metagRoot

F494469

General Info

Members	Datasets	Scaffolds	Average Seq Length
1510	917	3020	329

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|2844009547\|2844011705
Length	397
Sequence	DVLCIGNAIVDIIAXKPARVLAEILMPDYDVLCIGNAIVDIIAQCDEVFLETNGIIKGAMNLIDTQRAELLYSRMGPAIEASGGSAGNTAAGVASFGGRAAFFGKVSNDALGEIYAHDIHAQGVAFDTTPLKGEPPTARSMIFVTPDGERSMNTYLGACVELGPEDVEADKASGAKVTYFEGYLWDPPRAKEAIRQTAKLAHAAGREVSMTLSDSFCVDRYRDEFLDLMRSGTVDIVFANSHEIKSLYQTSSFDEALAQIRKDCRIAAVTRSEKGSVIVRGDETVVIKATAIKELVDTTGAGDLYAAGFLHGYTQGRDLQXIKATAIKELVDTTGAGDLYAAGFLHGYTQGRDLQTCGDLGSLAAGLVIQQIGPRLRQNLRREAEQAGLTIPDVQTS

Samples

	Sample ID	Description	Type	Environment
1	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
2	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
3	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
4	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
5	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
6	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
7	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
8	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
9	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
10	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
11	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
12	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
13	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
14	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
15	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
16	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
17	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
18	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
19	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
20	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
21	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
22	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
23	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
24	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
25	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
26	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
27	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
28	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
29	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
30	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
31	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
32	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
33	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
34	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
35	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
36	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
37	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
38	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
39	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
40	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
41	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
42	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
43	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
44	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
45	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
46	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
47	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
48	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
49	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
50	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
51	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
52	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
53	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
54	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
55	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
56	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
57	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
58	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
59	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
60	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
61	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
62	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
63	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
64	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
65	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
66	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
67	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
68	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
69	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
70	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
71	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
72	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
73	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
74	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
75	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
76	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
77	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
78	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
79	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
80	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
82	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
83	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
85	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
86	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
87	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
88	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
89	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
90	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
91	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
92	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
93	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
94	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
95	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
96	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
97	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
98	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
99	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
100	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
101	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
102	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
103	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
104	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
105	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
106	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
107	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
108	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
109	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
110	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
111	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
112	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
113	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
114	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
115	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
116	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
117	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
118	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
119	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
120	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
121	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
122	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
123	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
124	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
125	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
126	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
127	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
128	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
129	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
130	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
131	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
173	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
175	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
178	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
179	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
180	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
181	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
182	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
183	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
184	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
185	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
186	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
187	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
188	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
189	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
190	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
191	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
192	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
193	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
194	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
195	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
196	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
197	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
198	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
199	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
200	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
201	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
202	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
203	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
204	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
205	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
206	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
207	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
208	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
209	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
210	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
211	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
212	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
213	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
214	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
215	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
216	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
217	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
218	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
219	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
220	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
221	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
222	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
223	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
224	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
225	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
226	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
227	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
228	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
229	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
230	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
231	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
232	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
233	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
234	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
235	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
236	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
237	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
238	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
239	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
240	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
241	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
242	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
243	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
244	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
245	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
246	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
247	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
248	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
249	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
250	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
251	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
252	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
253	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
254	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
255	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
256	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
257	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
258	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
259	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
260	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
261	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
262	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
263	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
264	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
265	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
266	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
267	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
268	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
269	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
270	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
271	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
272	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
273	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
274	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
275	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
276	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
277	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
278	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
279	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
280	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
281	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
282	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
283	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
284	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
285	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
286	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
287	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
288	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
289	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
290	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
291	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
292	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
293	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
294	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
295	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
296	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
297	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
298	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
299	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
300	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
301	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
302	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
303	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
304	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
305	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
306	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
307	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
308	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
309	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
310	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
311	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
312	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
313	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
314	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
315	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
316	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
317	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
318	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
319	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
320	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
321	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
322	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
323	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
324	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
325	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
326	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
327	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
328	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
329	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
330	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
331	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
332	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
333	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
334	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
335	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
336	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
337	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
338	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
339	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
340	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
341	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
342	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
343	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
344	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
345	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
346	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
347	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
348	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
349	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
350	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
351	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
352	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
353	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
354	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
355	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
356	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
357	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
358	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
359	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
360	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
361	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
362	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
363	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
364	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
365	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
366	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
367	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
368	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
369	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
370	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
371	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
372	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
373	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
374	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
375	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
376	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
377	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
378	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
379	3300053736	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere	Metagenome	Endosphere
380	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
381	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
382	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
383	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
384	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
385	2844009547	Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1	Isolate	Nodule
386	2503198000	Mesorhizobium opportunistum WSM2075	Isolate	Nodule
387	2508501127	Mesorhizobium sp. WSM2561	Isolate	Nodule
388	2509276018	Mesorhizobium ciceri CMG6	Isolate	Nodule
389	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
390	2509276022	Mesorhizobium australicum WSM2073	Isolate	Nodule
391	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
392	2510065019	Rhizobium leguminosarum bv. trifolii WSM1689	Isolate	Nodule
393	2510065059	Mesorhizobium ciceri WSM4083	Isolate	Nodule
394	2510461069	Rhizobium sp. PDO1-076	Isolate	Rhizosphere
395	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
396	2510917026	Rhizobium sp. CF80	Isolate	Rhizosphere
397	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
398	2511231027	Phyllobacterium sp. YR531	Isolate	Rhizosphere
399	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
400	2512875016	Mesorhizobium japonicum R7A	Isolate	Nodule
401	2512875024
402	2513237084	Rhizobium leguminosarum bv. viciae UPM1131	Isolate	Nodule
403	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
404	2513237088	Rhizobium mesoamericanum STM6155	Isolate	Nodule
405	2513237090	Mesorhizobium sp. WSM3224	Isolate	Nodule
406	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
407	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
408	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
409	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
410	2513237164	Mesorhizobium loti CJ3sym	Isolate	Nodule
411	2513237305	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
412	2513237351	Mesorhizobium alhagi CCNWXJ12-2	Isolate	Nodule
413	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
414	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
415	2516143018	Ensifer sp. BR816	Isolate	Nodule
416	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
417	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
418	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
419	2524023209	Rhizobium leucaenae USDA 9039	Isolate	Nodule
420	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
421	2534681786	Brucella suis 92/29	Isolate	Unclassified
422	2534681796	Rhizobium grahamii CCGE 502	Isolate	Nodule
423	2554235003	Agrobacterium tumefaciens WRT31	Isolate	Rhizosphere
424	2558860242	Agrobacterium fabacearum P4	Isolate	Rhizosphere
425	2558860983	Allorhizobium undicola ATCC 700741	Isolate	Rhizoplane
426	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
427	2582581299	Rhizobium leguminosarum OV483	Isolate	Rhizosphere
428	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
429	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
430	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
431	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
432	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
433	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
434	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
435	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
436	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
437	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
438	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
439	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
440	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
441	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
442	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
443	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
444	2585427633	Neorhizobium galegae bv. officinalis HAMBI 1141	Isolate	Nodule
445	2585427634	Neorhizobium galegae bv. orientalis HAMBI 540	Isolate	Nodule
446	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
447	2588253730	Mesorhizobium huakuii 7653R	Isolate	Rhizosphere
448	2597489875	Mesorhizobium ciceri ca181	Isolate	Unclassified
449	2599185156	Rhizobium sp. NFR03	Isolate	Rhizoplane
450	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
451	2599185236	Rhizobium sp. NFR07	Isolate	Rhizoplane
452	2599185301	Mesorhizobium sp. NFR06	Isolate	Rhizoplane
453	2600254933	Rhizobium sp. NFR12	Isolate	Rhizoplane
454	2615840624	Rhizobium aethiopicum HBR26	Isolate	Nodule
455	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
456	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
457	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
458	2643221550	Mesorhizobium sp. Root552	Isolate	Unclassified
459	2643221551	Mesorhizobium sp. Root1471	Isolate	Unclassified
460	2643221555	Mesorhizobium sp. Root554	Isolate	Unclassified
461	2643221564	Mesorhizobium sp. Root157	Isolate	Unclassified
462	2643221568	Rhizobium sp. Root564	Isolate	Unclassified
463	2643221595	Mesorhizobium sp. Root695	Isolate	Unclassified
464	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
465	2643221623	Aminobacter sp. DSM 101952 Root100	Isolate	Unclassified
466	2643221627	Mesorhizobium sp. Root102	Isolate	Unclassified
467	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
468	2643221653	Rhizobium sp. Root1240	Isolate	Unclassified
469	2643221693	Rhizobium sp. Root491	Isolate	Unclassified
470	2643221719	Rhizobium sp. Root274	Isolate	Unclassified
471	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
472	2687453392	Mesorhizobium ciceri biserrulae WSM1284	Isolate	Unclassified
473	2693429783	Mesorhizobium sp. LCM 4577	Isolate	Rhizosphere
474	2693429784	Mesorhizobium sp. LCM 4576	Isolate	Rhizosphere
475	2718217882	Rhizobium sp. N741	Isolate	Nodule
476	2718217927	Rhizobium sp. N324	Isolate	Nodule
477	2718217997	Rhizobium phaseoli sv. phaseoli R723	Isolate	Nodule
478	2718218009	Rhizobium sp. N561	Isolate	Nodule
479	2718218199	Rhizobium phaseoli sv. phaseoli N261	Isolate	Nodule
480	2718218232	Rhizobium phaseoli sv. phaseoli N161	Isolate	Nodule
481	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
482	2718218235	Rhizobium phaseoli sv. phaseoli R620	Isolate	Nodule
483	2718218269	Rhizobium phaseoli sv. phaseoli N671	Isolate	Nodule
484	2718218363	Rhizobium sp. N113	Isolate	Nodule
485	2718218365	Rhizobium sp. N731	Isolate	Nodule
486	2718218366	Rhizobium sp. N621	Isolate	Nodule
487	2718218423	Rhizobium sp. N941	Isolate	Nodule
488	2721755514	Rhizobium sp. N6212	Isolate	Nodule
489	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
490	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
491	2721755685	Rhizobium phaseoli sv. phaseoli R611	Isolate	Nodule
492	2721755686	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
493	2721755809	Rhizobium sp. N541	Isolate	Nodule
494	2721755810	Rhizobium sp. N871	Isolate	Nodule
495	2721755819	Rhizobium phaseoli sv. phaseoli N771	Isolate	Nodule
496	2721755822	Rhizobium phaseoli sv. phaseoli R650	Isolate	Nodule
497	2721755823	Rhizobium phaseoli sv. phaseoli R630	Isolate	Nodule
498	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
499	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
500	2728369365	Rhizobium sp. N1341	Isolate	Nodule
501	2728369397	Rhizobium sp. N1314	Isolate	Nodule
502	2738541293	Rhizobium sp. GV031	Isolate	Unclassified
503	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
504	2738543024	Aminobacter sp. AP02	Isolate	Unclassified
505	2751185800	Brucella pituitosa AA2	Isolate	Unclassified
506	2751185821	Ensifer shofinae CCBAU 251167	Isolate	Unclassified
507	2756170246	Mesorhizobium loti DSM 2626	Isolate	Nodule
508	2757320392	Phyllobacterium leguminum ORS 1419	Isolate	Nodule
509	2758568016	[Ochrobactrum] quorumnocens A44	Isolate	Rhizosphere
510	2765235802	Phyllobacterium bourgognense 31-25a	Isolate	Rhizoplane
511	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
512	2767802442	Phyllobacterium brassicacearum 29-15	Isolate	Rhizoplane
513	2775506902	Phyllobacterium zundukense Tri-48	Isolate	Unclassified
514	2775506904	Phyllobacterium zundukense Tri-38	Isolate	Unclassified
515	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
516	2791355123	Mesorhizobium sophorae ICMP 19535	Isolate	Unclassified
517	2791355253	Rhizobium rhizosphaerae RD15	Isolate	Rhizosphere
518	2791355256	Rhizobium sp. M10	Isolate	Nodule
519	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
520	2791355262	Rhizobium sp. M1	Isolate	Nodule
521	2791355264	Rhizobium sp. S9	Isolate	Nodule
522	2791355265	Rhizobium sp. H4	Isolate	Nodule
523	2791355266	Rhizobium sp. L43	Isolate	Nodule
524	2791355267	Rhizobium sp. L18	Isolate	Nodule
525	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
526	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
527	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
528	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
529	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
530	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
531	2808606387	Rhizobium sp. SJZ105	Isolate	Rhizosphere
532	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
533	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
534	2821123053	Rhizobium cellulosilyticum 1193	Isolate	Unclassified
535	2821443989	Inquilinus ginsengisoli 584	Isolate	Unclassified
536	2837651117	Pseudohoeflea suaedae YC6898	Isolate	Unclassified
537	2837678835	Jiella endophytica CBS5Q-3	Isolate	Unclassified
538	2838016132	Rhizobium phaseoli SEMIA 4071	Isolate	Nodule
539	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
540	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
541	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
542	2838048938	Rhizobium pisi 27/80	Isolate	Nodule
543	2838061910	Rhizobium phaseoli L15	Isolate	Nodule
544	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
545	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
546	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
547	2838668709	Rhizobium sophoriradicis SEMIA 403	Isolate	Nodule
548	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
549	2838701080	Rhizobium aethiopicum SEMIA 428	Isolate	Nodule
550	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
551	2838736955	Rhizobium cellulosilyticum SEMIA 448	Isolate	Nodule
552	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
553	2839993093	Phyllobacterium endophyticum PEPV15	Isolate	Unclassified
554	2840764183	Phyllobacterium sophorae CCBAU 03422	Isolate	Unclassified
555	2841734538	Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1	Isolate	Nodule
556	2841840854	Rhizobium cellulosilyticum SEMIA 444	Isolate	Nodule
557	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
558	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
559	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
560	2842140634	Rhizobium cellulosilyticum SEMIA 452	Isolate	Nodule
561	2842146304	Rhizobium sophoriradicis SEMIA 454	Isolate	Nodule
562	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
563	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
564	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
565	2842192696	Rhizobium esperanzae SEMIA 468	Isolate	Nodule
566	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
567	2842205361	Rhizobium etli SEMIA 471	Isolate	Nodule
568	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
569	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
570	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
571	2842250916	Rhizobium etli SEMIA 484	Isolate	Nodule
572	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
573	2842264693	Rhizobium phaseoli SEMIA 487	Isolate	Nodule
574	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
575	2842278818	Rhizobium etli SEMIA 489	Isolate	Nodule
576	2842285085	Rhizobium lentis SEMIA 490	Isolate	Nodule
577	2842298080	Rhizobium leucaenae SEMIA 492	Isolate	Nodule
578	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
579	2842311132	Rhizobium phaseoli SEMIA 4002	Isolate	Nodule
580	2842317721	Rhizobium etli SEMIA 4004	Isolate	Nodule
581	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
582	2842357229	Rhizobium leucaenae SEMIA 4015	Isolate	Nodule
583	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
584	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
585	2842402390	Rhizobium lentis SEMIA 4033	Isolate	Nodule
586	2842409023	Rhizobium lentis SEMIA 4034	Isolate	Nodule
587	2842415677	Rhizobium lentis SEMIA 4036	Isolate	Nodule
588	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
589	2842428310	Rhizobium phaseoli SEMIA 4050	Isolate	Nodule
590	2842434925	Rhizobium esperanzae SEMIA 4051	Isolate	Nodule
591	2842441272	Rhizobium esperanzae SEMIA 4053	Isolate	Nodule
592	2842447887	Rhizobium esperanzae SEMIA 4055	Isolate	Nodule
593	2842462802	Rhizobium phaseoli SEMIA 4057	Isolate	Nodule
594	2842469257	Rhizobium phaseoli SEMIA 4058	Isolate	Nodule
595	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
596	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
597	2842489311	Rhizobium sophoriradicis SEMIA 4061	Isolate	Nodule
598	2842495871	Rhizobium etli SEMIA 4062	Isolate	Nodule
599	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
600	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
601	2842871566	Phyllobacterium sp. R-73111	Isolate	Unclassified
602	2842922631	Pararhizobium sp. R-72066	Isolate	Unclassified
603	2844002411	Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1	Isolate	Nodule
604	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
605	2847670302	Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1	Isolate	Nodule
606	2847686936	Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1	Isolate	Nodule
607	2852387548	Rhizobium jaguaris CCGE525	Isolate	Unclassified
608	2854916844	Neorhizobium huautlense DSM 21817	Isolate	Unclassified
609	2856314179	Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1	Isolate	Nodule
610	2856320880	Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1	Isolate	Nodule
611	2856328259	Mesorhizobium sp. Primo-B	Isolate	Nodule
612	2856334872	Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1	Isolate	Nodule
613	2856342000	Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1	Isolate	Nodule
614	2856349417	Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1	Isolate	Nodule
615	2856356410	Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1	Isolate	Nodule
616	2856364286	Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1	Isolate	Nodule
617	2857349434	Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1	Isolate	Nodule
618	2857367948	Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1	Isolate	Nodule
619	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
620	2857531043	Neorhizobium sp. R-72160	Isolate	Unclassified
621	2869162929	Mesorhizobium sanjuanii BSA136	Isolate	Nodule
622	2869169390	Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1	Isolate	Nodule
623	2869242130	Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1	Isolate	Nodule
624	2869249662	Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1	Isolate	Nodule
625	2869264136	Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1	Isolate	Nodule
626	2869278585	Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1	Isolate	Nodule
627	2869285874	Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1	Isolate	Nodule
628	2871429161	Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1	Isolate	Nodule
629	2871435913	Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0	Isolate	Nodule
630	2871444079	Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1	Isolate	Nodule
631	2871451962	Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1	Isolate	Nodule
632	2871466892	Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1	Isolate	Nodule
633	2871474448	Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1	Isolate	Nodule
634	2871488783	Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1	Isolate	Nodule
635	2871495908	Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1	Isolate	Nodule
636	2874102143	Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1	Isolate	Nodule
637	2874109183	Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1	Isolate	Nodule
638	2874116593	Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1	Isolate	Nodule
639	2874123672	Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1	Isolate	Nodule
640	2874131515	Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1	Isolate	Nodule
641	2874139085	Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1	Isolate	Nodule
642	2874146452	Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1	Isolate	Nodule
643	2874155637	Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1	Isolate	Nodule
644	2874162495	Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1	Isolate	Nodule
645	2874168670	Mesorhizobium kowhaii Ach-343	Isolate	Nodule
646	2876363079	Mesorhizobium loti R7ANS::ICEMlSym2042	Isolate	Nodule
647	2876369609	Mesorhizobium sp. USDA-HM6	Isolate	Unclassified
648	2876377896	Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1	Isolate	Nodule
649	2876392853	Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1	Isolate	Nodule
650	2876399893	Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1	Isolate	Nodule
651	2876406927	Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1	Isolate	Nodule
652	2876413966	Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1	Isolate	Nodule
653	2878035449	Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1	Isolate	Nodule
654	2878730984	Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1	Isolate	Nodule
655	2878738818	Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1	Isolate	Nodule
656	2878745973	Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1	Isolate	Nodule
657	2878753008	Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1	Isolate	Nodule
658	2878760144	Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1	Isolate	Nodule
659	2878767105	Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1	Isolate	Nodule
660	2878774303	Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1	Isolate	Nodule
661	2878781027	Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1	Isolate	Nodule
662	2878788777	Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1	Isolate	Nodule
663	2881147464	Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1	Isolate	Nodule
664	2881155292	Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1	Isolate	Nodule
665	2881161766	Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1	Isolate	Nodule
666	2881845957	Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1	Isolate	Nodule
667	2881853255	Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1	Isolate	Nodule
668	2882632389	Mesorhizobium waimense ICMP19557	Isolate	Unclassified
669	2882912400	Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1	Isolate	Nodule
670	2885305155	Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1	Isolate	Nodule
671	2885312484	Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2	Isolate	Nodule
672	2885318864	Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1	Isolate	Nodule
673	2885326080	Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1	Isolate	Nodule
674	2885334103	Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1	Isolate	Nodule
675	2885342637	Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1	Isolate	Nodule
676	2885350715	Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1	Isolate	Nodule
677	2888337043	Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1	Isolate	Nodule
678	2888343758	Mesorhizobium sp. AA22	Isolate	Unclassified
679	2888350351	Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1	Isolate	Nodule
680	2889010040	Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1	Isolate	Nodule
681	2889016732	Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1	Isolate	Nodule
682	2894652903	Phyllobacterium sp. SYP-B3895	Isolate	Rhizosphere
683	2899803654	Agrobacterium sp. a22-2	Isolate	Unclassified
684	2899845264	Agrobacterium fabacearum CNPSo 675	Isolate	Unclassified
685	2903448605	Mesorhizobium japonicum Opo-235	Isolate	Nodule
686	2903492973	Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1	Isolate	Nodule
687	2903521522	Mesorhizobium loti R7ANS::ICEMlSym2014	Isolate	Nodule
688	2903528002	Mesorhizobium loti R7ANS::ICEMlSym2037	Isolate	Nodule
689	2903540706	Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1	Isolate	Nodule
690	2904578770	Phyllobacterium sp. 586	Isolate	Unclassified
691	2904659560	Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1	Isolate	Nodule
692	2906308376	Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1	Isolate	Nodule
693	2906321335	Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1	Isolate	Nodule
694	2906328253	Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1	Isolate	Nodule
695	2906354277	Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1	Isolate	Nodule
696	2906370794	Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1	Isolate	Nodule
697	2906378014	Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1	Isolate	Nodule
698	2906386501	Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1	Isolate	Nodule
699	2906393657	Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1	Isolate	Nodule
700	2906401398	Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1	Isolate	Nodule
701	2906408224	Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1	Isolate	Nodule
702	2906414383	Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1	Isolate	Nodule
703	2906427513	Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1	Isolate	Nodule
704	2909042592	Labrys sp. LIt4	Isolate	Nodule
705	2913295892	Sinorhizobium kostiensis DSM 13372	Isolate	Nodule
706	2915650412	Ochrobactrum sp. CM-21-5	Isolate	Rhizosphere
707	2919119836	Phyllobacterium sp. 1468	Isolate	Rhizosphere
708	2919166419	Agrobacterium cavarae 2074	Isolate	Unclassified
709	2919171160	Neorhizobium sp. 2083	Isolate	Unclassified
710	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
711	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
712	2922130491	Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1	Isolate	Nodule
713	2922151315	Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1	Isolate	Nodule
714	2922158528	Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1	Isolate	Nodule
715	2922172374	Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1	Isolate	Nodule
716	2922185730	Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1	Isolate	Nodule
717	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
718	2924710171	Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2	Isolate	Nodule
719	2924718760	Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1	Isolate	Nodule
720	2924726620	Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1	Isolate	Nodule
721	2924733363	Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1	Isolate	Nodule
722	2924748358	Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2	Isolate	Nodule
723	2924754689	Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1	Isolate	Nodule
724	2924762789	Mesorhizobium sp. WSM4303	Isolate	Unclassified
725	2924776078	Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1	Isolate	Nodule
726	2924784321	Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1	Isolate	Nodule
727	2926760298	Agrobacterium tumefaciens SLBN-170	Isolate	Rhizosphere
728	2928521798	Phyllobacterium ifriqiyense 1451	Isolate	Rhizosphere
729	2929199973	Roseomonas sp. R-73070 Hybrid assembly	Isolate	Unclassified
730	2933016740	Rhizobium sp. SEMIA 4085	Isolate	Nodule
731	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
732	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
733	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
734	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
735	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
736	2937813078	Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1	Isolate	Nodule
737	2937822353	Mesorhizobium neociceri CCANP35	Isolate	Nodule
738	2937836603	Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1	Isolate	Nodule
739	2937843397	Mesorhizobium xinjiangense lm94	Isolate	Rhizosphere
740	2937848649	Mesorhizobium sp. WSM4310	Isolate	Unclassified
741	2937868953	Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1	Isolate	Nodule
742	2937877337	Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1	Isolate	Nodule
743	2937891427	Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1	Isolate	Nodule
744	2937972304	Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1	Isolate	Nodule
745	2937980651	Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1	Isolate	Nodule
746	2937994558	Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1	Isolate	Nodule
747	2938014810	Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1	Isolate	Nodule
748	2954011201	Phyllobacterium ifrigiyense W4I11	Isolate	Rhizosphere
749	2958034702	Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1	Isolate	Nodule
750	2958041894	Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1	Isolate	Nodule
751	2958064165	Mesorhizobium sp. SARCC-RB16n	Isolate	Unclassified
752	2958071322	Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1	Isolate	Nodule
753	2958084443	Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1	Isolate	Nodule
754	2958092219	Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1	Isolate	Nodule
755	2958100919	Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1	Isolate	Nodule
756	2958115193	Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1	Isolate	Nodule
757	2958122699	Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1	Isolate	Nodule
758	2958130278	Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1	Isolate	Nodule
759	2958137437	Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1	Isolate	Nodule
760	2958144490	Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1	Isolate	Nodule
761	2958165035	Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1	Isolate	Nodule
762	2958172287	Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1	Isolate	Nodule
763	2958179912	Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1	Isolate	Nodule
764	2961077736	Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1	Isolate	Nodule
765	2961114664	Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1	Isolate	Nodule
766	2961127735	Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1	Isolate	Nodule
767	2961136820	Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1	Isolate	Nodule
768	2961163497	Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1	Isolate	Nodule
769	2961170736	Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1	Isolate	Nodule
770	2961183825	Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1	Isolate	Nodule
771	2963644680	Mesorhizobium japonicum R7A	Isolate	Nodule
772	2965018300	Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1	Isolate	Nodule
773	2965025482	Mesorhizobium sp. Primo-A	Isolate	Nodule
774	2965032056	Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1	Isolate	Nodule
775	2965040258	Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1	Isolate	Nodule
776	2965047637	Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1	Isolate	Nodule
777	2965062239	Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1	Isolate	Nodule
778	2965089291	Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1	Isolate	Nodule
779	2965102966	Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1	Isolate	Nodule
780	2965110997	Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1	Isolate	Nodule
781	2965119406	Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1	Isolate	Nodule
782	2967996073	Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1	Isolate	Nodule
783	2968003550	Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1	Isolate	Nodule
784	2968016561	Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1	Isolate	Nodule
785	2968083720	Mesorhizobium erdmanii Opo-242	Isolate	Unclassified
786	2968091066	Mesorhizobium sp. AA23	Isolate	Unclassified
787	2968097103	Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1	Isolate	Nodule
788	2968110612	Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1	Isolate	Nodule
789	2968117919	Mesorhizobium atlanticum CNPSo 3140	Isolate	Unclassified
790	2968128360	Mesorhizobium sp. WSM3873	Isolate	Unclassified
791	2968138860	Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1	Isolate	Nodule
792	2968171901	Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1	Isolate	Nodule
793	2970469710	Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1	Isolate	Nodule
794	2970489779	Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1	Isolate	Nodule
795	2970503327	Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1	Isolate	Nodule
796	2970524798	Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1	Isolate	Nodule
797	2970532167	Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1	Isolate	Nodule
798	2970540015	Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1	Isolate	Nodule
799	2970547951	Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1	Isolate	Nodule
800	2970554993	Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1	Isolate	Nodule
801	2970593180	Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1	Isolate	Nodule
802	2970619444	Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1	Isolate	Nodule
803	2970627176	Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1	Isolate	Nodule
804	2977821940	Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1	Isolate	Nodule
805	2977828996	Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1	Isolate	Nodule
806	2977843712	Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1	Isolate	Nodule
807	2977851361	Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1	Isolate	Nodule
808	2977858184	Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1	Isolate	Nodule
809	2977864932	Mesorhizobium tamadayense DSM 28320	Isolate	Nodule
810	2977872689	Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1	Isolate	Nodule
811	2977898635	Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1	Isolate	Nodule
812	2977907340	Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1	Isolate	Nodule
813	2977922695	Mesorhizobium sp. WSM4305	Isolate	Unclassified
814	2977935797	Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1	Isolate	Nodule
815	2977942078	Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1	Isolate	Nodule
816	2977950692	Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1	Isolate	Nodule
817	2977971508	Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1	Isolate	Nodule
818	2977986579	Mesorhizobium intechi BD68	Isolate	Unclassified
819	2978969890	Agrobacterium sp. SORGH_AS 787	Isolate	Unclassified
820	2979089926	Agrobacterium sp. SORGH_AS 745	Isolate	Unclassified
821	2979095461	Agrobacterium tumefaciens SORGH_AS 749	Isolate	Unclassified
822	2979710463	Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1	Isolate	Nodule
823	2979742915	Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1	Isolate	Nodule
824	2979764755	Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1	Isolate	Nodule
825	2979772303	Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1	Isolate	Nodule
826	2979779861	Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1	Isolate	Nodule
827	2979793036	Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1	Isolate	Nodule
828	2979808191	Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1	Isolate	Nodule
829	2984587000	Agrobacterium larrymoorei SORGH_AS974	Isolate	Aerial Root
830	2987636660	Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1	Isolate	Nodule
831	2987645492	Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1	Isolate	Nodule
832	2987652177	Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1	Isolate	Nodule
833	2987659509	Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1	Isolate	Nodule
834	2987666974	Mesorhizobium sp. WSM4306	Isolate	Unclassified
835	2987673487	Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1	Isolate	Nodule
836	2989771324	Rhizobium rhizolycopersici DBTS2	Isolate	Rhizosphere
837	2989776772	Rhizobium glycinendophyticum CL12	Isolate	Unclassified
838	2996310559	Mesorhizobium zhangyense CGMCC 1.15528	Isolate	Unclassified
839	2996336353	Mesorhizobium sp. YM1C-6-2	Isolate	Unclassified
840	2996341866	Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1	Isolate	Nodule
841	2996348954	Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1	Isolate	Nodule
842	3000135777	Unclassified bacterium M00.F.Ca.ET.205.01.1.1	Isolate	Unclassified
843	3002141150	Phyllobacterium sp. 628	Isolate	Unclassified
844	3004167301	Mesorhizobium loti 582	Isolate	Unclassified
845	3004188549	Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1	Isolate	Nodule
846	3004195979	Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1	Isolate	Nodule
847	3004203850	Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1	Isolate	Nodule
848	3004211236	Mesorhizobium sp. WSM4307	Isolate	Unclassified
849	3004218560	Mesorhizobium sp. WSM4315	Isolate	Unclassified
850	3004239961	Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1	Isolate	Nodule
851	3004248173	Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1	Isolate	Nodule
852	3004268573	Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1	Isolate	Nodule
853	3004275668	Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1	Isolate	Nodule
854	3004289098	Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1	Isolate	Nodule
855	3004334049	Mesorhizobium huakuii 583	Isolate	Unclassified
856	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
857	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
858	3005452660	Rhizobium grahamii BG7	Isolate	Unclassified
859	637000159	Mesorhizobium japonicum MAFF 303099	Isolate	Unclassified
860	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
861	649633066	Mesorhizobium ciceri bv. biserrulae WSM1271	Isolate	Nodule
862	650716007	Agrobacterium fabacearum H13-3	Isolate	Rhizosphere
863	8002285264	Aminobacter anthyllidis LMG 26462	Isolate	Nodule
864	8004300914	Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1	Isolate	Nodule
865	8004312739	Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0	Isolate	Nodule
866	8004361976	Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1	Isolate	Nodule
867	8004374579	Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1	Isolate	Nodule
868	8004387939	Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1	Isolate	Nodule
869	8004395343	Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1	Isolate	Nodule
870	8004445564	Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1	Isolate	Nodule
871	8004633249	Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1	Isolate	Nodule
872	8004640170	Mesorhizobium sp. GbtcB19	Isolate	Unclassified
873	8004695233	Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1	Isolate	Nodule
874	8004703790	Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1	Isolate	Nodule
875	8004714634	Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1	Isolate	Nodule
876	8004727605	Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1	Isolate	Nodule
877	8005246636	Rhizobium wuzhouense W44	Isolate	Rhizosphere
878	8005275841	Rhizobium sp. N4311	Isolate	Nodule
879	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
880	8005289223	Rhizobium bangladeshense 1002	Isolate	Nodule
881	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
882	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
883	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
884	8005382845	Rhizobium sp. R634	Isolate	Nodule
885	8005395548	Rhizobium sp. R339	Isolate	Nodule
886	8005430974	Rhizobium phaseoli Y20	Isolate	Nodule
887	8005460587	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
888	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
889	8005497431	Rhizobium phaseoli CCGM8	Isolate	Unclassified
890	8005542996	Rhizobium grahamii CCGM3	Isolate	Unclassified
891	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
892	8005563573	Rhizobium sp. WYCCWR 11152	Isolate	Nodule
893	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
894	8005619151	Rhizobium phaseoli CCGM2	Isolate	Unclassified
895	8005626139	Rhizobium phaseoli Y18	Isolate	Nodule
896	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
897	8005658619	Rhizobium terrae CC-HIH110	Isolate	Unclassified
898	8005668836	Rhizobium phaseoli CCGM9	Isolate	Unclassified
899	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
900	8005688590	Rhizobium bangladeshense 1024	Isolate	Nodule
901	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
902	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
903	8018150411	Rhizobium straminoryzae SM12	Isolate	Rhizosphere
904	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
905	8018176218	Rhizobium sp. N122	Isolate	Nodule
906	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
907	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule
908	8024501048	Rhizobium sp. H4	Isolate	Nodule
909	8046767195	Rhizobium calliandrae CCGE524	Isolate	Unclassified
910	8055431914	Allorhizobium sonneratiae BGMRC 0089	Isolate	Unclassified
911	8055617313	Mesorhizobium onobrychidis OM4	Isolate	Nodule
912	8055909800	Plastoroseomonas hellenica LMG 31523	Isolate	Unclassified
913	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
914	8056382006	Rhizobium croatiense 13T	Isolate	Nodule
915	8056875544	Rhizobium halophilum TRM95001	Isolate	Rhizosphere
916	8057575449	Rhizobium mayense CCGE526	Isolate	Nodule
917	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	53.91
Metatranscriptomes	0.07
Isolates	46.03

Biome Distribution

Category	Percentage (%)
Aerial Root	0.07
Bulb	0
Endosphere	12.91
Nodule	35.56
Rhizoplane	2.85
Rhizosphere	35.96
Stem	0
Stem Tuber	0
Unclassified	0.13

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10003587	3300001979	Bacteria	6774
2	JGI24740J21852_10010947	3300001979	Bacteria	3468
3	JGI24740J21852_10016869	3300001979	Bacteria	2627
4	JGI25156J39149_1000095	3300002705	Bacteria	64645
5	JGI25162J39368_1001577	3300002737	Bacteria	11612
6	JGI25162J39368_1001625	3300002737	Bacteria	11230
7	JGI25154J39366_1000560	3300002738	Bacteria	18262
8	JGI25157J39369_1000216	3300002741	Bacteria	47231
9	JGI25157J39369_1001318	3300002741	Bacteria	9876
10	JGI25150J39212_1000203	3300002774	Bacteria	32405
11	JGI25159J45721_1000278	3300002987	Bacteria	24036
12	JGI25151J46595_10000439	3300003187	Bacteria	41010
13	JGI25151J46595_10002873	3300003187	Bacteria	9893
14	JGI25151J46595_10011724	3300003187	Bacteria	4016
15	JGI25406J46586_10000015	3300003203	Bacteria	91406
16	JGI25406J46586_10034543	3300003203	Bacteria	1854
17	JGI25165J46597_1000019	3300003214	Bacteria	371528
18	JGI25165J46597_1001566	3300003214	Bacteria	11230
19	JGI25165J46597_1004099	3300003214	Bacteria	3262
20	JGI25153J46596_10002927	3300003215	Bacteria	9665
21	JGI25153J46596_10025491	3300003215	Bacteria	2112
22	JGI25153J46596_10026732	3300003215	Bacteria	2037
23	rootH1_10025987	3300003323	Bacteria	1320
24	JGI25160J50197_1000326	3300003354	Bacteria	32667
25	JGI25160J50197_1001685	3300003354	Bacteria	10772
26	JGI25160J50197_1003176	3300003354	Bacteria	7455
27	JGI25160J50197_1012952	3300003354	Bacteria	2866
28	JGI25160J50197_1025431	3300003354	Bacteria	1657
29	JGI25161J50226_1000244	3300003374	Bacteria	32663
30	Ga0006562J51391_1007721	3300003578	Bacteria	1270
31	Ga0055539_1003331	3300003752	Bacteria	2263
32	Ga0055542_1000777	3300003762	Bacteria	23984
33	Ga0055529_1002268	3300003763	Bacteria	3890
34	Ga0055526_1002554	3300003771	Bacteria	12216
35	Ga0055526_1007620	3300003771	Bacteria	5584
36	Ga0055524_1002068	3300003775	Bacteria	10650
37	Ga0055524_1009647	3300003775	Bacteria	3904
38	Ga0055524_1015115	3300003775	Bacteria	2828
39	Ga0055528_1001428	3300003790	Bacteria	14606
40	Ga0055528_1004890	3300003790	Bacteria	6334
41	Ga0055528_1011160	3300003790	Bacteria	3594
42	Ga0055540_1002547	3300003792	Bacteria	9501
43	Ga0055540_1019061	3300003792	Bacteria	1860
44	Ga0055543_1000114	3300004625	Bacteria	69144
45	Ga0055543_1000187	3300004625	Bacteria	50429
46	Ga0065165_1000511	3300005262	Bacteria	59722
47	Ga0065165_1001605	3300005262	Bacteria	23138
48	Ga0065165_1002373	3300005262	Bacteria	16271
49	Ga0070658_10028613	3300005327	Bacteria	4475
50	Ga0070683_100018901	3300005329	Bacteria	6114
51	Ga0070670_100000427	3300005331	Bacteria	34727
52	Ga0070670_100209235	3300005331	Bacteria	1696
53	Ga0070677_10023499	3300005333	Bacteria	2283
54	Ga0070666_10026321	3300005335	Bacteria	3799
55	Ga0070680_100026103	3300005336	Bacteria	4672
56	Ga0070682_100211426	3300005337	Bacteria	1375
57	Ga0070668_100127996	3300005347	Bacteria	2036
58	Ga0070669_100116613	3300005353	Bacteria	2032
59	Ga0070675_100108246	3300005354	Bacteria	2347
60	Ga0070671_100020442	3300005355	Bacteria	5399
61	Ga0070688_100051439	3300005365	Bacteria	2570
62	Ga0070709_10034404	3300005434	Bacteria	3072
63	Ga0070709_10063672	3300005434	Bacteria	2356
64	Ga0070714_100026488	3300005435	Bacteria	4793
65	Ga0070713_100363160	3300005436	Bacteria	1346
66	Ga0070711_100037883	3300005439	Bacteria	3238
67	Ga0070711_100321597	3300005439	Bacteria	1236
68	Ga0070694_100009711	3300005444	Bacteria	5909
69	Ga0070678_100003875	3300005456	Bacteria	8404
70	Ga0070685_10009072	3300005466	Bacteria	5132
71	Ga0068853_100016763	3300005539	Bacteria	6035
72	Ga0068853_100226231	3300005539	Bacteria	1710
73	Ga0070672_100150550	3300005543	Bacteria	1924
74	Ga0070665_100000937	3300005548	Bacteria	37328
75	Ga0070665_100017127	3300005548	Bacteria	7270
76	Ga0070665_100021730	3300005548	Bacteria	6452
77	Ga0070665_100109571	3300005548	Bacteria	2763
78	Ga0070665_100148188	3300005548	Bacteria	2349
79	Ga0070665_100223858	3300005548	Bacteria	1882
80	Ga0070664_100131819	3300005564	Bacteria	2196
81	Ga0068857_100234209	3300005577	Bacteria	1680
82	Ga0068854_100229549	3300005578	Bacteria	1473
83	Ga0068856_100000585	3300005614	Bacteria	39903
84	Ga0068852_100027156	3300005616	Bacteria	4662
85	Ga0068864_100032695	3300005618	Bacteria	4421
86	Ga0068861_100118035	3300005719	Bacteria	2136
87	Ga0068863_100201754	3300005841	Bacteria	1913
88	Ga0068860_100164683	3300005843	Bacteria	2140
89	Ga0081455_10000559	3300005937	Bacteria	48458
90	Ga0081455_10007724	3300005937	Bacteria	11282
91	Ga0081540_1000034	3300005983	Bacteria	142197
92	Ga0081540_1035672	3300005983	Bacteria	2663
93	Ga0081540_1085848	3300005983	Bacteria	1400
94	Ga0081539_10000064	3300005985	Bacteria	247020
95	Ga0081539_10000429	3300005985	Bacteria	89452
96	Ga0075365_10003247	3300006038	Bacteria	8332
97	Ga0075365_10004697	3300006038	Bacteria	7283
98	Ga0075365_10008954	3300006038	Bacteria	5721
99	Ga0075365_10010651	3300006038	Bacteria	5370
100	Ga0075365_10023237	3300006038	Bacteria	3897
101	Ga0075365_10026369	3300006038	Bacteria	3689
102	Ga0075365_10027279	3300006038	Bacteria	3632
103	Ga0075365_10030629	3300006038	Bacteria	3448
104	Ga0075365_10063458	3300006038	Bacteria	2474
105	Ga0075365_10178272	3300006038	Bacteria	1485
106	Ga0075368_10032653	3300006042	Bacteria	2023
107	Ga0075363_100009083	3300006048	Bacteria	4665
108	Ga0075363_100025278	3300006048	Bacteria	3027
109	Ga0075363_100120206	3300006048	Bacteria	1467
110	Ga0075364_10003131	3300006051	Bacteria	9363
111	Ga0075364_10018453	3300006051	Bacteria	4367
112	Ga0075364_10036352	3300006051	Bacteria	3183
113	Ga0075364_10143605	3300006051	Bacteria	1606
114	Ga0070715_10019146	3300006163	Bacteria	2620
115	Ga0070716_100052017	3300006173	Bacteria	2331
116	Ga0070712_100003003	3300006175	Bacteria	10444
117	Ga0075362_10017119	3300006177	Bacteria	2982
118	Ga0075367_10001390	3300006178	Bacteria	10351
119	Ga0075367_10001874	3300006178	Bacteria	9304
120	Ga0075367_10016557	3300006178	Bacteria	4026
121	Ga0075367_10028216	3300006178	Bacteria	3200
122	Ga0075367_10029486	3300006178	Bacteria	3139
123	Ga0075367_10040804	3300006178	Bacteria	2711
124	Ga0075367_10052924	3300006178	Bacteria	2405
125	Ga0075369_10002052	3300006186	Bacteria	7100
126	Ga0075369_10016510	3300006186	Bacteria	2981
127	Ga0075369_10052102	3300006186	Bacteria	1774
128	Ga0075366_10000883	3300006195	Bacteria	14482
129	Ga0075366_10006147	3300006195	Bacteria	6550
130	Ga0075370_10019600	3300006353	Bacteria	3686
131	Ga0075370_10094706	3300006353	Bacteria	1724
132	Ga0075370_10105199	3300006353	Bacteria	1636
133	Ga0075428_100046349	3300006844	Bacteria	4775
134	Ga0075430_100134560	3300006846	Bacteria	2060
135	Ga0075430_100251476	3300006846	Bacteria	1464
136	Ga0075434_100000437	3300006871	Bacteria	30944
137	Ga0075429_100003731	3300006880	Bacteria	12987
138	Ga0075429_100138666	3300006880	Bacteria	2129
139	Ga0075436_100156462	3300006914	Bacteria	1606
140	Ga0079104_1000082	3300006946	Bacteria	137722
141	Ga0075435_100010838	3300007076	Bacteria	6675
142	Ga0105244_10053101	3300009036	Bacteria	2061
143	Ga0105240_10000310	3300009093	Bacteria	93883
144	Ga0105240_10014635	3300009093	Bacteria	10704
145	Ga0105240_10019620	3300009093	Bacteria	9030
146	Ga0105240_10402800	3300009093	Unclassified	1541
147	Ga0111539_10133814	3300009094	Bacteria	2903
148	Ga0111539_10203145	3300009094	Bacteria	2310
149	Ga0105245_10492832	3300009098	Bacteria	1240
150	Ga0105245_10570515	3300009098	Bacteria	1155
151	Ga0105247_10010489	3300009101	Bacteria	5601
152	Ga0105247_10133748	3300009101	Bacteria	1618
153	Ga0114129_10025349	3300009147	Bacteria	8402
154	Ga0105241_10177898	3300009174	Bacteria	1762
155	Ga0105248_10006268	3300009177	Bacteria	13043
156	Ga0105237_10003525	3300009545	Bacteria	18547
157	Ga0105237_10012619	3300009545	Bacteria	8897
158	Ga0105237_10290127	3300009545	Bacteria	1639
159	Ga0105238_10000400	3300009551	Bacteria	46160
160	Ga0105238_10134327	3300009551	Bacteria	2452
161	Ga0105238_10167106	3300009551	Bacteria	2176
162	Ga0123341_1000017	3300009765	Bacteria	82963
163	Ga0123342_1019278	3300009766	Bacteria	5246
164	Ga0123342_1021091	3300009766	Bacteria	4640
165	Ga0105239_10036377	3300010375	Bacteria	5405
166	Ga0105239_10071354	3300010375	Bacteria	3816
167	Ga0105239_10221286	3300010375	Bacteria	2123
168	Ga0105239_10385611	3300010375	Bacteria	1585
169	Ga0105246_10464036	3300011119	Bacteria	1067
170	Ga0157373_10003148	3300013100	Bacteria	12468
171	Ga0157373_10015568	3300013100	Bacteria	5559
172	Ga0157371_10000004	3300013102	Bacteria	512593
173	Ga0157370_10001986	3300013104	Bacteria	25145
174	Ga0157370_10003450	3300013104	Bacteria	18554
175	Ga0157369_10035975	3300013105	Bacteria	5427
176	Ga0157369_10090493	3300013105	Bacteria	3267
177	Ga0157378_10207015	3300013297	Bacteria	1858
178	Ga0157375_10328219	3300013308	Bacteria	1695
179	Ga0163163_10072174	3300014325	Bacteria	3441
180	Ga0163163_10404620	3300014325	Bacteria	1423
181	Ga0157379_10275357	3300014968	Bacteria	1531
182	Ga0157376_10072161	3300014969	Bacteria	2936
183	Ga0182007_10001142	3300015262	Bacteria	14376
184	Ga0182005_1042150	3300015265	Bacteria	1241
185	Ga0183363_1300	3300015690	Bacteria	6977
186	Ga0214544_1000652	3300021320	Bacteria	65892
187	Ga0214542_1000146	3300021321	Bacteria	103035
188	Ga0214542_1001787	3300021321	Bacteria	44536
189	Ga0214543_1000054	3300021327	Bacteria	140288
190	Ga0214543_1001073	3300021327	Bacteria	51004
191	Ga0209435_100049	3300025206	Bacteria	92067
192	Ga0209672_103567	3300025228	Bacteria	3165
193	Ga0209672_110444	3300025228	Bacteria	1254
194	Ga0209563_101326	3300025230	Bacteria	6743
195	Ga0209437_100376	3300025233	Bacteria	45400
196	Ga0209437_100448	3300025233	Bacteria	34068
197	Ga0209437_102855	3300025233	Bacteria	3243
198	Ga0207425_1000052	3300025245	Bacteria	162123
199	Ga0209646_1000159	3300025246	Bacteria	92067
200	Ga0209646_1011320	3300025246	Bacteria	1382
201	Ga0209026_1000013	3300025250	Bacteria	415633
202	Ga0209026_1000183	3300025250	Bacteria	92067
203	Ga0209677_101202	3300025253	Bacteria	11784
204	Ga0209677_101282	3300025253	Bacteria	11224
205	Ga0209148_1000032	3300025254	Bacteria	557660
206	Ga0209148_1000170	3300025254	Bacteria	132641
207	Ga0209759_1000206	3300025256	Bacteria	92067
208	Ga0209759_1000241	3300025256	Bacteria	81497
209	Ga0209759_1019695	3300025256	Bacteria	1591
210	Ga0209129_1000446	3300025258	Bacteria	30875
211	Ga0209129_1000512	3300025258	Bacteria	27712
212	Ga0209129_1001160	3300025258	Bacteria	15200
213	Ga0209129_1004136	3300025258	Bacteria	5875
214	Ga0209233_1000034	3300025261	Bacteria	578898
215	Ga0209233_1000368	3300025261	Bacteria	40743
216	Ga0209233_1000423	3300025261	Bacteria	31308
217	Ga0209233_1000458	3300025261	Bacteria	26629
218	Ga0209233_1004030	3300025261	Bacteria	5087
219	Ga0209233_1010496	3300025261	Bacteria	2772
220	Ga0209233_1018820	3300025261	Bacteria	1848
221	Ga0209233_1029363	3300025261	Bacteria	1308
222	Ga0209455_1000168	3300025272	Bacteria	111903
223	Ga0209455_1001123	3300025272	Bacteria	13002
224	Ga0209673_1000358	3300025273	Bacteria	82232
225	Ga0209673_1000526	3300025273	Bacteria	62641
226	Ga0209673_1007086	3300025273	Bacteria	5252
227	Ga0209673_1011728	3300025273	Bacteria	3590
228	Ga0209673_1022460	3300025273	Bacteria	2175
229	Ga0209130_1000377	3300025284	Bacteria	50153
230	Ga0209676_1006407	3300025292	Bacteria	5820
231	Ga0209025_1000144	3300025294	Bacteria	181446
232	Ga0209025_1000274	3300025294	Bacteria	119322
233	Ga0209025_1004395	3300025294	Bacteria	12270
234	Ga0209564_1002120	3300025295	Bacteria	16833
235	Ga0209564_1002146	3300025295	Bacteria	16663
236	Ga0209758_1000519	3300025297	Bacteria	61859
237	Ga0209758_1000753	3300025297	Bacteria	46946
238	Ga0209758_1003023	3300025297	Bacteria	16055
239	Ga0209758_1003885	3300025297	Bacteria	13076
240	Ga0209758_1006823	3300025297	Bacteria	8001
241	Ga0209758_1015415	3300025297	Bacteria	3958
242	Ga0209758_1033121	3300025297	Bacteria	2083
243	Ga0209050_1001979	3300025298	Bacteria	19259
244	Ga0209256_1003426	3300025299	Bacteria	11139
245	Ga0209256_1003678	3300025299	Bacteria	10443
246	Ga0209256_1007818	3300025299	Bacteria	5145
247	Ga0207426_1000142	3300025302	Bacteria	194023
248	Ga0207426_1000330	3300025302	Bacteria	89992
249	Ga0207426_1000608	3300025302	Bacteria	46209
250	Ga0207426_1000804	3300025302	Bacteria	33966
251	Ga0207426_1002121	3300025302	Bacteria	13600
252	Ga0209051_1000170	3300025303	Bacteria	119026
253	Ga0209051_1004553	3300025303	Bacteria	8497
254	Ga0209051_1009521	3300025303	Bacteria	4998
255	Ga0209257_1005926	3300025304	Bacteria	8222
256	Ga0209257_1028191	3300025304	Bacteria	1852
257	Ga0209257_1032207	3300025304	Bacteria	1666
258	Ga0207656_10036597	3300025321	Bacteria	2061
259	Ga0207682_10000660	3300025893	Bacteria	16114
260	Ga0207680_10034614	3300025903	Bacteria	2892
261	Ga0207647_10007695	3300025904	Bacteria	7757
262	Ga0207685_10033504	3300025905	Bacteria	1857
263	Ga0207699_10031828	3300025906	Bacteria	2966
264	Ga0207645_10019410	3300025907	Bacteria	4457
265	Ga0207643_10024343	3300025908	Bacteria	3341
266	Ga0207654_10120991	3300025911	Bacteria	1644
267	Ga0207695_10000107	3300025913	Bacteria	252606
268	Ga0207695_10000403	3300025913	Bacteria	96385
269	Ga0207695_10053440	3300025913	Bacteria	4225
270	Ga0207695_10245547	3300025913	Unclassified	1690
271	Ga0207671_10000277	3300025914	Bacteria	76473
272	Ga0207671_10009176	3300025914	Bacteria	8297
273	Ga0207671_10261211	3300025914	Bacteria	1363
274	Ga0207693_10013931	3300025915	Bacteria	6475
275	Ga0207663_10284490	3300025916	Bacteria	1229
276	Ga0207657_10112401	3300025919	Bacteria	2248
277	Ga0207681_10096982	3300025923	Bacteria	2118
278	Ga0207694_10001476	3300025924	Bacteria	20116
279	Ga0207694_10387283	3300025924	Bacteria	1161
280	Ga0207650_10000775	3300025925	Bacteria	24588
281	Ga0207650_10131296	3300025925	Bacteria	1960
282	Ga0207659_10107062	3300025926	Bacteria	2118
283	Ga0207664_10028168	3300025929	Bacteria	4267
284	Ga0207644_10017690	3300025931	Bacteria	4820
285	Ga0207709_10088402	3300025935	Bacteria	2017
286	Ga0207709_10396435	3300025935	Bacteria	1054
287	Ga0207669_10001111	3300025937	Bacteria	11514
288	Ga0207665_10040215	3300025939	Bacteria	3118
289	Ga0207691_10012880	3300025940	Bacteria	8006
290	Ga0207691_10173474	3300025940	Bacteria	1887
291	Ga0207711_10092309	3300025941	Bacteria	2664
292	Ga0207667_10154388	3300025949	Bacteria	2362
293	Ga0207651_10168056	3300025960	Bacteria	1727
294	Ga0207668_10026389	3300025972	Bacteria	3771
295	Ga0207640_10186394	3300025981	Bacteria	1560
296	Ga0207658_10097637	3300025986	Bacteria	2294
297	Ga0207639_10058014	3300026041	Bacteria	2975
298	Ga0207678_10034781	3300026067	Bacteria	4388
299	Ga0207678_10083476	3300026067	Bacteria	2733
300	Ga0207708_10063857	3300026075	Bacteria	2813
301	Ga0207702_10002157	3300026078	Bacteria	18902
302	Ga0207641_10180197	3300026088	Bacteria	1935
303	Ga0207641_10212824	3300026088	Bacteria	1788
304	Ga0207648_10035133	3300026089	Bacteria	4417
305	Ga0207648_10327224	3300026089	Bacteria	1378
306	Ga0207676_10022351	3300026095	Bacteria	4651
307	Ga0207674_10022703	3300026116	Bacteria	6734
308	Ga0207674_10180606	3300026116	Bacteria	2062
309	Ga0207675_100042256	3300026118	Bacteria	4255
310	Ga0207683_10004311	3300026121	Bacteria	12281
311	Ga0207698_10047141	3300026142	Bacteria	3261
312	Ga0207698_10437228	3300026142	Bacteria	1259
313	Ga0209281_1000043	3300027111	Bacteria	341543
314	Ga0209371_1002666	3300027312	Bacteria	9705
315	Ga0209813_10021535	3300027866	Bacteria	1814
316	Ga0209813_10027691	3300027866	Bacteria	1648
317	Ga0268266_10001786	3300028379	Bacteria	24408
318	Ga0268266_10004006	3300028379	Bacteria	14250
319	Ga0268266_10038058	3300028379	Bacteria	4096
320	Ga0268266_10054640	3300028379	Bacteria	3432
321	Ga0268266_10061218	3300028379	Bacteria	3246
322	Ga0268264_10127941	3300028381	Bacteria	2247
323	Ga0307515_10029590	3300028794	Bacteria	9247
324	Ga0268256_1009285	3300030500	Bacteria	3283
325	Ga0265327_10030333	3300031251	Bacteria	3059
326	Ga0265327_10104606	3300031251	Bacteria	1361
327	Ga0307513_10021731	3300031456	Bacteria	7570
328	Ga0307408_100026734	3300031548	Bacteria	3968
329	Ga0307408_100050223	3300031548	Bacteria	2999
330	Ga0307405_10000276	3300031731	Bacteria	18944
331	Ga0307405_10250421	3300031731	Bacteria	1318
332	Ga0307406_10052403	3300031901	Bacteria	2595
333	Ga0307412_10006187	3300031911	Bacteria	6749
334	Ga0307412_10129613	3300031911	Bacteria	1830
335	Ga0307412_10132732	3300031911	Bacteria	1811
336	Ga0307412_10288150	3300031911	Bacteria	1292
337	Ga0307510_10011182	3300033180	Bacteria	10673
338	Ga0373940_0004325	3300035088	Bacteria	2996
339	Ga0373949_0005842	3300035090	Bacteria	2735
340	Ga0373951_0017084	3300035091	Bacteria	1640
341	Ga0373952_0010335	3300035092	Bacteria	1802
342	Ga0373932_0085345	3300035112	Bacteria	1004
343	Ga0373936_0005975	3300035113	Bacteria	4583
344	Ga0373941_0049729	3300035115	Bacteria	1328
345	Ga0373954_0050663	3300035118	Bacteria	1948
346	Ga0373957_0107884	3300035120	Bacteria	1119
347	Ga0373960_0094824	3300035121	Bacteria	959
348	Ga0373946_0005856	3300035171	Bacteria	4451
349	Ga0373942_0016960	3300035207	Bacteria	1791
350	Ga0373961_0002679	3300035241	Bacteria	4570
351	Ga0373962_0004539	3300035242	Bacteria	3359
352	Ga0373924_0019794	3300035410	Bacteria	2610
353	Ga0373931_0007899	3300035691	Bacteria	5032
354	Ga0373933_0015761	3300035724	Bacteria	4216
355	Ga0373933_0061938	3300035724	Bacteria	2258
356	Ga0373947_0007513	3300035725	Bacteria	6306
357	Ga0373937_0000312	3300036401	Bacteria	45975
358	Ga0373937_0007378	3300036401	Bacteria	9513
359	Ga0316582_0122842	3300036647	Bacteria	1739
360	Ga0316584_0168155	3300036712	Bacteria	1628
361	Ga0373925_0097553	3300037068	Bacteria	2254
362	Ga0373925_0225686	3300037068	Bacteria	1496
363	Ga0395899_0000114	3300037312	Bacteria	134621
364	Ga0395900_0000154	3300037418	Bacteria	113757
365	Ga0395900_0003627	3300037418	Bacteria	16600
366	Ga0395900_0203220	3300037418	Bacteria	2004
367	Ga0395900_0310147	3300037418	Bacteria	1561
368	Ga0395898_0000308	3300037466	Bacteria	113757
369	Ga0395898_0010894	3300037466	Bacteria	9489
370	Ga0395905_0000153	3300037471	Bacteria	113757
371	Ga0395905_0016507	3300037471	Bacteria	7019
372	Ga0395905_0075336	3300037471	Bacteria	3163
373	Ga0395905_0105810	3300037471	Bacteria	2642
374	Ga0395905_0141333	3300037471	Bacteria	2264
375	Ga0436364_1318815	3300037853	Bacteria	2622
376	Ga0395901_0000107	3300038443	Bacteria	113757
377	Ga0395901_0011312	3300038443	Bacteria	9041
378	Ga0395901_0044068	3300038443	Bacteria	4627
379	Ga0436365_0061548	3300039437	Bacteria	1637
380	Ga0436365_0787841	3300039437	Bacteria	2327
381	Ga0436365_1836336	3300039437	Bacteria	3481
382	Ga0436360_0771687	3300039438	Bacteria	1218
383	Ga0436360_0956360	3300039438	Bacteria	4044
384	Ga0436360_1070168	3300039438	Bacteria	3222
385	Ga0436361_0109192	3300039447	Bacteria	4234
386	Ga0436363_0890798	3300039450	Bacteria	2340
387	Ga0436362_1177950	3300039453	Bacteria	1117
388	Ga0439465_0015307	3300041413	Bacteria	2393
389	Ga0439465_0025608	3300041413	Bacteria	1862
390	Ga0451853_3317846	3300041512	Bacteria	1247
391	Ga0439449_0025353	3300042007	Bacteria	2217
392	Ga0466966_0054809	3300044684	Bacteria	2525
393	Ga0466963_0054882	3300044694	Bacteria	2649
394	Ga0466960_0022089	3300044901	Bacteria	2841
395	Ga0466959_0005344	3300045049	Bacteria	8786
396	Ga0466958_0125958	3300045836	Bacteria	1606
397	Ga0495617_011352	3300046452	Bacteria	3039
398	Ga0495592_0009518	3300046454	Bacteria	7311
399	Ga0495629_0013843	3300046459	Bacteria	5820
400	Ga0495638_0000546	3300046460	Bacteria	42990
401	Ga0495638_0007050	3300046460	Bacteria	8107
402	Ga0495638_0015356	3300046460	Bacteria	5145
403	Ga0495651_0069607	3300046462	Bacteria	2679
404	Ga0495651_0092309	3300046462	Bacteria	2268
405	Ga0495653_0104339	3300046463	Bacteria	2049
406	Ga0495605_0033303	3300046474	Bacteria	2616
407	Ga0495605_0041179	3300046474	Bacteria	2302
408	Ga0495605_0048697	3300046474	Bacteria	2074
409	Ga0495664_0000781	3300046477	Bacteria	16249
410	Ga0495585_0053366	3300046492	Bacteria	2237
411	Ga0495606_0002266	3300046507	Bacteria	22765
412	Ga0495608_0028263	3300046511	Bacteria	3811
413	Ga0495610_0044759	3300046512	Bacteria	2194
414	Ga0495620_0037288	3300046515	Bacteria	2167
415	Ga0495628_0089652	3300046516	Bacteria	2381
416	Ga0495631_0001028	3300046518	Bacteria	17326
417	Ga0495632_0004447	3300046519	Bacteria	9521
418	Ga0495632_0005489	3300046519	Bacteria	8377
419	Ga0495643_0099765	3300046522	Bacteria	1489
420	Ga0495648_0002380	3300046524	Bacteria	17465
421	Ga0495666_0023150	3300046526	Bacteria	3073
422	Ga0495666_0086781	3300046526	Bacteria	1478
423	Ga0495652_0068189	3300046529	Bacteria	2980
424	Ga0495652_0123460	3300046529	Bacteria	2061
425	Ga0495654_0001020	3300046530	Bacteria	20494
426	Ga0495640_0048700	3300046533	Bacteria	2927
427	Ga0495640_0055328	3300046533	Bacteria	2714
428	Ga0495640_0198326	3300046533	Bacteria	1273
429	Ga0495587_0025343	3300046536	Bacteria	3624
430	Ga0495587_0070002	3300046536	Bacteria	2042
431	Ga0495587_0115214	3300046536	Bacteria	1542
432	Ga0495598_0003729	3300046537	Bacteria	3254
433	Ga0495645_0001100	3300046543	Bacteria	18313
434	Ga0495645_0165848	3300046543	Bacteria	1523
435	Ga0495667_0005370	3300046559	Bacteria	8664
436	Ga0495667_0029143	3300046559	Bacteria	3715
437	Ga0495667_0038537	3300046559	Bacteria	3182
438	Ga0495656_0005466	3300046615	Bacteria	4386
439	Ga0495668_0012816	3300046616	Bacteria	4965
440	Ga0495668_0014014	3300046616	Bacteria	4712
441	Ga0495668_0045721	3300046616	Bacteria	2434
442	Ga0495668_0107739	3300046616	Bacteria	1524
443	Ga0495634_0201545	3300046642	Bacteria	1236
444	Ga0495625_0004012	3300046660	Bacteria	14085
445	Ga0495625_0029317	3300046660	Bacteria	4118
446	Ga0495625_0218208	3300046660	Bacteria	1251
447	Ga0495635_0069029	3300046663	Bacteria	2423
448	Ga0495635_0107819	3300046663	Bacteria	1902
449	Ga0495635_0306949	3300046663	Bacteria	1063
450	Ga0495588_0037661	3300046674	Bacteria	2458
451	Ga0495657_0022921	3300046675	Bacteria	4469
452	Ga0495657_0040411	3300046675	Bacteria	3199
453	Ga0495657_0053913	3300046675	Bacteria	2688
454	Ga0495623_0006287	3300046679	Bacteria	7721
455	Ga0495623_0084564	3300046679	Bacteria	1958
456	Ga0495646_0019529	3300046680	Bacteria	4289
457	Ga0495613_0020499	3300046689	Bacteria	4928
458	Ga0495624_0141065	3300046690	Bacteria	1476
459	Ga0495671_0039265	3300046692	Bacteria	2391
460	Ga0495600_0073831	3300046809	Bacteria	2227
461	Ga0495600_0103626	3300046809	Bacteria	1854
462	Ga0495600_0245592	3300046809	Bacteria	1139
463	Ga0495604_0016156	3300047317	Bacteria	5964
464	Ga0495604_0031621	3300047317	Bacteria	4197
465	Ga0495604_0034993	3300047317	Bacteria	3968
466	Ga0495674_0117491	3300047319	Bacteria	2249
467	Ga0495674_0144681	3300047319	Bacteria	1996
468	Ga0495676_0127983	3300047321	Bacteria	1838
469	Ga0495676_0279233	3300047321	Bacteria	1131
470	Ga0495680_0021255	3300047322	Bacteria	5436
471	Ga0495687_013306	3300047443	Bacteria	4306
472	Ga0495675_0008854	3300047444	Bacteria	6250
473	Ga0495675_0060590	3300047444	Bacteria	2399
474	Ga0495677_0078590	3300047445	Bacteria	1235
475	Ga0495685_027896	3300047447	Bacteria	1942
476	Ga0495684_0024439	3300047471	Bacteria	4651
477	Ga0495684_0104447	3300047471	Bacteria	2141
478	Ga0495684_0154654	3300047471	Bacteria	1713
479	Ga0495686_0012713	3300047472	Bacteria	5878
480	Ga0495686_0023696	3300047472	Bacteria	4044
481	Ga0495686_0024272	3300047472	Bacteria	3987
482	Ga0495686_0100313	3300047472	Bacteria	1747
483	Ga0495686_0139729	3300047472	Bacteria	1430
484	Ga0495602_0000195	3300048088	Bacteria	57149
485	Ga0495602_0058639	3300048088	Bacteria	3368
486	Ga0495602_0199048	3300048088	Bacteria	1530
487	Ga0495626_0019902	3300048091	Bacteria	3349
488	Ga0496102_0003654	3300048905	Bacteria	13009
489	Ga0496102_0024140	3300048905	Bacteria	5404
490	Ga0496102_0182758	3300048905	Bacteria	1976
491	Ga0496102_0462453	3300048905	Bacteria	1190
492	Ga0496103_0022188	3300048906	Bacteria	3822
493	Ga0496103_0047679	3300048906	Bacteria	2648
494	Ga0496103_0268440	3300048906	Bacteria	1098
495	Ga0496104_0000118	3300048907	Bacteria	74158
496	Ga0496104_0001078	3300048907	Bacteria	23308
497	Ga0496104_0128018	3300048907	Bacteria	2438
498	Ga0496104_0407258	3300048907	Bacteria	1272
499	Ga0496105_0032835	3300048908	Bacteria	4260
500	Ga0496105_0098145	3300048908	Bacteria	2419
501	Ga0496106_0043548	3300048909	Bacteria	3368
502	Ga0496108_0079602	3300048911	Bacteria	2775
503	Ga0496108_0155152	3300048911	Bacteria	1977
504	Ga0496108_0291705	3300048911	Bacteria	1420
505	Ga0496109_0375833	3300048912	Bacteria	1342
506	Ga0496110_0150382	3300048913	Bacteria	2108
507	Ga0496111_0024922	3300048914	Bacteria	4219
508	Ga0496112_0000015	3300048915	Bacteria	206423
509	Ga0496112_0025929	3300048915	Bacteria	5633
510	Ga0496112_0054660	3300048915	Bacteria	3924
511	Ga0496112_0099916	3300048915	Bacteria	2871
512	Ga0496113_0092530	3300048916	Bacteria	2332
513	Ga0496113_0171438	3300048916	Bacteria	1719
514	Ga0496114_0068843	3300048917	Bacteria	2971
515	Ga0496114_0086114	3300048917	Bacteria	2662
516	Ga0496114_0168414	3300048917	Bacteria	1908
517	Ga0496115_0002469	3300048918	Bacteria	13283
518	Ga0496115_0038418	3300048918	Bacteria	3798
519	Ga0496115_0065173	3300048918	Bacteria	2942
520	Ga0496115_0091906	3300048918	Bacteria	2480
521	Ga0496115_0124420	3300048918	Bacteria	2124
522	Ga0496115_0285987	3300048918	Bacteria	1353
523	Ga0496116_0012271	3300048919	Bacteria	7006
524	Ga0496116_0012404	3300048919	Bacteria	6966
525	Ga0496116_0021303	3300048919	Bacteria	4893
526	Ga0496117_0000002	3300048920	Bacteria	2483758
527	Ga0496117_0024374	3300048920	Bacteria	4788
528	Ga0496117_0028575	3300048920	Bacteria	4316
529	Ga0496117_0100142	3300048920	Bacteria	1836
530	Ga0496118_0002959	3300048921	Bacteria	22001
531	Ga0496118_0004935	3300048921	Bacteria	15469
532	Ga0496118_0038318	3300048921	Bacteria	3844
533	Ga0496118_0050898	3300048921	Bacteria	3173
534	Ga0496118_0131098	3300048921	Bacteria	1610
535	Ga0496119_0000206	3300048922	Bacteria	83950
536	Ga0496119_0005715	3300048922	Bacteria	11798
537	Ga0496119_0016272	3300048922	Bacteria	5670
538	Ga0496119_0049901	3300048922	Bacteria	2583
539	Ga0496119_0125041	3300048922	Bacteria	1408
540	Ga0496120_0002005	3300048923	Bacteria	22146
541	Ga0496120_0002040	3300048923	Bacteria	21866
542	Ga0496120_0011499	3300048923	Bacteria	6082
543	Ga0496120_0036088	3300048923	Bacteria	2946
544	Ga0496121_0004266	3300048924	Bacteria	19420
545	Ga0496121_0005841	3300048924	Bacteria	15595
546	Ga0496121_0012228	3300048924	Bacteria	9402
547	Ga0496121_0018486	3300048924	Bacteria	7024
548	Ga0496121_0026291	3300048924	Bacteria	5489
549	Ga0496121_0039489	3300048924	Bacteria	4157
550	Ga0496121_0057208	3300048924	Bacteria	3233
551	Ga0496121_0071894	3300048924	Bacteria	2780
552	Ga0496121_0128560	3300048924	Bacteria	1900
553	Ga0496122_0000001	3300048925	Bacteria	1827766
554	Ga0496122_0004983	3300048925	Bacteria	16067
555	Ga0496122_0008471	3300048925	Bacteria	11086
556	Ga0496122_0009610	3300048925	Bacteria	10129
557	Ga0496122_0016672	3300048925	Bacteria	6927
558	Ga0496122_0040292	3300048925	Bacteria	3715
559	Ga0496123_0000001	3300048926	Bacteria	1831497
560	Ga0496123_0033814	3300048926	Bacteria	3672
561	Ga0496123_0043723	3300048926	Bacteria	3072
562	Ga0496123_0043953	3300048926	Bacteria	3060
563	Ga0496123_0087049	3300048926	Bacteria	1870
564	Ga0496124_0006759	3300048927	Bacteria	12398
565	Ga0496124_0009881	3300048927	Bacteria	9758
566	Ga0496124_0010264	3300048927	Bacteria	9508
567	Ga0496124_0028881	3300048927	Bacteria	4952
568	Ga0496124_0028883	3300048927	Bacteria	4952
569	Ga0496124_0120670	3300048927	Bacteria	2095
570	Ga0496124_0152628	3300048927	Bacteria	1810
571	Ga0496124_0155857	3300048927	Bacteria	1786
572	Ga0496125_0024228	3300048928	Bacteria	5584
573	Ga0496125_0027692	3300048928	Bacteria	5131
574	Ga0496125_0034809	3300048928	Bacteria	4431
575	Ga0496125_0083240	3300048928	Bacteria	2435
576	Ga0496125_0134774	3300048928	Bacteria	1730
577	Ga0496126_0001398	3300048929	Bacteria	38223
578	Ga0496126_0040266	3300048929	Bacteria	4332
579	Ga0496126_0122011	3300048929	Bacteria	2259
580	Ga0496126_0156015	3300048929	Bacteria	1953
581	Ga0496126_0239844	3300048929	Bacteria	1515
582	Ga0495678_023644	3300049459	Bacteria	2667
583	Ga0501031_0000002	3300049568	Bacteria	217588
584	Ga0501031_0002129	3300049568	Bacteria	12485
585	Ga0501031_0010598	3300049568	Bacteria	6000
586	Ga0501031_0115697	3300049568	Bacteria	1752
587	Ga0501031_0189660	3300049568	Bacteria	1343
588	Ga0501031_0203894	3300049568	Bacteria	1290
589	Ga0501031_0305904	3300049568	Bacteria	1030
590	Ga0501032_0000004	3300049569	Bacteria	310855
591	Ga0501032_0006153	3300049569	Bacteria	8832
592	Ga0501032_0016972	3300049569	Bacteria	5116
593	Ga0501032_0025925	3300049569	Bacteria	4038
594	Ga0501033_0000016	3300049570	Bacteria	217458
595	Ga0501033_0000220	3300049570	Bacteria	55046
596	Ga0501033_0005369	3300049570	Bacteria	10153
597	Ga0501033_0015334	3300049570	Bacteria	5813
598	Ga0501033_0017626	3300049570	Bacteria	5394
599	Ga0501033_0025854	3300049570	Bacteria	4420
600	Ga0501033_0030136	3300049570	Bacteria	4076
601	Ga0501033_0059579	3300049570	Bacteria	2819
602	Ga0501033_0070038	3300049570	Bacteria	2577
603	Ga0501033_0124996	3300049570	Bacteria	1865
604	Ga0501034_0000011	3300049571	Bacteria	310855
605	Ga0501034_0001008	3300049571	Bacteria	40385
606	Ga0501034_0006630	3300049571	Bacteria	12427
607	Ga0501034_0013053	3300049571	Bacteria	8563
608	Ga0501034_0024219	3300049571	Bacteria	6174
609	Ga0501034_0043060	3300049571	Bacteria	4570
610	Ga0501034_0047799	3300049571	Bacteria	4319
611	Ga0501034_0073982	3300049571	Bacteria	3416
612	Ga0501034_0198639	3300049571	Bacteria	1964
613	Ga0501036_0000001	3300049572	Bacteria	310855
614	Ga0501036_0010962	3300049572	Bacteria	7494
615	Ga0501036_0041850	3300049572	Bacteria	3877
616	Ga0501036_0056945	3300049572	Bacteria	3311
617	Ga0501036_0074230	3300049572	Bacteria	2876
618	Ga0501036_0086578	3300049572	Bacteria	2648
619	Ga0501036_0194986	3300049572	Bacteria	1704
620	Ga0501036_0259852	3300049572	Bacteria	1455
621	Ga0501036_0390740	3300049572	Bacteria	1161
622	Ga0501037_0000006	3300049573	Bacteria	217461
623	Ga0501037_0000047	3300049573	Bacteria	114757
624	Ga0501037_0010944	3300049573	Bacteria	6669
625	Ga0501037_0184722	3300049573	Bacteria	1478
626	Ga0501038_0000003	3300049574	Bacteria	310855
627	Ga0501038_0002943	3300049574	Bacteria	15884
628	Ga0501038_0004026	3300049574	Bacteria	13661
629	Ga0501038_0020729	3300049574	Bacteria	5908
630	Ga0501038_0032553	3300049574	Bacteria	4599
631	Ga0501038_0047641	3300049574	Bacteria	3712
632	Ga0501038_0108317	3300049574	Bacteria	2304
633	Ga0501038_0118350	3300049574	Bacteria	2188
634	Ga0501038_0386443	3300049574	Bacteria	1085
635	Ga0501039_0000004	3300049575	Bacteria	310855
636	Ga0501039_0040604	3300049575	Bacteria	3591
637	Ga0501039_0048823	3300049575	Bacteria	3272
638	Ga0501039_0091825	3300049575	Bacteria	2366
639	Ga0501039_0107699	3300049575	Bacteria	2178
640	Ga0501040_0001875	3300049576	Bacteria	13486
641	Ga0501040_0003086	3300049576	Bacteria	10804
642	Ga0501040_0027043	3300049576	Bacteria	3860
643	Ga0501041_0000262	3300049577	Bacteria	24854
644	Ga0501042_0005258	3300049578	Bacteria	8317
645	Ga0501042_0005740	3300049578	Bacteria	8018
646	Ga0501043_0000032	3300049579	Bacteria	140037
647	Ga0501043_0000478	3300049579	Bacteria	35744
648	Ga0501043_0010226	3300049579	Bacteria	7354
649	Ga0501043_0067568	3300049579	Bacteria	2807
650	Ga0501043_0125179	3300049579	Bacteria	2015
651	Ga0501046_0004260	3300049580	Bacteria	13024
652	Ga0501046_0055374	3300049580	Bacteria	3117
653	Ga0501047_0002317	3300049581	Bacteria	18214
654	Ga0501047_0045808	3300049581	Bacteria	4228
655	Ga0501047_0048954	3300049581	Bacteria	4081
656	Ga0501047_0050306	3300049581	Bacteria	4024
657	Ga0501047_0053447	3300049581	Bacteria	3906
658	Ga0501047_0077795	3300049581	Bacteria	3190
659	Ga0501047_0355414	3300049581	Bacteria	1301
660	Ga0501048_0001501	3300049582	Bacteria	17665
661	Ga0501048_0206206	3300049582	Bacteria	1394
662	Ga0501067_0044086	3300049583	Bacteria	2479
663	Ga0501067_0113997	3300049583	Bacteria	1503
664	Ga0501068_0000789	3300049584	Bacteria	16386
665	Ga0501068_0047845	3300049584	Bacteria	2581
666	Ga0501068_0051467	3300049584	Bacteria	2491
667	Ga0501069_0000073	3300049585	Bacteria	50646
668	Ga0501069_0011383	3300049585	Bacteria	4716
669	Ga0501069_0018151	3300049585	Bacteria	3794
670	Ga0501070_0000160	3300049586	Bacteria	61662
671	Ga0501070_0002269	3300049586	Bacteria	16899
672	Ga0501070_0002837	3300049586	Bacteria	15124
673	Ga0501070_0011230	3300049586	Bacteria	7563
674	Ga0501070_0016814	3300049586	Bacteria	6140
675	Ga0501070_0037574	3300049586	Bacteria	4042
676	Ga0501070_0069679	3300049586	Bacteria	2912
677	Ga0501071_0021183	3300049587	Bacteria	4528
678	Ga0501071_0023477	3300049587	Bacteria	4308
679	Ga0501071_0048792	3300049587	Bacteria	3046
680	Ga0501071_0071142	3300049587	Bacteria	2535
681	Ga0501073_0042682	3300049589	Bacteria	3200
682	Ga0501073_0045155	3300049589	Bacteria	3104
683	Ga0501073_0090441	3300049589	Bacteria	2127
684	Ga0501073_0139125	3300049589	Bacteria	1682
685	Ga0501074_0000014	3300049590	Bacteria	80359
686	Ga0501074_0006040	3300049590	Bacteria	8739
687	Ga0501074_0017482	3300049590	Bacteria	5205
688	Ga0501074_0027418	3300049590	Bacteria	4131
689	Ga0501074_0057790	3300049590	Bacteria	2795
690	Ga0501075_0224094	3300049591	Bacteria	1434
691	Ga0501076_0421852	3300049592	Bacteria	1098
692	Ga0501077_0010921	3300049593	Bacteria	5660
693	Ga0501079_0004652	3300049741	Bacteria	10169
694	Ga0501079_0051297	3300049741	Bacteria	3185
695	Ga0501080_0000116	3300049742	Bacteria	55473
696	Ga0501080_0004455	3300049742	Bacteria	12465
697	Ga0501080_0010696	3300049742	Bacteria	8395
698	Ga0501080_0162298	3300049742	Bacteria	2063
699	Ga0501081_0000379	3300049743	Bacteria	24411
700	Ga0501083_0000062	3300049744	Bacteria	75924
701	Ga0501083_0051972	3300049744	Bacteria	2754
702	Ga0501083_0094931	3300049744	Bacteria	1969
703	Ga0501241_004957	3300049758	Bacteria	2487
704	Ga0501035_0000009	3300049822	Bacteria	310827
705	Ga0501035_0000025	3300049822	Bacteria	204195
706	Ga0501035_0007294	3300049822	Bacteria	10345
707	Ga0501035_0009031	3300049822	Bacteria	9271
708	Ga0501035_0014215	3300049822	Bacteria	7346
709	Ga0501035_0034742	3300049822	Bacteria	4579
710	Ga0501035_0047662	3300049822	Bacteria	3845
711	Ga0501035_0056696	3300049822	Bacteria	3494
712	Ga0501035_0067339	3300049822	Bacteria	3178
713	Ga0501035_0089493	3300049822	Bacteria	2711
714	Ga0501035_0183316	3300049822	Bacteria	1803
715	Ga0501044_0000005	3300049823	Bacteria	310855
716	Ga0501044_0000031	3300049823	Bacteria	173135
717	Ga0501044_0003628	3300049823	Bacteria	17366
718	Ga0501044_0006736	3300049823	Bacteria	12666
719	Ga0501044_0019278	3300049823	Bacteria	7299
720	Ga0501044_0026221	3300049823	Bacteria	6172
721	Ga0501044_0050590	3300049823	Bacteria	4286
722	Ga0501044_0074133	3300049823	Bacteria	3459
723	Ga0501044_0200417	3300049823	Bacteria	1954
724	Ga0501044_0249269	3300049823	Bacteria	1717
725	Ga0501045_0007368	3300049824	Bacteria	7649
726	Ga0501045_0038079	3300049824	Bacteria	3497
727	Ga0501045_0054716	3300049824	Bacteria	2918
728	nmdc:mga03683_6861_c1	3300050489	Bacteria	3922
729	nmdc:mga03n38_84916_c1	3300050490	Bacteria	1496
730	nmdc:mga00v17_10177_c1	3300050491	Bacteria	5126
731	nmdc:mga00v17_102_c1	3300050491	Bacteria	50732
732	nmdc:mga00v17_689_c1	3300050491	Bacteria	18565
733	nmdc:mga0yw44_120223_c1	3300050492	Bacteria	1691
734	nmdc:mga0yw44_1293_c1	3300050492	Bacteria	9890
735	nmdc:mga0yw44_22517_c1	3300050492	Bacteria	3535
736	nmdc:mga0yw44_2676_c1	3300050492	Bacteria	7688
737	nmdc:mga0yw44_46843_c1	3300050492	Bacteria	2599
738	nmdc:mga0yw44_9844_c1	3300050492	Bacteria	4853
739	nmdc:mga0k408_41909_c1	3300050493	Bacteria	2637
740	nmdc:mga06z11_76474_c1	3300050494	Bacteria	1785
741	nmdc:mga06z11_8263_c1	3300050494	Bacteria	4330
742	nmdc:mga06z11_95778_c1	3300050494	Bacteria	1620
743	nmdc:mga04h51_22171_c1	3300050495	Bacteria	1919
744	nmdc:mga04h51_97510_c1	3300050495	Bacteria	1067
745	nmdc:mga07m45_38208_c1	3300050496	Bacteria	2679
746	nmdc:mga07m45_55601_c1	3300050496	Bacteria	2237
747	nmdc:mga05p37_13385_c1	3300050507	Bacteria	9831
748	nmdc:mga05p37_181054_c1	3300050507	Bacteria	2563
749	nmdc:mga09592_100534_c1	3300050508	Bacteria	2476
750	nmdc:mga06r32_10904_c1	3300050510	Bacteria	8184
751	nmdc:mga08y16_110729_c1	3300050511	Bacteria	2859
752	nmdc:mga0n895_11019_c1	3300050512	Bacteria	8037
753	nmdc:mga08x19_334583_c1	3300050514	Bacteria	1055
754	nmdc:mga0sz30_223_c1	3300050516	Bacteria	21634
755	nmdc:mga0sz30_54194_c1	3300050516	Bacteria	1705
756	Ga0495601_0004391	3300053077	Bacteria	8150
757	Ga0495601_0076815	3300053077	Bacteria	2139
758	Ga0495595_0069465	3300053084	Bacteria	1663
759	Ga0495619_0006464	3300053085	Bacteria	7422
760	Ga0495619_0028068	3300053085	Bacteria	3629
761	Ga0495619_0071105	3300053085	Bacteria	2328
762	Ga0495619_0080049	3300053085	Bacteria	2198
763	Ga0495619_0125907	3300053085	Bacteria	1758
764	Ga0500578_0100618	3300053086	Bacteria	1829
765	Ga0500643_000049	3300053087	Bacteria	147107
766	Ga0500643_000792	3300053087	Bacteria	20488
767	Ga0500643_021843	3300053087	Bacteria	2070
768	Ga0500566_0002048	3300053094	Bacteria	11914
769	Ga0500640_077862	3300053095	Bacteria	1411
770	Ga0500555_002037	3300053103	Bacteria	5953
771	Ga0500557_000012	3300053105	Bacteria	115728
772	Ga0500557_059463	3300053105	Bacteria	1239
773	Ga0500562_004658	3300053108	Bacteria	3461
774	Ga0500569_007070	3300053109	Bacteria	2500
775	Ga0500572_004179	3300053111	Bacteria	3281
776	Ga0500572_025818	3300053111	Bacteria	1596
777	Ga0500595_061703	3300053119	Bacteria	1130
778	Ga0500607_024041	3300053121	Bacteria	3407
779	Ga0500618_000722	3300053125	Bacteria	18922
780	Ga0500618_001650	3300053125	Bacteria	9607
781	Ga0500642_0000202	3300053130	Bacteria	24340
782	Ga0500642_0038638	3300053130	Bacteria	2047
783	Ga0500658_0033631	3300053134	Bacteria	2017
784	Ga0500561_0000889	3300053137	Bacteria	4776
785	Ga0500568_0000197	3300053139	Bacteria	52712
786	Ga0500568_0002799	3300053139	Bacteria	10093
787	Ga0500568_0045365	3300053139	Bacteria	1749
788	Ga0500573_0089182	3300053140	Bacteria	1744
789	Ga0500588_0016916	3300053146	Bacteria	1894
790	Ga0500588_0064759	3300053146	Bacteria	1182
791	Ga0500590_004449	3300053148	Bacteria	6618
792	Ga0500616_0001964	3300053153	Bacteria	18305
793	Ga0500616_0006715	3300053153	Bacteria	7469
794	Ga0500616_0035841	3300053153	Bacteria	2695
795	Ga0500616_0042003	3300053153	Bacteria	2451
796	Ga0500620_003682	3300053155	Bacteria	3312
797	Ga0500622_0006401	3300053156	Bacteria	6838
798	Ga0500622_0010637	3300053156	Bacteria	5042
799	Ga0500627_0088418	3300053158	Bacteria	1386
800	Ga0500636_0000167	3300053177	Bacteria	34492
801	Ga0500636_0002734	3300053177	Bacteria	9817
802	Ga0500636_0222650	3300053177	Bacteria	982
803	Ga0500609_001666	3300053731	Bacteria	3248
804	Ga0500599_002147	3300053736	Bacteria	2344
805	Ga0500601_000550	3300053737	Bacteria	5533
806	Ga0501084_0000020	3300054114	Bacteria	146335
807	Ga0501084_0001278	3300054114	Bacteria	19819
808	Ga0501084_0049643	3300054114	Bacteria	3512
809	Ga0501084_0276443	3300054114	Bacteria	1418
810	Ga0501082_0003761	3300060353	Bacteria	13262
811	Ga0501082_0041914	3300060353	Bacteria	3947
812	Ga0501082_0116411	3300060353	Bacteria	2315
813	Ga0501082_0345432	3300060353	Bacteria	1297
814	Ga0466962_0038467	3300061719	Bacteria	2291
815	Ga0530510_0010460	3300061734	Bacteria	6506
816	2844011705	2844009547	Bacteria	6728125
817	2503198182	2503198000	Bacteria	6884444
818	2503204279	2503198000	Bacteria	6884444
819	2509140189	2508501127	Bacteria	7037543
820	2509368228	2509276018	Bacteria	6910194
821	2509389055	2509276021	Bacteria	7634384
822	2509393107	2509276022	Bacteria	6200534
823	2509398614	2509276022	Bacteria	6200534
824	2509444641	2509276033	Bacteria	7180565
825	2510135611	2510065019	Bacteria	6903379
826	2510314518	2510065059	Bacteria	6847884
827	2510320155	2510065059	Bacteria	6847884
828	2510838928	2510461069	Bacteria	5505000
829	2511132124	2510917022	Bacteria	6504556
830	2511174431	2510917026	Bacteria	7046020
831	2511185534	2510917028	Bacteria	6185411
832	2511392061	2511231027	Bacteria	5013807
833	2512531013	2512047086	Bacteria	6850303
834	2512934337	2512875016	Bacteria	6529530
835	2512934920	2512875016	Bacteria	6529530
836	2512962680	2512875024	Bacteria	7195110
837	2512963281	2512875024	Bacteria	7195110
838	2513570774	2513237084	Bacteria	7231967
839	2513575013	2513237085	Bacteria	7695351
840	2513599542	2513237088	Bacteria	6927906
841	2513609646	2513237090	Bacteria	7096802
842	2513613085	2513237090	Bacteria	7096802
843	2513633796	2513237093	Bacteria	7545552
844	2513713050	2513237103	Bacteria	7647401
845	2513868515	2513237138	Bacteria	7368160
846	2513924215	2513237146	Bacteria	7166346
847	2514034433	2513237164	Bacteria	7563725
848	2514037276	2513237164	Bacteria	7563725
849	2514416682	2513237305	Bacteria	7293571
850	2514423449	2513237305	Bacteria	7293571
851	2514586428	2513237351	Bacteria	6968952
852	2515114775	2515075009	Bacteria	7288508
853	2515741240	2515154134	Bacteria	7220242
854	2516210044	2516143018	Bacteria	6951533
855	2517038390	2516653077	Bacteria	7555578
856	2517078669	2516653085	Bacteria	7346596
857	2517097411	2517093000	Bacteria	7412387
858	2524462131	2524023209	Bacteria	6679728
859	2530648401	2529292951	Bacteria	6916614
860	2535483955	2534681786	Bacteria	3308809
861	2535514454	2534681796	Bacteria	7146037
862	2554246120	2554235003	Bacteria	5877155
863	2559293343	2558860242	Bacteria	5568029
864	2561466643	2558860983	Bacteria	4133860
865	2585201417	2582581294	Bacteria	6626667
866	2585232322	2582581299	Bacteria	6518058
867	2585276386	2582581307	Bacteria	6597605
868	2585282445	2582581308	Bacteria	7413247
869	2585328591	2582581315	Bacteria	7318924
870	2585336108	2582581316	Bacteria	7774528
871	2585396453	2582581866	Bacteria	6859583
872	2585405074	2582581867	Bacteria	7184437
873	2585524016	2585427526	Bacteria	7258840
874	2585536584	2585427527	Bacteria	7273426
875	2585542179	2585427528	Bacteria	6842387
876	2585557205	2585427530	Bacteria	7383882
877	2585564186	2585427531	Bacteria	6992870
878	2585825119	2585427590	Bacteria	6824633
879	2585840625	2585427593	Bacteria	7141551
880	2585843586	2585427594	Bacteria	6180594
881	2585897318	2585427608	Bacteria	6544331
882	2585902953	2585427609	Bacteria	6667127
883	2585998347	2585427633	Bacteria	6413184
884	2586002910	2585427634	Bacteria	6455027
885	2587978472	2585428125	Bacteria	6662905
886	2588520498	2588253730	Bacteria	6881675
887	2597810645	2597489875	Bacteria	7010078
888	2599332502	2599185156	Bacteria	5403036
889	2599419832	2599185170	Bacteria	7295545
890	2599718589	2599185236	Bacteria	6875203
891	2599935615	2599185301	Bacteria	6161860
892	2600376802	2600254933	Bacteria	4750527
893	2616294016	2615840624	Bacteria	6557588
894	2616311557	2615840626	Bacteria	7921970
895	2616551689	2615840698	Bacteria	7319877
896	2617386431	2617270742	Bacteria	6808054
897	2643770297	2643221550	Bacteria	4619371
898	2643777341	2643221551	Bacteria	3750538
899	2643795789	2643221555	Bacteria	3749717
900	2643838051	2643221564	Bacteria	4193379
901	2643857459	2643221568	Bacteria	5187270
902	2643987066	2643221595	Bacteria	6565519
903	2644004220	2643221599	Bacteria	6292121
904	2644130451	2643221623	Bacteria	5239945
905	2644155491	2643221627	Bacteria	6761570
906	2644191105	2643221634	Bacteria	6705461
907	2644298104	2643221653	Bacteria	4569637
908	2644519691	2643221693	Bacteria	5513853
909	2644656356	2643221719	Bacteria	4568197
910	2671116359	2667528174	Bacteria	6435400
911	2688595484	2687453392	Bacteria	6880454
912	2688601005	2687453392	Bacteria	6880454
913	2694628378	2693429783	Bacteria	7019804
914	2694631433	2693429783	Bacteria	7019804
915	2694636678	2693429784	Bacteria	7241525
916	2694640765	2693429784	Bacteria	7241525
917	2719183277	2718217882	Bacteria	6556348
918	2719388034	2718217927	Bacteria	6972593
919	2719667652	2718217997	Bacteria	6740740
920	2719733994	2718218009	Bacteria	6478651
921	2720494072	2718218199	Bacteria	6740745
922	2720615535	2718218232	Bacteria	6720332
923	2720622318	2718218233	Bacteria	6662049
924	2720633672	2718218235	Bacteria	6630699
925	2720777372	2718218269	Bacteria	6906114
926	2721149389	2718218363	Bacteria	6524337
927	2721160792	2718218365	Bacteria	6274507
928	2721166226	2718218366	Bacteria	6425255
929	2721401667	2718218423	Bacteria	6438183
930	2722842396	2721755514	Bacteria	6424414
931	2723028970	2721755556	Bacteria	6745503
932	2723562586	2721755684	Bacteria	6859907
933	2723569279	2721755685	Bacteria	6704835
934	2723571840	2721755686	Bacteria	7343952
935	2723572705	2721755686	Bacteria	7343952
936	2724040481	2721755809	Bacteria	6438790
937	2724046750	2721755810	Bacteria	6479005
938	2724091979	2721755819	Bacteria	6906405
939	2724106544	2721755822	Bacteria	6726041
940	2724112351	2721755823	Bacteria	6752556
941	2725951964	2724679232	Bacteria	7646494
942	2730109906	2728369352	Bacteria	6745171
943	2730166512	2728369365	Bacteria	6555560
944	2730300424	2728369397	Bacteria	6274511
945	2738800664	2738541293	Bacteria	7065685
946	2739037414	2738541333	Bacteria	7106503
947	2739307596	2738543024	Bacteria	5603683
948	2753358511	2751185800	Bacteria	5467370
949	2753460032	2751185821	Bacteria	6189929
950	2756674433	2756170246	Bacteria	7451806
951	2756677679	2756170246	Bacteria	7451806
952	2757571525	2757320392	Bacteria	3737298
953	2758640741	2758568016	Bacteria	5645291
954	2765465899	2765235802	Bacteria	5618596
955	2766067221	2765235942	Bacteria	7445910
956	2770196558	2767802442	Bacteria	5747986
957	2776269339	2775506902	Bacteria	6208009
958	2776283522	2775506904	Bacteria	5954060
959	2778179374	2775507266	Bacteria	7392367
960	2792746694	2791355123	Bacteria	8049106
961	2792748644	2791355123	Bacteria	8049106
962	2792751638	2791355123	Bacteria	8049106
963	2793283148	2791355253	Bacteria	5171699
964	2793298402	2791355256	Bacteria	6798008
965	2793315757	2791355259	Bacteria	7254731
966	2793335584	2791355262	Bacteria	6774204
967	2793350342	2791355264	Bacteria	6429314
968	2793354712	2791355265	Bacteria	6539969
969	2793358591	2791355266	Bacteria	7116587
970	2793369047	2791355267	Bacteria	7222458
971	2805928966	2802429605	Bacteria	6875453
972	2806047141	2802429633	Bacteria	7341974
973	2806054860	2802429634	Bacteria	7083200
974	2806061912	2802429635	Bacteria	7650140
975	2806069565	2802429636	Bacteria	7597525
976	2806076064	2802429637	Bacteria	7067217
977	2808986888	2808606387	Bacteria	5697198
978	2819613268	2818991448	Bacteria	6772224
979	2819643736	2818991453	Bacteria	7181617
980	2821123143	2821123053	Bacteria	7836056
981	2821450321	2821443989	Bacteria	7658172
982	2837651672	2837651117	Bacteria	3772164
983	2837682365	2837678835	Bacteria	5252418
984	2838020882	2838016132	Bacteria	6577831
985	2838026789	2838022645	Bacteria	6494267
986	2838034305	2838029111	Bacteria	6603031
987	2838039638	2838035591	Bacteria	7166484
988	2838052975	2838048938	Bacteria	6044578
989	2838064767	2838061910	Bacteria	6794874
990	2838070457	2838068647	Bacteria	6208656
991	2838074797	2838074704	Bacteria	6785777
992	2838081050	2838074704	Bacteria	6785777
993	2838663909	2838661181	Bacteria	7385261
994	2838672593	2838668709	Bacteria	6671819
995	2838689900	2838686498	Bacteria	7807632
996	2838705084	2838701080	Bacteria	6669771
997	2838731404	2838729681	Bacteria	7400765
998	2838739833	2838736955	Bacteria	5760694
999	2838744345	2838742623	Bacteria	7396178
1000	2839993542	2839993093	Bacteria	5512535
1001	2840766558	2840764183	Bacteria	6358399
1002	2841735959	2841734538	Bacteria	6784580
1003	2841737928	2841734538	Bacteria	6784580
1004	2841844044	2841840854	Bacteria	5761912
1005	2841852885	2841851746	Bacteria	7532261
1006	2841870268	2841864319	Bacteria	6742987
1007	2842112808	2842110456	Bacteria	7656360
1008	2842143765	2842140634	Bacteria	5759631
1009	2842150078	2842146304	Bacteria	5957337
1010	2842160212	2842156927	Bacteria	6894975
1011	2842165810	2842163707	Bacteria	6916235
1012	2842184122	2842180545	Bacteria	6888678
1013	2842196427	2842192696	Bacteria	6147454
1014	2842202494	2842198810	Bacteria	6608673
1015	2842208849	2842205361	Bacteria	6340321
1016	2842219486	2842217011	Bacteria	7497767
1017	2842231704	2842229732	Bacteria	7475766
1018	2842245827	2842243621	Bacteria	7421798
1019	2842254764	2842250916	Bacteria	6579627
1020	2842260205	2842257432	Bacteria	7401195
1021	2842267086	2842264693	Bacteria	6472963
1022	2842273616	2842271015	Bacteria	7807131
1023	2842282461	2842278818	Bacteria	6340002
1024	2842290000	2842285085	Bacteria	6011953
1025	2842303489	2842298080	Bacteria	6123127
1026	2842308532	2842304105	Bacteria	7023636
1027	2842312159	2842311132	Bacteria	6616990
1028	2842321758	2842317721	Bacteria	6793725
1029	2842344719	2842341865	Bacteria	7003929
1030	2842362760	2842357229	Bacteria	6485165
1031	2842367706	2842363717	Bacteria	6844742
1032	2842397905	2842395702	Bacteria	6780583
1033	2842407609	2842402390	Bacteria	6681310
1034	2842414240	2842409023	Bacteria	6687331
1035	2842420900	2842415677	Bacteria	6596907
1036	2842424071	2842422224	Bacteria	6239196
1037	2842431218	2842428310	Bacteria	6767288
1038	2842437553	2842434925	Bacteria	6502746
1039	2842444368	2842441272	Bacteria	6769273
1040	2842451207	2842447887	Bacteria	6754142
1041	2842465361	2842462802	Bacteria	6588055
1042	2842472170	2842469257	Bacteria	6752936
1043	2842481051	2842475841	Bacteria	6603183
1044	2842487739	2842482326	Bacteria	7212537
1045	2842494046	2842489311	Bacteria	6620893
1046	2842501307	2842495871	Bacteria	6820686
1047	2842507817	2842502639	Bacteria	6604161
1048	2842515307	2842509118	Bacteria	6850950
1049	2842874965	2842871566	Bacteria	4827117
1050	2842922774	2842922631	Bacteria	5824079
1051	2844002619	2844002411	Bacteria	7168230
1052	2844003995	2844002411	Bacteria	7168230
1053	2844010275	2844009547	Bacteria	6728125
1054	2844456648	2844454524	Bacteria	7952546
1055	2847673045	2847670302	Bacteria	6165597
1056	2847674207	2847670302	Bacteria	6165597
1057	2847688812	2847686936	Bacteria	6278406
1058	2847689562	2847686936	Bacteria	6278406
1059	2852387693	2852387548	Bacteria	8025568
1060	2854920715	2854916844	Bacteria	5725939
1061	2856317876	2856314179	Bacteria	6477897
1062	2856319922	2856314179	Bacteria	6477897
1063	2856321283	2856320880	Bacteria	7263508
1064	2856321812	2856320880	Bacteria	7263508
1065	2856331914	2856328259	Bacteria	6528202
1066	2856336258	2856334872	Bacteria	7037011
1067	2856348745	2856342000	Bacteria	7176905
1068	2856351158	2856349417	Bacteria	6230045
1069	2856357449	2856356410	Bacteria	6297484
1070	2856366300	2856364286	Bacteria	6939991
1071	2856371373	2856364286	Bacteria	6939991
1072	2857349957	2857349434	Bacteria	7926032
1073	2857357013	2857349434	Bacteria	7926032
1074	2857375135	2857367948	Bacteria	6965560
1075	2857520945	2857516855	Bacteria	7787325
1076	2857533904	2857531043	Bacteria	6754041
1077	2869167558	2869162929	Bacteria	6399702
1078	2869173726	2869169390	Bacteria	6659796
1079	2869247209	2869242130	Bacteria	6609239
1080	2869250830	2869249662	Bacteria	6868783
1081	2869268941	2869264136	Bacteria	6880765
1082	2869279989	2869278585	Bacteria	7077053
1083	2869281866	2869278585	Bacteria	7077053
1084	2869288289	2869285874	Bacteria	6901219
1085	2869292596	2869285874	Bacteria	6901219
1086	2871429411	2871429161	Bacteria	6547891
1087	2871443296	2871435913	Bacteria	6880295
1088	2871446604	2871444079	Bacteria	6423508
1089	2871458562	2871451962	Bacteria	7336357
1090	2871467284	2871466892	Bacteria	6923287
1091	2871474442	2871466892	Bacteria	6923287
1092	2871476555	2871474448	Bacteria	6806570
1093	2871479609	2871474448	Bacteria	6806570
1094	2871490539	2871488783	Bacteria	6929816
1095	2871490924	2871488783	Bacteria	6929816
1096	2871498167	2871495908	Bacteria	6935695
1097	2871499508	2871495908	Bacteria	6935695
1098	2874106422	2874102143	Bacteria	6342645
1099	2874107485	2874102143	Bacteria	6342645
1100	2874115377	2874109183	Bacteria	6517025
1101	2874122321	2874116593	Bacteria	6674494
1102	2874124597	2874123672	Bacteria	7238285
1103	2874131309	2874123672	Bacteria	7238285
1104	2874133620	2874131515	Bacteria	6820270
1105	2874140290	2874139085	Bacteria	7021506
1106	2874145825	2874139085	Bacteria	7021506
1107	2874151922	2874146452	Bacteria	7533118
1108	2874154318	2874146452	Bacteria	7533118
1109	2874159555	2874155637	Bacteria	6724144
1110	2874161819	2874155637	Bacteria	6724144
1111	2874162893	2874162495	Bacteria	6174670
1112	2874163320	2874162495	Bacteria	6174670
1113	2874171540	2874168670	Bacteria	8062617
1114	2874171884	2874168670	Bacteria	8062617
1115	2876363401	2876363079	Bacteria	6544991
1116	2876365926	2876363079	Bacteria	6544991
1117	2876373202	2876369609	Bacteria	6807521
1118	2876383867	2876377896	Bacteria	6565995
1119	2876396678	2876392853	Bacteria	6660880
1120	2876397474	2876392853	Bacteria	6660880
1121	2876405284	2876399893	Bacteria	6927900
1122	2876408565	2876406927	Bacteria	6191900
1123	2876417973	2876413966	Bacteria	6831344
1124	2876420001	2876413966	Bacteria	6831344
1125	2878035655	2878035449	Bacteria	6555736
1126	2878041275	2878035449	Bacteria	6555736
1127	2878736326	2878730984	Bacteria	6380721
1128	2878740472	2878738818	Bacteria	7136951
1129	2878741628	2878738818	Bacteria	7136951
1130	2878749800	2878745973	Bacteria	6867388
1131	2878752939	2878745973	Bacteria	6867388
1132	2878755328	2878753008	Bacteria	6922523
1133	2878759399	2878753008	Bacteria	6922523
1134	2878762389	2878760144	Bacteria	6823465
1135	2878763698	2878760144	Bacteria	6823465
1136	2878769356	2878767105	Bacteria	6898628
1137	2878770696	2878767105	Bacteria	6898628
1138	2878774641	2878774303	Bacteria	6108671
1139	2878784792	2878781027	Bacteria	6834456
1140	2878789183	2878788777	Bacteria	6567085
1141	2881147747	2881147464	Bacteria	7779814
1142	2881148963	2881147464	Bacteria	7779814
1143	2881158839	2881155292	Bacteria	6461656
1144	2881160203	2881155292	Bacteria	6461656
1145	2881163923	2881161766	Bacteria	7127907
1146	2881164523	2881161766	Bacteria	7127907
1147	2881165793	2881161766	Bacteria	7127907
1148	2881850735	2881845957	Bacteria	6611900
1149	2881852018	2881845957	Bacteria	6611900
1150	2881854542	2881853255	Bacteria	6698367
1151	2881856693	2881853255	Bacteria	6698367
1152	2882634942	2882632389	Bacteria	8154593
1153	2882637221	2882632389	Bacteria	8154593
1154	2882916196	2882912400	Bacteria	6801539
1155	2882918221	2882912400	Bacteria	6801539
1156	2885305271	2885305155	Bacteria	7348390
1157	2885306385	2885305155	Bacteria	7348390
1158	2885314581	2885312484	Bacteria	6415165
1159	2885315317	2885312484	Bacteria	6415165
1160	2885319702	2885318864	Bacteria	6729568
1161	2885330462	2885326080	Bacteria	7134805
1162	2885337660	2885334103	Bacteria	7216818
1163	2885340658	2885334103	Bacteria	7216818
1164	2885346164	2885342637	Bacteria	7011821
1165	2885351717	2885350715	Bacteria	6787678
1166	2885354848	2885350715	Bacteria	6787678
1167	2888337489	2888337043	Bacteria	6629336
1168	2888343931	2888343758	Bacteria	6611049
1169	2888349624	2888343758	Bacteria	6611049
1170	2888351637	2888350351	Bacteria	7372807
1171	2888352631	2888350351	Bacteria	7372807
1172	2888354009	2888350351	Bacteria	7372807
1173	2889014408	2889010040	Bacteria	6749192
1174	2889015720	2889010040	Bacteria	6749192
1175	2889019229	2889016732	Bacteria	6700763
1176	2889020606	2889016732	Bacteria	6700763
1177	2894653488	2894652903	Bacteria	4587256
1178	2899808312	2899803654	Bacteria	5577784
1179	2899849010	2899845264	Bacteria	5672268
1180	2903454522	2903448605	Bacteria	7357801
1181	2903495038	2903492973	Bacteria	13473544
1182	2903495688	2903492973	Bacteria	13473544
1183	2903499191	2903492973	Bacteria	13473544
1184	2903505688	2903492973	Bacteria	13473544
1185	2903525351	2903521522	Bacteria	6525694
1186	2903526097	2903521522	Bacteria	6525694
1187	2903531288	2903528002	Bacteria	6586099
1188	2903531904	2903528002	Bacteria	6586099
1189	2903542964	2903540706	Bacteria	7062119
1190	2903544313	2903540706	Bacteria	7062119
1191	2904579795	2904578770	Bacteria	5302906
1192	2904663455	2904659560	Bacteria	6685615
1193	2904664228	2904659560	Bacteria	6685615
1194	2906310838	2906308376	Bacteria	6841989
1195	2906315330	2906308376	Bacteria	6841989
1196	2906321586	2906321335	Bacteria	6579571
1197	2906329310	2906328253	Bacteria	6585166
1198	2906334425	2906328253	Bacteria	6585166
1199	2906354794	2906354277	Bacteria	6991324
1200	2906357532	2906354277	Bacteria	6991324
1201	2906374251	2906370794	Bacteria	6881062
1202	2906385063	2906378014	Bacteria	6911440
1203	2906388868	2906386501	Bacteria	5977019
1204	2906396246	2906393657	Bacteria	6790866
1205	2906401648	2906401398	Bacteria	6693206
1206	2906409327	2906408224	Bacteria	6162342
1207	2906412383	2906408224	Bacteria	6162342
1208	2906417941	2906414383	Bacteria	6580790
1209	2906420698	2906414383	Bacteria	6580790
1210	2906435198	2906427513	Bacteria	6375796
1211	2909046675	2909042592	Bacteria	6499737
1212	2913298469	2913295892	Bacteria	6333755
1213	2913298547	2913295892	Bacteria	6333755
1214	2915650889	2915650412	Bacteria	4288180
1215	2919120535	2919119836	Bacteria	5208557
1216	2919166562	2919166419	Bacteria	4952238
1217	2919172564	2919171160	Bacteria	6499771
1218	2919414078	2919408235	Bacteria	6149349
1219	2920764014	2920760137	Bacteria	7427611
1220	2922131875	2922130491	Bacteria	7173936
1221	2922135683	2922130491	Bacteria	7173936
1222	2922152923	2922151315	Bacteria	6902399
1223	2922159450	2922158528	Bacteria	6573167
1224	2922159994	2922158528	Bacteria	6573167
1225	2922175719	2922172374	Bacteria	6167644
1226	2922176609	2922172374	Bacteria	6167644
1227	2922189461	2922185730	Bacteria	7113964
1228	2923561736	2923556063	Bacteria	6793593
1229	2924716845	2924710171	Bacteria	6752351
1230	2924722192	2924718760	Bacteria	6331356
1231	2924727600	2924726620	Bacteria	6271473
1232	2924730970	2924726620	Bacteria	6271473
1233	2924736840	2924733363	Bacteria	7574837
1234	2924741075	2924733363	Bacteria	7574837
1235	2924753677	2924748358	Bacteria	6154725
1236	2924757507	2924754689	Bacteria	6774424
1237	2924763649	2924762789	Bacteria	6561353
1238	2924766380	2924762789	Bacteria	6561353
1239	2924778073	2924776078	Bacteria	7492003
1240	2924779311	2924776078	Bacteria	7492003
1241	2924787206	2924784321	Bacteria	7416538
1242	2924791689	2924784321	Bacteria	7416538
1243	2926761984	2926760298	Bacteria	5505990
1244	2928522546	2928521798	Bacteria	4960112
1245	2929200115	2929199973	Bacteria	7260745
1246	2933021255	2933016740	Bacteria	6355406
1247	2933574981	2933570622	Bacteria	7023390
1248	2933588302	2933586486	Bacteria	7667493
1249	2933601261	2933599457	Bacteria	5858799
1250	2935902265	2935901341	Bacteria	7341747
1251	2936385195	2936381700	Bacteria	7006523
1252	2937817663	2937813078	Bacteria	7783518
1253	2937821873	2937813078	Bacteria	7783518
1254	2937826116	2937822353	Bacteria	7290551
1255	2937829575	2937822353	Bacteria	7290551
1256	2937837242	2937836603	Bacteria	6811263
1257	2937840973	2937836603	Bacteria	6811263
1258	2937848304	2937843397	Bacteria	5256375
1259	2937849666	2937848649	Bacteria	6983481
1260	2937854820	2937848649	Bacteria	6983481
1261	2937872884	2937868953	Bacteria	6639878
1262	2937877867	2937877337	Bacteria	7246526
1263	2937878663	2937877337	Bacteria	7246526
1264	2937897711	2937891427	Bacteria	6357007
1265	2937898250	2937891427	Bacteria	6357007
1266	2937973860	2937972304	Bacteria	7532020
1267	2937979346	2937972304	Bacteria	7532020
1268	2937982920	2937980651	Bacteria	6517427
1269	2937996817	2937994558	Bacteria	7036190
1270	2937998157	2937994558	Bacteria	7036190
1271	2938016239	2938014810	Bacteria	6700592
1272	2954014057	2954011201	Bacteria	4762601
1273	2958035855	2958034702	Bacteria	6989922
1274	2958036760	2958034702	Bacteria	6989922
1275	2958045161	2958041894	Bacteria	13082850
1276	2958046833	2958041894	Bacteria	13082850
1277	2958056562	2958041894	Bacteria	13082850
1278	2958068170	2958064165	Bacteria	7158582
1279	2958068977	2958064165	Bacteria	7158582
1280	2958073840	2958071322	Bacteria	6815895
1281	2958076175	2958071322	Bacteria	6815895
1282	2958084977	2958084443	Bacteria	7312792
1283	2958085817	2958084443	Bacteria	7312792
1284	2958093587	2958092219	Bacteria	6861151
1285	2958103392	2958100919	Bacteria	6800575
1286	2958103941	2958100919	Bacteria	6800575
1287	2958115345	2958115193	Bacteria	6923548
1288	2958119551	2958115193	Bacteria	6923548
1289	2958121779	2958115193	Bacteria	6923548
1290	2958126224	2958122699	Bacteria	7280457
1291	2958132689	2958130278	Bacteria	6897202
1292	2958136996	2958130278	Bacteria	6897202
1293	2958140360	2958137437	Bacteria	6050276
1294	2958146261	2958144490	Bacteria	6677056
1295	2958167286	2958165035	Bacteria	6906348
1296	2958168632	2958165035	Bacteria	6906348
1297	2958173976	2958172287	Bacteria	6716688
1298	2958178166	2958172287	Bacteria	6716688
1299	2958182503	2958179912	Bacteria	6874908
1300	2958186879	2958179912	Bacteria	6874908
1301	2961080348	2961077736	Bacteria	7079850
1302	2961085380	2961077736	Bacteria	7079850
1303	2961118480	2961114664	Bacteria	6680456
1304	2961118632	2961114664	Bacteria	6680456
1305	2961129044	2961127735	Bacteria	7196641
1306	2961140097	2961136820	Bacteria	6775228
1307	2961165759	2961163497	Bacteria	6901077
1308	2961167096	2961163497	Bacteria	6901077
1309	2961172329	2961170736	Bacteria	7072258
1310	2961177586	2961170736	Bacteria	7072258
1311	2961189717	2961183825	Bacteria	6688536
1312	2963644861	2963644680	Bacteria	6530403
1313	2963650700	2963644680	Bacteria	6530403
1314	2965020577	2965018300	Bacteria	6883036
1315	2965021920	2965018300	Bacteria	6883036
1316	2965028722	2965025482	Bacteria	6532201
1317	2965034740	2965032056	Bacteria	6887443
1318	2965040622	2965040258	Bacteria	6855979
1319	2965052009	2965047637	Bacteria	6623551
1320	2965064942	2965062239	Bacteria	7412989
1321	2965068012	2965062239	Bacteria	7412989
1322	2965091266	2965089291	Bacteria	6866420
1323	2965109821	2965102966	Bacteria	6800987
1324	2965114600	2965110997	Bacteria	6693150
1325	2965124598	2965119406	Bacteria	6956431
1326	2965127108	2965119406	Bacteria	6956431
1327	2967997244	2967996073	Bacteria	6787468
1328	2968001262	2967996073	Bacteria	6787468
1329	2968007315	2968003550	Bacteria	6929263
1330	2968010563	2968003550	Bacteria	6929263
1331	2968017323	2968016561	Bacteria	7022047
1332	2968022479	2968016561	Bacteria	7022047
1333	2968085788	2968083720	Bacteria	7351627
1334	2968088863	2968083720	Bacteria	7351627
1335	2968093978	2968091066	Bacteria	6052692
1336	2968100567	2968097103	Bacteria	6107094
1337	2968114541	2968110612	Bacteria	6814636
1338	2968115367	2968110612	Bacteria	6814636
1339	2968121790	2968117919	Bacteria	6536078
1340	2968123992	2968117919	Bacteria	6536078
1341	2968130284	2968128360	Bacteria	6270294
1342	2968134255	2968128360	Bacteria	6270294
1343	2968144314	2968138860	Bacteria	6605449
1344	2968174158	2968171901	Bacteria	6894245
1345	2968175502	2968171901	Bacteria	6894245
1346	2970470680	2970469710	Bacteria	6969209
1347	2970475063	2970469710	Bacteria	6969209
1348	2970494021	2970489779	Bacteria	6517260
1349	2970496275	2970489779	Bacteria	6517260
1350	2970504924	2970503327	Bacteria	7099517
1351	2970510264	2970503327	Bacteria	7099517
1352	2970525635	2970524798	Bacteria	6840927
1353	2970539568	2970532167	Bacteria	6553173
1354	2970540700	2970540015	Bacteria	6977556
1355	2970553092	2970547951	Bacteria	6931819
1356	2970557247	2970554993	Bacteria	6814252
1357	2970558540	2970554993	Bacteria	6814252
1358	2970594586	2970593180	Bacteria	7073582
1359	2970596469	2970593180	Bacteria	7073582
1360	2970623827	2970619444	Bacteria	6986144
1361	2970628782	2970627176	Bacteria	6680862
1362	2977824468	2977821940	Bacteria	6906439
1363	2977827934	2977821940	Bacteria	6906439
1364	2977830694	2977828996	Bacteria	7007971
1365	2977849903	2977843712	Bacteria	6753583
1366	2977857848	2977851361	Bacteria	6694324
1367	2977860049	2977858184	Bacteria	6215359
1368	2977864245	2977858184	Bacteria	6215359
1369	2977870685	2977864932	Bacteria	7534097
1370	2977870772	2977864932	Bacteria	7534097
1371	2977873402	2977872689	Bacteria	7270173
1372	2977899100	2977898635	Bacteria	6675551
1373	2977911488	2977907340	Bacteria	6577984
1374	2977926014	2977922695	Bacteria	6956781
1375	2977926537	2977922695	Bacteria	6956781
1376	2977938406	2977935797	Bacteria	6252826
1377	2977940245	2977935797	Bacteria	6252826
1378	2977950225	2977942078	Bacteria	7570577
1379	2977950523	2977942078	Bacteria	7570577
1380	2977955213	2977950692	Bacteria	6893264
1381	2977977346	2977971508	Bacteria	7472917
1382	2977978086	2977971508	Bacteria	7472917
1383	2977989228	2977986579	Bacteria	6581278
1384	2977989382	2977986579	Bacteria	6581278
1385	2978972953	2978969890	Bacteria	5400756
1386	2979092748	2979089926	Bacteria	5670289
1387	2979099862	2979095461	Bacteria	5669583
1388	2979712785	2979710463	Bacteria	6785254
1389	2979717327	2979710463	Bacteria	6785254
1390	2979747784	2979742915	Bacteria	7301278
1391	2979769638	2979764755	Bacteria	6610066
1392	2979777134	2979772303	Bacteria	6618277
1393	2979784254	2979779861	Bacteria	6219781
1394	2979785852	2979779861	Bacteria	6219781
1395	2979798339	2979793036	Bacteria	6808957
1396	2979809562	2979808191	Bacteria	7179355
1397	2979815137	2979808191	Bacteria	7179355
1398	2984591201	2984587000	Bacteria	5263363
1399	2987637059	2987636660	Bacteria	8088555
1400	2987644292	2987636660	Bacteria	8088555
1401	2987651660	2987645492	Bacteria	6117018
1402	2987652666	2987652177	Bacteria	6969023
1403	2987653890	2987652177	Bacteria	6969023
1404	2987661764	2987659509	Bacteria	6966464
1405	2987663108	2987659509	Bacteria	6966464
1406	2987668286	2987666974	Bacteria	6509233
1407	2987668294	2987666974	Bacteria	6509233
1408	2987674033	2987673487	Bacteria	6884027
1409	2987679350	2987673487	Bacteria	6884027
1410	2989774588	2989771324	Bacteria	5605128
1411	2989776956	2989776772	Bacteria	4843317
1412	2996316120	2996310559	Bacteria	6357320
1413	2996336832	2996336353	Bacteria	5511628
1414	2996345474	2996341866	Bacteria	6643098
1415	2996349111	2996348954	Bacteria	7239054
1416	2996353513	2996348954	Bacteria	7239054
1417	3000136756	3000135777	Bacteria	6891109
1418	3002141899	3002141150	Bacteria	5254435
1419	3004172669	3004167301	Bacteria	8330599
1420	3004190814	3004188549	Bacteria	6952365
1421	3004192160	3004188549	Bacteria	6952365
1422	3004201046	3004195979	Bacteria	6776956
1423	3004208442	3004203850	Bacteria	7307914
1424	3004209848	3004203850	Bacteria	7307914
1425	3004214367	3004211236	Bacteria	7417683
1426	3004216559	3004211236	Bacteria	7417683
1427	3004218770	3004218560	Bacteria	7421728
1428	3004222943	3004218560	Bacteria	7421728
1429	3004245351	3004239961	Bacteria	6892290
1430	3004253044	3004248173	Bacteria	6563236
1431	3004270927	3004268573	Bacteria	7043476
1432	3004272906	3004268573	Bacteria	7043476
1433	3004275823	3004275668	Bacteria	7114440
1434	3004280193	3004275668	Bacteria	7114440
1435	3004290425	3004289098	Bacteria	6135450
1436	3004337927	3004334049	Bacteria	8449246
1437	3004341474	3004334049	Bacteria	8449246
1438	3005410540	3005409236	Bacteria	7188837
1439	3005419255	3005416602	Bacteria	7064308
1440	3005456219	3005452660	Bacteria	5889319
1441	637077489	637000159	Bacteria	7596297
1442	637078139	637000159	Bacteria	7596297
1443	639646009	639633055	Bacteria	7751309
1444	649870053	649633066	Bacteria	6690028
1445	649875483	649633066	Bacteria	6690028
1446	650738578	650716007	Bacteria	5573770
1447	8002287142	8002285264	Bacteria	6717907
1448	8002290756	8002285264	Bacteria	6717907
1449	8004303421	8004300914	Bacteria	6132239
1450	8004314290	8004312739	Bacteria	7444653
1451	8004367911	8004361976	Bacteria	6858373
1452	8004376908	8004374579	Bacteria	6898112
1453	8004380910	8004374579	Bacteria	6898112
1454	8004390074	8004387939	Bacteria	7049250
1455	8004395270	8004387939	Bacteria	7049250
1456	8004402514	8004395343	Bacteria	6620908
1457	8004402966	8004395343	Bacteria	6620908
1458	8004449321	8004445564	Bacteria	6322258
1459	8004450465	8004445564	Bacteria	6322258
1460	8004633489	8004633249	Bacteria	6723080
1461	8004634794	8004633249	Bacteria	6723080
1462	8004644449	8004640170	Bacteria	6723001
1463	8004697669	8004695233	Bacteria	6731676
1464	8004707136	8004703790	Bacteria	8006957
1465	8004712622	8004703790	Bacteria	8006957
1466	8004714103	8004703790	Bacteria	8006957
1467	8004721591	8004714634	Bacteria	6776161
1468	8004729248	8004727605	Bacteria	6643904
1469	8005248017	8005246636	Bacteria	4933972
1470	8005278235	8005275841	Bacteria	6929066
1471	8005282737	8005282627	Bacteria	6675747
1472	8005291703	8005289223	Bacteria	6634003
1473	8005305422	8005301065	Bacteria	6614431
1474	8005310195	8005307578	Bacteria	7395396
1475	8005317589	8005314921	Bacteria	7072929
1476	8005384165	8005382845	Bacteria	6732062
1477	8005399557	8005395548	Bacteria	6806915
1478	8005432315	8005430974	Bacteria	6689030
1479	8005465470	8005460587	Bacteria	7157962
1480	8005489308	8005484373	Bacteria	6297373
1481	8005498046	8005497431	Bacteria	6477605
1482	8005543090	8005542996	Bacteria	7077758
1483	8005559916	8005556819	Bacteria	6908598
1484	8005564588	8005563573	Bacteria	7153261
1485	8005571278	8005570704	Bacteria	6957481
1486	8005619260	8005619151	Bacteria	7030230
1487	8005627821	8005626139	Bacteria	6534237
1488	8005645441	8005645114	Bacteria	6950293
1489	8005661586	8005658619	Bacteria	4500593
1490	8005669454	8005668836	Bacteria	6953162
1491	8005687701	8005682033	Bacteria	6726518
1492	8005692826	8005688590	Bacteria	6610080
1493	8005701533	8005695170	Bacteria	6912330
1494	8018132480	8018127388	Bacteria	7351159
1495	8018151081	8018150411	Bacteria	5549903
1496	8018167664	8018163183	Bacteria	7277977
1497	8018176677	8018176218	Bacteria	6896178
1498	8023681329	8023680758	Bacteria	7729763
1499	8024481839	8024479707	Bacteria	6954785
1500	8024506277	8024501048	Bacteria	6427847
1501	8046771549	8046767195	Bacteria	7547379
1502	8055433733	8055431914	Bacteria	4551896
1503	8055617453	8055617313	Bacteria	7548464
1504	8055624153	8055617313	Bacteria	7548464
1505	8055912250	8055909800	Bacteria	7278581
1506	8056381251	8056375014	Bacteria	7006639
1507	8056382738	8056382006	Bacteria	6408074
1508	8056878594	8056875544	Bacteria	4355797
1509	8057577864	8057575449	Bacteria	7367519
1510	8057877178	8057874678	Bacteria	7494653
1511	JGI24740J21852_10003587
1512	JGI24740J21852_10010947
1513	JGI24740J21852_10016869
1514	JGI25156J39149_1000095
1515	JGI25162J39368_1001577
1516	JGI25162J39368_1001625
1517	JGI25154J39366_1000560
1518	JGI25157J39369_1000216
1519	JGI25157J39369_1001318
1520	JGI25150J39212_1000203
1521	JGI25159J45721_1000278
1522	JGI25151J46595_10000439
1523	JGI25151J46595_10002873
1524	JGI25151J46595_10011724
1525	JGI25406J46586_10000015
1526	JGI25406J46586_10034543
1527	JGI25165J46597_1000019
1528	JGI25165J46597_1001566
1529	JGI25165J46597_1004099
1530	JGI25153J46596_10002927
1531	JGI25153J46596_10025491
1532	JGI25153J46596_10026732
1533	rootH1_10025987
1534	JGI25160J50197_1000326
1535	JGI25160J50197_1001685
1536	JGI25160J50197_1003176
1537	JGI25160J50197_1012952
1538	JGI25160J50197_1025431
1539	JGI25161J50226_1000244
1540	Ga0006562J51391_1007721
1541	Ga0055539_1003331
1542	Ga0055542_1000777
1543	Ga0055529_1002268
1544	Ga0055526_1002554
1545	Ga0055526_1007620
1546	Ga0055524_1002068
1547	Ga0055524_1009647
1548	Ga0055524_1015115
1549	Ga0055528_1001428
1550	Ga0055528_1004890
1551	Ga0055528_1011160
1552	Ga0055540_1002547
1553	Ga0055540_1019061
1554	Ga0055543_1000114
1555	Ga0055543_1000187
1556	Ga0065165_1000511
1557	Ga0065165_1001605
1558	Ga0065165_1002373
1559	Ga0070658_10028613
1560	Ga0070683_100018901
1561	Ga0070670_100000427
1562	Ga0070670_100209235
1563	Ga0070677_10023499
1564	Ga0070666_10026321
1565	Ga0070680_100026103
1566	Ga0070682_100211426
1567	Ga0070668_100127996
1568	Ga0070669_100116613
1569	Ga0070675_100108246
1570	Ga0070671_100020442
1571	Ga0070688_100051439
1572	Ga0070709_10034404
1573	Ga0070709_10063672
1574	Ga0070714_100026488
1575	Ga0070713_100363160
1576	Ga0070711_100037883
1577	Ga0070711_100321597
1578	Ga0070694_100009711
1579	Ga0070678_100003875
1580	Ga0070685_10009072
1581	Ga0068853_100016763
1582	Ga0068853_100226231
1583	Ga0070672_100150550
1584	Ga0070665_100000937
1585	Ga0070665_100017127
1586	Ga0070665_100021730
1587	Ga0070665_100109571
1588	Ga0070665_100148188
1589	Ga0070665_100223858
1590	Ga0070664_100131819
1591	Ga0068857_100234209
1592	Ga0068854_100229549
1593	Ga0068856_100000585
1594	Ga0068852_100027156
1595	Ga0068864_100032695
1596	Ga0068861_100118035
1597	Ga0068863_100201754
1598	Ga0068860_100164683
1599	Ga0081455_10000559
1600	Ga0081455_10007724
1601	Ga0081540_1000034
1602	Ga0081540_1035672
1603	Ga0081540_1085848
1604	Ga0081539_10000064
1605	Ga0081539_10000429
1606	Ga0075365_10003247
1607	Ga0075365_10004697
1608	Ga0075365_10008954
1609	Ga0075365_10010651
1610	Ga0075365_10023237
1611	Ga0075365_10026369
1612	Ga0075365_10027279
1613	Ga0075365_10030629
1614	Ga0075365_10063458
1615	Ga0075365_10178272
1616	Ga0075368_10032653
1617	Ga0075363_100009083
1618	Ga0075363_100025278
1619	Ga0075363_100120206
1620	Ga0075364_10003131
1621	Ga0075364_10018453
1622	Ga0075364_10036352
1623	Ga0075364_10143605
1624	Ga0070715_10019146
1625	Ga0070716_100052017
1626	Ga0070712_100003003
1627	Ga0075362_10017119
1628	Ga0075367_10001390
1629	Ga0075367_10001874
1630	Ga0075367_10016557
1631	Ga0075367_10028216
1632	Ga0075367_10029486
1633	Ga0075367_10040804
1634	Ga0075367_10052924
1635	Ga0075369_10002052
1636	Ga0075369_10016510
1637	Ga0075369_10052102
1638	Ga0075366_10000883
1639	Ga0075366_10006147
1640	Ga0075370_10019600
1641	Ga0075370_10094706
1642	Ga0075370_10105199
1643	Ga0075428_100046349
1644	Ga0075430_100134560
1645	Ga0075430_100251476
1646	Ga0075434_100000437
1647	Ga0075429_100003731
1648	Ga0075429_100138666
1649	Ga0075436_100156462
1650	Ga0079104_1000082
1651	Ga0075435_100010838
1652	Ga0105244_10053101
1653	Ga0105240_10000310
1654	Ga0105240_10014635
1655	Ga0105240_10019620
1656	Ga0105240_10402800
1657	Ga0111539_10133814
1658	Ga0111539_10203145
1659	Ga0105245_10492832
1660	Ga0105245_10570515
1661	Ga0105247_10010489
1662	Ga0105247_10133748
1663	Ga0114129_10025349
1664	Ga0105241_10177898
1665	Ga0105248_10006268
1666	Ga0105237_10003525
1667	Ga0105237_10012619
1668	Ga0105237_10290127
1669	Ga0105238_10000400
1670	Ga0105238_10134327
1671	Ga0105238_10167106
1672	Ga0123341_1000017
1673	Ga0123342_1019278
1674	Ga0123342_1021091
1675	Ga0105239_10036377
1676	Ga0105239_10071354
1677	Ga0105239_10221286
1678	Ga0105239_10385611
1679	Ga0105246_10464036
1680	Ga0157373_10003148
1681	Ga0157373_10015568
1682	Ga0157371_10000004
1683	Ga0157370_10001986
1684	Ga0157370_10003450
1685	Ga0157369_10035975
1686	Ga0157369_10090493
1687	Ga0157378_10207015
1688	Ga0157375_10328219
1689	Ga0163163_10072174
1690	Ga0163163_10404620
1691	Ga0157379_10275357
1692	Ga0157376_10072161
1693	Ga0182007_10001142
1694	Ga0182005_1042150
1695	Ga0183363_1300
1696	Ga0214544_1000652
1697	Ga0214542_1000146
1698	Ga0214542_1001787
1699	Ga0214543_1000054
1700	Ga0214543_1001073
1701	Ga0209435_100049
1702	Ga0209672_103567
1703	Ga0209672_110444
1704	Ga0209563_101326
1705	Ga0209437_100376
1706	Ga0209437_100448
1707	Ga0209437_102855
1708	Ga0207425_1000052
1709	Ga0209646_1000159
1710	Ga0209646_1011320
1711	Ga0209026_1000013
1712	Ga0209026_1000183
1713	Ga0209677_101202
1714	Ga0209677_101282
1715	Ga0209148_1000032
1716	Ga0209148_1000170
1717	Ga0209759_1000206
1718	Ga0209759_1000241
1719	Ga0209759_1019695
1720	Ga0209129_1000446
1721	Ga0209129_1000512
1722	Ga0209129_1001160
1723	Ga0209129_1004136
1724	Ga0209233_1000034
1725	Ga0209233_1000368
1726	Ga0209233_1000423
1727	Ga0209233_1000458
1728	Ga0209233_1004030
1729	Ga0209233_1010496
1730	Ga0209233_1018820
1731	Ga0209233_1029363
1732	Ga0209455_1000168
1733	Ga0209455_1001123
1734	Ga0209673_1000358
1735	Ga0209673_1000526
1736	Ga0209673_1007086
1737	Ga0209673_1011728
1738	Ga0209673_1022460
1739	Ga0209130_1000377
1740	Ga0209676_1006407
1741	Ga0209025_1000144
1742	Ga0209025_1000274
1743	Ga0209025_1004395
1744	Ga0209564_1002120
1745	Ga0209564_1002146
1746	Ga0209758_1000519
1747	Ga0209758_1000753
1748	Ga0209758_1003023
1749	Ga0209758_1003885
1750	Ga0209758_1006823
1751	Ga0209758_1015415
1752	Ga0209758_1033121
1753	Ga0209050_1001979
1754	Ga0209256_1003426
1755	Ga0209256_1003678
1756	Ga0209256_1007818
1757	Ga0207426_1000142
1758	Ga0207426_1000330
1759	Ga0207426_1000608
1760	Ga0207426_1000804
1761	Ga0207426_1002121
1762	Ga0209051_1000170
1763	Ga0209051_1004553
1764	Ga0209051_1009521
1765	Ga0209257_1005926
1766	Ga0209257_1028191
1767	Ga0209257_1032207
1768	Ga0207656_10036597
1769	Ga0207682_10000660
1770	Ga0207680_10034614
1771	Ga0207647_10007695
1772	Ga0207685_10033504
1773	Ga0207699_10031828
1774	Ga0207645_10019410
1775	Ga0207643_10024343
1776	Ga0207654_10120991
1777	Ga0207695_10000107
1778	Ga0207695_10000403
1779	Ga0207695_10053440
1780	Ga0207695_10245547
1781	Ga0207671_10000277
1782	Ga0207671_10009176
1783	Ga0207671_10261211
1784	Ga0207693_10013931
1785	Ga0207663_10284490
1786	Ga0207657_10112401
1787	Ga0207681_10096982
1788	Ga0207694_10001476
1789	Ga0207694_10387283
1790	Ga0207650_10000775
1791	Ga0207650_10131296
1792	Ga0207659_10107062
1793	Ga0207664_10028168
1794	Ga0207644_10017690
1795	Ga0207709_10088402
1796	Ga0207709_10396435
1797	Ga0207669_10001111
1798	Ga0207665_10040215
1799	Ga0207691_10012880
1800	Ga0207691_10173474
1801	Ga0207711_10092309
1802	Ga0207667_10154388
1803	Ga0207651_10168056
1804	Ga0207668_10026389
1805	Ga0207640_10186394
1806	Ga0207658_10097637
1807	Ga0207639_10058014
1808	Ga0207678_10034781
1809	Ga0207678_10083476
1810	Ga0207708_10063857
1811	Ga0207702_10002157
1812	Ga0207641_10180197
1813	Ga0207641_10212824
1814	Ga0207648_10035133
1815	Ga0207648_10327224
1816	Ga0207676_10022351
1817	Ga0207674_10022703
1818	Ga0207674_10180606
1819	Ga0207675_100042256
1820	Ga0207683_10004311
1821	Ga0207698_10047141
1822	Ga0207698_10437228
1823	Ga0209281_1000043
1824	Ga0209371_1002666
1825	Ga0209813_10021535
1826	Ga0209813_10027691
1827	Ga0268266_10001786
1828	Ga0268266_10004006
1829	Ga0268266_10038058
1830	Ga0268266_10054640
1831	Ga0268266_10061218
1832	Ga0268264_10127941
1833	Ga0307515_10029590
1834	Ga0268256_1009285
1835	Ga0265327_10030333
1836	Ga0265327_10104606
1837	Ga0307513_10021731
1838	Ga0307408_100026734
1839	Ga0307408_100050223
1840	Ga0307405_10000276
1841	Ga0307405_10250421
1842	Ga0307406_10052403
1843	Ga0307412_10006187
1844	Ga0307412_10129613
1845	Ga0307412_10132732
1846	Ga0307412_10288150
1847	Ga0307510_10011182
1848	Ga0373940_0004325
1849	Ga0373949_0005842
1850	Ga0373951_0017084
1851	Ga0373952_0010335
1852	Ga0373932_0085345
1853	Ga0373936_0005975
1854	Ga0373941_0049729
1855	Ga0373954_0050663
1856	Ga0373957_0107884
1857	Ga0373960_0094824
1858	Ga0373946_0005856
1859	Ga0373942_0016960
1860	Ga0373961_0002679
1861	Ga0373962_0004539
1862	Ga0373924_0019794
1863	Ga0373931_0007899
1864	Ga0373933_0015761
1865	Ga0373933_0061938
1866	Ga0373947_0007513
1867	Ga0373937_0000312
1868	Ga0373937_0007378
1869	Ga0316582_0122842
1870	Ga0316584_0168155
1871	Ga0373925_0097553
1872	Ga0373925_0225686
1873	Ga0395899_0000114
1874	Ga0395900_0000154
1875	Ga0395900_0003627
1876	Ga0395900_0203220
1877	Ga0395900_0310147
1878	Ga0395898_0000308
1879	Ga0395898_0010894
1880	Ga0395905_0000153
1881	Ga0395905_0016507
1882	Ga0395905_0075336
1883	Ga0395905_0105810
1884	Ga0395905_0141333
1885	Ga0436364_1318815
1886	Ga0395901_0000107
1887	Ga0395901_0011312
1888	Ga0395901_0044068
1889	Ga0436365_0061548
1890	Ga0436365_0787841
1891	Ga0436365_1836336
1892	Ga0436360_0771687
1893	Ga0436360_0956360
1894	Ga0436360_1070168
1895	Ga0436361_0109192
1896	Ga0436363_0890798
1897	Ga0436362_1177950
1898	Ga0439465_0015307
1899	Ga0439465_0025608
1900	Ga0451853_3317846
1901	Ga0439449_0025353
1902	Ga0466966_0054809
1903	Ga0466963_0054882
1904	Ga0466960_0022089
1905	Ga0466959_0005344
1906	Ga0466958_0125958
1907	Ga0495617_011352
1908	Ga0495592_0009518
1909	Ga0495629_0013843
1910	Ga0495638_0000546
1911	Ga0495638_0007050
1912	Ga0495638_0015356
1913	Ga0495651_0069607
1914	Ga0495651_0092309
1915	Ga0495653_0104339
1916	Ga0495605_0033303
1917	Ga0495605_0041179
1918	Ga0495605_0048697
1919	Ga0495664_0000781
1920	Ga0495585_0053366
1921	Ga0495606_0002266
1922	Ga0495608_0028263
1923	Ga0495610_0044759
1924	Ga0495620_0037288
1925	Ga0495628_0089652
1926	Ga0495631_0001028
1927	Ga0495632_0004447
1928	Ga0495632_0005489
1929	Ga0495643_0099765
1930	Ga0495648_0002380
1931	Ga0495666_0023150
1932	Ga0495666_0086781
1933	Ga0495652_0068189
1934	Ga0495652_0123460
1935	Ga0495654_0001020
1936	Ga0495640_0048700
1937	Ga0495640_0055328
1938	Ga0495640_0198326
1939	Ga0495587_0025343
1940	Ga0495587_0070002
1941	Ga0495587_0115214
1942	Ga0495598_0003729
1943	Ga0495645_0001100
1944	Ga0495645_0165848
1945	Ga0495667_0005370
1946	Ga0495667_0029143
1947	Ga0495667_0038537
1948	Ga0495656_0005466
1949	Ga0495668_0012816
1950	Ga0495668_0014014
1951	Ga0495668_0045721
1952	Ga0495668_0107739
1953	Ga0495634_0201545
1954	Ga0495625_0004012
1955	Ga0495625_0029317
1956	Ga0495625_0218208
1957	Ga0495635_0069029
1958	Ga0495635_0107819
1959	Ga0495635_0306949
1960	Ga0495588_0037661
1961	Ga0495657_0022921
1962	Ga0495657_0040411
1963	Ga0495657_0053913
1964	Ga0495623_0006287
1965	Ga0495623_0084564
1966	Ga0495646_0019529
1967	Ga0495613_0020499
1968	Ga0495624_0141065
1969	Ga0495671_0039265
1970	Ga0495600_0073831
1971	Ga0495600_0103626
1972	Ga0495600_0245592
1973	Ga0495604_0016156
1974	Ga0495604_0031621
1975	Ga0495604_0034993
1976	Ga0495674_0117491
1977	Ga0495674_0144681
1978	Ga0495676_0127983
1979	Ga0495676_0279233
1980	Ga0495680_0021255
1981	Ga0495687_013306
1982	Ga0495675_0008854
1983	Ga0495675_0060590
1984	Ga0495677_0078590
1985	Ga0495685_027896
1986	Ga0495684_0024439
1987	Ga0495684_0104447
1988	Ga0495684_0154654
1989	Ga0495686_0012713
1990	Ga0495686_0023696
1991	Ga0495686_0024272
1992	Ga0495686_0100313
1993	Ga0495686_0139729
1994	Ga0495602_0000195
1995	Ga0495602_0058639
1996	Ga0495602_0199048
1997	Ga0495626_0019902
1998	Ga0496102_0003654
1999	Ga0496102_0024140
2000	Ga0496102_0182758
2001	Ga0496102_0462453
2002	Ga0496103_0022188
2003	Ga0496103_0047679
2004	Ga0496103_0268440
2005	Ga0496104_0000118
2006	Ga0496104_0001078
2007	Ga0496104_0128018
2008	Ga0496104_0407258
2009	Ga0496105_0032835
2010	Ga0496105_0098145
2011	Ga0496106_0043548
2012	Ga0496108_0079602
2013	Ga0496108_0155152
2014	Ga0496108_0291705
2015	Ga0496109_0375833
2016	Ga0496110_0150382
2017	Ga0496111_0024922
2018	Ga0496112_0000015
2019	Ga0496112_0025929
2020	Ga0496112_0054660
2021	Ga0496112_0099916
2022	Ga0496113_0092530
2023	Ga0496113_0171438
2024	Ga0496114_0068843
2025	Ga0496114_0086114
2026	Ga0496114_0168414
2027	Ga0496115_0002469
2028	Ga0496115_0038418
2029	Ga0496115_0065173
2030	Ga0496115_0091906
2031	Ga0496115_0124420
2032	Ga0496115_0285987
2033	Ga0496116_0012271
2034	Ga0496116_0012404
2035	Ga0496116_0021303
2036	Ga0496117_0000002
2037	Ga0496117_0024374
2038	Ga0496117_0028575
2039	Ga0496117_0100142
2040	Ga0496118_0002959
2041	Ga0496118_0004935
2042	Ga0496118_0038318
2043	Ga0496118_0050898
2044	Ga0496118_0131098
2045	Ga0496119_0000206
2046	Ga0496119_0005715
2047	Ga0496119_0016272
2048	Ga0496119_0049901
2049	Ga0496119_0125041
2050	Ga0496120_0002005
2051	Ga0496120_0002040
2052	Ga0496120_0011499
2053	Ga0496120_0036088
2054	Ga0496121_0004266
2055	Ga0496121_0005841
2056	Ga0496121_0012228
2057	Ga0496121_0018486
2058	Ga0496121_0026291
2059	Ga0496121_0039489
2060	Ga0496121_0057208
2061	Ga0496121_0071894
2062	Ga0496121_0128560
2063	Ga0496122_0000001
2064	Ga0496122_0004983
2065	Ga0496122_0008471
2066	Ga0496122_0009610
2067	Ga0496122_0016672
2068	Ga0496122_0040292
2069	Ga0496123_0000001
2070	Ga0496123_0033814
2071	Ga0496123_0043723
2072	Ga0496123_0043953
2073	Ga0496123_0087049
2074	Ga0496124_0006759
2075	Ga0496124_0009881
2076	Ga0496124_0010264
2077	Ga0496124_0028881
2078	Ga0496124_0028883
2079	Ga0496124_0120670
2080	Ga0496124_0152628
2081	Ga0496124_0155857
2082	Ga0496125_0024228
2083	Ga0496125_0027692
2084	Ga0496125_0034809
2085	Ga0496125_0083240
2086	Ga0496125_0134774
2087	Ga0496126_0001398
2088	Ga0496126_0040266
2089	Ga0496126_0122011
2090	Ga0496126_0156015
2091	Ga0496126_0239844
2092	Ga0495678_023644
2093	Ga0501031_0000002
2094	Ga0501031_0002129
2095	Ga0501031_0010598
2096	Ga0501031_0115697
2097	Ga0501031_0189660
2098	Ga0501031_0203894
2099	Ga0501031_0305904
2100	Ga0501032_0000004
2101	Ga0501032_0006153
2102	Ga0501032_0016972
2103	Ga0501032_0025925
2104	Ga0501033_0000016
2105	Ga0501033_0000220
2106	Ga0501033_0005369
2107	Ga0501033_0015334
2108	Ga0501033_0017626
2109	Ga0501033_0025854
2110	Ga0501033_0030136
2111	Ga0501033_0059579
2112	Ga0501033_0070038
2113	Ga0501033_0124996
2114	Ga0501034_0000011
2115	Ga0501034_0001008
2116	Ga0501034_0006630
2117	Ga0501034_0013053
2118	Ga0501034_0024219
2119	Ga0501034_0043060
2120	Ga0501034_0047799
2121	Ga0501034_0073982
2122	Ga0501034_0198639
2123	Ga0501036_0000001
2124	Ga0501036_0010962
2125	Ga0501036_0041850
2126	Ga0501036_0056945
2127	Ga0501036_0074230
2128	Ga0501036_0086578
2129	Ga0501036_0194986
2130	Ga0501036_0259852
2131	Ga0501036_0390740
2132	Ga0501037_0000006
2133	Ga0501037_0000047
2134	Ga0501037_0010944
2135	Ga0501037_0184722
2136	Ga0501038_0000003
2137	Ga0501038_0002943
2138	Ga0501038_0004026
2139	Ga0501038_0020729
2140	Ga0501038_0032553
2141	Ga0501038_0047641
2142	Ga0501038_0108317
2143	Ga0501038_0118350
2144	Ga0501038_0386443
2145	Ga0501039_0000004
2146	Ga0501039_0040604
2147	Ga0501039_0048823
2148	Ga0501039_0091825
2149	Ga0501039_0107699
2150	Ga0501040_0001875
2151	Ga0501040_0003086
2152	Ga0501040_0027043
2153	Ga0501041_0000262
2154	Ga0501042_0005258
2155	Ga0501042_0005740
2156	Ga0501043_0000032
2157	Ga0501043_0000478
2158	Ga0501043_0010226
2159	Ga0501043_0067568
2160	Ga0501043_0125179
2161	Ga0501046_0004260
2162	Ga0501046_0055374
2163	Ga0501047_0002317
2164	Ga0501047_0045808
2165	Ga0501047_0048954
2166	Ga0501047_0050306
2167	Ga0501047_0053447
2168	Ga0501047_0077795
2169	Ga0501047_0355414
2170	Ga0501048_0001501
2171	Ga0501048_0206206
2172	Ga0501067_0044086
2173	Ga0501067_0113997
2174	Ga0501068_0000789
2175	Ga0501068_0047845
2176	Ga0501068_0051467
2177	Ga0501069_0000073
2178	Ga0501069_0011383
2179	Ga0501069_0018151
2180	Ga0501070_0000160
2181	Ga0501070_0002269
2182	Ga0501070_0002837
2183	Ga0501070_0011230
2184	Ga0501070_0016814
2185	Ga0501070_0037574
2186	Ga0501070_0069679
2187	Ga0501071_0021183
2188	Ga0501071_0023477
2189	Ga0501071_0048792
2190	Ga0501071_0071142
2191	Ga0501073_0042682
2192	Ga0501073_0045155
2193	Ga0501073_0090441
2194	Ga0501073_0139125
2195	Ga0501074_0000014
2196	Ga0501074_0006040
2197	Ga0501074_0017482
2198	Ga0501074_0027418
2199	Ga0501074_0057790
2200	Ga0501075_0224094
2201	Ga0501076_0421852
2202	Ga0501077_0010921
2203	Ga0501079_0004652
2204	Ga0501079_0051297
2205	Ga0501080_0000116
2206	Ga0501080_0004455
2207	Ga0501080_0010696
2208	Ga0501080_0162298
2209	Ga0501081_0000379
2210	Ga0501083_0000062
2211	Ga0501083_0051972
2212	Ga0501083_0094931
2213	Ga0501241_004957
2214	Ga0501035_0000009
2215	Ga0501035_0000025
2216	Ga0501035_0007294
2217	Ga0501035_0009031
2218	Ga0501035_0014215
2219	Ga0501035_0034742
2220	Ga0501035_0047662
2221	Ga0501035_0056696
2222	Ga0501035_0067339
2223	Ga0501035_0089493
2224	Ga0501035_0183316
2225	Ga0501044_0000005
2226	Ga0501044_0000031
2227	Ga0501044_0003628
2228	Ga0501044_0006736
2229	Ga0501044_0019278
2230	Ga0501044_0026221
2231	Ga0501044_0050590
2232	Ga0501044_0074133
2233	Ga0501044_0200417
2234	Ga0501044_0249269
2235	Ga0501045_0007368
2236	Ga0501045_0038079
2237	Ga0501045_0054716
2238	nmdc:mga03683_6861_c1
2239	nmdc:mga03n38_84916_c1
2240	nmdc:mga00v17_10177_c1
2241	nmdc:mga00v17_102_c1
2242	nmdc:mga00v17_689_c1
2243	nmdc:mga0yw44_120223_c1
2244	nmdc:mga0yw44_1293_c1
2245	nmdc:mga0yw44_22517_c1
2246	nmdc:mga0yw44_2676_c1
2247	nmdc:mga0yw44_46843_c1
2248	nmdc:mga0yw44_9844_c1
2249	nmdc:mga0k408_41909_c1
2250	nmdc:mga06z11_76474_c1
2251	nmdc:mga06z11_8263_c1
2252	nmdc:mga06z11_95778_c1
2253	nmdc:mga04h51_22171_c1
2254	nmdc:mga04h51_97510_c1
2255	nmdc:mga07m45_38208_c1
2256	nmdc:mga07m45_55601_c1
2257	nmdc:mga05p37_13385_c1
2258	nmdc:mga05p37_181054_c1
2259	nmdc:mga09592_100534_c1
2260	nmdc:mga06r32_10904_c1
2261	nmdc:mga08y16_110729_c1
2262	nmdc:mga0n895_11019_c1
2263	nmdc:mga08x19_334583_c1
2264	nmdc:mga0sz30_223_c1
2265	nmdc:mga0sz30_54194_c1
2266	Ga0495601_0004391
2267	Ga0495601_0076815
2268	Ga0495595_0069465
2269	Ga0495619_0006464
2270	Ga0495619_0028068
2271	Ga0495619_0071105
2272	Ga0495619_0080049
2273	Ga0495619_0125907
2274	Ga0500578_0100618
2275	Ga0500643_000049
2276	Ga0500643_000792
2277	Ga0500643_021843
2278	Ga0500566_0002048
2279	Ga0500640_077862
2280	Ga0500555_002037
2281	Ga0500557_000012
2282	Ga0500557_059463
2283	Ga0500562_004658
2284	Ga0500569_007070
2285	Ga0500572_004179
2286	Ga0500572_025818
2287	Ga0500595_061703
2288	Ga0500607_024041
2289	Ga0500618_000722
2290	Ga0500618_001650
2291	Ga0500642_0000202
2292	Ga0500642_0038638
2293	Ga0500658_0033631
2294	Ga0500561_0000889
2295	Ga0500568_0000197
2296	Ga0500568_0002799
2297	Ga0500568_0045365
2298	Ga0500573_0089182
2299	Ga0500588_0016916
2300	Ga0500588_0064759
2301	Ga0500590_004449
2302	Ga0500616_0001964
2303	Ga0500616_0006715
2304	Ga0500616_0035841
2305	Ga0500616_0042003
2306	Ga0500620_003682
2307	Ga0500622_0006401
2308	Ga0500622_0010637
2309	Ga0500627_0088418
2310	Ga0500636_0000167
2311	Ga0500636_0002734
2312	Ga0500636_0222650
2313	Ga0500609_001666
2314	Ga0500599_002147
2315	Ga0500601_000550
2316	Ga0501084_0000020
2317	Ga0501084_0001278
2318	Ga0501084_0049643
2319	Ga0501084_0276443
2320	Ga0501082_0003761
2321	Ga0501082_0041914
2322	Ga0501082_0116411
2323	Ga0501082_0345432
2324	Ga0466962_0038467
2325	Ga0530510_0010460
2326	2844011705
2327	2503198182
2328	2503204279
2329	2509140189
2330	2509368228
2331	2509389055
2332	2509393107
2333	2509398614
2334	2509444641
2335	2510135611
2336	2510314518
2337	2510320155
2338	2510838928
2339	2511132124
2340	2511174431
2341	2511185534
2342	2511392061
2343	2512531013
2344	2512934337
2345	2512934920
2346	2512962680
2347	2512963281
2348	2513570774
2349	2513575013
2350	2513599542
2351	2513609646
2352	2513613085
2353	2513633796
2354	2513713050
2355	2513868515
2356	2513924215
2357	2514034433
2358	2514037276
2359	2514416682
2360	2514423449
2361	2514586428
2362	2515114775
2363	2515741240
2364	2516210044
2365	2517038390
2366	2517078669
2367	2517097411
2368	2524462131
2369	2530648401
2370	2535483955
2371	2535514454
2372	2554246120
2373	2559293343
2374	2561466643
2375	2585201417
2376	2585232322
2377	2585276386
2378	2585282445
2379	2585328591
2380	2585336108
2381	2585396453
2382	2585405074
2383	2585524016
2384	2585536584
2385	2585542179
2386	2585557205
2387	2585564186
2388	2585825119
2389	2585840625
2390	2585843586
2391	2585897318
2392	2585902953
2393	2585998347
2394	2586002910
2395	2587978472
2396	2588520498
2397	2597810645
2398	2599332502
2399	2599419832
2400	2599718589
2401	2599935615
2402	2600376802
2403	2616294016
2404	2616311557
2405	2616551689
2406	2617386431
2407	2643770297
2408	2643777341
2409	2643795789
2410	2643838051
2411	2643857459
2412	2643987066
2413	2644004220
2414	2644130451
2415	2644155491
2416	2644191105
2417	2644298104
2418	2644519691
2419	2644656356
2420	2671116359
2421	2688595484
2422	2688601005
2423	2694628378
2424	2694631433
2425	2694636678
2426	2694640765
2427	2719183277
2428	2719388034
2429	2719667652
2430	2719733994
2431	2720494072
2432	2720615535
2433	2720622318
2434	2720633672
2435	2720777372
2436	2721149389
2437	2721160792
2438	2721166226
2439	2721401667
2440	2722842396
2441	2723028970
2442	2723562586
2443	2723569279
2444	2723571840
2445	2723572705
2446	2724040481
2447	2724046750
2448	2724091979
2449	2724106544
2450	2724112351
2451	2725951964
2452	2730109906
2453	2730166512
2454	2730300424
2455	2738800664
2456	2739037414
2457	2739307596
2458	2753358511
2459	2753460032
2460	2756674433
2461	2756677679
2462	2757571525
2463	2758640741
2464	2765465899
2465	2766067221
2466	2770196558
2467	2776269339
2468	2776283522
2469	2778179374
2470	2792746694
2471	2792748644
2472	2792751638
2473	2793283148
2474	2793298402
2475	2793315757
2476	2793335584
2477	2793350342
2478	2793354712
2479	2793358591
2480	2793369047
2481	2805928966
2482	2806047141
2483	2806054860
2484	2806061912
2485	2806069565
2486	2806076064
2487	2808986888
2488	2819613268
2489	2819643736
2490	2821123143
2491	2821450321
2492	2837651672
2493	2837682365
2494	2838020882
2495	2838026789
2496	2838034305
2497	2838039638
2498	2838052975
2499	2838064767
2500	2838070457
2501	2838074797
2502	2838081050
2503	2838663909
2504	2838672593
2505	2838689900
2506	2838705084
2507	2838731404
2508	2838739833
2509	2838744345
2510	2839993542
2511	2840766558
2512	2841735959
2513	2841737928
2514	2841844044
2515	2841852885
2516	2841870268
2517	2842112808
2518	2842143765
2519	2842150078
2520	2842160212
2521	2842165810
2522	2842184122
2523	2842196427
2524	2842202494
2525	2842208849
2526	2842219486
2527	2842231704
2528	2842245827
2529	2842254764
2530	2842260205
2531	2842267086
2532	2842273616
2533	2842282461
2534	2842290000
2535	2842303489
2536	2842308532
2537	2842312159
2538	2842321758
2539	2842344719
2540	2842362760
2541	2842367706
2542	2842397905
2543	2842407609
2544	2842414240
2545	2842420900
2546	2842424071
2547	2842431218
2548	2842437553
2549	2842444368
2550	2842451207
2551	2842465361
2552	2842472170
2553	2842481051
2554	2842487739
2555	2842494046
2556	2842501307
2557	2842507817
2558	2842515307
2559	2842874965
2560	2842922774
2561	2844002619
2562	2844003995
2563	2844010275
2564	2844456648
2565	2847673045
2566	2847674207
2567	2847688812
2568	2847689562
2569	2852387693
2570	2854920715
2571	2856317876
2572	2856319922
2573	2856321283
2574	2856321812
2575	2856331914
2576	2856336258
2577	2856348745
2578	2856351158
2579	2856357449
2580	2856366300
2581	2856371373
2582	2857349957
2583	2857357013
2584	2857375135
2585	2857520945
2586	2857533904
2587	2869167558
2588	2869173726
2589	2869247209
2590	2869250830
2591	2869268941
2592	2869279989
2593	2869281866
2594	2869288289
2595	2869292596
2596	2871429411
2597	2871443296
2598	2871446604
2599	2871458562
2600	2871467284
2601	2871474442
2602	2871476555
2603	2871479609
2604	2871490539
2605	2871490924
2606	2871498167
2607	2871499508
2608	2874106422
2609	2874107485
2610	2874115377
2611	2874122321
2612	2874124597
2613	2874131309
2614	2874133620
2615	2874140290
2616	2874145825
2617	2874151922
2618	2874154318
2619	2874159555
2620	2874161819
2621	2874162893
2622	2874163320
2623	2874171540
2624	2874171884
2625	2876363401
2626	2876365926
2627	2876373202
2628	2876383867
2629	2876396678
2630	2876397474
2631	2876405284
2632	2876408565
2633	2876417973
2634	2876420001
2635	2878035655
2636	2878041275
2637	2878736326
2638	2878740472
2639	2878741628
2640	2878749800
2641	2878752939
2642	2878755328
2643	2878759399
2644	2878762389
2645	2878763698
2646	2878769356
2647	2878770696
2648	2878774641
2649	2878784792
2650	2878789183
2651	2881147747
2652	2881148963
2653	2881158839
2654	2881160203
2655	2881163923
2656	2881164523
2657	2881165793
2658	2881850735
2659	2881852018
2660	2881854542
2661	2881856693
2662	2882634942
2663	2882637221
2664	2882916196
2665	2882918221
2666	2885305271
2667	2885306385
2668	2885314581
2669	2885315317
2670	2885319702
2671	2885330462
2672	2885337660
2673	2885340658
2674	2885346164
2675	2885351717
2676	2885354848
2677	2888337489
2678	2888343931
2679	2888349624
2680	2888351637
2681	2888352631
2682	2888354009
2683	2889014408
2684	2889015720
2685	2889019229
2686	2889020606
2687	2894653488
2688	2899808312
2689	2899849010
2690	2903454522
2691	2903495038
2692	2903495688
2693	2903499191
2694	2903505688
2695	2903525351
2696	2903526097
2697	2903531288
2698	2903531904
2699	2903542964
2700	2903544313
2701	2904579795
2702	2904663455
2703	2904664228
2704	2906310838
2705	2906315330
2706	2906321586
2707	2906329310
2708	2906334425
2709	2906354794
2710	2906357532
2711	2906374251
2712	2906385063
2713	2906388868
2714	2906396246
2715	2906401648
2716	2906409327
2717	2906412383
2718	2906417941
2719	2906420698
2720	2906435198
2721	2909046675
2722	2913298469
2723	2913298547
2724	2915650889
2725	2919120535
2726	2919166562
2727	2919172564
2728	2919414078
2729	2920764014
2730	2922131875
2731	2922135683
2732	2922152923
2733	2922159450
2734	2922159994
2735	2922175719
2736	2922176609
2737	2922189461
2738	2923561736
2739	2924716845
2740	2924722192
2741	2924727600
2742	2924730970
2743	2924736840
2744	2924741075
2745	2924753677
2746	2924757507
2747	2924763649
2748	2924766380
2749	2924778073
2750	2924779311
2751	2924787206
2752	2924791689
2753	2926761984
2754	2928522546
2755	2929200115
2756	2933021255
2757	2933574981
2758	2933588302
2759	2933601261
2760	2935902265
2761	2936385195
2762	2937817663
2763	2937821873
2764	2937826116
2765	2937829575
2766	2937837242
2767	2937840973
2768	2937848304
2769	2937849666
2770	2937854820
2771	2937872884
2772	2937877867
2773	2937878663
2774	2937897711
2775	2937898250
2776	2937973860
2777	2937979346
2778	2937982920
2779	2937996817
2780	2937998157
2781	2938016239
2782	2954014057
2783	2958035855
2784	2958036760
2785	2958045161
2786	2958046833
2787	2958056562
2788	2958068170
2789	2958068977
2790	2958073840
2791	2958076175
2792	2958084977
2793	2958085817
2794	2958093587
2795	2958103392
2796	2958103941
2797	2958115345
2798	2958119551
2799	2958121779
2800	2958126224
2801	2958132689
2802	2958136996
2803	2958140360
2804	2958146261
2805	2958167286
2806	2958168632
2807	2958173976
2808	2958178166
2809	2958182503
2810	2958186879
2811	2961080348
2812	2961085380
2813	2961118480
2814	2961118632
2815	2961129044
2816	2961140097
2817	2961165759
2818	2961167096
2819	2961172329
2820	2961177586
2821	2961189717
2822	2963644861
2823	2963650700
2824	2965020577
2825	2965021920
2826	2965028722
2827	2965034740
2828	2965040622
2829	2965052009
2830	2965064942
2831	2965068012
2832	2965091266
2833	2965109821
2834	2965114600
2835	2965124598
2836	2965127108
2837	2967997244
2838	2968001262
2839	2968007315
2840	2968010563
2841	2968017323
2842	2968022479
2843	2968085788
2844	2968088863
2845	2968093978
2846	2968100567
2847	2968114541
2848	2968115367
2849	2968121790
2850	2968123992
2851	2968130284
2852	2968134255
2853	2968144314
2854	2968174158
2855	2968175502
2856	2970470680
2857	2970475063
2858	2970494021
2859	2970496275
2860	2970504924
2861	2970510264
2862	2970525635
2863	2970539568
2864	2970540700
2865	2970553092
2866	2970557247
2867	2970558540
2868	2970594586
2869	2970596469
2870	2970623827
2871	2970628782
2872	2977824468
2873	2977827934
2874	2977830694
2875	2977849903
2876	2977857848
2877	2977860049
2878	2977864245
2879	2977870685
2880	2977870772
2881	2977873402
2882	2977899100
2883	2977911488
2884	2977926014
2885	2977926537
2886	2977938406
2887	2977940245
2888	2977950225
2889	2977950523
2890	2977955213
2891	2977977346
2892	2977978086
2893	2977989228
2894	2977989382
2895	2978972953
2896	2979092748
2897	2979099862
2898	2979712785
2899	2979717327
2900	2979747784
2901	2979769638
2902	2979777134
2903	2979784254
2904	2979785852
2905	2979798339
2906	2979809562
2907	2979815137
2908	2984591201
2909	2987637059
2910	2987644292
2911	2987651660
2912	2987652666
2913	2987653890
2914	2987661764
2915	2987663108
2916	2987668286
2917	2987668294
2918	2987674033
2919	2987679350
2920	2989774588
2921	2989776956
2922	2996316120
2923	2996336832
2924	2996345474
2925	2996349111
2926	2996353513
2927	3000136756
2928	3002141899
2929	3004172669
2930	3004190814
2931	3004192160
2932	3004201046
2933	3004208442
2934	3004209848
2935	3004214367
2936	3004216559
2937	3004218770
2938	3004222943
2939	3004245351
2940	3004253044
2941	3004270927
2942	3004272906
2943	3004275823
2944	3004280193
2945	3004290425
2946	3004337927
2947	3004341474
2948	3005410540
2949	3005419255
2950	3005456219
2951	637077489
2952	637078139
2953	639646009
2954	649870053
2955	649875483
2956	650738578
2957	8002287142
2958	8002290756
2959	8004303421
2960	8004314290
2961	8004367911
2962	8004376908
2963	8004380910
2964	8004390074
2965	8004395270
2966	8004402514
2967	8004402966
2968	8004449321
2969	8004450465
2970	8004633489
2971	8004634794
2972	8004644449
2973	8004697669
2974	8004707136
2975	8004712622
2976	8004714103
2977	8004721591
2978	8004729248
2979	8005248017
2980	8005278235
2981	8005282737
2982	8005291703
2983	8005305422
2984	8005310195
2985	8005317589
2986	8005384165
2987	8005399557
2988	8005432315
2989	8005465470
2990	8005489308
2991	8005498046
2992	8005543090
2993	8005559916
2994	8005564588
2995	8005571278
2996	8005619260
2997	8005627821
2998	8005645441
2999	8005661586
3000	8005669454
3001	8005687701
3002	8005692826
3003	8005701533
3004	8018132480
3005	8018151081
3006	8018167664
3007	8018176677
3008	8023681329
3009	8024481839
3010	8024506277
3011	8046771549
3012	8055433733
3013	8055617453
3014	8055624153
3015	8055912250
3016	8056381251
3017	8056382738
3018	8056878594
3019	8057577864
3020	8057877178

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

78

326

0.96 PF00294

PfkB

pfkB family carbohydrate kinase

320

379

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4e3a-assembly1.cif.gz_A	crystal structure of probable sugar kinase protein from rhizobium etli cfn 42	0.976	1	330
3ubo-assembly1.cif.gz_B	the crystal structure of adenosine kinase from sinorhizobium meliloti	0.9721	3	328
3ubo-assembly1.cif.gz_B	the crystal structure of adenosine kinase from sinorhizobium meliloti	0.9663	3	328
1bx4-assembly1.cif.gz_A	structure of human adenosine kinase at 1.50 angstroms	0.8922	6	314
3loo-assembly2.cif.gz_B	crystal structure of anopheles gambiae adenosine kinase in complex with p1,p4-di(adenosine-5) tetraphosphate	0.8897	6	311

ID	Description	Score	Start	End	Superfamily
3uboB00	Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase	0.9715	3	328	3.40.1190.20
3uboB00	Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase	0.9656	3	328	3.40.1190.20
af_Q7XBZ0_99_432_3.40.1190.20	Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase	0.9266	3	321	3.40.1190.20
af_K7VK13_1_174_3.40.1190.20	Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase	0.8987	76	200	3.40.1190.20
af_I1MXX4_25_354_3.40.1190.20	Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase	0.8973	12	321	3.40.1190.20

ID	Description	Score	Start	End	GO Terms
AF-A0A4S0IG99-F1-model_v4	deleted	0.998	199	308
AF-A0A531JBW0-F1-model_v4	Adenosine kinase	0.9964	147	225	GO:0016301
AF-A0A439ILM4-F1-model_v4	deleted	0.9956	153	285
AF-A0A531KZL5-F1-model_v4	deleted	0.9939	130	330
AF-A0A359F550-F1-model_v4	Adenosine kinase	0.9937	209	330	GO:0016301

F494469

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00294

PfkB

pfkB family carbohydrate kinase

78

326

0.96

PF00294

PfkB

pfkB family carbohydrate kinase

320

379

0.9

Structural Annotation

Top 5 Hits

Map