
471 Ga0207661_10011425 3300025944 Bacteria 6433
472 Ga0207661_10016081 3300025944 Bacteria 5514
473 Ga0207661_10018986 3300025944 Bacteria 5116
474 Ga0207679_10408739 3300025945 Bacteria 1195
475 Ga0207667_10008537 3300025949 Bacteria 12160
476 Ga0207667_10008887 3300025949 Bacteria 11890
477 Ga0207667_10011455 3300025949 Bacteria 10305
478 Ga0207667_10071605 3300025949 Bacteria 3604
479 Ga0207667_10211342 3300025949 Bacteria 1989
480 Ga0207667_10491677 3300025949 Bacteria 1245
481 Ga0207651_10246219 3300025960 Bacteria 1460
482 Ga0207712_10144849 3300025961 Bacteria 1828
483 Ga0207668_10055842 3300025972 Bacteria 2747
484 Ga0207668_10089279 3300025972 Bacteria 2259
485 Ga0207668_10095789 3300025972 Bacteria 2191
486 Ga0207668_10505317 3300025972 Bacteria 1040
487 Ga0207640_10008213 3300025981 Bacteria 5787
488 Ga0207640_10057350 3300025981 Bacteria 2561
489 Ga0207640_10304191 3300025981 Bacteria 1263
490 Ga0207640_10329032 3300025981 Bacteria 1220
491 Ga0207640_10889702 3300025981 Bacteria 777
492 Ga0207677_10040604 3300026023 Bacteria 3069
493 Ga0207677_10310611 3300026023 Bacteria 1306
494 Ga0207677_10467410 3300026023 Bacteria 1084
495 Ga0207703_10138867 3300026035 Bacteria 2107
496 Ga0207703_10395872 3300026035 Bacteria 1281
497 Ga0207639_10003011 3300026041 Bacteria 11341
498 Ga0207639_10011122 3300026041 Bacteria 6243
499 Ga0207639_10139409 3300026041 Bacteria 2018
500 Ga0207639_10164748 3300026041 Bacteria 1871
501 Ga0207639_10288181 3300026041 Bacteria 1447
502 Ga0207678_10012518 3300026067 Bacteria 7450
503 Ga0207678_10028890 3300026067 Bacteria 4840
504 Ga0207678_10044475 3300026067 Bacteria 3841
505 Ga0207678_10046223 3300026067 Bacteria 3765
506 Ga0207678_10051151 3300026067 Bacteria 3567
507 Ga0207678_10067071 3300026067 Bacteria 3080
508 Ga0207678_10261061 3300026067 Bacteria 1484
509 Ga0207678_10282689 3300026067 Bacteria 1424
510 Ga0207678_10502784 3300026067 Bacteria 1057
511 Ga0207678_10691587 3300026067 Bacteria 897
512 Ga0207708_10179092 3300026075 Bacteria 1683
513 Ga0207702_10000191 3300026078 Bacteria 72810
514 Ga0207702_10000938 3300026078 Bacteria 30006
515 Ga0207702_10151553 3300026078 Bacteria 2109
516 Ga0207702_10174928 3300026078 Bacteria 1972
517 Ga0207641_10168200 3300026088 Bacteria 1999
518 Ga0207641_10437919 3300026088 Bacteria 1261
519 Ga0207641_10925629 3300026088 Bacteria 866
520 Ga0207648_10068173 3300026089 Bacteria 3100
521 Ga0207648_10088934 3300026089 Bacteria 2697
522 Ga0207648_10494684 3300026089 Bacteria 1118
523 Ga0207676_10249689 3300026095 Bacteria 1596
524 Ga0207676_10252223 3300026095 Bacteria 1589
525 Ga0207676_10360496 3300026095 Bacteria 1347
526 Ga0207674_10015534 3300026116 Bacteria 8363
527 Ga0207674_10024882 3300026116 Bacteria 6390
528 Ga0207674_10025851 3300026116 Bacteria 6250
529 Ga0207674_10087858 3300026116 Bacteria 3102
530 Ga0207674_10526896 3300026116 Bacteria 1141
531 Ga0207674_10580151 3300026116 Bacteria 1083
532 Ga0207675_100128208 3300026118 Bacteria 2404
533 Ga0207675_100180691 3300026118 Bacteria 2020
534 Ga0207675_100393557 3300026118 Bacteria 1364
535 Ga0207675_100503487 3300026118 Bacteria 1206
536 Ga0207683_10083353 3300026121 Bacteria 2841
537 Ga0207683_10156406 3300026121 Bacteria 2059
538 Ga0207683_10180779 3300026121 Bacteria 1912
539 Ga0207683_10205022 3300026121 Bacteria 1793
540 Ga0207683_10452446 3300026121 Bacteria 1184
541 Ga0207698_10034211 3300026142 Bacteria 3702
542 Ga0207698_10054754 3300026142 Bacteria 3071
543 Ga0207698_10182140 3300026142 Bacteria 1862
544 Ga0207698_10305660 3300026142 Bacteria 1483
545 Ga0209389_1000193 3300027296 Bacteria 44705
546 Ga0209389_1000207 3300027296 Bacteria 42300
547 Ga0209589_1000024 3300027357 Bacteria 169886
548 Ga0209589_1000025 3300027357 Bacteria 165546
549 Ga0209489_100039 3300027361 Bacteria 165546
550 Ga0209489_101741 3300027361 Bacteria 44747
551 Ga0209489_101963 3300027361 Bacteria 42342
552 Ga0209700_100043 3300027363 Bacteria 167890
553 Ga0209700_100420 3300027363 Bacteria 77617
554 Ga0209179_1054355 3300027512 Bacteria 863
555 Ga0209588_1007005 3300027671 Bacteria 3305
556 Ga0209813_10018664 3300027866 Bacteria 1919
557 Ga0209813_10075582 3300027866 Bacteria 1104
558 Ga0207428_10228213 3300027907 Bacteria 1394
559 Ga0268266_10003056 3300028379 Bacteria 17112
560 Ga0268266_10003703 3300028379 Bacteria 15062
561 Ga0268266_10029112 3300028379 Bacteria 4694
562 Ga0268266_10194830 3300028379 Bacteria 1851
563 Ga0268266_10275029 3300028379 Bacteria 1564
564 Ga0268266_10340770 3300028379 Bacteria 1407
565 Ga0268265_10070116 3300028380 Bacteria 2724
566 Ga0268265_10207239 3300028380 Bacteria 1705
567 Ga0268265_10253413 3300028380 Bacteria 1560
568 Ga0268265_10346048 3300028380 Bacteria 1355
569 Ga0268264_10000051 3300028381 Bacteria 321565
570 Ga0268264_10191049 3300028381 Bacteria 1867
571 Ga0265337_1007383 3300028556 Bacteria 4117
572 Ga0265319_1009743 3300028563 Bacteria 4062
573 Ga0265334_10001692 3300028573 Bacteria 10542
574 Ga0265323_10008924 3300028653 Bacteria 4118
575 Ga0265336_10009566 3300028666 Bacteria 3346
576 Ga0307517_10005748 3300028786 Bacteria 18557
577 Ga0307515_10110960 3300028794 Bacteria 3205
578 Ga0265338_10000231 3300028800 Bacteria 103805
579 Ga0265330_10044930 3300031235 Bacteria 1949
580 Ga0265340_10020047 3300031247 Bacteria 3440
581 Ga0265339_10004944 3300031249 Bacteria 8978
582 Ga0265339_10024066 3300031249 Bacteria 3513
583 Ga0265331_10042928 3300031250 Bacteria 2192
584 Ga0265331_10049490 3300031250 Bacteria 2019
585 Ga0265316_10371105 3300031344 Bacteria 1033
586 Ga0307513_10215645 3300031456 Bacteria 1746
587 Ga0307509_10030718 3300031507 Bacteria 5939
588 Ga0307509_10150798 3300031507 Bacteria 2240
589 Ga0307509_10312717 3300031507 Bacteria 1312
590 Ga0307509_10569584 3300031507 Bacteria 808
591 Ga0307508_10000152 3300031616 Bacteria 82883
592 Ga0307508_10058929 3300031616 Bacteria 3396
593 Ga0307508_10149960 3300031616 Bacteria 1936
594 Ga0307508_10516090 3300031616 Bacteria 791
595 Ga0265314_10002968 3300031711 Bacteria 16811
596 Ga0265314_10044116 3300031711 Bacteria 3163
597 Ga0265314_10219964 3300031711 Bacteria 1109
598 Ga0265342_10011951 3300031712 Bacteria 5900
599 Ga0265342_10076076 3300031712 Bacteria 1946
600 Ga0265342_10079404 3300031712 Bacteria 1897
601 Ga0265342_10264907 3300031712 Bacteria 913
602 Ga0307516_10001267 3300031730 Bacteria 35137
603 Ga0307516_10031057 3300031730 Bacteria 5387
604 Ga0307516_10073820 3300031730 Bacteria 3268
605 Ga0307516_10074213 3300031730 Bacteria 3257
606 Ga0307405_10059938 3300031731 Bacteria 2400
607 Ga0307405_10237076 3300031731 Bacteria 1349
608 Ga0307407_10150254 3300031903 Bacteria 1513
609 Ga0307407_10622708 3300031903 Bacteria 806
610 Ga0307409_101287410 3300031995 Bacteria 756
611 Ga0307416_100783114 3300032002 Bacteria 1048
612 Ga0307415_100271049 3300032126 Bacteria 1390
613 Ga0307415_100415298 3300032126 Bacteria 1153
614 Ga0307507_10022911 3300033179 Bacteria 6878
615 Ga0307510_10011169 3300033180 Bacteria 10679
616 Ga0307510_10038624 3300033180 Bacteria 5275
617 Ga0307510_10109970 3300033180 Bacteria 2503
618 Ga0307510_10117120 3300033180 Bacteria 2382
619 Ga0307510_10164220 3300033180 Bacteria 1812
620 Ga0315911_1000023 3300033442 Bacteria 110348
621 Ga0373930_0052197 3300034816 Bacteria 895
622 Ga0373926_0027374 3300035083 Bacteria 1998
623 Ga0373929_0039365 3300035085 Bacteria 1044
624 Ga0373934_0061754 3300035086 Bacteria 1493
625 Ga0373949_0059408 3300035090 Bacteria 981
626 Ga0373952_0012160 3300035092 Bacteria 1690
627 Ga0373936_0018508 3300035113 Bacteria 2691
628 Ga0373945_0007634 3300035116 Bacteria 3507
629 Ga0373953_0042103 3300035117 Bacteria 1819
630 Ga0373954_0008023 3300035118 Bacteria 4626
631 Ga0373954_0140367 3300035118 Bacteria 1178
632 Ga0373957_0018309 3300035120 Bacteria 2451
633 Ga0373957_0022368 3300035120 Bacteria 2253
634 Ga0373943_0013757 3300035170 Bacteria 3658
635 Ga0373943_0148931 3300035170 Bacteria 1266
636 Ga0373943_0150781 3300035170 Bacteria 1259
637 Ga0373946_0017770 3300035171 Bacteria 2724
638 Ga0373955_0017796 3300035172 Bacteria 3522
639 Ga0373955_0021131 3300035172 Bacteria 3280
640 Ga0373924_0013622 3300035410 Bacteria 3057
641 Ga0373935_0181513 3300035692 Bacteria 1445
642 Ga0373935_0547588 3300035692 Bacteria 843
643 Ga0373927_0002222 3300035695 Bacteria 14277
644 Ga0373927_0005329 3300035695 Bacteria 8887
645 Ga0373927_0010638 3300035695 Bacteria 6129
646 Ga0373927_0011810 3300035695 Bacteria 5817
647 Ga0373927_0022460 3300035695 Bacteria 4133
648 Ga0373927_0041347 3300035695 Bacteria 2990
649 Ga0373927_0069624 3300035695 Bacteria 2277
650 Ga0373933_0000018 3300035724 Bacteria 98044
651 Ga0373933_0024431 3300035724 Bacteria 3459
652 Ga0373947_0002696 3300035725 Bacteria 10657
653 Ga0373947_0042175 3300035725 Bacteria 2723
654 Ga0373947_0052878 3300035725 Bacteria 2447
655 Ga0373947_0180540 3300035725 Bacteria 1374
656 Ga0373947_0291999 3300035725 Bacteria 1086
657 Ga0373937_0160231 3300036401 Bacteria 2109
658 Ga0373937_0370114 3300036401 Bacteria 1358
659 Ga0373937_0490218 3300036401 Bacteria 1167
660 Ga0373937_0902749 3300036401 Bacteria 832
661 Ga0373925_0020019 3300037068 Bacteria 4868
662 Ga0373925_0049643 3300037068 Bacteria 3128
663 Ga0373925_0050903 3300037068 Bacteria 3090
664 Ga0373925_0122786 3300037068 Bacteria 2017
665 Ga0373925_0239995 3300037068 Bacteria 1451
666 Ga0395899_0168634 3300037312 Bacteria 1543
667 Ga0395900_0070034 3300037418 Bacteria 3606
668 Ga0395900_0078178 3300037418 Bacteria 3399
669 Ga0395900_0172996 3300037418 Bacteria 2197
670 Ga0395900_0359079 3300037418 Bacteria 1429
671 Ga0395900_0527449 3300037418 Bacteria 1128
672 Ga0395898_0035897 3300037466 Bacteria 4926
673 Ga0395898_0042754 3300037466 Bacteria 4469
674 Ga0395898_0085845 3300037466 Bacteria 3034
675 Ga0395898_0527750 3300037466 Bacteria 1122
676 Ga0395898_0933169 3300037466 Bacteria 805
677 Ga0395905_0001838 3300037471 Bacteria 24511
678 Ga0395905_0123229 3300037471 Bacteria 2437
679 Ga0395905_0216793 3300037471 Bacteria 1792
680 Ga0395905_0223618 3300037471 Bacteria 1762
681 Ga0395905_0743806 3300037471 Bacteria 883
682 Ga0436364_0120583 3300037853 Bacteria 775
683 Ga0436364_0428944 3300037853 Bacteria 3178
684 Ga0436364_1215160 3300037853 Bacteria 1295
685 Ga0395901_0005769 3300038443 Bacteria 12539
686 Ga0395901_0079476 3300038443 Bacteria 3425
687 Ga0395901_0205585 3300038443 Bacteria 2063
688 Ga0395901_0247426 3300038443 Bacteria 1858
689 Ga0395901_0325248 3300038443 Bacteria 1590
690 Ga0395901_0327270 3300038443 Bacteria 1585
691 Ga0395901_0378597 3300038443 Bacteria 1457
692 Ga0395901_0478536 3300038443 Bacteria 1270
693 Ga0436365_0068950 3300039437 Bacteria 778
694 Ga0436365_0099807 3300039437 Bacteria 5377
695 Ga0436365_0490213 3300039437 Bacteria 7502
696 Ga0436365_0959812 3300039437 Bacteria 1841
697 Ga0436365_1559462 3300039437 Bacteria 1075
698 Ga0436365_1694116 3300039437 Bacteria 1677
699 Ga0436365_1716695 3300039437 Bacteria 989
700 Ga0436360_0366592 3300039438 Bacteria 4915
701 Ga0436360_1350684 3300039438 Bacteria 1789
702 Ga0436361_0279908 3300039447 Bacteria 1009
703 Ga0436361_0307241 3300039447 Bacteria 1780
704 Ga0436363_0546873 3300039450 Bacteria 842
705 Ga0436363_0941603 3300039450 Bacteria 1989
706 Ga0436363_1088635 3300039450 Bacteria 2618
707 Ga0436362_0434371 3300039453 Bacteria 733
708 Ga0436362_0439678 3300039453 Bacteria 3212
709 Ga0436362_0674594 3300039453 Bacteria 4086
710 Ga0451797_1359922 3300041453 Bacteria 1066
711 Ga0451839_0690549 3300041496 Bacteria 984
712 Ga0451841_0959049 3300041498 Bacteria 1797
713 Ga0451849_1221422 3300041505 Bacteria 1472
714 Ga0451853_2141541 3300041512 Bacteria 977
715 Ga0439455_0133213 3300042012 Bacteria 702
716 Ga0439458_0012089 3300042157 Bacteria 1934
717 Ga0439459_0068866 3300042438 Bacteria 815
718 Ga0439440_0037718 3300042993 Bacteria 1168
719 Ga0466972_0001082 3300044658 Bacteria 13062
720 Ga0466972_0004060 3300044658 Bacteria 7303
721 Ga0466965_0200006 3300044683 Bacteria 1060
722 Ga0466966_0000514 3300044684 Bacteria 24679
723 Ga0466966_0319860 3300044684 Bacteria 932
724 Ga0466966_0403561 3300044684 Bacteria 821
725 Ga0466961_0001153 3300044693 Bacteria 16232
726 Ga0466963_0084624 3300044694 Bacteria 2152
727 Ga0466963_0094035 3300044694 Bacteria 2044
728 Ga0466964_0098617 3300044706 Bacteria 1284
729 Ga0466971_0307595 3300044719 Bacteria 762
730 Ga0466968_0014655 3300044735 Bacteria 3100
731 Ga0466960_0058810 3300044901 Bacteria 1878
732 Ga0466960_0318941 3300044901 Bacteria 880
733 Ga0466959_0013468 3300045049 Bacteria 5927
734 Ga0466959_0140778 3300045049 Bacteria 1705
735 Ga0466967_0062222 3300045976 Bacteria 3313
736 Ga0466967_0199509 3300045976 Bacteria 1894
737 Ga0495617_057833 3300046452 Bacteria 1285
738 Ga0495592_0049039 3300046454 Bacteria 3140
739 Ga0495592_0434217 3300046454 Bacteria 826
740 Ga0495603_0010946 3300046455 Bacteria 5502
741 Ga0495603_0029308 3300046455 Bacteria 3319
742 Ga0495603_0078135 3300046455 Bacteria 1941
743 Ga0495603_0085759 3300046455 Bacteria 1843
744 Ga0495629_0000074 3300046459 Bacteria 87355
745 Ga0495629_0003855 3300046459 Bacteria 11309
746 Ga0495629_0353266 3300046459 Bacteria 1002
747 Ga0495638_0035894 3300046460 Bacteria 3158
748 Ga0495641_0036661 3300046461 Bacteria 2303
749 Ga0495651_0006512 3300046462 Bacteria 8920
750 Ga0495651_0107572 3300046462 Bacteria 2066
751 Ga0495651_0150950 3300046462 Bacteria 1675
752 Ga0495653_0025810 3300046463 Bacteria 4714
753 Ga0495653_0264283 3300046463 Bacteria 1136
754 Ga0495653_0487433 3300046463 Bacteria 770
755 Ga0495580_0003195 3300046472 Bacteria 14033
756 Ga0495580_0063760 3300046472 Bacteria 2583
757 Ga0495580_0271551 3300046472 Bacteria 1158
758 Ga0495582_0000059 3300046473 Bacteria 55798
759 Ga0495582_0018139 3300046473 Bacteria 3851
760 Ga0495582_0202100 3300046473 Bacteria 1135
761 Ga0495639_0000954 3300046475 Bacteria 13049
762 Ga0495639_0041807 3300046475 Bacteria 2066
763 Ga0495662_0010592 3300046476 Bacteria 4509
764 Ga0495664_0182706 3300046477 Bacteria 1271
765 Ga0495664_0266167 3300046477 Bacteria 1036
766 Ga0495585_0193134 3300046492 Bacteria 1040
767 Ga0495594_0002251 3300046499 Bacteria 10047
768 Ga0495607_0208031 3300046501 Bacteria 964
769 Ga0495583_0114575 3300046506 Bacteria 1140
770 Ga0495606_0002903 3300046507 Bacteria 18933
771 Ga0495606_0021783 3300046507 Bacteria 4688
772 Ga0495606_0090304 3300046507 Bacteria 1885
773 Ga0495608_0021279 3300046511 Bacteria 4451
774 Ga0495608_0139118 3300046511 Bacteria 1550
775 Ga0495608_0213931 3300046511 Bacteria 1211
776 Ga0495608_0579796 3300046511 Bacteria 674
777 Ga0495610_0155097 3300046512 Bacteria 973
778 Ga0495610_0167510 3300046512 Bacteria 924
779 Ga0495616_0065486 3300046513 Bacteria 1770
780 Ga0495618_0173313 3300046514 Bacteria 1372
781 Ga0495620_0146509 3300046515 Bacteria 922
782 Ga0495620_0154292 3300046515 Bacteria 894
783 Ga0495628_0133332 3300046516 Bacteria 1899
784 Ga0495628_0136649 3300046516 Bacteria 1873
785 Ga0495628_0225659 3300046516 Bacteria 1405
786 Ga0495628_0543040 3300046516 Bacteria 835
787 Ga0495630_0007365 3300046517 Bacteria 7860
788 Ga0495630_0494793 3300046517 Bacteria 937
789 Ga0495631_0073853 3300046518 Bacteria 1472
790 Ga0495631_0077469 3300046518 Bacteria 1435
791 Ga0495632_0072875 3300046519 Bacteria 1647
792 Ga0495632_0146648 3300046519 Bacteria 1092
793 Ga0495637_0023062 3300046520 Bacteria 2833
794 Ga0495643_0083759 3300046522 Bacteria 1655
795 Ga0495643_0218538 3300046522 Bacteria 905
796 Ga0495648_0008568 3300046524 Bacteria 8030
797 Ga0495648_0009770 3300046524 Bacteria 7390
798 Ga0495648_0169962 3300046524 Bacteria 1118
799 Ga0495663_0007571 3300046525 Bacteria 3005
800 Ga0495652_0010788 3300046529 Bacteria 8281
801 Ga0495652_0027010 3300046529 Bacteria 5062
802 Ga0495652_0315001 3300046529 Bacteria 1132
803 Ga0495652_0365300 3300046529 Bacteria 1030
804 Ga0495654_0004466 3300046530 Bacteria 8294
805 Ga0495665_0000395 3300046531 Bacteria 22177
806 Ga0495665_0048944 3300046531 Bacteria 2241
807 Ga0495665_0179137 3300046531 Bacteria 1102
808 Ga0495640_0007796 3300046533 Bacteria 8424
809 Ga0495640_0033703 3300046533 Bacteria 3637
810 Ga0495640_0084710 3300046533 Bacteria 2102
811 Ga0495640_0114632 3300046533 Bacteria 1757
812 Ga0495598_0005932 3300046537 Bacteria 2733
813 Ga0495609_0089477 3300046538 Bacteria 1339
814 Ga0495609_0185301 3300046538 Bacteria 875
815 Ga0495609_0192878 3300046538 Bacteria 854
816 Ga0495621_0017220 3300046539 Bacteria 2332
817 Ga0495597_0057697 3300046542 Bacteria 1698
818 Ga0495597_0071574 3300046542 Bacteria 1493
819 Ga0495645_0065000 3300046543 Bacteria 2639
820 Ga0495645_0077357 3300046543 Bacteria 2392
821 Ga0495645_0085629 3300046543 Bacteria 2256
822 Ga0495622_0007380 3300046557 Bacteria 5099
823 Ga0495622_0010940 3300046557 Bacteria 4186
824 Ga0495622_0022682 3300046557 Bacteria 2925
825 Ga0495622_0130393 3300046557 Bacteria 1145
826 Ga0495667_0002693 3300046559 Bacteria 11884
827 Ga0495667_0023995 3300046559 Bacteria 4107
828 Ga0495667_0128115 3300046559 Bacteria 1637
829 Ga0495667_0455703 3300046559 Bacteria 803
830 Ga0495656_0066589 3300046615 Bacteria 1587
831 Ga0495668_0101316 3300046616 Bacteria 1575
832 Ga0495668_0161542 3300046616 Bacteria 1227
833 Ga0495668_0286712 3300046616 Bacteria 902
834 Ga0495668_0464696 3300046616 Bacteria 697
835 Ga0495634_0003890 3300046642 Bacteria 11859
836 Ga0495634_0049440 3300046642 Bacteria 2828
837 Ga0495634_0329155 3300046642 Bacteria 918
838 Ga0495611_0125703 3300046648 Bacteria 1196
839 Ga0495625_0026562 3300046660 Bacteria 4373
840 Ga0495625_0129814 3300046660 Bacteria 1708
841 Ga0495625_0192049 3300046660 Bacteria 1352
842 Ga0495635_0037524 3300046663 Bacteria 3354
843 Ga0495659_0004407 3300046664 Bacteria 4433
844 Ga0495661_0014019 3300046665 Bacteria 5373
845 Ga0495661_0068017 3300046665 Bacteria 2091
846 Ga0495588_0005567 3300046674 Bacteria 5614
847 Ga0495588_0040853 3300046674 Bacteria 2367
848 Ga0495657_0004123 3300046675 Bacteria 11637
849 Ga0495657_0248612 3300046675 Bacteria 1071
850 Ga0495599_0039373 3300046678 Bacteria 2970
851 Ga0495599_0199240 3300046678 Bacteria 1230
852 Ga0495599_0286326 3300046678 Bacteria 997
853 Ga0495623_0027805 3300046679 Bacteria 3641
854 Ga0495646_0048511 3300046680 Bacteria 2579
855 Ga0495646_0049700 3300046680 Bacteria 2544
856 Ga0495647_0015017 3300046681 Bacteria 2707
857 Ga0495658_0001708 3300046683 Bacteria 11417
858 Ga0495658_0117171 3300046683 Bacteria 1607
859 Ga0495658_0149753 3300046683 Bacteria 1432
860 Ga0495669_0016657 3300046684 Bacteria 3149
861 Ga0495669_0062078 3300046684 Bacteria 1692
862 Ga0495669_0224628 3300046684 Bacteria 900
863 Ga0495669_0286021 3300046684 Bacteria 794
864 Ga0495613_0037354 3300046689 Bacteria 3601
865 Ga0495613_0094143 3300046689 Bacteria 2168
866 Ga0495613_0489234 3300046689 Bacteria 829
867 Ga0495624_0194616 3300046690 Bacteria 1233
868 Ga0495624_0269109 3300046690 Bacteria 1029
869 Ga0495670_0018631 3300046691 Bacteria 3419
870 Ga0495670_0050963 3300046691 Bacteria 2072
871 Ga0495670_0057059 3300046691 Bacteria 1960
872 Ga0495670_0077078 3300046691 Bacteria 1694
873 Ga0495671_0008231 3300046692 Bacteria 5881
874 Ga0495671_0172036 3300046692 Bacteria 1053
875 Ga0495589_0071392 3300046794 Bacteria 1697
876 Ga0495600_0088781 3300046809 Bacteria 2016
877 Ga0495660_0012639 3300046810 Bacteria 4900
878 Ga0495581_0000037 3300047315 Bacteria 47930
879 Ga0495581_0067114 3300047315 Bacteria 2074
880 Ga0495581_0092933 3300047315 Bacteria 1751
881 Ga0495581_0217098 3300047315 Bacteria 1118
882 Ga0495604_0015796 3300047317 Bacteria 6025
883 Ga0495604_0080448 3300047317 Bacteria 2441
884 Ga0495604_0197643 3300047317 Bacteria 1397
885 Ga0495674_0000499 3300047319 Bacteria 35905
886 Ga0495674_0299963 3300047319 Bacteria 1312
887 Ga0495672_0010203 3300047320 Bacteria 6713
888 Ga0495672_0025038 3300047320 Bacteria 3829
889 Ga0495676_0072599 3300047321 Bacteria 2642
890 Ga0495676_0171972 3300047321 Bacteria 1524
891 Ga0495676_0256358 3300047321 Bacteria 1191
892 Ga0495676_0427991 3300047321 Bacteria 875
893 Ga0495680_0007828 3300047322 Bacteria 9757
894 Ga0495680_0047752 3300047322 Bacteria 3365
895 Ga0495687_007460 3300047443 Bacteria 6435
896 Ga0495687_064096 3300047443 Bacteria 1502
897 Ga0495687_082924 3300047443 Bacteria 1250
898 Ga0495675_0021958 3300047444 Bacteria 4065
899 Ga0495675_0097237 3300047444 Bacteria 1845
900 Ga0495677_0010815 3300047445 Bacteria 3343
901 Ga0495673_0117030 3300047469 Bacteria 1059
902 Ga0495684_0004761 3300047471 Bacteria 10604
903 Ga0495684_0009233 3300047471 Bacteria 7615
904 Ga0495684_0448684 3300047471 Bacteria 897
905 Ga0495686_0161363 3300047472 Bacteria 1309
906 Ga0495593_0005039 3300047673 Bacteria 7817
907 Ga0495593_0088364 3300047673 Bacteria 1597
908 Ga0495593_0233537 3300047673 Bacteria 922
909 Ga0495602_0071161 3300048088 Bacteria 2971
910 Ga0495602_0285083 3300048088 Bacteria 1215
911 Ga0495626_0017446 3300048091 Bacteria 3623
912 Ga0495626_0133501 3300048091 Bacteria 1058
913 Ga0496100_0118302 3300048903 Bacteria 1851
914 Ga0496100_0624594 3300048903 Bacteria 838
915 Ga0496100_0666833 3300048903 Bacteria 810
916 Ga0496101_0016596 3300048904 Bacteria 4980
917 Ga0496101_0078259 3300048904 Bacteria 2438
918 Ga0496101_0154100 3300048904 Bacteria 1759
919 Ga0496101_0245888 3300048904 Bacteria 1393
920 Ga0496101_0573924 3300048904 Bacteria 892
921 Ga0496102_0007995 3300048905 Bacteria 9037
922 Ga0496102_0105126 3300048905 Bacteria 2627
923 Ga0496102_0114675 3300048905 Bacteria 2514
924 Ga0496102_0133455 3300048905 Bacteria 2325
925 Ga0496102_0435364 3300048905 Bacteria 1231
926 Ga0496102_0480087 3300048905 Bacteria 1164
927 Ga0496102_0608825 3300048905 Bacteria 1015
928 Ga0496103_0021683 3300048906 Bacteria 3866
929 Ga0496103_0026466 3300048906 Bacteria 3511
930 Ga0496103_0287995 3300048906 Bacteria 1057
931 Ga0496104_0002953 3300048907 Bacteria 14655
932 Ga0496104_0019560 3300048907 Bacteria 6198
933 Ga0496104_0064707 3300048907 Bacteria 3469
934 Ga0496104_0195370 3300048907 Bacteria 1935
935 Ga0496104_0237253 3300048907 Bacteria 1735
936 Ga0496104_0282510 3300048907 Bacteria 1573
937 Ga0496104_0561854 3300048907 Bacteria 1052
938 Ga0496105_0004911 3300048908 Bacteria 10109
939 Ga0496105_0006535 3300048908 Bacteria 8969
940 Ga0496105_0092349 3300048908 Bacteria 2499
941 Ga0496105_0364485 3300048908 Bacteria 1152
942 Ga0496106_0001534 3300048909 Bacteria 17367
943 Ga0496106_0002682 3300048909 Bacteria 13223
944 Ga0496106_0165162 3300048909 Bacteria 1752
945 Ga0496106_0205698 3300048909 Bacteria 1567
946 Ga0496106_0362496 3300048909 Bacteria 1164
947 Ga0496106_0526338 3300048909 Bacteria 949
948 Ga0496106_0796895 3300048909 Bacteria 749
949 Ga0496107_0009723 3300048910 Bacteria 6669
950 Ga0496107_0020271 3300048910 Bacteria 4694
951 Ga0496107_0041291 3300048910 Bacteria 3312
952 Ga0496107_0224849 3300048910 Bacteria 1396
953 Ga0496107_0264714 3300048910 Bacteria 1279
954 Ga0496107_0270875 3300048910 Bacteria 1264
955 Ga0496107_0287865 3300048910 Bacteria 1223
956 Ga0496107_0328471 3300048910 Bacteria 1138
957 Ga0496107_0629840 3300048910 Bacteria 791
958 Ga0496108_0000438 3300048911 Bacteria 33500
959 Ga0496108_0086587 3300048911 Bacteria 2660
960 Ga0496108_0311738 3300048911 Bacteria 1371
961 Ga0496108_0359744 3300048911 Bacteria 1270
962 Ga0496109_0000284 3300048912 Bacteria 48342
963 Ga0496109_0049092 3300048912 Bacteria 3841
964 Ga0496109_0119220 3300048912 Bacteria 2457
965 Ga0496109_0126075 3300048912 Bacteria 2387
966 Ga0496109_0163132 3300048912 Bacteria 2088
967 Ga0496109_0226785 3300048912 Bacteria 1757
968 Ga0496109_0615417 3300048912 Bacteria 1022
969 Ga0496110_0013998 3300048913 Bacteria 6649
970 Ga0496110_0027228 3300048913 Bacteria 4899
971 Ga0496110_0118790 3300048913 Bacteria 2381
972 Ga0496110_0196934 3300048913 Bacteria 1830
973 Ga0496110_0361433 3300048913 Bacteria 1323
974 Ga0496110_0363304 3300048913 Bacteria 1319
975 Ga0496111_0003617 3300048914 Bacteria 9584
976 Ga0496111_0188832 3300048914 Bacteria 1532
977 Ga0496111_0248473 3300048914 Bacteria 1320
978 Ga0496112_0000090 3300048915 Bacteria 59721
979 Ga0496112_0012845 3300048915 Bacteria 7709
980 Ga0496112_0026339 3300048915 Bacteria 5593
981 Ga0496112_0032112 3300048915 Bacteria 5096
982 Ga0496112_0041410 3300048915 Bacteria 4507
983 Ga0496112_0045171 3300048915 Bacteria 4318
984 Ga0496112_0048383 3300048915 Bacteria 4169
985 Ga0496112_0104578 3300048915 Bacteria 2801
986 Ga0496112_0851032 3300048915 Bacteria 835
987 Ga0496113_0021967 3300048916 Bacteria 4507
988 Ga0496113_0032368 3300048916 Bacteria 3801
989 Ga0496113_0178351 3300048916 Bacteria 1684
990 Ga0496114_0074265 3300048917 Bacteria 2862
991 Ga0496114_0085219 3300048917 Bacteria 2676
992 Ga0496114_0100146 3300048917 Bacteria 2472
993 Ga0496114_0353929 3300048917 Bacteria 1299
994 Ga0496114_0429457 3300048917 Bacteria 1170
995 Ga0496114_0709835 3300048917 Bacteria 881
996 Ga0496115_0011512 3300048918 Bacteria 6632
997 Ga0496115_0041650 3300048918 Bacteria 3656
998 Ga0496115_0050637 3300048918 Bacteria 3328
999 Ga0496115_0129251 3300048918 Bacteria 2081
1000 Ga0496115_0140415 3300048918 Bacteria 1993
1001 Ga0496115_0182002 3300048918 Bacteria 1737
1002 Ga0496115_0217540 3300048918 Bacteria 1577
1003 Ga0496115_0269887 3300048918 Bacteria 1398
1004 Ga0496115_0308792 3300048918 Bacteria 1295
1005 Ga0496116_0039187 3300048919 Bacteria 3278
1006 Ga0496117_0018642 3300048920 Bacteria 5738
1007 Ga0496117_0026927 3300048920 Bacteria 4489
1008 Ga0496117_0127817 3300048920 Bacteria 1547
1009 Ga0496117_0154326 3300048920 Bacteria 1354
1010 Ga0496117_0156770 3300048920 Bacteria 1339
1011 Ga0496118_0010937 3300048921 Bacteria 8923
1012 Ga0496118_0013220 3300048921 Bacteria 7828
1013 Ga0496118_0043013 3300048921 Bacteria 3556
1014 Ga0496118_0058685 3300048921 Bacteria 2873
1015 Ga0496119_0003665 3300048922 Bacteria 15760
1016 Ga0496119_0037454 3300048922 Bacteria 3150
1017 Ga0496119_0211864 3300048922 Bacteria 996
1018 Ga0496119_0214474 3300048922 Bacteria 988
1019 Ga0496120_0009533 3300048923 Bacteria 6874
1020 Ga0496120_0015629 3300048923 Bacteria 4997
1021 Ga0496120_0036659 3300048923 Bacteria 2916
1022 Ga0496120_0061579 3300048923 Bacteria 2094
1023 Ga0496120_0196722 3300048923 Bacteria 979
1024 Ga0496121_0000571 3300048924 Bacteria 69504
1025 Ga0496121_0002044 3300048924 Bacteria 31940
1026 Ga0496121_0005698 3300048924 Bacteria 15829
1027 Ga0496121_0009006 3300048924 Bacteria 11574
1028 Ga0496121_0021216 3300048924 Bacteria 6375
1029 Ga0496121_0050387 3300048924 Bacteria 3518
1030 Ga0496121_0137009 3300048924 Bacteria 1822
1031 Ga0496121_0143830 3300048924 Bacteria 1765
1032 Ga0496121_0147464 3300048924 Bacteria 1736
1033 Ga0496121_0159670 3300048924 Bacteria 1650
1034 Ga0496122_0032311 3300048925 Bacteria 4332
1035 Ga0496122_0279424 3300048925 Bacteria 913
1036 Ga0496123_0027188 3300048926 Bacteria 4266
1037 Ga0496124_0001685 3300048927 Bacteria 31301
1038 Ga0496124_0054167 3300048927 Bacteria 3396
1039 Ga0496124_0191030 3300048927 Bacteria 1567
1040 Ga0496124_0315592 3300048927 Bacteria 1122
1041 Ga0496124_0333586 3300048927 Bacteria 1080
1042 Ga0496125_0008547 3300048928 Bacteria 10696
1043 Ga0496125_0032470 3300048928 Bacteria 4637
1044 Ga0496125_0044277 3300048928 Bacteria 3766
1045 Ga0496125_0051110 3300048928 Bacteria 3412
1046 Ga0496125_0189819 3300048928 Bacteria 1358
1047 Ga0496125_0192476 3300048928 Bacteria 1345
1048 Ga0496125_0434044 3300048928 Bacteria 757
1049 Ga0496126_0001940 3300048929 Bacteria 29487
1050 Ga0496126_0011305 3300048929 Bacteria 9260
1051 Ga0496126_0012589 3300048929 Bacteria 8658
1052 Ga0496126_0020579 3300048929 Bacteria 6461
1053 Ga0496126_0034993 3300048929 Bacteria 4710
1054 Ga0496126_0035265 3300048929 Bacteria 4690
1055 Ga0496126_0036452 3300048929 Bacteria 4598
1056 Ga0496126_0051743 3300048929 Bacteria 3737
1057 Ga0496126_0054192 3300048929 Bacteria 3634
1058 Ga0496126_0084046 3300048929 Bacteria 2808
1059 Ga0496126_0088646 3300048929 Bacteria 2725
1060 Ga0496126_0106344 3300048929 Bacteria 2449
1061 Ga0496126_0215996 3300048929 Bacteria 1613
1062 Ga0496126_0228097 3300048929 Bacteria 1561
1063 Ga0496126_0283923 3300048929 Bacteria 1370
1064 Ga0495682_0007587 3300049460 Bacteria 4308
1065 Ga0495682_0090317 3300049460 Bacteria 1100
1066 Ga0495682_0159291 3300049460 Bacteria 804
1067 Ga0501031_0004229 3300049568 Bacteria 9276
1068 Ga0501031_0022815 3300049568 Bacteria 4081
1069 Ga0501032_0005576 3300049569 Bacteria 9333
1070 Ga0501032_0008917 3300049569 Bacteria 7292
1071 Ga0501032_0026485 3300049569 Bacteria 3987
1072 Ga0501033_0001252 3300049570 Bacteria 22748
1073 Ga0501033_0002138 3300049570 Bacteria 17097
1074 Ga0501033_0010457 3300049570 Bacteria 7117
1075 Ga0501033_0015364 3300049570 Bacteria 5809
1076 Ga0501033_0308681 3300049570 Bacteria 1112
1077 Ga0501034_0000417 3300049571 Bacteria 71512
1078 Ga0501034_0091175 3300049571 Bacteria 3045
1079 Ga0501034_0230850 3300049571 Bacteria 1800
1080 Ga0501036_0007704 3300049572 Bacteria 8795
1081 Ga0501036_0124734 3300049572 Bacteria 2174
1082 Ga0501036_0126547 3300049572 Bacteria 2158
1083 Ga0501036_0242142 3300049572 Bacteria 1513
1084 Ga0501037_0000156 3300049573 Bacteria 63938
1085 Ga0501037_0004921 3300049573 Bacteria 9721
1086 Ga0501037_0103996 3300049573 Bacteria 2048
1087 Ga0501037_0140803 3300049573 Bacteria 1726
1088 Ga0501038_0000164 3300049574 Bacteria 56139
1089 Ga0501038_0002067 3300049574 Bacteria 18586
1090 Ga0501038_0038092 3300049574 Bacteria 4211
1091 Ga0501038_0060185 3300049574 Bacteria 3250
1092 Ga0501038_0130779 3300049574 Bacteria 2061
1093 Ga0501038_0137484 3300049574 Bacteria 2001
1094 Ga0501039_0000457 3300049575 Bacteria 29700
1095 Ga0501039_0009452 3300049575 Bacteria 7432
1096 Ga0501039_0045721 3300049575 Bacteria 3382
1097 Ga0501039_0073043 3300049575 Bacteria 2666
1098 Ga0501039_0108017 3300049575 Bacteria 2175
1099 Ga0501039_0148154 3300049575 Bacteria 1844
1100 Ga0501039_0787607 3300049575 Bacteria 742
1101 Ga0501040_0003098 3300049576 Bacteria 10777
1102 Ga0501041_0021842 3300049577 Bacteria 3834
1103 Ga0501042_0076593 3300049578 Bacteria 2394
1104 Ga0501042_0100031 3300049578 Bacteria 2084
1105 Ga0501043_0000617 3300049579 Bacteria 31394
1106 Ga0501043_0004274 3300049579 Bacteria 11628
1107 Ga0501043_0023016 3300049579 Bacteria 4886
1108 Ga0501043_0164488 3300049579 Bacteria 1732
1109 Ga0501043_0563045 3300049579 Bacteria 845
1110 Ga0501046_0000304 3300049580 Bacteria 49687
1111 Ga0501046_0031928 3300049580 Bacteria 4266
1112 Ga0501046_0049248 3300049580 Bacteria 3333
1113 Ga0501046_0054572 3300049580 Bacteria 3142
1114 Ga0501047_0000739 3300049581 Bacteria 34062
1115 Ga0501047_0021855 3300049581 Bacteria 6143
1116 Ga0501047_0342840 3300049581 Bacteria 1331
1117 Ga0501047_0392041 3300049581 Bacteria 1222
1118 Ga0501047_0486122 3300049581 Bacteria 1062
1119 Ga0501048_0001982 3300049582 Bacteria 15559
1120 Ga0501048_0071488 3300049582 Bacteria 2449
1121 Ga0501048_0075721 3300049582 Bacteria 2375
1122 Ga0501067_0001170 3300049583 Bacteria 14229
1123 Ga0501067_0005434 3300049583 Bacteria 7075
1124 Ga0501068_0000092 3300049584 Bacteria 38245
1125 Ga0501068_0007115 3300049584 Bacteria 6193
1126 Ga0501068_0034398 3300049584 Bacteria 3022
1127 Ga0501069_0026949 3300049585 Bacteria 3148
1128 Ga0501070_0003917 3300049586 Bacteria 12845
1129 Ga0501070_0089886 3300049586 Bacteria 2541
1130 Ga0501072_0000981 3300049588 Bacteria 21075
1131 Ga0501072_0069835 3300049588 Bacteria 2773
1132 Ga0501073_0000309 3300049589 Bacteria 32261
1133 Ga0501073_0010512 3300049589 Bacteria 6782
1134 Ga0501073_0264178 3300049589 Bacteria 1188
1135 Ga0501073_0310870 3300049589 Bacteria 1087
1136 Ga0501074_0000051 3300049590 Bacteria 56446
1137 Ga0501074_0103930 3300049590 Bacteria 2033
1138 Ga0501076_0534345 3300049592 Bacteria 967
1139 Ga0501077_0045933 3300049593 Bacteria 2775
1140 Ga0501079_0008257 3300049741 Bacteria 7893
1141 Ga0501079_0012954 3300049741 Bacteria 6360
1142 Ga0501080_0004599 3300049742 Bacteria 12301
1143 Ga0501080_0278926 3300049742 Bacteria 1520
1144 Ga0501083_0000276 3300049744 Bacteria 32596
1145 Ga0501083_0024290 3300049744 Bacteria 4199
1146 Ga0501035_0003055 3300049822 Bacteria 16049
1147 Ga0501035_0010916 3300049822 Bacteria 8411
1148 Ga0501035_0060737 3300049822 Bacteria 3365
1149 Ga0501035_0136279 3300049822 Bacteria 2137
1150 Ga0501035_0200136 3300049822 Bacteria 1713
1151 Ga0501035_0253058 3300049822 Bacteria 1495
1152 Ga0501035_0479898 3300049822 Bacteria 1025
1153 Ga0501044_0005655 3300049823 Bacteria 13861
1154 Ga0501044_0015923 3300049823 Bacteria 8091
1155 Ga0501044_0030430 3300049823 Bacteria 5690
1156 Ga0501044_0059675 3300049823 Bacteria 3908
1157 Ga0501044_0071441 3300049823 Bacteria 3529
1158 Ga0501044_0230031 3300049823 Bacteria 1802
1159 Ga0501044_0313630 3300049823 Bacteria 1494
1160 Ga0501044_0506812 3300049823 Bacteria 1107
1161 Ga0501045_0006640 3300049824 Bacteria 8019
1162 nmdc:mga03683_23142_c1 3300050489 Bacteria 2416
1163 nmdc:mga03683_51528_c1 3300050489 Bacteria 1718
1164 nmdc:mga03n38_14107_c1 3300050490 Bacteria 3056
1165 nmdc:mga00v17_12435_c1 3300050491 Bacteria 4697
1166 nmdc:mga00v17_328007_c1 3300050491 Bacteria 994
1167 nmdc:mga0yw44_104106_c1 3300050492 Bacteria 1811
1168 nmdc:mga0yw44_143268_c1 3300050492 Bacteria 1554
1169 nmdc:mga0yw44_288949_c1 3300050492 Bacteria 1097
1170 nmdc:mga0yw44_35812_c1 3300050492 Bacteria 2920
1171 nmdc:mga0yw44_43176_c1 3300050492 Bacteria 2691
1172 nmdc:mga0yw44_9908_c1 3300050492 Bacteria 4843
1173 nmdc:mga0k408_31278_c1 3300050493 Bacteria 3038
1174 nmdc:mga0k408_335517_c1 3300050493 Bacteria 902
1175 nmdc:mga06z11_21544_c1 3300050494 Bacteria 2996
1176 nmdc:mga04h51_18212_c1 3300050495 Bacteria 2065
1177 nmdc:mga04h51_52527_c1 3300050495 Bacteria 1373
1178 nmdc:mga07m45_23537_c2 3300050496 Bacteria 1267
1179 nmdc:mga07m45_34403_c1 3300050496 Bacteria 2816
1180 nmdc:mga09592_498483_c1 3300050508 Bacteria 1048
1181 nmdc:mga08y16_174216_c1 3300050511 Bacteria 2234
1182 nmdc:mga0n895_563477_c1 3300050512 Bacteria 1144
1183 nmdc:mga0rr50_20625_c1 3300050513 Bacteria 4481
1184 nmdc:mga0sz30_150175_c1 3300050516 Bacteria 1031
1185 nmdc:mga0sz30_2295_c1 3300050516 Bacteria 6830
1186 nmdc:mga0sz30_50523_c1 3300050516 Bacteria 1763
1187 Ga0495601_0049088 3300053077 Bacteria 2660
1188 Ga0495601_0227975 3300053077 Bacteria 1217
1189 Ga0495612_0085023 3300053078 Bacteria 1333
1190 Ga0500635_0016398 3300053080 Bacteria 2203
1191 Ga0500635_0114726 3300053080 Bacteria 1003
1192 Ga0495655_0015329 3300053083 Bacteria 1627
1193 Ga0495595_0054793 3300053084 Bacteria 1855
1194 Ga0495619_0003869 3300053085 Bacteria 9622
1195 Ga0495619_0064649 3300053085 Bacteria 2439
1196 Ga0500578_0041025 3300053086 Bacteria 2974
1197 Ga0500643_000028 3300053087 Bacteria 245672
1198 Ga0500643_006922 3300053087 Bacteria 4660
1199 Ga0500644_0004653 3300053088 Bacteria 3442
1200 Ga0500651_0027045 3300053093 Bacteria 3606
1201 Ga0500651_0054621 3300053093 Bacteria 2502
1202 Ga0500651_0063127 3300053093 Bacteria 2312
1203 Ga0500566_0004102 3300053094 Bacteria 8686
1204 Ga0500566_0023555 3300053094 Bacteria 3615
1205 Ga0500566_0165438 3300053094 Bacteria 1148
1206 Ga0500641_0005429 3300053096 Bacteria 4518
1207 Ga0500641_0006195 3300053096 Bacteria 4241
1208 Ga0500641_0013290 3300053096 Bacteria 3022
1209 Ga0500650_0102863 3300053098 Bacteria 1336
1210 Ga0500554_067098 3300053102 Bacteria 1161
1211 Ga0500555_005200 3300053103 Bacteria 3691
1212 Ga0500556_0000051 3300053104 Bacteria 119031
1213 Ga0500556_0002319 3300053104 Bacteria 6243
1214 Ga0500556_0082667 3300053104 Bacteria 1216
1215 Ga0500557_000127 3300053105 Bacteria 20158
1216 Ga0500569_049232 3300053109 Bacteria 1265
1217 Ga0500569_055369 3300053109 Bacteria 1209
1218 Ga0500592_001710 3300053116 Bacteria 3556
1219 Ga0500594_0124599 3300053118 Bacteria 811
1220 Ga0500595_000141 3300053119 Bacteria 46988
1221 Ga0500595_008509 3300053119 Bacteria 4187
1222 Ga0500595_012407 3300053119 Bacteria 3298
1223 Ga0500595_013681 3300053119 Bacteria 3103
1224 Ga0500595_030082 3300053119 Bacteria 1834
1225 Ga0500607_016454 3300053121 Bacteria 4240
1226 Ga0500607_142469 3300053121 Bacteria 1125
1227 Ga0500608_000364 3300053122 Bacteria 17525
1228 Ga0500608_092763 3300053122 Bacteria 1409
1229 Ga0500642_0000041 3300053130 Bacteria 89564
1230 Ga0500642_0000174 3300053130 Bacteria 26656
1231 Ga0500642_0003706 3300053130 Bacteria 4666
1232 Ga0500652_009360 3300053131 Bacteria 3311
1233 Ga0500658_0058930 3300053134 Bacteria 1591
1234 Ga0500658_0102230 3300053134 Bacteria 1252
1235 Ga0500559_0000878 3300053136 Bacteria 19226
1236 Ga0500559_0067464 3300053136 Bacteria 1606
1237 Ga0500559_0132545 3300053136 Bacteria 1164
1238 Ga0500568_0006215 3300053139 Bacteria 6031
1239 Ga0500568_0009795 3300053139 Bacteria 4529
1240 Ga0500568_0039918 3300053139 Bacteria 1892
1241 Ga0500577_0003046 3300053142 Bacteria 4324
1242 Ga0500585_100240 3300053144 Bacteria 1044
1243 Ga0500590_199889 3300053148 Bacteria 847
1244 Ga0500603_004904 3300053150 Bacteria 2868
1245 Ga0500603_005027 3300053150 Bacteria 2837
1246 Ga0500604_0028195 3300053151 Bacteria 1629
1247 Ga0500616_0000150 3300053153 Bacteria 117918
1248 Ga0500616_0000408 3300053153 Bacteria 58453
1249 Ga0500616_0124189 3300053153 Bacteria 1229
1250 Ga0500620_033895 3300053155 Bacteria 1636
1251 Ga0500622_0004154 3300053156 Bacteria 9267
1252 Ga0500622_0074804 3300053156 Bacteria 1705
1253 Ga0500627_0179982 3300053158 Bacteria 951
1254 Ga0500627_0188176 3300053158 Bacteria 927
1255 Ga0500633_0115842 3300053160 Bacteria 995
1256 Ga0500638_010096 3300053162 Bacteria 4115
1257 Ga0500636_0003573 3300053177 Bacteria 8763
1258 Ga0500636_0010474 3300053177 Bacteria 5411
1259 Ga0500636_0032237 3300053177 Bacteria 3101
1260 Ga0500636_0270208 3300053177 Bacteria 855
1261 Ga0500637_0000311 3300053178 Bacteria 18186
1262 Ga0500637_0011488 3300053178 Bacteria 4583
1263 Ga0500637_0013210 3300053178 Bacteria 4324
1264 Ga0500570_145036 3300053724 Bacteria 861
1265 Ga0500657_124126 3300053728 Bacteria 1016
1266 Ga0500625_008973 3300053729 Bacteria 4444
1267 Ga0500645_012425 3300053730 Bacteria 2751
1268 Ga0500552_020207 3300053733 Bacteria 940
1269 Ga0500599_000989 3300053736 Bacteria 3182
1270 Ga0500601_000420 3300053737 Bacteria 7101
1271 Ga0501084_0005554 3300054114 Bacteria 10350
1272 Ga0501084_0115581 3300054114 Bacteria 2255
1273 Ga0500661_013901 3300055283 Bacteria 1450
1274 Ga0500661_025906 3300055283 Bacteria 1037
1275 Ga0501082_0026337 3300060353 Bacteria 5010
1276 Ga0501082_0087083 3300060353 Bacteria 2694
1277 Ga0501082_0790994 3300060353 Bacteria 830
1278 2507504426 2507262055 Bacteria 8048963
1279 2508545854 2508501009 Bacteria 7784016
1280 2508694681 2508501042 Bacteria 8719808
1281 2509146408 2508501128 Bacteria 8613869
1282 2511396418 2511231028 Bacteria 8046582
1283 2513624232 2513237092 Bacteria 8341956
1284 2513638720 2513237094 Bacteria 8789602
1285 2513649192 2513237095 Bacteria 8976980
1286 2513656218 2513237096 Bacteria 8722461
1287 2513673372 2513237098 Bacteria 9902361
1288 2513694637 2513237101 Bacteria 7952346
1289 2513702120 2513237102 Bacteria 7703324
1290 2513716706 2513237104 Bacteria 10034502
1291 2513860681 2513237137 Bacteria 9558895
1292 2513874191 2513237139 Bacteria 8737671
1293 2513892502 2513237141 Bacteria 8496279
1294 2513917603 2513237145 Bacteria 8979722
1295 2514010051 2513237161 Bacteria 8871253
1296 2515624400 2515154112 Bacteria 8294334
1297 2517103091 2517093001 Bacteria 9002274
1298 2517887738 2517572143 Bacteria 9484767
1299 2524438925 2524023205 Bacteria 8918781
1300 2524470912 2524023210 Bacteria 9029266
1301 2524535403 2524023228 Bacteria 10118060
1302 2528849425 2528768022 Bacteria 10457665
1303 2603862432 2602042107 Bacteria 6226103
1304 2617350310 2617270735 Bacteria 9163226
1305 2617374396 2617270741 Bacteria 8201522
1306 2644290271 2643221651 Bacteria 4798932
1307 2671120751 2667528175 Bacteria 7532676
1308 2723842451 2721755755 Bacteria 8322773
1309 2728748304 2728368998 Bacteria 8720350
1310 2745081980 2744054633 Bacteria 8678936
1311 2793059311 2791355196 Bacteria 7323613
1312 2793070475 2791355197 Bacteria 8420563
1313 2793078695
1314 2805920909 2802429603 Bacteria 8777136
1315 2818240579 2816332527 Bacteria 8933356
1316 2824604684 2824600985 Bacteria 8488197
1317 2824615397 2824609381 Bacteria 8672835
1318 2824618854 2824617872 Bacteria 8814715
1319 2824628960 2824626560 Bacteria 8813858
1320 2824639253 2824635225 Bacteria 8785348
1321 2824648827 2824644064 Bacteria 8743947
1322 2824658643 2824653114 Bacteria 8493680
1323 2824665825 2824661429 Bacteria 9877870
1324 2824675100 2824671348 Bacteria 8369588
1325 2824686249 2824679649 Bacteria 8248951
1326 2824692537 2824687955 Bacteria 8360029
1327 2824700900 2824696289 Bacteria 8335049
1328 2824711300 2824704595 Bacteria 9667483
1329 2824717538 2824714736 Bacteria 8717648
1330 2824726770 2824723954 Bacteria 8758240
1331 2824737689 2824732956 Bacteria 7810675
1332 2824751202 2824746037 Bacteria 7911610
1333 2824759684 2824753945 Bacteria 9787441
1334 2824769935 2824763712 Bacteria 9792355
1335 2824780317 2824773399 Bacteria 8360218
1336 2838126041 2838122688 Bacteria 8803140
1337 2841942565 2841941048 Bacteria 8688029
1338 2841953085 2841949485 Bacteria 8680857
1339 2841963938 2841957949 Bacteria 8652217
1340 2841970890 2841966195 Bacteria 8673214
1341 2841977850 2841974524 Bacteria 8931498
1342 2841984586 2841983080 Bacteria 8395090
1343 2842041690 2842038055 Bacteria 8002051
1344 2842049732 2842045827 Bacteria 8006841
1345 2844321420 2844315083 Bacteria 8138177
1346 2847931981 2847930680 Bacteria 9342022
1347 2847943228 2847939898 Bacteria 8606328
1348 2849076957 2849076700 Bacteria 7039503
1349 2857514774 2857509624 Bacteria 7472071
1350 2857525679 2857524615 Bacteria 6615449
1351 2874595628 2874590934 Bacteria 8299676
1352 2874606863 2874604998 Bacteria 7834745
1353 2874620377 2874612657 Bacteria 8252029
1354 2874621865 2874620515 Bacteria 8290088
1355 2874629651 2874628541 Bacteria 8630250
1356 2874651738 2874645413 Bacteria 8214782
1357 2876769219 2876761206 Bacteria 10111113
1358 2876775823 2876771140 Bacteria 8287509
1359 2876821634 2876818435 Bacteria 8274608
1360 2879079914 2879074833 Bacteria 8279565
1361 2879085663 2879083081 Bacteria 8587928
1362 2879104502 2879099564 Bacteria 10442239
1363 2879112297 2879110137 Bacteria 8907982
1364 2879133999 2879127579 Bacteria 8294491
1365 2879148484 2879142872 Bacteria 8267021
1366 2881364631 2881364244 Bacteria 7710352
1367 2881671352 2881665667 Bacteria 8175609
1368 2885374397 2885366525 Bacteria 8326213
1369 2885383288 2885374607 Bacteria 8927485
1370 2885391149 2885383462 Bacteria 9473874
1371 2885413482 2885409591 Bacteria 9235467
1372 2888387257 2888378607 Bacteria 9652610
1373 2888391444 2888388044 Bacteria 7304136
1374 2888426939 2888419890 Bacteria 7857137
1375 2889034320 2889033259 Bacteria 9099371
1376 2893071761 2893066018 Bacteria 6158120
1377 2903728001 2903727486 Bacteria 8281579
1378 2903755489 2903748898 Bacteria 9972761
1379 2903776235 2903768456 Bacteria 9749579
1380 2904669542 2904666416 Bacteria 8226587
1381 2904691869 2904690495 Bacteria 9412302
1382 2904709529
1383 2904713645 2904711408 Bacteria 9771557
1384 2906602515 2906602504 Bacteria 8295279
1385 2906612752
1386 2906635108 2906626472 Bacteria 8826946
1387 2906640578 2906635258 Bacteria 8601019
1388 2906649706 2906643746 Bacteria 8722424
1389 2906663198 2906660503 Bacteria 8595048
1390 2908745944 2908739725 Bacteria 8628932
1391 2908763972 2908756301 Bacteria 8864324
1392 2908776878 2908775508 Bacteria 8092255
1393 2919074529 2919073203 Bacteria 6531949
1394 2922364900 2922361189 Bacteria 7436256
1395 2922370319
1396 2922391636 2922386360 Bacteria 7017218
1397 2922398857 2922393267 Bacteria 8285685
1398 2922433229
1399 2929622625 2929615660 Bacteria 9193770
1400 2929632272 2929624759 Bacteria 9339455
1401 2932790032 2932784394 Bacteria 9704911
1402 2932800700 2932794094 Bacteria 7915132
1403 2932808431 2932801729 Bacteria 7987968
1404 2932815575 2932809354 Bacteria 9135765
1405 2932824849 2932818245 Bacteria 9955613
1406 2932829111 2932828146 Bacteria 9745859
1407 2933584743 2933577622 Bacteria 9116884
1408 2935613169 2935608549 Bacteria 8203142
1409 2935617587 2935616580 Bacteria 9032984
1410 2935630574 2935630451 Bacteria 8169952
1411 2935643632 2935638405 Bacteria 10015038
1412 2935654127 2935648319 Bacteria 8801166
1413 2935662771 2935656913 Bacteria 8965014
1414 2935671058 2935665750 Bacteria 9571747
1415 2935681701 2935675223 Bacteria 9928132
1416 2935692678 2935684952 Bacteria 9590419
1417 2935702665 2935694250 Bacteria 9291695
1418 2935711952 2935703347 Bacteria 10242284
1419 2935721296 2935713505 Bacteria 9608509
1420 2935730710 2935722832 Bacteria 9608746
1421 2935739986 2935732158 Bacteria 9706831
1422 2935749024 2935741537 Bacteria 9707219
1423 2935758894 2935750917 Bacteria 9590372
1424 2935767159 2935760218 Bacteria 9817913
1425 2935774811 2935769743 Bacteria 7878163
1426 2935780003 2935777560 Bacteria 8077691
1427 2935792989 2935785616 Bacteria 7962367
1428 2935798559 2935793552 Bacteria 8012592
1429 2935806923 2935801545 Bacteria 9301974
1430 2935818812 2935810662 Bacteria 9401221
1431 2935824979 2935819856 Bacteria 8261050
1432 2935834317 2935827899 Bacteria 10038562
1433 2935843958 2935837841 Bacteria 9454360
1434 2935852198 2935847175 Bacteria 8228321
1435 2935856914 2935855204 Bacteria 9035059
1436 2935868441 2935864058 Bacteria 9784707
1437 2935879751 2935873716 Bacteria 9632195
1438 2935883538 2935883170 Bacteria 7964738
1439 2935910632 2935908558 Bacteria 8568796
1440 2935921812 2935916978 Bacteria 9113783
1441 2935930049 2935926038 Bacteria 8601059
1442 2935937717 2935934488 Bacteria 8602579
1443 2935949821 2935942939 Bacteria 8599779
1444 2935956917 2935951376 Bacteria 8602333
1445 2935965374 2935959822 Bacteria 7869783
1446 2935970826 2935967501 Bacteria 8603075
1447 2935980141 2935975950 Bacteria 8347125
1448 2935984310 2935984226 Bacteria 8302647
1449 2935997258 2935992306 Bacteria 9802711
1450 2936010004 2936002035 Bacteria 9362176
1451 2936017032 2936011229 Bacteria 8801034
1452 2936025560 2936019824 Bacteria 8804134
1453 2936034402 2936028420 Bacteria 8965941
1454 2936045502 2936037263 Bacteria 9446081
1455 2936052564 2936046547 Bacteria 8903709
1456 2936055390 2936055302 Bacteria 8785755
1457 2940564516 2940556831 Bacteria 9590747
1458 2941507226 2941507105 Bacteria 8166816
1459 2941520304 2941515067 Bacteria 8166720
1460 2941523639 2941523033 Bacteria 8169134
1461 2941531996 2941531003 Bacteria 7653939
1462 2941545206 2941538514 Bacteria 9402094
1463 3005482825 3005474847 Bacteria 9259049
1464 3005490830 3005483717 Bacteria 7877331
1465 3005506578 3005506211 Bacteria 6943378
1466 3005588715 3005587118 Bacteria 7794411
1467 3005601783 3005594810 Bacteria 8716512
1468 3005717517 3005710791 Bacteria 7622528
1469 3005724464 3005718088 Bacteria 8283608
1470 8006927547 8006926726 Bacteria 6749210
1471 8006935129 8006933436 Bacteria 10410654
1472 8006965337 8006964411 Bacteria 8966052
1473 8006975097 8006973647 Bacteria 10679141
1474 8006993399 8006984368 Bacteria 9651211
1475 8006995478 8006994254 Bacteria 8309700
1476 8016519109 8016511872 Bacteria 9921665
1477 8016525205 8016522445 Bacteria 8156687
1478 8016538788 8016530956 Bacteria 8155261
1479 8016543071 8016539877 Bacteria 8155419
1480 8016550221 8016548790 Bacteria 8155074
1481 8016558627 8016557553 Bacteria 8154380
1482 8016581128 8016575299 Bacteria 8154085
1483 8016587581 8016583857 Bacteria 10421953
1484 8016596609 8016595262 Bacteria 8149947
1485 8016607479 8016603502 Bacteria 8731218
1486 8016619274 8016613128 Bacteria 8794220
1487 8016636828 8016630954 Bacteria 9217207
1488 8017057593 8017057580 Bacteria 10023680
1489 8019538454 8019530166 Bacteria 8155624
1490 8019541366 8019538911 Bacteria 7872763
1491 8019549260 8019547302 Bacteria 7996444
1492 8019563572 8019555841 Bacteria 9642137
1493 8019573641 8019565922 Bacteria 9639779
1494 8019578226 8019576017 Bacteria 10049540
1495 8019605434 8019597564 Bacteria 10041141
1496 8019613105 8019608314 Bacteria 10042931
1497 8019623793 8019619141 Bacteria 9218857
1498 8019638245 8019629233 Bacteria 8687553
1499 8019641394 8019638758 Bacteria 9062356
1500 8019651639 8019648815 Bacteria 10014479
1501 8019666164 8019659431 Bacteria 8577854
1502 8019675671 8019668869 Bacteria 8791617
1503 8019695391 8019687851 Bacteria 8712826
1504 8055750508 8055742211 Bacteria 9226248
1505 8056678993 8056673599 Bacteria 7871253
1506 8056681736 8056681323 Bacteria 8472857
1507 8056692851 8056689827 Bacteria 6712655
1508 8056975293 8056967851 Bacteria 9038162
1509 Ga0068865_100270148
1510 JGI24740J21852_10034575
1511 JGI24739J22299_10059577
1512 JGI24737J22298_10039047
1513 JGI24735J21928_10063092
1514 JGI24034J26672_10030416
1515 JGI24742J22300_10030193
1516 JGI25406J46586_10000081
1517 JGI25406J46586_10012034
1518 JGI25165J46597_1018010
1519 JGI25153J46596_10004550
1520 JGI25153J46596_10025326
1521 JGI25153J46596_10043473
1522 JGI25160J50197_1000829
1523 JGI25160J50197_1001208
1524 JGI25404J52841_10007604
1525 Ga0055526_1052591
1526 Ga0055531_10002243
1527 Ga0065165_1000370
1528 Ga0065165_1003163
1529 Ga0065165_1007682
1530 Ga0070658_10017799
1531 Ga0070658_10092636
1532 Ga0070658_10269959
1533 Ga0070658_10705812
1534 Ga0070690_100481109
1535 Ga0068869_100092594
1536 Ga0068869_100213252
1537 Ga0070680_100064863
1538 Ga0070680_100147579
1539 Ga0070680_100505061
1540 Ga0070682_100211858
1541 Ga0068868_100045614
1542 Ga0068868_100340219
1543 Ga0070660_100005164
1544 Ga0070660_100285260
1545 Ga0070660_100303267
1546 Ga0070691_10189163
1547 Ga0070661_100009758
1548 Ga0070661_100508579
1549 Ga0070668_100102225
1550 Ga0070668_100118511
1551 Ga0070668_100498830
1552 Ga0070668_100593019
1553 Ga0070668_100619190
1554 Ga0070669_100112414
1555 Ga0070669_100363384
1556 Ga0070671_100146173
1557 Ga0070671_100162483
1558 Ga0070671_100382112
1559 Ga0070674_100036979
1560 Ga0070674_100325033
1561 Ga0070688_100603015
1562 Ga0070667_100470660
1563 Ga0070667_100598551
1564 Ga0070709_10000683
1565 Ga0070709_10007897
1566 Ga0070709_10077703
1567 Ga0070709_10080184
1568 Ga0070714_100028423
1569 Ga0070714_100044019
1570 Ga0070714_100124798
1571 Ga0070714_100174433
1572 Ga0070714_100475181
1573 Ga0070714_100639602
1574 Ga0070713_100007562
1575 Ga0070713_100028530
1576 Ga0070713_100121742
1577 Ga0070713_100681411
1578 Ga0070710_10007651
1579 Ga0070710_10012117
1580 Ga0070711_100016292
1581 Ga0070711_100024517
1582 Ga0070711_100041462
1583 Ga0070711_100366261
1584 Ga0070700_100121553
1585 Ga0070708_100354922
1586 Ga0070663_100011265
1587 Ga0070663_100011993
1588 Ga0070663_100061990
1589 Ga0070663_100062509
1590 Ga0070663_100127319
1591 Ga0070663_100145532
1592 Ga0070663_100225717
1593 Ga0070663_100233703
1594 Ga0070663_100368656
1595 Ga0070663_100377028
1596 Ga0070678_100089774
1597 Ga0070678_100105754
1598 Ga0070678_100335349
1599 Ga0070678_100430805
1600 Ga0070662_100030852
1601 Ga0070662_100110957
1602 Ga0070662_100118180
1603 Ga0070662_100420789
1604 Ga0070681_10007799
1605 Ga0070681_10093506
1606 Ga0068867_100262542
1607 Ga0068867_100617273
1608 Ga0070707_100314508
1609 Ga0070698_100210588
1610 Ga0070679_100015888
1611 Ga0070679_100038175
1612 Ga0070679_100222276
1613 Ga0070679_100531808
1614 Ga0070684_100070098
1615 Ga0068853_100001993
1616 Ga0068853_100059849
1617 Ga0068853_100387598
1618 Ga0068853_100424306
1619 Ga0070686_100034196
1620 Ga0070665_100011107
1621 Ga0070665_100099117
1622 Ga0070665_100162314
1623 Ga0070665_100288534
1624 Ga0070665_100624496
1625 Ga0070665_101187924
1626 Ga0068855_100008845
1627 Ga0068855_100021063
1628 Ga0068855_100049395
1629 Ga0068855_100117367
1630 Ga0068855_100212536
1631 Ga0068855_100297006
1632 Ga0068855_100326778
1633 Ga0070664_100574431
1634 Ga0070664_100946260
1635 Ga0068857_100019981
1636 Ga0068857_100024793
1637 Ga0068857_100026031
1638 Ga0068857_100053517
1639 Ga0068857_100497738
1640 Ga0068857_100575564
1641 Ga0068854_100055722
1642 Ga0068854_100357069
1643 Ga0068854_100518108
1644 Ga0068854_100897929
1645 Ga0068856_100000226
1646 Ga0068856_100013591
1647 Ga0068856_100173656
1648 Ga0068856_100336826
1649 Ga0068856_100565188
1650 Ga0068852_100043038
1651 Ga0068852_100065894
1652 Ga0068852_100107874
1653 Ga0068852_100236571
1654 Ga0068852_100273425
1655 Ga0068852_100404973
1656 Ga0068859_100534282
1657 Ga0068859_100682342
1658 Ga0068864_100128362
1659 Ga0068864_100193657
1660 Ga0068866_10246142
1661 Ga0068861_100044595
1662 Ga0068861_100206411
1663 Ga0068861_100550303
1664 Ga0068851_10016208
1665 Ga0068851_10053452
1666 Ga0068863_100066570
1667 Ga0068863_100226973
1668 Ga0068858_100171027
1669 Ga0068858_100176774
1670 Ga0068860_100244034
1671 Ga0068860_100452704
1672 Ga0068860_100999042
1673 Ga0068862_100069837
1674 Ga0068862_100189575
1675 Ga0068862_100226244
1676 Ga0068862_100331902
1677 Ga0081455_10004766
1678 Ga0081455_10020570
1679 Ga0081455_10142581
1680 Ga0081538_10026047
1681 Ga0081540_1002522
1682 Ga0081540_1002586
1683 Ga0081540_1004666
1684 Ga0081540_1004860
1685 Ga0081540_1008255
1686 Ga0081540_1013787
1687 Ga0081540_1033364
1688 Ga0081540_1048561
1689 Ga0081540_1054280
1690 Ga0081540_1059367
1691 Ga0081539_10000461
1692 Ga0081539_10002797
1693 Ga0081539_10201860
1694 Ga0070717_10001762
1695 Ga0070717_10002235
1696 Ga0070717_10226510
1697 Ga0070717_10332399
1698 Ga0070717_10440277
1699 Ga0075365_10047628
1700 Ga0075365_10057556
1701 Ga0075365_10145411
1702 Ga0075365_10169893
1703 Ga0075365_10174248
1704 Ga0075368_10058421
1705 Ga0075363_100089300
1706 Ga0075364_10024726
1707 Ga0075364_10035699
1708 Ga0075364_10090415
1709 Ga0075364_10176114
1710 Ga0075364_10332650
1711 Ga0075432_10153259
1712 Ga0070716_100006994
1713 Ga0070716_100368526
1714 Ga0070716_100504939
1715 Ga0070712_100028123
1716 Ga0070712_100037712
1717 Ga0070712_100112710
1718 Ga0070712_100334596
1719 Ga0070712_100413973
1720 Ga0075362_10142285
1721 Ga0075367_10050515
1722 Ga0075367_10114566
1723 Ga0075367_10240800
1724 Ga0075367_10290495
1725 Ga0075367_10292677
1726 Ga0075367_10328898
1727 Ga0075369_10021181
1728 Ga0075369_10033402
1729 Ga0075369_10077695
1730 Ga0075369_10143784
1731 Ga0097621_100275598
1732 Ga0075370_10045185
1733 Ga0075370_10246806
1734 Ga0075370_10271456
1735 Ga0068871_100083760
1736 Ga0068871_100290074
1737 Ga0068871_100490232
1738 Ga0075428_100185896
1739 Ga0075429_100435594
1740 Ga0068865_100542538
1741 Ga0097620_100534263
1742 Ga0097620_100682326
1743 Ga0099825_1036925
1744 Ga0099824_1007227
1745 Ga0099824_1017577
1746 Ga0099822_1005717
1747 Ga0099823_1008742
1748 Ga0075435_100006891
1749 Ga0099794_10042881
1750 Ga0099795_10001991
1751 Ga0105250_10226993
1752 Ga0105240_10013959
1753 Ga0105240_10014054
1754 Ga0105240_10040849
1755 Ga0105240_10050894
1756 Ga0105240_10056236
1757 Ga0105240_10547935
1758 Ga0105240_10632355
1759 Ga0111539_10043707
1760 Ga0105245_10023421
1761 Ga0105245_10758021
1762 Ga0105247_10009405
1763 Ga0105247_10058758
1764 Ga0105247_10105147
1765 Ga0105247_10161683
1766 Ga0105247_10257845
1767 Ga0105247_10470997
1768 Ga0114129_10550389
1769 Ga0105243_10087129
1770 Ga0105243_10374055
1771 Ga0105243_10641060
1772 Ga0105243_10645411
1773 Ga0105241_10004545
1774 Ga0105241_10149193
1775 Ga0105241_10195554
1776 Ga0105242_10351796
1777 Ga0105242_10717647
1778 Ga0105248_10716530
1779 Ga0105237_10007960
1780 Ga0105237_10026951
1781 Ga0105237_10030213
1782 Ga0105237_10039289
1783 Ga0105237_10039787
1784 Ga0105237_10050359
1785 Ga0105237_10209106
1786 Ga0105237_10352445
1787 Ga0105237_10470755
1788 Ga0105237_10654564
1789 Ga0105238_10001176
1790 Ga0105238_10029351
1791 Ga0105238_10419376
1792 Ga0105238_10443781
1793 Ga0105249_10106290
1794 Ga0099796_10057177
1795 Ga0105239_10017508
1796 Ga0105239_10038465
1797 Ga0105239_10128447
1798 Ga0105239_10171193
1799 Ga0105239_10197232
1800 Ga0105239_10657049
1801 Ga0105239_10779251
1802 Ga0105246_10028115
1803 Ga0105246_10264285
1804 Ga0157343_1004575
1805 Ga0157370_10060204
1806 Ga0157370_10163325
1807 Ga0157370_10291238
1808 Ga0157369_10004958
1809 Ga0157369_10014414
1810 Ga0157369_10030732
1811 Ga0157369_10030744
1812 Ga0157369_10826944
1813 Ga0157374_10099137
1814 Ga0157374_11057407
1815 Ga0163162_10027557
1816 Ga0163162_10279585
1817 Ga0163162_10527541
1818 Ga0157372_10361750
1819 Ga0163163_10192343
1820 Ga0163163_10327618
1821 Ga0163163_10332623
1822 Ga0163163_10662010
1823 Ga0163163_10874900
1824 Ga0157380_10522411
1825 Ga0157379_10056635
1826 Ga0157379_10419728
1827 Ga0157376_10026136
1828 Ga0163161_10246013
1829 Ga0163161_10338792
1830 Ga0214544_1000003
1831 Ga0214542_1000003
1832 Ga0214545_1000004
1833 Ga0214543_1000007
1834 Ga0213872_10029016
1835 Ga0213874_10007521
1836 Ga0213876_10023140
1837 Ga0213876_10075715
1838 Ga0213871_10052440
1839 Ga0224712_10153828
1840 Ga0209563_102179
1841 Ga0209677_100607
1842 Ga0209677_106579
1843 Ga0209148_1000998
1844 Ga0209233_1012176
1845 Ga0209233_1015743
1846 Ga0209233_1016001
1847 Ga0209233_1017966
1848 Ga0209233_1020887
1849 Ga0209455_1000711
1850 Ga0209455_1005632
1851 Ga0209455_1015674
1852 Ga0209564_1001190
1853 Ga0209564_1016775
1854 Ga0209564_1018469
1855 Ga0209758_1000030
1856 Ga0209758_1000277
1857 Ga0209758_1001754
1858 Ga0209758_1004789
1859 Ga0209758_1028967
1860 Ga0209758_1057311
1861 Ga0209758_1075248
1862 Ga0209256_1011379
1863 Ga0209256_1020794
1864 Ga0207426_1000271
1865 Ga0207426_1000913
1866 Ga0207426_1021235
1867 Ga0207426_1039009
1868 Ga0209051_1077321
1869 Ga0209257_1000947
1870 Ga0209257_1029045
1871 Ga0207697_10056662
1872 Ga0207656_10001009
1873 Ga0207656_10127230
1874 Ga0207656_10197500
1875 Ga0207653_10092121
1876 Ga0207692_10000396
1877 Ga0207710_10039449
1878 Ga0207688_10010005
1879 Ga0207688_10059119
1880 Ga0207688_10112352
1881 Ga0207688_10249884
1882 Ga0207647_10052442
1883 Ga0207647_10128616
1884 Ga0207647_10205388
1885 Ga0207685_10023468
1886 Ga0207685_10036159
1887 Ga0207699_10000506
1888 Ga0207699_10017577
1889 Ga0207699_10468119
1890 Ga0207645_10201120
1891 Ga0207643_10130903
1892 Ga0207705_10027863
1893 Ga0207654_10001189
1894 Ga0207654_10107546
1895 Ga0207707_10001378
1896 Ga0207707_10004787
1897 Ga0207707_10019821
1898 Ga0207707_10323444
1899 Ga0207695_10005181
1900 Ga0207695_10026278
1901 Ga0207695_10029019
1902 Ga0207695_10054124
1903 Ga0207695_10058640
1904 Ga0207695_10126249
1905 Ga0207695_10206864
1906 Ga0207695_10509689
1907 Ga0207671_10025307
1908 Ga0207671_10026212
1909 Ga0207671_10037186
1910 Ga0207671_10053272
1911 Ga0207671_10067250
1912 Ga0207671_10241471
1913 Ga0207671_10266059
1914 Ga0207693_10004427
1915 Ga0207693_10026084
1916 Ga0207693_10055856
1917 Ga0207693_10063883
1918 Ga0207693_10279210
1919 Ga0207663_10000893
1920 Ga0207663_10014297
1921 Ga0207663_10035267
1922 Ga0207660_10015291
1923 Ga0207660_10039604
1924 Ga0207660_10056603
1925 Ga0207660_10608155
1926 Ga0207657_10004291
1927 Ga0207657_10011254
1928 Ga0207649_10398346
1929 Ga0207652_10034951
1930 Ga0207652_10044378
1931 Ga0207652_10454217
1932 Ga0207652_10517784
1933 Ga0207646_10485207
1934 Ga0207681_10118888
1935 Ga0207694_10000719
1936 Ga0207694_10032793
1937 Ga0207694_10048591
1938 Ga0207694_10145540
1939 Ga0207694_10261019
1940 Ga0207694_10283514
1941 Ga0207694_10347160
1942 Ga0207694_10349051
1943 Ga0207659_10488012
1944 Ga0207687_10015241
1945 Ga0207687_10156318
1946 Ga0207700_10004999
1947 Ga0207700_10029357
1948 Ga0207700_10089326
1949 Ga0207700_10515352
1950 Ga0207700_10922244
1951 Ga0207664_10092659
1952 Ga0207664_10095627
1953 Ga0207664_10115426
1954 Ga0207664_10117454
1955 Ga0207664_10135274
1956 Ga0207664_10653140
1957 Ga0207644_10091110
1958 Ga0207644_10091767
1959 Ga0207644_10377256
1960 Ga0207644_10489912
1961 Ga0207690_10042474
1962 Ga0207706_10010327
1963 Ga0207706_10326460
1964 Ga0207706_10572481
1965 Ga0207686_10401604
1966 Ga0207669_10010714
1967 Ga0207669_10498838
1968 Ga0207704_10311582
1969 Ga0207665_10076644
1970 Ga0207665_10118421
1971 Ga0207665_10342000
1972 Ga0207691_10022979
1973 Ga0207711_10030704
1974 Ga0207711_10325154
1975 Ga0207689_10096244
1976 Ga0207689_10119085
1977 Ga0207689_10157237
1978 Ga0207689_10250026
1979 Ga0207661_10011425
1980 Ga0207661_10016081
1981 Ga0207661_10018986
1982 Ga0207679_10408739
1983 Ga0207667_10008537
1984 Ga0207667_10008887
1985 Ga0207667_10011455
1986 Ga0207667_10071605
1987 Ga0207667_10211342
1988 Ga0207667_10491677
1989 Ga0207651_10246219
1990 Ga0207712_10144849
1991 Ga0207668_10055842
1992 Ga0207668_10089279
1993 Ga0207668_10095789
1994 Ga0207668_10505317
1995 Ga0207640_10008213
1996 Ga0207640_10057350
1997 Ga0207640_10304191
1998 Ga0207640_10329032
1999 Ga0207640_10889702
2000 Ga0207677_10040604
2001 Ga0207677_10310611
2002 Ga0207677_10467410
2003 Ga0207703_10138867
2004 Ga0207703_10395872
2005 Ga0207639_10003011
2006 Ga0207639_10011122
2007 Ga0207639_10139409
2008 Ga0207639_10164748
2009 Ga0207639_10288181
2010 Ga0207678_10012518
2011 Ga0207678_10028890
2012 Ga0207678_10044475
2013 Ga0207678_10046223
2014 Ga0207678_10051151
2015 Ga0207678_10067071
2016 Ga0207678_10261061
2017 Ga0207678_10282689
2018 Ga0207678_10502784
2019 Ga0207678_10691587
2020 Ga0207708_10179092
2021 Ga0207702_10000191
2022 Ga0207702_10000938
2023 Ga0207702_10151553
2024 Ga0207702_10174928
2025 Ga0207641_10168200
2026 Ga0207641_10437919
2027 Ga0207641_10925629
2028 Ga0207648_10068173
2029 Ga0207648_10088934
2030 Ga0207648_10494684
2031 Ga0207676_10249689
2032 Ga0207676_10252223
2033 Ga0207676_10360496
2034 Ga0207674_10015534
2035 Ga0207674_10024882
2036 Ga0207674_10025851
2037 Ga0207674_10087858
2038 Ga0207674_10526896
2039 Ga0207674_10580151
2040 Ga0207675_100128208
2041 Ga0207675_100180691
2042 Ga0207675_100393557
2043 Ga0207675_100503487
2044 Ga0207683_10083353
2045 Ga0207683_10156406
2046 Ga0207683_10180779
2047 Ga0207683_10205022
2048 Ga0207683_10452446
2049 Ga0207698_10034211
2050 Ga0207698_10054754
2051 Ga0207698_10182140
2052 Ga0207698_10305660
2053 Ga0209389_1000193
2054 Ga0209389_1000207
2055 Ga0209589_1000024
2056 Ga0209589_1000025
2057 Ga0209489_100039
2058 Ga0209489_101741
2059 Ga0209489_101963
2060 Ga0209700_100043
2061 Ga0209700_100420
2062 Ga0209179_1054355
2063 Ga0209588_1007005
2064 Ga0209813_10018664
2065 Ga0209813_10075582
2066 Ga0207428_10228213
2067 Ga0268266_10003056
2068 Ga0268266_10003703
2069 Ga0268266_10029112
2070 Ga0268266_10194830
2071 Ga0268266_10275029
2072 Ga0268266_10340770
2073 Ga0268265_10070116
2074 Ga0268265_10207239
2075 Ga0268265_10253413
2076 Ga0268265_10346048
2077 Ga0268264_10000051
2078 Ga0268264_10191049
2079 Ga0265337_1007383
2080 Ga0265319_1009743
2081 Ga0265334_10001692
2082 Ga0265323_10008924
2083 Ga0265336_10009566
2084 Ga0307517_10005748
2085 Ga0307515_10110960
2086 Ga0265338_10000231
2087 Ga0265330_10044930
2088 Ga0265340_10020047
2089 Ga0265339_10004944
2090 Ga0265339_10024066
2091 Ga0265331_10042928
2092 Ga0265331_10049490
2093 Ga0265316_10371105
2094 Ga0307513_10215645
2095 Ga0307509_10030718
2096 Ga0307509_10150798
2097 Ga0307509_10312717
2098 Ga0307509_10569584
2099 Ga0307508_10000152
2100 Ga0307508_10058929
2101 Ga0307508_10149960
2102 Ga0307508_10516090
2103 Ga0265314_10002968
2104 Ga0265314_10044116
2105 Ga0265314_10219964
2106 Ga0265342_10011951
2107 Ga0265342_10076076
2108 Ga0265342_10079404
2109 Ga0265342_10264907
2110 Ga0307516_10001267
2111 Ga0307516_10031057
2112 Ga0307516_10073820
2113 Ga0307516_10074213
2114 Ga0307405_10059938
2115 Ga0307405_10237076
2116 Ga0307407_10150254
2117 Ga0307407_10622708
2118 Ga0307409_101287410
2119 Ga0307416_100783114
2120 Ga0307415_100271049
2121 Ga0307415_100415298
2122 Ga0307507_10022911
2123 Ga0307510_10011169
2124 Ga0307510_10038624
2125 Ga0307510_10109970
2126 Ga0307510_10117120
2127 Ga0307510_10164220
2128 Ga0315911_1000023
2129 Ga0373930_0052197
2130 Ga0373926_0027374
2131 Ga0373929_0039365
2132 Ga0373934_0061754
2133 Ga0373949_0059408
2134 Ga0373952_0012160
2135 Ga0373936_0018508
2136 Ga0373945_0007634
2137 Ga0373953_0042103
2138 Ga0373954_0008023
2139 Ga0373954_0140367
2140 Ga0373957_0018309
2141 Ga0373957_0022368
2142 Ga0373943_0013757
2143 Ga0373943_0148931
2144 Ga0373943_0150781
2145 Ga0373946_0017770
2146 Ga0373955_0017796
2147 Ga0373955_0021131
2148 Ga0373924_0013622
2149 Ga0373935_0181513
2150 Ga0373935_0547588
2151 Ga0373927_0002222
2152 Ga0373927_0005329
2153 Ga0373927_0010638
2154 Ga0373927_0011810
2155 Ga0373927_0022460
2156 Ga0373927_0041347
2157 Ga0373927_0069624
2158 Ga0373933_0000018
2159 Ga0373933_0024431
2160 Ga0373947_0002696
2161 Ga0373947_0042175
2162 Ga0373947_0052878
2163 Ga0373947_0180540
2164 Ga0373947_0291999
2165 Ga0373937_0160231
2166 Ga0373937_0370114
2167 Ga0373937_0490218
2168 Ga0373937_0902749
2169 Ga0373925_0020019
2170 Ga0373925_0049643
2171 Ga0373925_0050903
2172 Ga0373925_0122786
2173 Ga0373925_0239995
2174 Ga0395899_0168634
2175 Ga0395900_0070034
2176 Ga0395900_0078178
2177 Ga0395900_0172996
2178 Ga0395900_0359079
2179 Ga0395900_0527449
2180 Ga0395898_0035897
2181 Ga0395898_0042754
2182 Ga0395898_0085845
2183 Ga0395898_0527750
2184 Ga0395898_0933169
2185 Ga0395905_0001838
2186 Ga0395905_0123229
2187 Ga0395905_0216793
2188 Ga0395905_0223618
2189 Ga0395905_0743806
2190 Ga0436364_0120583
2191 Ga0436364_0428944
2192 Ga0436364_1215160
2193 Ga0395901_0005769
2194 Ga0395901_0079476
2195 Ga0395901_0205585
2196 Ga0395901_0247426
2197 Ga0395901_0325248
2198 Ga0395901_0327270
2199 Ga0395901_0378597
2200 Ga0395901_0478536
2201 Ga0436365_0068950
2202 Ga0436365_0099807
2203 Ga0436365_0490213
2204 Ga0436365_0959812
2205 Ga0436365_1559462
2206 Ga0436365_1694116
2207 Ga0436365_1716695
2208 Ga0436360_0366592
2209 Ga0436360_1350684
2210 Ga0436361_0279908
2211 Ga0436361_0307241
2212 Ga0436363_0546873
2213 Ga0436363_0941603
2214 Ga0436363_1088635
2215 Ga0436362_0434371
2216 Ga0436362_0439678
2217 Ga0436362_0674594
2218 Ga0451797_1359922
2219 Ga0451839_0690549
2220 Ga0451841_0959049
2221 Ga0451849_1221422
2222 Ga0451853_2141541
2223 Ga0439455_0133213
2224 Ga0439458_0012089
2225 Ga0439459_0068866
2226 Ga0439440_0037718
2227 Ga0466972_0001082
2228 Ga0466972_0004060
2229 Ga0466965_0200006
2230 Ga0466966_0000514
2231 Ga0466966_0319860
2232 Ga0466966_0403561
2233 Ga0466961_0001153
2234 Ga0466963_0084624
2235 Ga0466963_0094035
2236 Ga0466964_0098617
2237 Ga0466971_0307595
2238 Ga0466968_0014655
2239 Ga0466960_0058810
2240 Ga0466960_0318941
2241 Ga0466959_0013468
2242 Ga0466959_0140778
2243 Ga0466967_0062222
2244 Ga0466967_0199509
2245 Ga0495617_057833
2246 Ga0495592_0049039
2247 Ga0495592_0434217
2248 Ga0495603_0010946
2249 Ga0495603_0029308
2250 Ga0495603_0078135
2251 Ga0495603_0085759
2252 Ga0495629_0000074
2253 Ga0495629_0003855
2254 Ga0495629_0353266
2255 Ga0495638_0035894
2256 Ga0495641_0036661
2257 Ga0495651_0006512
2258 Ga0495651_0107572
2259 Ga0495651_0150950
2260 Ga0495653_0025810
2261 Ga0495653_0264283
2262 Ga0495653_0487433
2263 Ga0495580_0003195
2264 Ga0495580_0063760
2265 Ga0495580_0271551
2266 Ga0495582_0000059
2267 Ga0495582_0018139
2268 Ga0495582_0202100
2269 Ga0495639_0000954
2270 Ga0495639_0041807
2271 Ga0495662_0010592
2272 Ga0495664_0182706
2273 Ga0495664_0266167
2274 Ga0495585_0193134
2275 Ga0495594_0002251
2276 Ga0495607_0208031
2277 Ga0495583_0114575
2278 Ga0495606_0002903
2279 Ga0495606_0021783
2280 Ga0495606_0090304
2281 Ga0495608_0021279
2282 Ga0495608_0139118
2283 Ga0495608_0213931
2284 Ga0495608_0579796
2285 Ga0495610_0155097
2286 Ga0495610_0167510
2287 Ga0495616_0065486
2288 Ga0495618_0173313
2289 Ga0495620_0146509
2290 Ga0495620_0154292
2291 Ga0495628_0133332
2292 Ga0495628_0136649
2293 Ga0495628_0225659
2294 Ga0495628_0543040
2295 Ga0495630_0007365
2296 Ga0495630_0494793
2297 Ga0495631_0073853
2298 Ga0495631_0077469
2299 Ga0495632_0072875
2300 Ga0495632_0146648
2301 Ga0495637_0023062
2302 Ga0495643_0083759
2303 Ga0495643_0218538
2304 Ga0495648_0008568
2305 Ga0495648_0009770
2306 Ga0495648_0169962
2307 Ga0495663_0007571
2308 Ga0495652_0010788
2309 Ga0495652_0027010
2310 Ga0495652_0315001
2311 Ga0495652_0365300
2312 Ga0495654_0004466
2313 Ga0495665_0000395
2314 Ga0495665_0048944
2315 Ga0495665_0179137
2316 Ga0495640_0007796
2317 Ga0495640_0033703
2318 Ga0495640_0084710
2319 Ga0495640_0114632
2320 Ga0495598_0005932
2321 Ga0495609_0089477
2322 Ga0495609_0185301
2323 Ga0495609_0192878
2324 Ga0495621_0017220
2325 Ga0495597_0057697
2326 Ga0495597_0071574
2327 Ga0495645_0065000
2328 Ga0495645_0077357
2329 Ga0495645_0085629
2330 Ga0495622_0007380
2331 Ga0495622_0010940
2332 Ga0495622_0022682
2333 Ga0495622_0130393
2334 Ga0495667_0002693
2335 Ga0495667_0023995
2336 Ga0495667_0128115
2337 Ga0495667_0455703
2338 Ga0495656_0066589
2339 Ga0495668_0101316
2340 Ga0495668_0161542
2341 Ga0495668_0286712
2342 Ga0495668_0464696
2343 Ga0495634_0003890
2344 Ga0495634_0049440
2345 Ga0495634_0329155
2346 Ga0495611_0125703
2347 Ga0495625_0026562
2348 Ga0495625_0129814
2349 Ga0495625_0192049
2350 Ga0495635_0037524
2351 Ga0495659_0004407
2352 Ga0495661_0014019
2353 Ga0495661_0068017
2354 Ga0495588_0005567
2355 Ga0495588_0040853
2356 Ga0495657_0004123
2357 Ga0495657_0248612
2358 Ga0495599_0039373
2359 Ga0495599_0199240
2360 Ga0495599_0286326
2361 Ga0495623_0027805
2362 Ga0495646_0048511
2363 Ga0495646_0049700
2364 Ga0495647_0015017
2365 Ga0495658_0001708
2366 Ga0495658_0117171
2367 Ga0495658_0149753
2368 Ga0495669_0016657
2369 Ga0495669_0062078
2370 Ga0495669_0224628
2371 Ga0495669_0286021
2372 Ga0495613_0037354
2373 Ga0495613_0094143
2374 Ga0495613_0489234
2375 Ga0495624_0194616
2376 Ga0495624_0269109
2377 Ga0495670_0018631
2378 Ga0495670_0050963
2379 Ga0495670_0057059
2380 Ga0495670_0077078
2381 Ga0495671_0008231
2382 Ga0495671_0172036
2383 Ga0495589_0071392
2384 Ga0495600_0088781
2385 Ga0495660_0012639
2386 Ga0495581_0000037
2387 Ga0495581_0067114
2388 Ga0495581_0092933
2389 Ga0495581_0217098
2390 Ga0495604_0015796
2391 Ga0495604_0080448
2392 Ga0495604_0197643
2393 Ga0495674_0000499
2394 Ga0495674_0299963
2395 Ga0495672_0010203
2396 Ga0495672_0025038
2397 Ga0495676_0072599
2398 Ga0495676_0171972
2399 Ga0495676_0256358
2400 Ga0495676_0427991
2401 Ga0495680_0007828
2402 Ga0495680_0047752
2403 Ga0495687_007460
2404 Ga0495687_064096
2405 Ga0495687_082924
2406 Ga0495675_0021958
2407 Ga0495675_0097237
2408 Ga0495677_0010815
2409 Ga0495673_0117030
2410 Ga0495684_0004761
2411 Ga0495684_0009233
2412 Ga0495684_0448684
2413 Ga0495686_0161363
2414 Ga0495593_0005039
2415 Ga0495593_0088364
2416 Ga0495593_0233537
2417 Ga0495602_0071161
2418 Ga0495602_0285083
2419 Ga0495626_0017446
2420 Ga0495626_0133501
2421 Ga0496100_0118302
2422 Ga0496100_0624594
2423 Ga0496100_0666833
2424 Ga0496101_0016596
2425 Ga0496101_0078259
2426 Ga0496101_0154100
2427 Ga0496101_0245888
2428 Ga0496101_0573924
2429 Ga0496102_0007995
2430 Ga0496102_0105126
2431 Ga0496102_0114675
2432 Ga0496102_0133455
2433 Ga0496102_0435364
2434 Ga0496102_0480087
2435 Ga0496102_0608825
2436 Ga0496103_0021683
2437 Ga0496103_0026466
2438 Ga0496103_0287995
2439 Ga0496104_0002953
2440 Ga0496104_0019560
2441 Ga0496104_0064707
2442 Ga0496104_0195370
2443 Ga0496104_0237253
2444 Ga0496104_0282510
2445 Ga0496104_0561854
2446 Ga0496105_0004911
2447 Ga0496105_0006535
2448 Ga0496105_0092349
2449 Ga0496105_0364485
2450 Ga0496106_0001534
2451 Ga0496106_0002682
2452 Ga0496106_0165162
2453 Ga0496106_0205698
2454 Ga0496106_0362496
2455 Ga0496106_0526338
2456 Ga0496106_0796895
2457 Ga0496107_0009723
2458 Ga0496107_0020271
2459 Ga0496107_0041291
2460 Ga0496107_0224849
2461 Ga0496107_0264714
2462 Ga0496107_0270875
2463 Ga0496107_0287865
2464 Ga0496107_0328471
2465 Ga0496107_0629840
2466 Ga0496108_0000438
2467 Ga0496108_0086587
2468 Ga0496108_0311738
2469 Ga0496108_0359744
2470 Ga0496109_0000284
2471 Ga0496109_0049092
2472 Ga0496109_0119220
2473 Ga0496109_0126075
2474 Ga0496109_0163132
2475 Ga0496109_0226785
2476 Ga0496109_0615417
2477 Ga0496110_0013998
2478 Ga0496110_0027228
2479 Ga0496110_0118790
2480 Ga0496110_0196934
2481 Ga0496110_0361433
2482 Ga0496110_0363304
2483 Ga0496111_0003617
2484 Ga0496111_0188832
2485 Ga0496111_0248473
2486 Ga0496112_0000090
2487 Ga0496112_0012845
2488 Ga0496112_0026339
2489 Ga0496112_0032112
2490 Ga0496112_0041410
2491 Ga0496112_0045171
2492 Ga0496112_0048383
2493 Ga0496112_0104578
2494 Ga0496112_0851032
2495 Ga0496113_0021967
2496 Ga0496113_0032368
2497 Ga0496113_0178351
2498 Ga0496114_0074265
2499 Ga0496114_0085219
2500 Ga0496114_0100146
2501 Ga0496114_0353929
2502 Ga0496114_0429457
2503 Ga0496114_0709835
2504 Ga0496115_0011512
2505 Ga0496115_0041650
2506 Ga0496115_0050637
2507 Ga0496115_0129251
2508 Ga0496115_0140415
2509 Ga0496115_0182002
2510 Ga0496115_0217540
2511 Ga0496115_0269887
2512 Ga0496115_0308792
2513 Ga0496116_0039187
2514 Ga0496117_0018642
2515 Ga0496117_0026927
2516 Ga0496117_0127817
2517 Ga0496117_0154326
2518 Ga0496117_0156770
2519 Ga0496118_0010937
2520 Ga0496118_0013220
2521 Ga0496118_0043013
2522 Ga0496118_0058685
2523 Ga0496119_0003665
2524 Ga0496119_0037454
2525 Ga0496119_0211864
2526 Ga0496119_0214474
2527 Ga0496120_0009533
2528 Ga0496120_0015629
2529 Ga0496120_0036659
2530 Ga0496120_0061579
2531 Ga0496120_0196722
2532 Ga0496121_0000571
2533 Ga0496121_0002044
2534 Ga0496121_0005698
2535 Ga0496121_0009006
2536 Ga0496121_0021216
2537 Ga0496121_0050387
2538 Ga0496121_0137009
2539 Ga0496121_0143830
2540 Ga0496121_0147464
2541 Ga0496121_0159670
2542 Ga0496122_0032311
2543 Ga0496122_0279424
2544 Ga0496123_0027188
2545 Ga0496124_0001685
2546 Ga0496124_0054167
2547 Ga0496124_0191030
2548 Ga0496124_0315592
2549 Ga0496124_0333586
2550 Ga0496125_0008547
2551 Ga0496125_0032470
2552 Ga0496125_0044277
2553 Ga0496125_0051110
2554 Ga0496125_0189819
2555 Ga0496125_0192476
2556 Ga0496125_0434044
2557 Ga0496126_0001940
2558 Ga0496126_0011305
2559 Ga0496126_0012589
2560 Ga0496126_0020579
2561 Ga0496126_0034993
2562 Ga0496126_0035265
2563 Ga0496126_0036452
2564 Ga0496126_0051743
2565 Ga0496126_0054192
2566 Ga0496126_0084046
2567 Ga0496126_0088646
2568 Ga0496126_0106344
2569 Ga0496126_0215996
2570 Ga0496126_0228097
2571 Ga0496126_0283923
2572 Ga0495682_0007587
2573 Ga0495682_0090317
2574 Ga0495682_0159291
2575 Ga0501031_0004229
2576 Ga0501031_0022815
2577 Ga0501032_0005576
2578 Ga0501032_0008917
2579 Ga0501032_0026485
2580 Ga0501033_0001252
2581 Ga0501033_0002138
2582 Ga0501033_0010457
2583 Ga0501033_0015364
2584 Ga0501033_0308681
2585 Ga0501034_0000417
2586 Ga0501034_0091175
2587 Ga0501034_0230850
2588 Ga0501036_0007704
2589 Ga0501036_0124734
2590 Ga0501036_0126547
2591 Ga0501036_0242142
2592 Ga0501037_0000156
2593 Ga0501037_0004921
2594 Ga0501037_0103996
2595 Ga0501037_0140803
2596 Ga0501038_0000164
2597 Ga0501038_0002067
2598 Ga0501038_0038092
2599 Ga0501038_0060185
2600 Ga0501038_0130779
2601 Ga0501038_0137484
2602 Ga0501039_0000457
2603 Ga0501039_0009452
2604 Ga0501039_0045721
2605 Ga0501039_0073043
2606 Ga0501039_0108017
2607 Ga0501039_0148154
2608 Ga0501039_0787607
2609 Ga0501040_0003098
2610 Ga0501041_0021842
2611 Ga0501042_0076593
2612 Ga0501042_0100031
2613 Ga0501043_0000617
2614 Ga0501043_0004274
2615 Ga0501043_0023016
2616 Ga0501043_0164488
2617 Ga0501043_0563045
2618 Ga0501046_0000304
2619 Ga0501046_0031928
2620 Ga0501046_0049248
2621 Ga0501046_0054572
2622 Ga0501047_0000739
2623 Ga0501047_0021855
2624 Ga0501047_0342840
2625 Ga0501047_0392041
2626 Ga0501047_0486122
2627 Ga0501048_0001982
2628 Ga0501048_0071488
2629 Ga0501048_0075721
2630 Ga0501067_0001170
2631 Ga0501067_0005434
2632 Ga0501068_0000092
2633 Ga0501068_0007115
2634 Ga0501068_0034398
2635 Ga0501069_0026949
2636 Ga0501070_0003917
2637 Ga0501070_0089886
2638 Ga0501072_0000981
2639 Ga0501072_0069835
2640 Ga0501073_0000309
2641 Ga0501073_0010512
2642 Ga0501073_0264178
2643 Ga0501073_0310870
2644 Ga0501074_0000051
2645 Ga0501074_0103930
2646 Ga0501076_0534345
2647 Ga0501077_0045933
2648 Ga0501079_0008257
2649 Ga0501079_0012954
2650 Ga0501080_0004599
2651 Ga0501080_0278926
2652 Ga0501083_0000276
2653 Ga0501083_0024290
2654 Ga0501035_0003055
2655 Ga0501035_0010916
2656 Ga0501035_0060737
2657 Ga0501035_0136279
2658 Ga0501035_0200136
2659 Ga0501035_0253058
2660 Ga0501035_0479898
2661 Ga0501044_0005655
2662 Ga0501044_0015923
2663 Ga0501044_0030430
2664 Ga0501044_0059675
2665 Ga0501044_0071441
2666 Ga0501044_0230031
2667 Ga0501044_0313630
2668 Ga0501044_0506812
2669 Ga0501045_0006640
2670 nmdc:mga03683_23142_c1
2671 nmdc:mga03683_51528_c1
2672 nmdc:mga03n38_14107_c1
2673 nmdc:mga00v17_12435_c1
2674 nmdc:mga00v17_328007_c1
2675 nmdc:mga0yw44_104106_c1
2676 nmdc:mga0yw44_143268_c1
2677 nmdc:mga0yw44_288949_c1
2678 nmdc:mga0yw44_35812_c1
2679 nmdc:mga0yw44_43176_c1
2680 nmdc:mga0yw44_9908_c1
2681 nmdc:mga0k408_31278_c1
2682 nmdc:mga0k408_335517_c1
2683 nmdc:mga06z11_21544_c1
2684 nmdc:mga04h51_18212_c1
2685 nmdc:mga04h51_52527_c1
2686 nmdc:mga07m45_23537_c2
2687 nmdc:mga07m45_34403_c1
2688 nmdc:mga09592_498483_c1
2689 nmdc:mga08y16_174216_c1
2690 nmdc:mga0n895_563477_c1
2691 nmdc:mga0rr50_20625_c1
2692 nmdc:mga0sz30_150175_c1
2693 nmdc:mga0sz30_2295_c1
2694 nmdc:mga0sz30_50523_c1
2695 Ga0495601_0049088
2696 Ga0495601_0227975
2697 Ga0495612_0085023
2698 Ga0500635_0016398
2699 Ga0500635_0114726
2700 Ga0495655_0015329
2701 Ga0495595_0054793
2702 Ga0495619_0003869
2703 Ga0495619_0064649
2704 Ga0500578_0041025
2705 Ga0500643_000028
2706 Ga0500643_006922
2707 Ga0500644_0004653
2708 Ga0500651_0027045
2709 Ga0500651_0054621
2710 Ga0500651_0063127
2711 Ga0500566_0004102
2712 Ga0500566_0023555
2713 Ga0500566_0165438
2714 Ga0500641_0005429
2715 Ga0500641_0006195
2716 Ga0500641_0013290
2717 Ga0500650_0102863
2718 Ga0500554_067098
2719 Ga0500555_005200
2720 Ga0500556_0000051
2721 Ga0500556_0002319
2722 Ga0500556_0082667
2723 Ga0500557_000127
2724 Ga0500569_049232
2725 Ga0500569_055369
2726 Ga0500592_001710
2727 Ga0500594_0124599
2728 Ga0500595_000141
2729 Ga0500595_008509
2730 Ga0500595_012407
2731 Ga0500595_013681
2732 Ga0500595_030082
2733 Ga0500607_016454
2734 Ga0500607_142469
2735 Ga0500608_000364
2736 Ga0500608_092763
2737 Ga0500642_0000041
2738 Ga0500642_0000174
2739 Ga0500642_0003706
2740 Ga0500652_009360
2741 Ga0500658_0058930
2742 Ga0500658_0102230
2743 Ga0500559_0000878
2744 Ga0500559_0067464
2745 Ga0500559_0132545
2746 Ga0500568_0006215
2747 Ga0500568_0009795
2748 Ga0500568_0039918
2749 Ga0500577_0003046
2750 Ga0500585_100240
2751 Ga0500590_199889
2752 Ga0500603_004904
2753 Ga0500603_005027
2754 Ga0500604_0028195
2755 Ga0500616_0000150
2756 Ga0500616_0000408
2757 Ga0500616_0124189
2758 Ga0500620_033895
2759 Ga0500622_0004154
2760 Ga0500622_0074804
2761 Ga0500627_0179982
2762 Ga0500627_0188176
2763 Ga0500633_0115842
2764 Ga0500638_010096
2765 Ga0500636_0003573
2766 Ga0500636_0010474
2767 Ga0500636_0032237
2768 Ga0500636_0270208
2769 Ga0500637_0000311
2770 Ga0500637_0011488
2771 Ga0500637_0013210
2772 Ga0500570_145036
2773 Ga0500657_124126
2774 Ga0500625_008973
2775 Ga0500645_012425
2776 Ga0500552_020207
2777 Ga0500599_000989
2778 Ga0500601_000420
2779 Ga0501084_0005554
2780 Ga0501084_0115581
2781 Ga0500661_013901
2782 Ga0500661_025906
2783 Ga0501082_0026337
2784 Ga0501082_0087083
2785 Ga0501082_0790994
2786 2507504426
2787 2508545854
2788 2508694681
2789 2509146408
2790 2511396418
2791 2513624232
2792 2513638720
2793 2513649192
2794 2513656218
2795 2513673372
2796 2513694637
2797 2513702120
2798 2513716706
2799 2513860681
2800 2513874191
2801 2513892502
2802 2513917603
2803 2514010051
2804 2515624400
2805 2517103091
2806 2517887738
2807 2524438925
2808 2524470912
2809 2524535403
2810 2528849425
2811 2603862432
2812 2617350310
2813 2617374396
2814 2644290271
2815 2671120751
2816 2723842451
2817 2728748304
2818 2745081980
2819 2793059311
2820 2793070475
2821 2793078695
2822 2805920909
2823 2818240579
2824 2824604684
2825 2824615397
2826 2824618854
2827 2824628960
2828 2824639253
2829 2824648827
2830 2824658643
2831 2824665825
2832 2824675100
2833 2824686249
2834 2824692537
2835 2824700900
2836 2824711300
2837 2824717538
2838 2824726770
2839 2824737689
2840 2824751202
2841 2824759684
2842 2824769935
2843 2824780317
2844 2838126041
2845 2841942565
2846 2841953085
2847 2841963938
2848 2841970890
2849 2841977850
2850 2841984586
2851 2842041690
2852 2842049732
2853 2844321420
2854 2847931981
2855 2847943228
2856 2849076957
2857 2857514774
2858 2857525679
2859 2874595628
2860 2874606863
2861 2874620377
2862 2874621865
2863 2874629651
2864 2874651738
2865 2876769219
2866 2876775823
2867 2876821634
2868 2879079914
2869 2879085663
2870 2879104502
2871 2879112297
2872 2879133999
2873 2879148484
2874 2881364631
2875 2881671352
2876 2885374397
2877 2885383288
2878 2885391149
2879 2885413482
2880 2888387257
2881 2888391444
2882 2888426939
2883 2889034320
2884 2893071761
2885 2903728001
2886 2903755489
2887 2903776235
2888 2904669542
2889 2904691869
2890 2904709529
2891 2904713645
2892 2906602515
2893 2906612752
2894 2906635108
2895 2906640578
2896 2906649706
2897 2906663198
2898 2908745944
2899 2908763972
2900 2908776878
2901 2919074529
2902 2922364900
2903 2922370319
2904 2922391636
2905 2922398857
2906 2922433229
2907 2929622625
2908 2929632272
2909 2932790032
2910 2932800700
2911 2932808431
2912 2932815575
2913 2932824849
2914 2932829111
2915 2933584743
2916 2935613169
2917 2935617587
2918 2935630574
2919 2935643632
2920 2935654127
2921 2935662771
2922 2935671058
2923 2935681701
2924 2935692678
2925 2935702665
2926 2935711952
2927 2935721296
2928 2935730710
2929 2935739986
2930 2935749024
2931 2935758894
2932 2935767159
2933 2935774811
2934 2935780003
2935 2935792989
2936 2935798559
2937 2935806923
2938 2935818812
2939 2935824979
2940 2935834317
2941 2935843958
2942 2935852198
2943 2935856914
2944 2935868441
2945 2935879751
2946 2935883538
2947 2935910632
2948 2935921812
2949 2935930049
2950 2935937717
2951 2935949821
2952 2935956917
2953 2935965374
2954 2935970826
2955 2935980141
2956 2935984310
2957 2935997258
2958 2936010004
2959 2936017032
2960 2936025560
2961 2936034402
2962 2936045502
2963 2936052564
2964 2936055390
2965 2940564516
2966 2941507226
2967 2941520304
2968 2941523639
2969 2941531996
2970 2941545206
2971 3005482825
2972 3005490830
2973 3005506578
2974 3005588715
2975 3005601783
2976 3005717517
2977 3005724464
2978 8006927547
2979 8006935129
2980 8006965337
2981 8006975097
2982 8006993399
2983 8006995478
2984 8016519109
2985 8016525205
2986 8016538788
2987 8016543071
2988 8016550221
2989 8016558627
2990 8016581128
2991 8016587581
2992 8016596609
2993 8016607479
2994 8016619274
2995 8016636828
2996 8017057593
2997 8019538454
2998 8019541366
2999 8019549260
3000 8019563572
3001 8019573641
3002 8019578226
3003 8019605434
3004 8019613105
3005 8019623793
3006 8019638245
3007 8019641394
3008 8019651639
3009 8019666164
3010 8019675671
3011 8019695391
3012 8055750508
3013 8056678993
3014 8056681736
3015 8056692851
3016 8056975293

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07021

MetW

Methionine biosynthesis protein MetW

22

215

0.99

PF08241

Methyltransf_11

Methyltransferase domain

39

124

0.9

PF13649

Methyltransf_25

Methyltransferase domain

38

123

0.89

PF13847

Methyltransf_31

Methyltransferase domain

32

179

0.82

PF08242

Methyltransf_12

Methyltransferase domain

39

121

0.77

PF13489

Methyltransf_23

Methyltransferase domain

19

184

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hek-assembly2.cif.gz_A crystal structure of m1.hpyavi 0.8185 25 75
5hek-assembly2.cif.gz_C crystal structure of m1.hpyavi 0.8166 25 77
6m83-assembly1.cif.gz_A-2 crystal structure of tylm1 s120a bound to sah and dtdp-phenol 0.7952 25 127
6m82-assembly1.cif.gz_A crystal structure of tylm1 y14paf bound to sah and dtdp-phenol 0.7911 25 127
3cc8-assembly1.cif.gz_A-2 crystal structure of a putative methyltransferase (bce_1332) from bacillus cereus atcc 10987 at 1.64 a resolution 0.7895 27 218
ID Description Score Start End Superfamily
af_K7MPH7_12_143_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8793 37 102 3.40.50.150
af_Q50584_122_315_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8785 25 123 3.40.50.150
af_I6X5U4_8_196_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.856 23 122 3.40.50.150
af_Q5A3P1_25_227_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8499 47 81 3.40.50.1010
af_A0A1D6MEH1_3_91_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8487 37 103 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A522W3Z1-F1-model_v4 Methyltransferase domain-containing protein 0.9778 16 125 GO:0008168
GO:0032259
AF-A0A0F9K5A2-F1-model_v4 Methionine biosynthesis protein MetW 0.9736 20 99
AF-A0A2S5LMP8-F1-model_v4 Methionine biosynthesis protein MetW 0.966 24 122
AF-A0A0F9K5A2-F1-model_v4 Methionine biosynthesis protein MetW 0.9393 20 99
AF-A0A522W3Z1-F1-model_v4 Methyltransferase domain-containing protein 0.928 16 125 GO:0008168
GO:0032259

Map