F494472

General Info

Members Datasets Scaffolds Average Seq Length
1511 818 3022 378

Family's Representative Sequence

Representative Sequence 3300025919|Ga0207657_10155384|Ga0207657_101553843
Length 425
Sequence VPDGVGQPGKIDSEQFHRRRQPRFGRQGEHHVGIRLDGKPGILRDFLLELVGRPAGIAERDQYVLRPFAVTDGFDLGSGMLLPFAARNDIERRVVINSVGPVWEGNQVWLILGGGAIFAAWPQLYAVSFSGFYLAMFVILTALILRPVAFKFRSKRESPQWRARWDWVLFFSGFVPALICGVAVGNVLQGVPFRFGSDMHIFYDGGFFGLLNPFAILCGLVSVAMLVMHGASWLLLKTAGPVAERARSYGMVAAVLTIALYALAGVLLATSIGGYRISSVVDAIGPSNPMLKTVELHAGAWTANYTAHPWTWAAPAAGFVGALGALLGLALRRPVLALLAAALGIAGIILSVGASMFPFILPSSIDPRASLTVWDSSSSHLTLFIMLVVTAFFIPLIVAYTSWVYHVLWGKVDEQAIRDESGHAY

Samples

Sample ID Description Type Environment
1 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
95 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
114 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
118 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
124 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
183 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
190 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
191 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
192 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
193 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
194 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
195 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
199 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
200 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
205 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
206 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
226 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
235 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
236 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
237 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
238 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
239 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
240 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
241 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
242 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
243 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
244 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
245 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
246 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
247 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
248 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
249 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
250 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
251 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
252 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
253 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
254 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
257 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
260 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
261 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
262 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
267 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
270 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
271 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
272 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
275 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
278 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
279 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
280 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
281 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
282 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
283 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
284 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
292 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
293 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
297 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
298 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
299 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
300 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
301 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
311 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
312 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
313 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
314 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
315 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
316 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
317 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
318 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
319 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
320 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
321 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
322 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
323 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
324 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
325 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
337 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
338 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
339 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
342 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
344 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
345 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
346 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
347 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
348 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
349 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
350 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
351 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
352 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
353 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
354 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
355 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
356 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
357 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
358 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
359 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
360 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
361 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
362 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
363 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
364 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
365 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
366 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
367 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
368 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
369 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
370 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
371 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
372 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
373 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
374 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
375 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
376 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
377 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
378 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
379 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
380 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
381 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
382 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
383 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
384 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
385 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
386 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
387 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
388 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
389 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
390 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
391 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
392 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
393 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
394 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
395 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
396 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
397 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
398 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
399 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
400 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
401 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
402 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
403 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
404 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
405 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
406 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
407 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
408 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
409 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
410 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
411 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
412 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
413 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
414 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
415 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
416 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
417 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
418 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
419 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
420 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
421 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
422 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
423 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
424 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
425 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
426 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
427 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
428 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
429 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
430 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
431 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
432 2519103095 Burkholderia sp. KJ006 Isolate Nodule
433 2519899620 Rhizobium sp. Pop5 Isolate Nodule
434 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
435 2534681786 Brucella suis 92/29 Isolate Unclassified
436 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
437 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
438 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
439 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
440 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
441 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
442 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
443 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
444 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
445 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
446 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
447 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
448 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
449 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
450 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
451 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
452 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
453 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
454 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
455 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
456 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
457 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
458 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
459 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
460 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
461 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
462 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
463 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
464 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
465 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
466 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
467 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
468 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
469 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
470 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
471 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
472 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
473 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
474 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
475 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
476 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
477 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
478 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
479 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
480 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
481 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
482 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
483 2643221580 Devosia sp. Root635 Isolate Unclassified
484 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
485 2643221582 Rhizobium sp. Root651 Isolate Unclassified
486 2643221583 Caulobacter sp. Root655 Isolate Unclassified
487 2643221584 Caulobacter sp. Root656 Isolate Unclassified
488 2643221591 Devosia sp. Root685 Isolate Unclassified
489 2643221599 Rhizobium sp. Root708 Isolate Unclassified
490 2643221629 Devosia sp. Root105 Isolate Unclassified
491 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
492 2643221640 Caulobacter sp. Root342 Isolate Unclassified
493 2643221642 Caulobacter sp. Root343 Isolate Unclassified
494 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
495 2643221658 Variovorax sp. Root411 Isolate Unclassified
496 2643221662 Devosia sp. Root413D1 Isolate Unclassified
497 2643221672 Variovorax sp. Root434 Isolate Unclassified
498 2643221674 Devosia sp. Root436 Isolate Unclassified
499 2643221683 Variovorax sp. Root473 Isolate Unclassified
500 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
501 2643221693 Rhizobium sp. Root491 Isolate Unclassified
502 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
503 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
504 2718217882 Rhizobium sp. N741 Isolate Nodule
505 2718217927 Rhizobium sp. N324 Isolate Nodule
506 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
507 2718218009 Rhizobium sp. N561 Isolate Nodule
508 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
509 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
510 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
511 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
512 2718218363 Rhizobium sp. N113 Isolate Nodule
513 2718218365 Rhizobium sp. N731 Isolate Nodule
514 2718218366 Rhizobium sp. N621 Isolate Nodule
515 2718218423 Rhizobium sp. N941 Isolate Nodule
516 2721755514 Rhizobium sp. N6212 Isolate Nodule
517 2721755523 Delftia sp. HK171 Isolate Unclassified
518 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
519 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
520 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
521 2721755809 Rhizobium sp. N541 Isolate Nodule
522 2721755810 Rhizobium sp. N871 Isolate Nodule
523 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
524 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
525 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
526 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
527 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
528 2728369365 Rhizobium sp. N1341 Isolate Nodule
529 2728369397 Rhizobium sp. N1314 Isolate Nodule
530 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
531 2738541277 Variovorax sp. GV051 Isolate Unclassified
532 2738541293 Rhizobium sp. GV031 Isolate Unclassified
533 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
534 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
535 2738541307 Variovorax sp. GV008 Isolate Unclassified
536 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
537 2738543013 Variovorax sp. BT01 Isolate Unclassified
538 2738543019 Variovorax sp. GV040 Isolate Unclassified
539 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
540 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
541 2751185800 Brucella pituitosa AA2 Isolate Unclassified
542 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
543 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
544 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
545 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
546 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
547 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
548 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
549 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
550 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
551 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
552 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
553 2791355256 Rhizobium sp. M10 Isolate Nodule
554 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
555 2791355260 Rhizobium sp. L9 Isolate Nodule
556 2791355261 Rhizobium sp. J15 Isolate Nodule
557 2791355262 Rhizobium sp. M1 Isolate Nodule
558 2791355263 Rhizobium chutanense C5 Isolate Nodule
559 2791355264 Rhizobium sp. S9 Isolate Nodule
560 2791355265 Rhizobium sp. H4 Isolate Nodule
561 2791355266 Rhizobium sp. L43 Isolate Nodule
562 2791355267 Rhizobium sp. L18 Isolate Nodule
563 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
564 2802429633 Rhizobium anhuiense J3 Isolate Nodule
565 2802429634 Rhizobium anhuiense S10 Isolate Nodule
566 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
567 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
568 2802429637 Rhizobium anhuiense C15 Isolate Nodule
569 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
570 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
571 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
572 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
573 2818991435 Caulobacter henricii 536 Isolate Unclassified
574 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
575 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
576 2818991446 Variovorax sp. 1180 Isolate Unclassified
577 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
578 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
579 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
580 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
581 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
582 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
583 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
584 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
585 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
586 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
587 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
588 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
589 2838048938 Rhizobium pisi 27/80 Isolate Nodule
590 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
591 2838061910 Rhizobium phaseoli L15 Isolate Nodule
592 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
593 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
594 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
595 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
596 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
597 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
598 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
599 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
600 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
601 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
602 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
603 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
604 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
605 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
606 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
607 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
608 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
609 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
610 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
611 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
612 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
613 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
614 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
615 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
616 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
617 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
618 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
619 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
620 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
621 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
622 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
623 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
624 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
625 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
626 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
627 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
628 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
629 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
630 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
631 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
632 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
633 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
634 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
635 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
636 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
637 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
638 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
639 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
640 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
641 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
642 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
643 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
644 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
645 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
646 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
647 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
648 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
649 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
650 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
651 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
652 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
653 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
654 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
655 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
656 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
657 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
658 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
659 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
660 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
661 2842733646 Variovorax sp. R-72446 Isolate Unclassified
662 2842747753 Variovorax sp. R-72060 Isolate Unclassified
663 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
664 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
665 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
666 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
667 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
668 2849560528 Caulobacter zeae 410 Isolate Unclassified
669 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
670 2851153111 Caulobacter radicis 736 Isolate Unclassified
671 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
672 2854911287 Brucella lupini LUP21 Isolate Unclassified
673 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
674 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
675 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
676 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
677 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
678 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
679 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
680 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
681 2885198086 Variovorax sp. 679 Isolate Unclassified
682 2885211737 Variovorax sp. 553 Isolate Unclassified
683 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
684 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
685 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
686 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
687 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
688 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
689 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
690 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
691 2899924645 Variovorax sp. 369 Isolate Unclassified
692 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
693 2904456579 Variovorax sp. 2002 Isolate Unclassified
694 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
695 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
696 2904564687 Burkholderia sp. 571 Isolate Unclassified
697 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
698 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
699 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
700 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
701 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
702 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
703 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
704 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
705 2919476304 Duganella sp. 3397 Isolate Unclassified
706 2919513703 Luteimonas sp. 3794 Isolate Unclassified
707 2919675420 Luteimonas terrae 4099 Isolate Unclassified
708 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
709 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
710 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
711 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
712 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
713 2928037797 Variovorax sp. 1126 Isolate Unclassified
714 2928044640 Variovorax sp. 1128 Isolate Unclassified
715 2928051484 Variovorax sp. 1133 Isolate Unclassified
716 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
717 2928070936 Variovorax gossypii 1167 Isolate Unclassified
718 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
719 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
720 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
721 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
722 2928163908 Burkholderia sp. 567 Isolate Unclassified
723 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
724 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
725 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
726 2928536128 Burkholderia sola 565 Isolate Unclassified
727 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
728 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
729 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
730 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
731 2929520902 Variovorax beijingensis 502 Isolate Unclassified
732 2932401849 Devosia sp. 2618 Isolate Rhizosphere
733 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
734 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
735 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
736 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
737 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
738 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
739 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
740 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
741 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
742 2933599457 Rhizobium phaseoli M3 Isolate Nodule
743 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
744 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
745 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
746 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
747 2936381700 Rhizobium chutanense C16 Isolate Unclassified
748 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
749 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
750 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
751 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
752 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
753 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
754 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
755 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
756 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
757 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
758 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
759 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
760 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
761 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
762 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
763 2996887358 Rhizobium sp. R711 Isolate Nodule
764 2996893221 Rhizobium sp. R635 Isolate Nodule
765 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
766 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
767 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
768 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
769 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
770 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
771 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
772 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
773 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
774 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
775 8005258706 Rhizobium sp. R693 Isolate Nodule
776 8005275841 Rhizobium sp. N4311 Isolate Nodule
777 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
778 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
779 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
780 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
781 8005321885 Rhizobium sp. R72 Isolate Nodule
782 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
783 8005382845 Rhizobium sp. R634 Isolate Nodule
784 8005395548 Rhizobium sp. R339 Isolate Nodule
785 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
786 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
787 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
788 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
789 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
790 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
791 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
792 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
793 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
794 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
795 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
796 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
797 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
798 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
799 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
800 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
801 8018176218 Rhizobium sp. N122 Isolate Nodule
802 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
803 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
804 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
805 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
806 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
807 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
808 8024501048 Rhizobium sp. H4 Isolate Nodule
809 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
810 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
811 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
812 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
813 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
814 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
815 8056382006 Rhizobium croatiense 13T Isolate Nodule
816 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere
817 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
818 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.41
Metatranscriptomes 0.33
Isolates 28.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 23.76
Nodule 12.71
Rhizoplane 2.45
Rhizosphere 41.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207657_10155384 3300025919 Bacteria 1861
2 JGI24741J21665_1000428 3300001915 Bacteria 12716
3 JGI24741J21665_1000868 3300001915 Bacteria 9116
4 JGI24740J21852_10003471 3300001979 Bacteria 6928
5 JGI24740J21852_10020346 3300001979 Bacteria 2317
6 JGI24739J22299_10001341 3300001989 Bacteria 9232
7 JGI24739J22299_10004190 3300001989 Bacteria 5517
8 JGI24737J22298_10000205 3300001990 Bacteria 19200
9 JGI24735J21928_10022322 3300002067 Bacteria 1928
10 JGI25162J39368_1000238 3300002737 Bacteria 54861
11 JGI25152J39213_1002339 3300002773 Bacteria 7279
12 JGI25152J39213_1002961 3300002773 Bacteria 6042
13 JGI25152J39213_1003510 3300002773 Bacteria 5317
14 JGI25152J39213_1006276 3300002773 Bacteria 3281
15 JGI25152J39213_1006995 3300002773 Bacteria 2973
16 JGI25150J39212_1000454 3300002774 Bacteria 18098
17 JGI25150J39212_1001788 3300002774 Bacteria 5726
18 JGI25150J39212_1002046 3300002774 Bacteria 5243
19 JGI25150J39212_1005929 3300002774 Bacteria 2567
20 JGI25159J45721_1000205 3300002987 Bacteria 27533
21 JGI25159J45721_1000661 3300002987 Bacteria 15285
22 JGI25151J46595_10000113 3300003187 Bacteria 109070
23 JGI25151J46595_10000201 3300003187 Bacteria 73412
24 JGI25151J46595_10002405 3300003187 Bacteria 11308
25 JGI25151J46595_10004654 3300003187 Bacteria 7219
26 JGI25151J46595_10004891 3300003187 Bacteria 6997
27 JGI25151J46595_10008211 3300003187 Bacteria 5043
28 JGI25151J46595_10009462 3300003187 Bacteria 4611
29 JGI25165J46597_1000198 3300003214 Bacteria 88888
30 JGI25165J46597_1000722 3300003214 Bacteria 25879
31 JGI25165J46597_1002928 3300003214 Bacteria 4802
32 JGI25165J46597_1003327 3300003214 Bacteria 4097
33 JGI25153J46596_10000838 3300003215 Bacteria 18810
34 JGI25153J46596_10005656 3300003215 Bacteria 6523
35 JGI25153J46596_10006518 3300003215 Bacteria 5891
36 JGI25153J46596_10013182 3300003215 Bacteria 3513
37 JGI25153J46596_10014260 3300003215 Bacteria 3313
38 rootH2_10019603 3300003320 Bacteria 4735
39 rootH2_10019800 3300003320 Bacteria 3247
40 rootH2_10026203 3300003320 Bacteria 4144
41 rootH2_10051955 3300003320 Bacteria 1477
42 rootH2_10064180 3300003320 Bacteria 3067
43 rootH2_10110706 3300003320 Bacteria 3889
44 rootH2_10263165 3300003320 Bacteria 2048
45 rootL2_10000041 3300003322 Bacteria 83940
46 rootL2_10008082 3300003322 Bacteria 60006
47 rootL2_10044988 3300003322 Bacteria 9264
48 rootL2_10243571 3300003322 Bacteria 2225
49 rootH1_10049778 3300003323 Bacteria 3981
50 JGI25160J50197_1000001 3300003354 Bacteria 782301
51 JGI25160J50197_1001703 3300003354 Bacteria 10672
52 JGI25160J50197_1005268 3300003354 Bacteria 5412
53 JGI25160J50197_1008255 3300003354 Bacteria 3983
54 JGI25161J50226_1000001 3300003374 Bacteria 655036
55 JGI25161J50226_1000289 3300003374 Bacteria 28340
56 JGI25161J50226_1003049 3300003374 Bacteria 4012
57 Ga0006562J51391_1006860 3300003578 Bacteria 1844
58 Ga0006562J51391_1010099 3300003578 Bacteria 7201
59 Ga0006562J51391_1023697 3300003578 Bacteria 3820
60 Ga0006562J51391_1076958 3300003578 Bacteria 9688
61 Ga0006562J51391_1126239 3300003578 Bacteria 1340
62 Ga0055532_1001435 3300003758 Bacteria 6647
63 Ga0055535_1000537 3300003761 Bacteria 32561
64 Ga0055542_1000378 3300003762 Bacteria 45624
65 Ga0055542_1005522 3300003762 Bacteria 2841
66 Ga0055542_1005980 3300003762 Bacteria 2661
67 Ga0055529_1000758 3300003763 Bacteria 20586
68 Ga0055526_1000513 3300003771 Bacteria 30919
69 Ga0055526_1001716 3300003771 Bacteria 15248
70 Ga0055526_1003200 3300003771 Bacteria 10590
71 Ga0055526_1007655 3300003771 Bacteria 5567
72 Ga0055526_1024485 3300003771 Bacteria 1972
73 Ga0055524_1002072 3300003775 Bacteria 10634
74 Ga0055524_1002429 3300003775 Bacteria 9611
75 Ga0055524_1003530 3300003775 Bacteria 7559
76 Ga0055524_1009778 3300003775 Bacteria 3870
77 Ga0055524_1014768 3300003775 Bacteria 2877
78 Ga0055524_1021336 3300003775 Bacteria 2151
79 Ga0055536_1000367 3300003781 Bacteria 33548
80 Ga0055536_1001335 3300003781 Bacteria 15032
81 Ga0055536_1011881 3300003781 Bacteria 3287
82 Ga0055536_1013976 3300003781 Bacteria 2852
83 Ga0055536_1014247 3300003781 Bacteria 2808
84 Ga0055534_1000528 3300003784 Bacteria 20631
85 Ga0055528_1000109 3300003790 Bacteria 66661
86 Ga0055528_1000243 3300003790 Bacteria 45851
87 Ga0055528_1003440 3300003790 Bacteria 7940
88 Ga0055528_1004308 3300003790 Bacteria 6880
89 Ga0055528_1004616 3300003790 Bacteria 6593
90 Ga0055528_1013526 3300003790 Bacteria 3084
91 Ga0055530_10000772 3300003791 Bacteria 26697
92 Ga0055530_10002375 3300003791 Bacteria 12199
93 Ga0055530_10025240 3300003791 Bacteria 1664
94 Ga0055530_10033990 3300003791 Bacteria 1307
95 Ga0055540_1000695 3300003792 Bacteria 23180
96 Ga0055540_1001122 3300003792 Bacteria 16723
97 Ga0055540_1009808 3300003792 Bacteria 3256
98 Ga0055531_10001330 3300003794 Bacteria 18455
99 Ga0055531_10002874 3300003794 Bacteria 11228
100 Ga0055531_10004218 3300003794 Bacteria 8853
101 Ga0055531_10006570 3300003794 Bacteria 6570
102 Ga0055531_10008536 3300003794 Bacteria 5380
103 Ga0058692_1001219 3300003856 Bacteria 9853
104 Ga0058692_1001492 3300003856 Bacteria 8575
105 Ga0055543_1000023 3300004625 Bacteria 140513
106 Ga0055543_1000089 3300004625 Bacteria 79924
107 Ga0065165_1000008 3300005262 Bacteria 334429
108 Ga0065165_1002567 3300005262 Bacteria 14996
109 Ga0065165_1003159 3300005262 Bacteria 12122
110 Ga0065165_1004507 3300005262 Bacteria 8557
111 Ga0065165_1020294 3300005262 Bacteria 2343
112 Ga0065704_10009095 3300005289 Bacteria 3482
113 Ga0070658_10017121 3300005327 Bacteria 5799
114 Ga0070658_10072771 3300005327 Bacteria 2817
115 Ga0070670_100003836 3300005331 Bacteria 12528
116 Ga0070666_10000489 3300005335 Bacteria 23884
117 Ga0070660_100000001 3300005339 Bacteria 190487
118 Ga0070691_10008314 3300005341 Bacteria 4752
119 Ga0070661_100005583 3300005344 Bacteria 8668
120 Ga0070661_100047773 3300005344 Bacteria 3132
121 Ga0070668_100000951 3300005347 Bacteria 20217
122 Ga0070668_100063622 3300005347 Bacteria 2860
123 Ga0070668_100098134 3300005347 Bacteria 2318
124 Ga0070669_100087075 3300005353 Bacteria 2335
125 Ga0070669_100159210 3300005353 Bacteria 1753
126 Ga0070675_100011142 3300005354 Bacteria 7035
127 Ga0070671_100038181 3300005355 Bacteria 3986
128 Ga0070674_100104529 3300005356 Bacteria 2069
129 Ga0070674_100121632 3300005356 Bacteria 1933
130 Ga0070667_100000202 3300005367 Bacteria 70190
131 Ga0070667_100069642 3300005367 Bacteria 2994
132 Ga0070667_100305905 3300005367 Bacteria 1432
133 Ga0070709_10000184 3300005434 Bacteria 39762
134 Ga0070663_100000078 3300005455 Bacteria 42943
135 Ga0070663_100003655 3300005455 Bacteria 8909
136 Ga0070678_100026881 3300005456 Bacteria 3898
137 Ga0070678_100057252 3300005456 Bacteria 2855
138 Ga0070681_10116633 3300005458 Bacteria 2607
139 Ga0068853_100008803 3300005539 Bacteria 8118
140 Ga0068853_100020228 3300005539 Bacteria 5533
141 Ga0068853_100072784 3300005539 Bacteria 2995
142 Ga0068853_100211697 3300005539 Bacteria 1767
143 Ga0070672_100000181 3300005543 Bacteria 34517
144 Ga0070665_100006150 3300005548 Bacteria 12277
145 Ga0070665_100006563 3300005548 Bacteria 11829
146 Ga0070665_100137401 3300005548 Bacteria 2447
147 Ga0068855_100010767 3300005563 Bacteria 11041
148 Ga0068855_100021482 3300005563 Bacteria 7741
149 Ga0068855_100038667 3300005563 Bacteria 5669
150 Ga0068855_100277451 3300005563 Bacteria 1862
151 Ga0068855_100331974 3300005563 Bacteria 1678
152 Ga0070664_100003704 3300005564 Bacteria 12319
153 Ga0070664_100004146 3300005564 Bacteria 11646
154 Ga0068857_100025243 3300005577 Bacteria 5233
155 Ga0068854_100125748 3300005578 Bacteria 1952
156 Ga0068856_100002978 3300005614 Bacteria 17348
157 Ga0068856_100101326 3300005614 Bacteria 2872
158 Ga0068856_100194770 3300005614 Bacteria 2040
159 Ga0068852_100014873 3300005616 Bacteria 6014
160 Ga0068852_100023291 3300005616 Bacteria 4982
161 Ga0068852_100149202 3300005616 Bacteria 2172
162 Ga0068859_100242909 3300005617 Bacteria 1890
163 Ga0068864_100040752 3300005618 Bacteria 3972
164 Ga0068864_100094806 3300005618 Bacteria 2638
165 Ga0068861_100184990 3300005719 Bacteria 1737
166 Ga0068851_10008273 3300005834 Bacteria 4804
167 Ga0068851_10014019 3300005834 Bacteria 3800
168 Ga0068863_100001922 3300005841 Bacteria 20631
169 Ga0068863_100085818 3300005841 Bacteria 2982
170 Ga0068858_100016145 3300005842 Bacteria 7015
171 Ga0068858_100105015 3300005842 Bacteria 2636
172 Ga0075365_10003546 3300006038 Bacteria 8073
173 Ga0075365_10054061 3300006038 Bacteria 2661
174 Ga0075365_10126580 3300006038 Bacteria 1766
175 Ga0075368_10000685 3300006042 Bacteria 10281
176 Ga0075368_10002173 3300006042 Bacteria 6344
177 Ga0075363_100006947 3300006048 Bacteria 5174
178 Ga0075363_100038875 3300006048 Bacteria 2503
179 Ga0075364_10085358 3300006051 Bacteria 2090
180 Ga0075364_10099076 3300006051 Bacteria 1939
181 Ga0075362_10001502 3300006177 Bacteria 7497
182 Ga0075362_10030828 3300006177 Bacteria 2317
183 Ga0075367_10000830 3300006178 Bacteria 12250
184 Ga0075367_10024181 3300006178 Bacteria 3426
185 Ga0075367_10069970 3300006178 Bacteria 2108
186 Ga0075367_10118711 3300006178 Bacteria 1628
187 Ga0075369_10004003 3300006186 Bacteria 5411
188 Ga0075369_10012656 3300006186 Bacteria 3334
189 Ga0075366_10007556 3300006195 Bacteria 6011
190 Ga0075366_10031365 3300006195 Bacteria 3127
191 Ga0075366_10034852 3300006195 Bacteria 2966
192 Ga0075366_10177884 3300006195 Bacteria 1292
193 Ga0097621_100020431 3300006237 Bacteria 5103
194 Ga0097621_100029468 3300006237 Bacteria 4335
195 Ga0075370_10002015 3300006353 Bacteria 9211
196 Ga0075370_10039891 3300006353 Bacteria 2647
197 Ga0075370_10108261 3300006353 Bacteria 1612
198 Ga0075370_10138093 3300006353 Bacteria 1424
199 Ga0068871_100043413 3300006358 Bacteria 3611
200 Ga0075431_100003896 3300006847 Bacteria 14523
201 Ga0075429_100033155 3300006880 Bacteria 4487
202 Ga0097620_100242902 3300006931 Bacteria 1890
203 Ga0079104_1000098 3300006946 Bacteria 129064
204 Ga0079104_1004606 3300006946 Bacteria 5814
205 Ga0099826_10002179 3300006948 Bacteria 12473
206 Ga0099826_10025592 3300006948 Bacteria 4370
207 Ga0105251_10002576 3300009011 Bacteria 14063
208 Ga0105250_10002823 3300009092 Bacteria 8509
209 Ga0105240_10000287 3300009093 Bacteria 98443
210 Ga0105240_10005351 3300009093 Bacteria 19146
211 Ga0105240_10010309 3300009093 Bacteria 13156
212 Ga0105240_10121147 3300009093 Bacteria 3150
213 Ga0105245_10170034 3300009098 Bacteria 2075
214 Ga0105243_10000536 3300009148 Bacteria 38594
215 Ga0105243_10006193 3300009148 Bacteria 9252
216 Ga0105241_10033388 3300009174 Bacteria 3863
217 Ga0105241_10298240 3300009174 Bacteria 1382
218 Ga0105242_10011693 3300009176 Bacteria 6752
219 Ga0105242_10033155 3300009176 Bacteria 4134
220 Ga0105242_10338053 3300009176 Bacteria 1387
221 Ga0105248_10036416 3300009177 Bacteria 5503
222 Ga0105237_10008586 3300009545 Bacteria 11047
223 Ga0105237_10012980 3300009545 Bacteria 8746
224 Ga0105237_10031795 3300009545 Bacteria 5346
225 Ga0105237_10041529 3300009545 Bacteria 4638
226 Ga0105238_10018532 3300009551 Bacteria 7085
227 Ga0105238_10082420 3300009551 Bacteria 3206
228 Ga0105238_10113255 3300009551 Bacteria 2692
229 Ga0105238_10239979 3300009551 Bacteria 1790
230 Ga0105249_10142837 3300009553 Bacteria 2297
231 Ga0123341_1069336 3300009765 Bacteria 1563
232 Ga0123342_1010365 3300009766 Bacteria 10729
233 Ga0105239_10002709 3300010375 Bacteria 22282
234 Ga0105239_10157019 3300010375 Bacteria 2541
235 Ga0105239_10160954 3300010375 Bacteria 2508
236 Ga0157373_10016155 3300013100 Bacteria 5449
237 Ga0157373_10109767 3300013100 Bacteria 1939
238 Ga0157371_10000018 3300013102 Bacteria 310522
239 Ga0157371_10000219 3300013102 Bacteria 83847
240 Ga0157370_10002266 3300013104 Bacteria 23363
241 Ga0157370_10106353 3300013104 Bacteria 2626
242 Ga0157370_10121460 3300013104 Bacteria 2439
243 Ga0157369_10002426 3300013105 Bacteria 22408
244 Ga0157369_10057634 3300013105 Bacteria 4190
245 Ga0157369_10114225 3300013105 Bacteria 2868
246 Ga0157378_10063839 3300013297 Bacteria 3292
247 Ga0163162_10027351 3300013306 Bacteria 5640
248 Ga0157372_10004734 3300013307 Bacteria 14458
249 Ga0157372_10013381 3300013307 Bacteria 8759
250 Ga0157375_10047086 3300013308 Bacteria 4208
251 Ga0157375_10129812 3300013308 Bacteria 2638
252 Ga0163163_10077400 3300014325 Bacteria 3321
253 Ga0157380_10062652 3300014326 Bacteria 2980
254 Ga0182008_10000330 3300014497 Bacteria 37364
255 Ga0182008_10001836 3300014497 Bacteria 13824
256 Ga0182008_10005195 3300014497 Bacteria 7466
257 Ga0182008_10007938 3300014497 Bacteria 5823
258 Ga0182008_10030817 3300014497 Bacteria 2702
259 Ga0157379_10072549 3300014968 Bacteria 3080
260 Ga0157379_10105858 3300014968 Bacteria 2525
261 Ga0157376_10017836 3300014969 Bacteria 5425
262 Ga0182006_1000035 3300015261 Bacteria 232349
263 Ga0182006_1000054 3300015261 Bacteria 174021
264 Ga0182006_1016546 3300015261 Bacteria 3145
265 Ga0182006_1057876 3300015261 Bacteria 1472
266 Ga0182007_10000678 3300015262 Bacteria 19554
267 Ga0182007_10004694 3300015262 Bacteria 6160
268 Ga0182007_10040059 3300015262 Bacteria 1565
269 Ga0182005_1000012 3300015265 Bacteria 396944
270 Ga0182005_1000025 3300015265 Bacteria 235532
271 Ga0182005_1000606 3300015265 Bacteria 17393
272 Ga0182005_1005953 3300015265 Bacteria 3773
273 Ga0182005_1012661 3300015265 Bacteria 2380
274 Ga0182005_1033924 3300015265 Bacteria 1388
275 Ga0183362_10001 3300015683 Bacteria 2046624
276 Ga0183362_10008 3300015683 Bacteria 223037
277 Ga0183363_1001 3300015690 Bacteria 611534
278 Ga0163161_10001155 3300017792 Bacteria 19878
279 Ga0213876_10082588 3300021384 Bacteria 1700
280 Ga0209436_100053 3300025208 Bacteria 63474
281 Ga0209436_103239 3300025208 Bacteria 4416
282 Ga0209672_100046 3300025228 Bacteria 264244
283 Ga0209672_100088 3300025228 Bacteria 121401
284 Ga0209672_101237 3300025228 Bacteria 10257
285 Ga0209147_100043 3300025229 Bacteria 300460
286 Ga0209147_100130 3300025229 Bacteria 121401
287 Ga0207427_105485 3300025231 Bacteria 1777
288 Ga0209437_100042 3300025233 Bacteria 444095
289 Ga0209437_100283 3300025233 Bacteria 74859
290 Ga0209258_100023 3300025242 Bacteria 547286
291 Ga0209258_100204 3300025242 Bacteria 121401
292 Ga0209258_100449 3300025242 Bacteria 45676
293 Ga0207425_1000055 3300025245 Bacteria 152820
294 Ga0207425_1000688 3300025245 Bacteria 18470
295 Ga0207425_1000968 3300025245 Bacteria 13512
296 Ga0207425_1002682 3300025245 Bacteria 6095
297 Ga0207425_1004908 3300025245 Bacteria 3915
298 Ga0209677_103766 3300025253 Bacteria 4719
299 Ga0209148_1000029 3300025254 Bacteria 579199
300 Ga0209148_1000426 3300025254 Bacteria 46846
301 Ga0209759_1008356 3300025256 Bacteria 3233
302 Ga0209129_1000016 3300025258 Bacteria 485491
303 Ga0209129_1000029 3300025258 Bacteria 401149
304 Ga0209129_1000071 3300025258 Bacteria 210729
305 Ga0209129_1000260 3300025258 Bacteria 53611
306 Ga0209129_1004589 3300025258 Bacteria 5305
307 Ga0209129_1005287 3300025258 Bacteria 4643
308 Ga0209129_1006003 3300025258 Bacteria 4078
309 Ga0209129_1006251 3300025258 Bacteria 3926
310 Ga0209233_1000103 3300025261 Bacteria 284123
311 Ga0209233_1000268 3300025261 Bacteria 74859
312 Ga0209233_1000727 3300025261 Bacteria 15234
313 Ga0209233_1001028 3300025261 Bacteria 11832
314 Ga0209233_1004127 3300025261 Bacteria 5000
315 Ga0209565_1000219 3300025263 Bacteria 64578
316 Ga0209565_1001369 3300025263 Bacteria 10961
317 Ga0209565_1015529 3300025263 Bacteria 1715
318 Ga0209455_1000064 3300025272 Bacteria 332404
319 Ga0209673_1000005 3300025273 Bacteria 692788
320 Ga0209673_1000020 3300025273 Bacteria 430653
321 Ga0209673_1000084 3300025273 Bacteria 215878
322 Ga0209673_1000178 3300025273 Bacteria 128628
323 Ga0209673_1002733 3300025273 Bacteria 11626
324 Ga0209673_1002949 3300025273 Bacteria 10672
325 Ga0209673_1003012 3300025273 Bacteria 10452
326 Ga0209673_1003061 3300025273 Bacteria 10309
327 Ga0209673_1004140 3300025273 Bacteria 7946
328 Ga0209130_1000003 3300025284 Bacteria 677988
329 Ga0209130_1000031 3300025284 Bacteria 322932
330 Ga0209130_1000351 3300025284 Bacteria 52869
331 Ga0209130_1000647 3300025284 Bacteria 32514
332 Ga0209130_1000747 3300025284 Bacteria 28269
333 Ga0209130_1002983 3300025284 Bacteria 7683
334 Ga0209130_1024438 3300025284 Bacteria 1319
335 Ga0209675_1000513 3300025291 Bacteria 28663
336 Ga0209675_1001145 3300025291 Bacteria 16159
337 Ga0209675_1001475 3300025291 Bacteria 13511
338 Ga0209675_1004603 3300025291 Bacteria 6071
339 Ga0209675_1016459 3300025291 Bacteria 2153
340 Ga0209676_1000005 3300025292 Bacteria 1076001
341 Ga0209676_1000043 3300025292 Bacteria 418680
342 Ga0209676_1000434 3300025292 Bacteria 72286
343 Ga0209676_1001197 3300025292 Bacteria 27791
344 Ga0209676_1001276 3300025292 Bacteria 26092
345 Ga0209676_1015783 3300025292 Bacteria 2763
346 Ga0209025_1000070 3300025294 Bacteria 287776
347 Ga0209025_1000072 3300025294 Bacteria 283452
348 Ga0209025_1000420 3300025294 Bacteria 84779
349 Ga0209025_1000585 3300025294 Bacteria 66076
350 Ga0209025_1001269 3300025294 Bacteria 34765
351 Ga0209025_1003196 3300025294 Bacteria 15897
352 Ga0209025_1004321 3300025294 Bacteria 12421
353 Ga0209025_1008163 3300025294 Bacteria 7586
354 Ga0209025_1010572 3300025294 Bacteria 6236
355 Ga0209025_1013743 3300025294 Bacteria 5056
356 Ga0209025_1017154 3300025294 Bacteria 4204
357 Ga0209025_1017358 3300025294 Bacteria 4160
358 Ga0209025_1040547 3300025294 Bacteria 2012
359 Ga0209564_1000114 3300025295 Bacteria 209934
360 Ga0209564_1000292 3300025295 Bacteria 101735
361 Ga0209564_1000334 3300025295 Bacteria 91091
362 Ga0209564_1000826 3300025295 Bacteria 42101
363 Ga0209564_1001317 3300025295 Bacteria 26581
364 Ga0209564_1002143 3300025295 Bacteria 16670
365 Ga0209564_1024316 3300025295 Bacteria 2073
366 Ga0209758_1000027 3300025297 Bacteria 549650
367 Ga0209758_1000053 3300025297 Bacteria 337751
368 Ga0209758_1000094 3300025297 Bacteria 241068
369 Ga0209758_1000461 3300025297 Bacteria 67480
370 Ga0209758_1002484 3300025297 Bacteria 18745
371 Ga0209758_1003539 3300025297 Bacteria 14062
372 Ga0209758_1005109 3300025297 Bacteria 10384
373 Ga0209758_1006177 3300025297 Bacteria 8768
374 Ga0209758_1008115 3300025297 Bacteria 6909
375 Ga0209758_1010898 3300025297 Bacteria 5356
376 Ga0209050_1000007 3300025298 Bacteria 1187891
377 Ga0209050_1000140 3300025298 Bacteria 173241
378 Ga0209050_1000542 3300025298 Bacteria 62500
379 Ga0209050_1000793 3300025298 Bacteria 44679
380 Ga0209050_1001099 3300025298 Bacteria 32819
381 Ga0209050_1001296 3300025298 Bacteria 28307
382 Ga0209050_1003464 3300025298 Bacteria 11602
383 Ga0209050_1009326 3300025298 Bacteria 5042
384 Ga0209050_1027362 3300025298 Bacteria 1881
385 Ga0209256_1000038 3300025299 Bacteria 375225
386 Ga0209256_1000081 3300025299 Bacteria 222908
387 Ga0209256_1000123 3300025299 Bacteria 165547
388 Ga0209256_1000549 3300025299 Bacteria 53852
389 Ga0209256_1000829 3300025299 Bacteria 39149
390 Ga0209256_1002527 3300025299 Bacteria 14697
391 Ga0209256_1013922 3300025299 Bacteria 2944
392 Ga0207426_1000011 3300025302 Bacteria 791203
393 Ga0207426_1000027 3300025302 Bacteria 513176
394 Ga0207426_1000035 3300025302 Bacteria 448327
395 Ga0207426_1000042 3300025302 Bacteria 433289
396 Ga0207426_1000102 3300025302 Bacteria 255303
397 Ga0207426_1000176 3300025302 Bacteria 159819
398 Ga0207426_1001714 3300025302 Bacteria 16806
399 Ga0209051_1000009 3300025303 Bacteria 706778
400 Ga0209051_1000070 3300025303 Bacteria 215616
401 Ga0209051_1000174 3300025303 Bacteria 116896
402 Ga0209051_1000262 3300025303 Bacteria 87898
403 Ga0209051_1001475 3300025303 Bacteria 19899
404 Ga0209051_1001909 3300025303 Bacteria 16211
405 Ga0209051_1010909 3300025303 Bacteria 4536
406 Ga0209051_1016117 3300025303 Bacteria 3405
407 Ga0209051_1026386 3300025303 Bacteria 2342
408 Ga0209257_1000011 3300025304 Bacteria 1112630
409 Ga0209257_1000036 3300025304 Bacteria 616006
410 Ga0209257_1000134 3300025304 Bacteria 207628
411 Ga0209257_1000139 3300025304 Bacteria 202285
412 Ga0209257_1001762 3300025304 Bacteria 23976
413 Ga0209257_1020896 3300025304 Bacteria 2399
414 Ga0209257_1021395 3300025304 Bacteria 2351
415 Ga0207656_10007996 3300025321 Bacteria 3878
416 Ga0207656_10029674 3300025321 Bacteria 2254
417 Ga0207655_1006242 3300025728 Bacteria 7928
418 Ga0207680_10025347 3300025903 Bacteria 3271
419 Ga0207647_10092886 3300025904 Bacteria 1799
420 Ga0207705_10038218 3300025909 Bacteria 3436
421 Ga0207654_10024639 3300025911 Bacteria 3237
422 Ga0207707_10183999 3300025912 Bacteria 1823
423 Ga0207695_10000319 3300025913 Bacteria 116116
424 Ga0207695_10001005 3300025913 Bacteria 49964
425 Ga0207695_10004444 3300025913 Bacteria 19118
426 Ga0207695_10016767 3300025913 Bacteria 8552
427 Ga0207695_10052878 3300025913 Bacteria 4252
428 Ga0207671_10000078 3300025914 Bacteria 150705
429 Ga0207671_10027278 3300025914 Bacteria 4270
430 Ga0207671_10031978 3300025914 Bacteria 3918
431 Ga0207671_10127765 3300025914 Bacteria 1949
432 Ga0207657_10000022 3300025919 Bacteria 154101
433 Ga0207657_10022271 3300025919 Bacteria 5936
434 Ga0207649_10010156 3300025920 Bacteria 5168
435 Ga0207652_10252622 3300025921 Bacteria 1590
436 Ga0207681_10069007 3300025923 Bacteria 2457
437 Ga0207694_10002426 3300025924 Bacteria 15209
438 Ga0207694_10008678 3300025924 Bacteria 7672
439 Ga0207694_10010847 3300025924 Bacteria 6878
440 Ga0207694_10229305 3300025924 Bacteria 1516
441 Ga0207650_10002818 3300025925 Bacteria 12007
442 Ga0207659_10042912 3300025926 Bacteria 3173
443 Ga0207644_10077791 3300025931 Bacteria 2444
444 Ga0207644_10220949 3300025931 Bacteria 1502
445 Ga0207690_10000010 3300025932 Bacteria 330298
446 Ga0207706_10086492 3300025933 Bacteria 2755
447 Ga0207706_10217274 3300025933 Bacteria 1675
448 Ga0207686_10002865 3300025934 Bacteria 9304
449 Ga0207686_10140396 3300025934 Bacteria 1669
450 Ga0207709_10000105 3300025935 Bacteria 130495
451 Ga0207709_10000242 3300025935 Bacteria 67423
452 Ga0207709_10006000 3300025935 Bacteria 6850
453 Ga0207665_10044658 3300025939 Bacteria 2965
454 Ga0207691_10010950 3300025940 Bacteria 8704
455 Ga0207711_10021600 3300025941 Bacteria 5376
456 Ga0207667_10014672 3300025949 Bacteria 8921
457 Ga0207667_10022590 3300025949 Bacteria 6942
458 Ga0207667_10027895 3300025949 Bacteria 6137
459 Ga0207651_10003219 3300025960 Bacteria 7986
460 Ga0207712_10132343 3300025961 Bacteria 1902
461 Ga0207668_10000663 3300025972 Bacteria 21145
462 Ga0207668_10031490 3300025972 Bacteria 3494
463 Ga0207640_10113022 3300025981 Bacteria 1929
464 Ga0207658_10000154 3300025986 Bacteria 72073
465 Ga0207703_10111213 3300026035 Bacteria 2338
466 Ga0207639_10021827 3300026041 Bacteria 4602
467 Ga0207639_10071462 3300026041 Bacteria 2714
468 Ga0207639_10128498 3300026041 Bacteria 2094
469 Ga0207678_10000226 3300026067 Bacteria 50299
470 Ga0207678_10027749 3300026067 Bacteria 4942
471 Ga0207678_10030480 3300026067 Bacteria 4708
472 Ga0207702_10005708 3300026078 Bacteria 10853
473 Ga0207702_10038679 3300026078 Bacteria 3995
474 Ga0207641_10000054 3300026088 Bacteria 170887
475 Ga0207676_10045625 3300026095 Bacteria 3387
476 Ga0207674_10021921 3300026116 Bacteria 6870
477 Ga0207674_10042976 3300026116 Bacteria 4662
478 Ga0207675_100240399 3300026118 Bacteria 1750
479 Ga0207683_10013526 3300026121 Bacteria 6962
480 Ga0207698_10003332 3300026142 Bacteria 9664
481 Ga0207698_10081751 3300026142 Bacteria 2609
482 Ga0209281_1000002 3300027111 Bacteria 1924012
483 Ga0209281_1010273 3300027111 Bacteria 2153
484 Ga0209371_1000035 3300027312 Bacteria 368979
485 Ga0209371_1000160 3300027312 Bacteria 103642
486 Ga0209371_1001218 3300027312 Bacteria 18553
487 Ga0209371_1001639 3300027312 Bacteria 14414
488 Ga0209282_1000173 3300027666 Bacteria 36304
489 Ga0209282_1005950 3300027666 Bacteria 7543
490 Ga0209813_10000215 3300027866 Bacteria 17765
491 Ga0268266_10002177 3300028379 Bacteria 21451
492 Ga0268266_10082078 3300028379 Bacteria 2811
493 Ga0268266_10227971 3300028379 Bacteria 1715
494 Ga0307515_10000048 3300028794 Bacteria 288111
495 Ga0307515_10000954 3300028794 Bacteria 66117
496 Ga0307515_10001052 3300028794 Bacteria 63228
497 Ga0307515_10010434 3300028794 Bacteria 17799
498 Ga0265338_10004781 3300028800 Bacteria 18103
499 Ga0265338_10007818 3300028800 Bacteria 13145
500 Ga0265338_10011970 3300028800 Bacteria 9939
501 Ga0265338_10062579 3300028800 Bacteria 3251
502 Ga0265338_10065581 3300028800 Bacteria 3148
503 Ga0265338_10192152 3300028800 Bacteria 1546
504 Ga0268256_1000037 3300030500 Bacteria 367024
505 Ga0268256_1000132 3300030500 Bacteria 103642
506 Ga0268256_1003221 3300030500 Bacteria 7533
507 Ga0268256_1008081 3300030500 Bacteria 3651
508 Ga0307511_10025370 3300030521 Bacteria 5466
509 Ga0307511_10082801 3300030521 Bacteria 2240
510 Ga0316181_1213357 3300030744 Bacteria 9550
511 Ga0316181_1285884 3300030744 Bacteria 2424
512 Ga0265330_10004426 3300031235 Bacteria 7132
513 Ga0265332_10058669 3300031238 Bacteria 1647
514 Ga0265328_10011738 3300031239 Bacteria 3495
515 Ga0265328_10041103 3300031239 Bacteria 1702
516 Ga0265325_10003718 3300031241 Bacteria 9865
517 Ga0265325_10003973 3300031241 Bacteria 9467
518 Ga0265325_10013188 3300031241 Bacteria 4709
519 Ga0265325_10052025 3300031241 Bacteria 2104
520 Ga0265340_10002162 3300031247 Bacteria 11273
521 Ga0265340_10002326 3300031247 Bacteria 10858
522 Ga0265340_10003981 3300031247 Bacteria 8303
523 Ga0265340_10018290 3300031247 Bacteria 3615
524 Ga0265340_10022268 3300031247 Bacteria 3241
525 Ga0265340_10022680 3300031247 Bacteria 3208
526 Ga0265340_10044175 3300031247 Bacteria 2181
527 Ga0265339_10005013 3300031249 Bacteria 8907
528 Ga0265339_10013146 3300031249 Bacteria 5026
529 Ga0265339_10064610 3300031249 Bacteria 1963
530 Ga0265331_10018245 3300031250 Bacteria 3645
531 Ga0265331_10028166 3300031250 Bacteria 2811
532 Ga0265327_10001863 3300031251 Bacteria 24454
533 Ga0265316_10049210 3300031344 Bacteria 3321
534 Ga0265316_10059724 3300031344 Bacteria 2964
535 Ga0265316_10094710 3300031344 Bacteria 2275
536 Ga0265316_10152372 3300031344 Bacteria 1732
537 Ga0307513_10013362 3300031456 Bacteria 10082
538 Ga0307408_100130656 3300031548 Bacteria 1958
539 Ga0307408_100145099 3300031548 Bacteria 1867
540 Ga0265313_10000044 3300031595 Bacteria 117063
541 Ga0265313_10004103 3300031595 Bacteria 11341
542 Ga0265313_10061981 3300031595 Bacteria 1748
543 Ga0307514_10003805 3300031649 Bacteria 14199
544 Ga0316575_10003555 3300031665 Bacteria 5392
545 Ga0316575_10010065 3300031665 Bacteria 3468
546 Ga0316579_10002372 3300031691 Bacteria 7104
547 Ga0265314_10000511 3300031711 Bacteria 50084
548 Ga0265314_10024073 3300031711 Bacteria 4625
549 Ga0265314_10053032 3300031711 Bacteria 2815
550 Ga0265342_10008325 3300031712 Bacteria 7456
551 Ga0265342_10014034 3300031712 Bacteria 5332
552 Ga0265342_10087258 3300031712 Bacteria 1793
553 Ga0316576_10016969 3300031727 Bacteria 4936
554 Ga0316576_10055503 3300031727 Bacteria 2891
555 Ga0316576_10070765 3300031727 Bacteria 2572
556 Ga0307405_10097588 3300031731 Bacteria 1962
557 Ga0316577_10036915 3300031733 Bacteria 2733
558 Ga0316577_10037416 3300031733 Bacteria 2713
559 Ga0307406_10005083 3300031901 Bacteria 7176
560 Ga0307406_10295922 3300031901 Bacteria 1241
561 Ga0307412_10001246 3300031911 Bacteria 14409
562 Ga0307412_10002096 3300031911 Bacteria 11071
563 Ga0307409_100111731 3300031995 Bacteria 2293
564 Ga0307414_10044972 3300032004 Bacteria 3020
565 Ga0316580_10010209 3300032139 Bacteria 2831
566 Ga0307510_10004106 3300033180 Bacteria 17088
567 Ga0307510_10067470 3300033180 Bacteria 3601
568 Ga0373936_0057357 3300035113 Bacteria 1584
569 Ga0373954_0015168 3300035118 Bacteria 3442
570 Ga0373946_0017767 3300035171 Bacteria 2725
571 Ga0373955_0020854 3300035172 Bacteria 3300
572 Ga0316574_0027709 3300035398 Bacteria 3413
573 Ga0316574_0117079 3300035398 Bacteria 1709
574 Ga0373927_0003123 3300035695 Bacteria 11979
575 Ga0373937_0116989 3300036401 Bacteria 2483
576 Ga0373937_0142382 3300036401 Bacteria 2244
577 Ga0316582_0018679 3300036647 Bacteria 4040
578 Ga0316582_0044438 3300036647 Bacteria 2792
579 Ga0316582_0059912 3300036647 Bacteria 2439
580 Ga0316584_0023996 3300036712 Bacteria 4459
581 Ga0316584_0058064 3300036712 Bacteria 2897
582 Ga0316584_0076928 3300036712 Bacteria 2500
583 Ga0373925_0000230 3300037068 Bacteria 59585
584 Ga0395899_0000058 3300037312 Bacteria 213049
585 Ga0395900_0000056 3300037418 Bacteria 213077
586 Ga0395900_0038585 3300037418 Bacteria 4924
587 Ga0395898_0000114 3300037466 Bacteria 213068
588 Ga0395905_0000053 3300037471 Bacteria 213077
589 Ga0316581_0019574 3300037588 Bacteria 1975
590 Ga0395901_0000037 3300038443 Bacteria 213059
591 Ga0400488_36896 3300038741 Bacteria 1273
592 Ga0237816_00091 3300039145 Bacteria 6575
593 Ga0436360_0650990 3300039438 Bacteria 2221
594 Ga0436361_0473951 3300039447 Bacteria 1258
595 Ga0439466_0009742 3300041411 Bacteria 3583
596 Ga0439465_0010686 3300041413 Bacteria 2881
597 Ga0451837_0233771 3300041494 Bacteria 2031
598 Ga0451837_0285545 3300041494 Bacteria 1599
599 Ga0451849_0629807 3300041505 Bacteria 2479
600 Ga0451843_0088258 3300041509 Bacteria 2148
601 Ga0439432_009880 3300042006 Bacteria 3319
602 Ga0439449_0002907 3300042007 Bacteria 6661
603 Ga0439452_009011 3300042010 Bacteria 2967
604 Ga0439457_005237 3300042014 Bacteria 3284
605 Ga0439462_0018070 3300042015 Bacteria 1830
606 Ga0450911_001695 3300042115 Bacteria 4847
607 Ga0450896_005461 3300042133 Bacteria 1732
608 Ga0450904_000283 3300042139 Bacteria 10954
609 Ga0439435_0006747 3300042436 Bacteria 2592
610 Ga0495617_002663 3300046452 Bacteria 6950
611 Ga0495627_000103 3300046453 Bacteria 104335
612 Ga0495627_000509 3300046453 Bacteria 32298
613 Ga0495627_028465 3300046453 Bacteria 1785
614 Ga0495590_0001131 3300046457 Bacteria 11677
615 Ga0495638_0000145 3300046460 Bacteria 112275
616 Ga0495638_0000958 3300046460 Bacteria 29269
617 Ga0495638_0001006 3300046460 Bacteria 28233
618 Ga0495638_0001202 3300046460 Bacteria 24742
619 Ga0495638_0001620 3300046460 Bacteria 20035
620 Ga0495638_0003751 3300046460 Bacteria 11823
621 Ga0495638_0014027 3300046460 Bacteria 5431
622 Ga0495638_0072870 3300046460 Bacteria 2098
623 Ga0495638_0084717 3300046460 Bacteria 1918
624 Ga0495650_0000015 3300046471 Bacteria 557595
625 Ga0495650_0000403 3300046471 Bacteria 71792
626 Ga0495650_0017525 3300046471 Bacteria 3589
627 Ga0495605_0001139 3300046474 Bacteria 17624
628 Ga0495605_0080377 3300046474 Bacteria 1526
629 Ga0495639_0025635 3300046475 Bacteria 2601
630 Ga0495585_0005189 3300046492 Bacteria 8259
631 Ga0495585_0024991 3300046492 Bacteria 3423
632 Ga0495585_0089866 3300046492 Bacteria 1655
633 Ga0495596_0000911 3300046500 Bacteria 17653
634 Ga0495596_0080672 3300046500 Bacteria 1263
635 Ga0495583_0000013 3300046506 Bacteria 323372
636 Ga0495583_0010945 3300046506 Bacteria 5239
637 Ga0495583_0026138 3300046506 Bacteria 2901
638 Ga0495606_0007407 3300046507 Bacteria 9838
639 Ga0495606_0008787 3300046507 Bacteria 8675
640 Ga0495606_0025208 3300046507 Bacteria 4265
641 Ga0495606_0025628 3300046507 Bacteria 4219
642 Ga0495606_0059250 3300046507 Bacteria 2457
643 Ga0495606_0117877 3300046507 Bacteria 1593
644 Ga0495610_0000484 3300046512 Bacteria 40825
645 Ga0495610_0000611 3300046512 Bacteria 35413
646 Ga0495610_0001765 3300046512 Bacteria 18927
647 Ga0495610_0001844 3300046512 Bacteria 18378
648 Ga0495610_0002613 3300046512 Bacteria 14916
649 Ga0495610_0004641 3300046512 Bacteria 10049
650 Ga0495610_0012359 3300046512 Bacteria 5147
651 Ga0495610_0017600 3300046512 Bacteria 4068
652 Ga0495610_0023557 3300046512 Bacteria 3343
653 Ga0495610_0028317 3300046512 Bacteria 2964
654 Ga0495616_0000161 3300046513 Bacteria 58725
655 Ga0495616_0000919 3300046513 Bacteria 21169
656 Ga0495616_0040551 3300046513 Bacteria 2378
657 Ga0495618_0039096 3300046514 Bacteria 2983
658 Ga0495620_0000299 3300046515 Bacteria 35229
659 Ga0495620_0025056 3300046515 Bacteria 2828
660 Ga0495620_0052200 3300046515 Bacteria 1737
661 Ga0495620_0054172 3300046515 Bacteria 1696
662 Ga0495631_0000242 3300046518 Bacteria 37711
663 Ga0495631_0019131 3300046518 Bacteria 3214
664 Ga0495632_0008158 3300046519 Bacteria 6470
665 Ga0495632_0011713 3300046519 Bacteria 5104
666 Ga0495632_0048892 3300046519 Bacteria 2092
667 Ga0495637_0021263 3300046520 Bacteria 2977
668 Ga0495637_0026585 3300046520 Bacteria 2595
669 Ga0495643_0001977 3300046522 Bacteria 17203
670 Ga0495643_0003005 3300046522 Bacteria 12694
671 Ga0495643_0108741 3300046522 Bacteria 1412
672 Ga0495648_0000067 3300046524 Bacteria 140250
673 Ga0495648_0001065 3300046524 Bacteria 27857
674 Ga0495648_0030837 3300046524 Bacteria 3539
675 Ga0495663_0000101 3300046525 Bacteria 35106
676 Ga0495652_0216539 3300046529 Bacteria 1442
677 Ga0495654_0000023 3300046530 Bacteria 243798
678 Ga0495654_0001761 3300046530 Bacteria 14505
679 Ga0495654_0101123 3300046530 Bacteria 1327
680 Ga0495609_0035647 3300046538 Bacteria 2251
681 Ga0495621_0029478 3300046539 Bacteria 1871
682 Ga0495597_0000492 3300046542 Bacteria 33012
683 Ga0495597_0018690 3300046542 Bacteria 3250
684 Ga0495622_0013960 3300046557 Bacteria 3727
685 Ga0495622_0060466 3300046557 Bacteria 1754
686 Ga0495633_0001863 3300046558 Bacteria 15474
687 Ga0495633_0003084 3300046558 Bacteria 11334
688 Ga0495633_0035124 3300046558 Bacteria 2408
689 Ga0495656_0000060 3300046615 Bacteria 52471
690 Ga0495668_0000061 3300046616 Bacteria 192499
691 Ga0495668_0013518 3300046616 Bacteria 4811
692 Ga0495668_0015196 3300046616 Bacteria 4499
693 Ga0495668_0020536 3300046616 Bacteria 3798
694 Ga0495668_0028459 3300046616 Bacteria 3160
695 Ga0495668_0053589 3300046616 Bacteria 2230
696 Ga0495611_0000583 3300046648 Bacteria 21088
697 Ga0495625_0000081 3300046660 Bacteria 156254
698 Ga0495625_0000467 3300046660 Bacteria 60730
699 Ga0495625_0000590 3300046660 Bacteria 52780
700 Ga0495625_0001051 3300046660 Bacteria 36220
701 Ga0495625_0015520 3300046660 Bacteria 6031
702 Ga0495625_0021632 3300046660 Bacteria 4947
703 Ga0495625_0050561 3300046660 Bacteria 2982
704 Ga0495625_0061285 3300046660 Bacteria 2662
705 Ga0495625_0081527 3300046660 Bacteria 2252
706 Ga0495625_0110157 3300046660 Bacteria 1882
707 Ga0495661_0003002 3300046665 Bacteria 12722
708 Ga0495588_0001206 3300046674 Bacteria 11139
709 Ga0495588_0029051 3300046674 Bacteria 2771
710 Ga0495588_0077877 3300046674 Bacteria 1729
711 Ga0495588_0079937 3300046674 Bacteria 1706
712 Ga0495669_0036645 3300046684 Bacteria 2169
713 Ga0495613_0000402 3300046689 Bacteria 37114
714 Ga0495670_0000129 3300046691 Bacteria 32692
715 Ga0495670_0028863 3300046691 Bacteria 2751
716 Ga0495670_0064304 3300046691 Bacteria 1848
717 Ga0495670_0070125 3300046691 Bacteria 1773
718 Ga0495671_0000401 3300046692 Bacteria 35219
719 Ga0495671_0031200 3300046692 Bacteria 2725
720 Ga0495649_0000882 3300046694 Bacteria 24041
721 Ga0495649_0011268 3300046694 Bacteria 5253
722 Ga0495589_0008483 3300046794 Bacteria 5363
723 Ga0495589_0068166 3300046794 Bacteria 1741
724 Ga0495660_0002916 3300046810 Bacteria 10706
725 Ga0495660_0039546 3300046810 Bacteria 2619
726 Ga0495660_0056260 3300046810 Bacteria 2126
727 Ga0495672_0000311 3300047320 Bacteria 65012
728 Ga0495676_0087636 3300047321 Bacteria 2338
729 Ga0495687_000478 3300047443 Bacteria 48491
730 Ga0495687_000998 3300047443 Bacteria 28327
731 Ga0495687_027903 3300047443 Bacteria 2635
732 Ga0495687_030939 3300047443 Bacteria 2461
733 Ga0495673_0000025 3300047469 Bacteria 512352
734 Ga0495673_0001006 3300047469 Bacteria 24938
735 Ga0495673_0014973 3300047469 Bacteria 4014
736 Ga0495681_0000030 3300047470 Bacteria 129910
737 Ga0495681_0000869 3300047470 Bacteria 23274
738 Ga0495681_0001049 3300047470 Bacteria 21067
739 Ga0495681_0022258 3300047470 Bacteria 3397
740 Ga0495686_0000090 3300047472 Bacteria 193179
741 Ga0495686_0000727 3300047472 Bacteria 44114
742 Ga0495686_0001164 3300047472 Bacteria 30807
743 Ga0495686_0049163 3300047472 Bacteria 2654
744 Ga0495686_0050970 3300047472 Bacteria 2599
745 Ga0495593_0096536 3300047673 Bacteria 1518
746 Ga0495602_0155231 3300048088 Bacteria 1793
747 Ga0495602_0224854 3300048088 Bacteria 1414
748 Ga0495626_0001860 3300048091 Bacteria 15837
749 Ga0495626_0039656 3300048091 Bacteria 2228
750 Ga0496101_0004597 3300048904 Bacteria 8715
751 Ga0496102_0000385 3300048905 Bacteria 52138
752 Ga0496102_0001748 3300048905 Bacteria 18970
753 Ga0496102_0021528 3300048905 Bacteria 5702
754 Ga0496102_0139498 3300048905 Bacteria 2273
755 Ga0496103_0000209 3300048906 Bacteria 58516
756 Ga0496103_0000703 3300048906 Bacteria 24765
757 Ga0496104_0001767 3300048907 Bacteria 18686
758 Ga0496104_0005945 3300048907 Bacteria 10684
759 Ga0496104_0288662 3300048907 Bacteria 1553
760 Ga0496105_0001117 3300048908 Bacteria 18690
761 Ga0496105_0032341 3300048908 Bacteria 4292
762 Ga0496105_0057687 3300048908 Bacteria 3205
763 Ga0496106_0000401 3300048909 Bacteria 30792
764 Ga0496106_0017263 3300048909 Bacteria 5341
765 Ga0496106_0121927 3300048909 Bacteria 2038
766 Ga0496106_0246342 3300048909 Bacteria 1428
767 Ga0496107_0035349 3300048910 Bacteria 3582
768 Ga0496107_0076031 3300048910 Bacteria 2445
769 Ga0496107_0112285 3300048910 Bacteria 2004
770 Ga0496110_0035676 3300048913 Bacteria 4316
771 Ga0496114_0005812 3300048917 Bacteria 9690
772 Ga0496114_0041609 3300048917 Bacteria 3809
773 Ga0496115_0022154 3300048918 Bacteria 4917
774 Ga0496116_0000062 3300048919 Bacteria 271104
775 Ga0496116_0001460 3300048919 Bacteria 26485
776 Ga0496116_0007741 3300048919 Bacteria 9451
777 Ga0496116_0010441 3300048919 Bacteria 7778
778 Ga0496116_0012133 3300048919 Bacteria 7056
779 Ga0496116_0016387 3300048919 Bacteria 5800
780 Ga0496116_0017849 3300048919 Bacteria 5493
781 Ga0496116_0056679 3300048919 Bacteria 2566
782 Ga0496117_0000045 3300048920 Bacteria 301047
783 Ga0496117_0000066 3300048920 Bacteria 253534
784 Ga0496117_0001080 3300048920 Bacteria 41299
785 Ga0496117_0002119 3300048920 Bacteria 26008
786 Ga0496117_0003250 3300048920 Bacteria 19126
787 Ga0496117_0007799 3300048920 Bacteria 10313
788 Ga0496117_0014192 3300048920 Bacteria 6883
789 Ga0496117_0022559 3300048920 Bacteria 5046
790 Ga0496117_0050930 3300048920 Bacteria 2932
791 Ga0496118_0000041 3300048921 Bacteria 301047
792 Ga0496118_0000231 3300048921 Bacteria 97930
793 Ga0496118_0000497 3300048921 Bacteria 65119
794 Ga0496118_0000561 3300048921 Bacteria 61276
795 Ga0496118_0002482 3300048921 Bacteria 24761
796 Ga0496118_0005916 3300048921 Bacteria 13682
797 Ga0496118_0014108 3300048921 Bacteria 7496
798 Ga0496118_0018380 3300048921 Bacteria 6310
799 Ga0496118_0021514 3300048921 Bacteria 5672
800 Ga0496118_0025226 3300048921 Bacteria 5104
801 Ga0496118_0028785 3300048921 Bacteria 4671
802 Ga0496118_0031555 3300048921 Bacteria 4389
803 Ga0496118_0041471 3300048921 Bacteria 3644
804 Ga0496118_0041807 3300048921 Bacteria 3624
805 Ga0496118_0074909 3300048921 Bacteria 2417
806 Ga0496119_0002703 3300048922 Bacteria 19155
807 Ga0496119_0008017 3300048922 Bacteria 9383
808 Ga0496119_0013561 3300048922 Bacteria 6476
809 Ga0496119_0040019 3300048922 Bacteria 3004
810 Ga0496119_0045344 3300048922 Bacteria 2756
811 Ga0496119_0045765 3300048922 Bacteria 2740
812 Ga0496119_0064237 3300048922 Bacteria 2180
813 Ga0496119_0126967 3300048922 Bacteria 1394
814 Ga0496120_0001197 3300048923 Bacteria 32900
815 Ga0496120_0001661 3300048923 Bacteria 25662
816 Ga0496120_0013133 3300048923 Bacteria 5595
817 Ga0496120_0058088 3300048923 Bacteria 2174
818 Ga0496120_0086808 3300048923 Bacteria 1681
819 Ga0496121_0000990 3300048924 Bacteria 50828
820 Ga0496121_0001249 3300048924 Bacteria 44078
821 Ga0496121_0002673 3300048924 Bacteria 26675
822 Ga0496121_0004008 3300048924 Bacteria 20291
823 Ga0496121_0004980 3300048924 Bacteria 17403
824 Ga0496121_0019150 3300048924 Bacteria 6861
825 Ga0496121_0037990 3300048924 Bacteria 4270
826 Ga0496121_0039385 3300048924 Bacteria 4166
827 Ga0496121_0066541 3300048924 Bacteria 2925
828 Ga0496121_0150762 3300048924 Bacteria 1711
829 Ga0496121_0163224 3300048924 Bacteria 1626
830 Ga0496122_0000057 3300048925 Bacteria 253452
831 Ga0496122_0000579 3300048925 Bacteria 75073
832 Ga0496122_0000718 3300048925 Bacteria 64979
833 Ga0496122_0004459 3300048925 Bacteria 17355
834 Ga0496122_0004784 3300048925 Bacteria 16566
835 Ga0496122_0006181 3300048925 Bacteria 13901
836 Ga0496122_0008213 3300048925 Bacteria 11340
837 Ga0496122_0011055 3300048925 Bacteria 9211
838 Ga0496122_0012724 3300048925 Bacteria 8330
839 Ga0496122_0019899 3300048925 Bacteria 6103
840 Ga0496122_0028233 3300048925 Bacteria 4770
841 Ga0496122_0036023 3300048925 Bacteria 4011
842 Ga0496122_0039278 3300048925 Bacteria 3776
843 Ga0496122_0059795 3300048925 Bacteria 2811
844 Ga0496122_0074549 3300048925 Bacteria 2400
845 Ga0496123_0000096 3300048926 Bacteria 173914
846 Ga0496123_0000179 3300048926 Bacteria 127833
847 Ga0496123_0000428 3300048926 Bacteria 75893
848 Ga0496123_0002144 3300048926 Bacteria 25227
849 Ga0496123_0002829 3300048926 Bacteria 20519
850 Ga0496123_0003479 3300048926 Bacteria 17594
851 Ga0496123_0004959 3300048926 Bacteria 13640
852 Ga0496123_0005053 3300048926 Bacteria 13486
853 Ga0496123_0005681 3300048926 Bacteria 12444
854 Ga0496123_0011274 3300048926 Bacteria 7769
855 Ga0496123_0015141 3300048926 Bacteria 6346
856 Ga0496123_0017974 3300048926 Bacteria 5658
857 Ga0496123_0066114 3300048926 Bacteria 2293
858 Ga0496123_0105865 3300048926 Bacteria 1622
859 Ga0496123_0131298 3300048926 Bacteria 1387
860 Ga0496124_0000006 3300048927 Bacteria 904259
861 Ga0496124_0000588 3300048927 Bacteria 61276
862 Ga0496124_0000644 3300048927 Bacteria 57634
863 Ga0496124_0000813 3300048927 Bacteria 50733
864 Ga0496124_0000897 3300048927 Bacteria 48151
865 Ga0496124_0001421 3300048927 Bacteria 35525
866 Ga0496124_0001631 3300048927 Bacteria 32175
867 Ga0496124_0004388 3300048927 Bacteria 16491
868 Ga0496124_0018086 3300048927 Bacteria 6617
869 Ga0496124_0023641 3300048927 Bacteria 5606
870 Ga0496124_0034544 3300048927 Bacteria 4436
871 Ga0496124_0039691 3300048927 Bacteria 4077
872 Ga0496124_0043714 3300048927 Bacteria 3850
873 Ga0496124_0044693 3300048927 Bacteria 3799
874 Ga0496124_0048363 3300048927 Bacteria 3634
875 Ga0496124_0057752 3300048927 Bacteria 3268
876 Ga0496124_0058422 3300048927 Bacteria 3244
877 Ga0496124_0065372 3300048927 Bacteria 3033
878 Ga0496124_0076507 3300048927 Bacteria 2762
879 Ga0496125_0000318 3300048928 Bacteria 93900
880 Ga0496125_0001090 3300048928 Bacteria 41847
881 Ga0496125_0001200 3300048928 Bacteria 38991
882 Ga0496125_0001577 3300048928 Bacteria 32451
883 Ga0496125_0003923 3300048928 Bacteria 17552
884 Ga0496125_0008338 3300048928 Bacteria 10872
885 Ga0496125_0008349 3300048928 Bacteria 10861
886 Ga0496125_0013329 3300048928 Bacteria 8088
887 Ga0496125_0039154 3300048928 Bacteria 4087
888 Ga0496125_0046907 3300048928 Bacteria 3619
889 Ga0496125_0048422 3300048928 Bacteria 3544
890 Ga0496125_0051484 3300048928 Bacteria 3395
891 Ga0496125_0059397 3300048928 Bacteria 3081
892 Ga0496125_0065919 3300048928 Bacteria 2865
893 Ga0496125_0079283 3300048928 Bacteria 2520
894 Ga0496125_0195527 3300048928 Bacteria 1330
895 Ga0496126_0000709 3300048929 Bacteria 60772
896 Ga0496126_0002250 3300048929 Bacteria 26630
897 Ga0496126_0014469 3300048929 Bacteria 7974
898 Ga0496126_0062411 3300048929 Bacteria 3344
899 Ga0496126_0070130 3300048929 Bacteria 3123
900 Ga0496126_0082813 3300048929 Bacteria 2834
901 Ga0496126_0104752 3300048929 Bacteria 2471
902 Ga0496126_0142679 3300048929 Bacteria 2060
903 Ga0496126_0205755 3300048929 Bacteria 1659
904 Ga0495678_000322 3300049459 Bacteria 51143
905 Ga0495678_000635 3300049459 Bacteria 32497
906 Ga0495678_001397 3300049459 Bacteria 19166
907 Ga0495678_024602 3300049459 Bacteria 2598
908 Ga0495682_0000331 3300049460 Bacteria 35194
909 Ga0495682_0007156 3300049460 Bacteria 4458
910 Ga0495682_0013879 3300049460 Bacteria 3059
911 Ga0501031_0094921 3300049568 Bacteria 1946
912 Ga0501032_0012101 3300049569 Bacteria 6177
913 Ga0501032_0046891 3300049569 Bacteria 2920
914 Ga0501033_0007222 3300049570 Bacteria 8666
915 Ga0501033_0014076 3300049570 Bacteria 6082
916 Ga0501033_0020908 3300049570 Bacteria 4940
917 Ga0501033_0073535 3300049570 Bacteria 2510
918 Ga0501034_0000275 3300049571 Bacteria 92805
919 Ga0501034_0000807 3300049571 Bacteria 46580
920 Ga0501034_0039444 3300049571 Bacteria 4784
921 Ga0501034_0161269 3300049571 Bacteria 2213
922 Ga0501036_0032236 3300049572 Bacteria 4427
923 Ga0501037_0014435 3300049573 Bacteria 5814
924 Ga0501039_0204687 3300049575 Bacteria 1552
925 Ga0501043_0176544 3300049579 Bacteria 1665
926 Ga0501046_0259957 3300049580 Bacteria 1276
927 Ga0501047_0091562 3300049581 Bacteria 2919
928 Ga0501047_0109842 3300049581 Bacteria 2640
929 Ga0501047_0150091 3300049581 Bacteria 2207
930 Ga0501047_0170986 3300049581 Bacteria 2042
931 Ga0501047_0290171 3300049581 Bacteria 1480
932 Ga0501048_0040037 3300049582 Bacteria 3359
933 Ga0501067_0072028 3300049583 Bacteria 1914
934 Ga0501070_0067116 3300049586 Bacteria 2971
935 Ga0501070_0113508 3300049586 Bacteria 2239
936 Ga0501074_0069892 3300049590 Bacteria 2525
937 Ga0501238_000574 3300049671 Bacteria 4214
938 Ga0501238_000970 3300049671 Bacteria 3291
939 Ga0501080_0025836 3300049742 Bacteria 5455
940 Ga0501080_0042029 3300049742 Bacteria 4258
941 Ga0501080_0069681 3300049742 Bacteria 3271
942 Ga0501080_0356703 3300049742 Bacteria 1320
943 Ga0501080_0368457 3300049742 Bacteria 1295
944 Ga0501083_0002409 3300049744 Bacteria 12787
945 Ga0501083_0050941 3300049744 Bacteria 2785
946 Ga0501083_0086916 3300049744 Bacteria 2067
947 Ga0501083_0109637 3300049744 Bacteria 1815
948 Ga0501035_0002715 3300049822 Bacteria 17199
949 Ga0501035_0050611 3300049822 Bacteria 3722
950 Ga0501035_0113585 3300049822 Bacteria 2372
951 Ga0501044_0017501 3300049823 Bacteria 7691
952 Ga0501044_0029598 3300049823 Bacteria 5773
953 Ga0501044_0037902 3300049823 Bacteria 5037
954 Ga0501044_0041412 3300049823 Bacteria 4795
955 Ga0501044_0180042 3300049823 Bacteria 2081
956 nmdc:mga03683_10597_c1 3300050489 Bacteria 2381
957 nmdc:mga03683_9897_c1 3300050489 Bacteria 3405
958 nmdc:mga03n38_11110_c1 3300050490 Bacteria 3342
959 nmdc:mga03n38_575_c1 3300050490 Bacteria 9323
960 nmdc:mga00v17_59_c1 3300050491 Bacteria 36576
961 nmdc:mga00v17_86361_c1 3300050491 Bacteria 1966
962 nmdc:mga0yw44_105281_c1 3300050492 Bacteria 1802
963 nmdc:mga0yw44_92488_c1 3300050492 Bacteria 1914
964 nmdc:mga0yw44_967_c1 3300050492 Bacteria 10933
965 nmdc:mga0k408_24688_c1 3300050493 Bacteria 3399
966 nmdc:mga0k408_47702_c1 3300050493 Bacteria 2476
967 nmdc:mga0k408_48063_c1 3300050493 Bacteria 2467
968 nmdc:mga0k408_75180_c1 3300050493 Bacteria 1974
969 nmdc:mga06z11_148_c1 3300050494 Bacteria 27628
970 nmdc:mga06z11_53795_c1 3300050494 Bacteria 2072
971 nmdc:mga04h51_66_c1 3300050495 Bacteria 33126
972 nmdc:mga07m45_1121_c1 3300050496 Bacteria 12013
973 nmdc:mga07m45_18025_c1 3300050496 Bacteria 3803
974 nmdc:mga07m45_2027_c1 3300050496 Bacteria 9401
975 nmdc:mga07m45_26942_c1 3300050496 Bacteria 3162
976 nmdc:mga07m45_55169_c1 3300050496 Bacteria 2246
977 nmdc:mga07m45_59309_c1 3300050496 Bacteria 2165
978 nmdc:mga06r32_3451_c1 3300050510 Bacteria 14127
979 nmdc:mga0n895_81699_c1 3300050512 Bacteria 3220
980 nmdc:mga0sz30_347_c1 3300050516 Bacteria 17727
981 nmdc:mga0sz30_3843_c1 3300050516 Bacteria 5413
982 nmdc:mga0sz30_43589_c1 3300050516 Bacteria 1889
983 Ga0495601_0036273 3300053077 Bacteria 3078
984 Ga0500610_0000931 3300053079 Bacteria 9471
985 Ga0500610_0000952 3300053079 Bacteria 9398
986 Ga0500610_0001112 3300053079 Bacteria 8849
987 Ga0495595_0023883 3300053084 Bacteria 2696
988 Ga0495619_0125571 3300053085 Bacteria 1761
989 Ga0495619_0196499 3300053085 Bacteria 1396
990 Ga0500578_0000161 3300053086 Bacteria 79058
991 Ga0500578_0001023 3300053086 Bacteria 30718
992 Ga0500643_000225 3300053087 Bacteria 52825
993 Ga0500643_015238 3300053087 Bacteria 2641
994 Ga0500643_016884 3300053087 Bacteria 2460
995 Ga0500644_0000166 3300053088 Bacteria 41856
996 Ga0500583_0000368 3300053092 Bacteria 14795
997 Ga0500651_0000099 3300053093 Bacteria 53568
998 Ga0500651_0001548 3300053093 Bacteria 11663
999 Ga0500651_0014566 3300053093 Bacteria 4812
1000 Ga0500566_0090726 3300053094 Bacteria 1689
1001 Ga0500566_0135977 3300053094 Bacteria 1309
1002 Ga0500641_0097189 3300053096 Bacteria 1261
1003 Ga0500554_004148 3300053102 Bacteria 3045
1004 Ga0500555_002310 3300053103 Bacteria 5550
1005 Ga0500555_003330 3300053103 Bacteria 4578
1006 Ga0500556_0002461 3300053104 Bacteria 5925
1007 Ga0500560_000388 3300053107 Bacteria 5900
1008 Ga0500562_002731 3300053108 Bacteria 4391
1009 Ga0500571_000006 3300053110 Bacteria 105538
1010 Ga0500593_028570 3300053117 Bacteria 2492
1011 Ga0500594_0000582 3300053118 Bacteria 7824
1012 Ga0500594_0000989 3300053118 Bacteria 6106
1013 Ga0500594_0002126 3300053118 Bacteria 4281
1014 Ga0500594_0021165 3300053118 Bacteria 1629
1015 Ga0500595_001494 3300053119 Bacteria 12428
1016 Ga0500597_002295 3300053120 Bacteria 5262
1017 Ga0500597_022646 3300053120 Bacteria 2502
1018 Ga0500607_006253 3300053121 Bacteria 7575
1019 Ga0500608_000239 3300053122 Bacteria 21608
1020 Ga0500608_000822 3300053122 Bacteria 11255
1021 Ga0500608_015072 3300053122 Bacteria 3464
1022 Ga0500618_000180 3300053125 Bacteria 52492
1023 Ga0500618_000668 3300053125 Bacteria 20211
1024 Ga0500618_001256 3300053125 Bacteria 11822
1025 Ga0500618_003845 3300053125 Bacteria 5007
1026 Ga0500626_013034 3300053128 Bacteria 3571
1027 Ga0500642_0000670 3300053130 Bacteria 10129
1028 Ga0500655_000132 3300053133 Bacteria 18802
1029 Ga0500655_000261 3300053133 Bacteria 12327
1030 Ga0500658_0000091 3300053134 Bacteria 41865
1031 Ga0500658_0000454 3300053134 Bacteria 17444
1032 Ga0500559_0000153 3300053136 Bacteria 54641
1033 Ga0500559_0000468 3300053136 Bacteria 28756
1034 Ga0500559_0003841 3300053136 Bacteria 7270
1035 Ga0500559_0015234 3300053136 Bacteria 3247
1036 Ga0500561_0000021 3300053137 Bacteria 39116
1037 Ga0500561_0001277 3300053137 Bacteria 4091
1038 Ga0500564_000129 3300053138 Bacteria 19265
1039 Ga0500564_031444 3300053138 Bacteria 2446
1040 Ga0500568_0000184 3300053139 Bacteria 55068
1041 Ga0500568_0005014 3300053139 Bacteria 6941
1042 Ga0500568_0016763 3300053139 Bacteria 3246
1043 Ga0500574_000035 3300053141 Bacteria 16935
1044 Ga0500574_000520 3300053141 Bacteria 4932
1045 Ga0500577_0027443 3300053142 Bacteria 1950
1046 Ga0500590_008115 3300053148 Bacteria 5224
1047 Ga0500590_013494 3300053148 Bacteria 4195
1048 Ga0500590_019355 3300053148 Bacteria 3528
1049 Ga0500616_0002258 3300053153 Bacteria 16380
1050 Ga0500616_0011006 3300053153 Bacteria 5383
1051 Ga0500616_0015599 3300053153 Bacteria 4340
1052 Ga0500616_0016864 3300053153 Bacteria 4149
1053 Ga0500619_000799 3300053154 Bacteria 5368
1054 Ga0500622_0000580 3300053156 Bacteria 33130
1055 Ga0500622_0003907 3300053156 Bacteria 9645
1056 Ga0500622_0006686 3300053156 Bacteria 6645
1057 Ga0500622_0009149 3300053156 Bacteria 5498
1058 Ga0500622_0015900 3300053156 Bacteria 4028
1059 Ga0500624_000002 3300053157 Bacteria 257900
1060 Ga0500624_000071 3300053157 Bacteria 58740
1061 Ga0500624_000211 3300053157 Bacteria 22021
1062 Ga0500624_001240 3300053157 Bacteria 4522
1063 Ga0500627_0024273 3300053158 Bacteria 2479
1064 Ga0500634_0000040 3300053161 Bacteria 59608
1065 Ga0500634_0000051 3300053161 Bacteria 52447
1066 Ga0500634_0030639 3300053161 Bacteria 2932
1067 Ga0500634_0036009 3300053161 Bacteria 2695
1068 Ga0500638_000049 3300053162 Bacteria 27994
1069 Ga0500636_0000596 3300053177 Bacteria 19728
1070 Ga0500636_0021086 3300053177 Bacteria 3859
1071 Ga0500636_0063244 3300053177 Bacteria 2157
1072 Ga0500637_0090764 3300053178 Bacteria 1769
1073 Ga0500567_019951 3300053723 Bacteria 3223
1074 Ga0500570_016713 3300053724 Bacteria 4111
1075 Ga0500596_001499 3300053735 Bacteria 4728
1076 Ga0501084_0178011 3300054114 Bacteria 1795
1077 Ga0501084_0242971 3300054114 Bacteria 1520
1078 Ga0501084_0267019 3300054114 Bacteria 1445
1079 Ga0500661_000041 3300055283 Bacteria 19487
1080 Ga0501082_0001697 3300060353 Bacteria 19418
1081 Ga0501082_0014699 3300060353 Bacteria 6742
1082 Ga0501082_0016188 3300060353 Bacteria 6418
1083 Ga0501082_0135197 3300060353 Bacteria 2139
1084 Ga0501082_0358940 3300060353 Bacteria 1271
1085 2509386250 2509276021 Bacteria 7634384
1086 2509441661 2509276033 Bacteria 7180565
1087 2510137749 2510065019 Bacteria 6903379
1088 2510893606 2510461076 Bacteria 8618824
1089 2511122929 2510917020 Bacteria 5657507
1090 2511182627 2510917028 Bacteria 6185411
1091 2511195208 2510917030 Bacteria 7460662
1092 2511391757 2511231027 Bacteria 5013807
1093 2512643188 2512564014 Bacteria 4639632
1094 2513226931 2513020051 Bacteria 6053213
1095 2513571808 2513237084 Bacteria 7231967
1096 2513576130 2513237085 Bacteria 7695351
1097 2513592283 2513237087 Bacteria 5817514
1098 2513597964 2513237088 Bacteria 6927906
1099 2513635307 2513237093 Bacteria 7545552
1100 2513870037 2513237138 Bacteria 7368160
1101 2513909991 2513237144 Bacteria 7530820
1102 2514018943 2513237162 Bacteria 7468464
1103 2515109332 2515075009 Bacteria 7288508
1104 2515633541 2515154113 Bacteria 7807172
1105 2515641576 2515154114 Bacteria 7848616
1106 2515660419 2515154116 Bacteria 7552979
1107 2515742445 2515154134 Bacteria 7220242
1108 2517042204 2516653077 Bacteria 7555578
1109 2517081591 2516653085 Bacteria 7346596
1110 2517099607 2517093000 Bacteria 7412387
1111 2517411805 2517287029 Bacteria 6905599
1112 2519459861 2519103095 Bacteria 6629912
1113 2520380133 2519899620 Bacteria 6499161
1114 2530650012 2529292951 Bacteria 6916614
1115 2535486480 2534681786 Bacteria 3308809
1116 2535516953 2534681796 Bacteria 7146037
1117 2537875701 2537561587 Bacteria 5425293
1118 2554244871 2554235003 Bacteria 5877155
1119 2559297295 2558860242 Bacteria 5568029
1120 2585146548 2582581279 Bacteria 4980720
1121 2585151668 2582581280 Bacteria 5994497
1122 2585195458 2582581293 Bacteria 5907401
1123 2585202131 2582581294 Bacteria 6626667
1124 2585222322 2582581298 Bacteria 7315509
1125 2585228370 2582581299 Bacteria 6518058
1126 2585258416 2582581304 Bacteria 5831370
1127 2585259731 2582581305 Bacteria 4895574
1128 2585275218 2582581307 Bacteria 6597605
1129 2585290623 2582581311 Bacteria 6763856
1130 2585327202 2582581315 Bacteria 7318924
1131 2585329233 2582581315 Bacteria 7318924
1132 2585335212 2582581316 Bacteria 7774528
1133 2585336667 2582581316 Bacteria 7774528
1134 2585400805 2582581867 Bacteria 7184437
1135 2585528667 2585427526 Bacteria 7258840
1136 2585536800 2585427527 Bacteria 7273426
1137 2585539335 2585427528 Bacteria 6842387
1138 2585544726 2585427529 Bacteria 7395659
1139 2585556500 2585427530 Bacteria 7383882
1140 2585557364 2585427530 Bacteria 7383882
1141 2585561067 2585427531 Bacteria 6992870
1142 2585822293 2585427590 Bacteria 6824633
1143 2585837289 2585427593 Bacteria 7141551
1144 2585843321 2585427594 Bacteria 6180594
1145 2585900864 2585427608 Bacteria 6544331
1146 2585908343 2585427609 Bacteria 6667127
1147 2587917679 2585428106 Bacteria 5179711
1148 2587983622 2585428125 Bacteria 6662905
1149 2599605843 2599185210 Bacteria 5624189
1150 2599625788 2599185214 Bacteria 8209958
1151 2599677465 2599185226 Bacteria 8233575
1152 2599684022 2599185227 Bacteria 8246414
1153 2599697253 2599185229 Bacteria 8216126
1154 2600202729 2599185354 Bacteria 4398675
1155 2600228672 2599185359 Bacteria 4772316
1156 2600376285 2600254933 Bacteria 4750527
1157 2601611602 2600255279 Bacteria 5605316
1158 2601669863 2600255292 Bacteria 6300551
1159 2601748846 2600255308 Bacteria 5611129
1160 2616294408 2615840624 Bacteria 6557588
1161 2616551991 2615840698 Bacteria 7319877
1162 2617382919 2617270742 Bacteria 6808054
1163 2643749169 2643221545 Bacteria 5083237
1164 2643781284 2643221552 Bacteria 5708754
1165 2643908356 2643221579 Bacteria 4443405
1166 2643909525 2643221580 Bacteria 3816678
1167 2643914658 2643221581 Bacteria 3893603
1168 2643921836 2643221582 Bacteria 5804683
1169 2643922867 2643221583 Bacteria 5218014
1170 2643927135 2643221584 Bacteria 5511711
1171 2643964354 2643221591 Bacteria 4397626
1172 2644007180 2643221599 Bacteria 6292121
1173 2644164329 2643221629 Bacteria 5850260
1174 2644193598 2643221634 Bacteria 6705461
1175 2644226803 2643221640 Bacteria 5258820
1176 2644233728 2643221642 Bacteria 5357871
1177 2644242425 2643221643 Bacteria 5749658
1178 2644328703 2643221658 Bacteria 6064537
1179 2644346398 2643221662 Bacteria 5851492
1180 2644398024 2643221672 Bacteria 6322190
1181 2644411094 2643221674 Bacteria 3919126
1182 2644469273 2643221683 Bacteria 5749203
1183 2644509056 2643221691 Bacteria 5093099
1184 2644519804 2643221693 Bacteria 5513853
1185 2671116239 2667528174 Bacteria 6435400
1186 2671692138 2671180139 Bacteria 4196045
1187 2719184642 2718217882 Bacteria 6556348
1188 2719389083 2718217927 Bacteria 6972593
1189 2719668447 2718217997 Bacteria 6740740
1190 2719728662 2718218009 Bacteria 6478651
1191 2720489140 2718218199 Bacteria 6740745
1192 2720609833 2718218232 Bacteria 6720332
1193 2720617263 2718218233 Bacteria 6662049
1194 2720628405 2718218235 Bacteria 6630699
1195 2721144353 2718218363 Bacteria 6524337
1196 2721161148 2718218365 Bacteria 6274507
1197 2721161723 2718218366 Bacteria 6425255
1198 2721402602 2718218423 Bacteria 6438183
1199 2722842868 2721755514 Bacteria 6424414
1200 2722884914 2721755523 Bacteria 6430384
1201 2723029779 2721755556 Bacteria 6745503
1202 2723564148 2721755684 Bacteria 6859907
1203 2723570158 2721755685 Bacteria 6704835
1204 2724034668 2721755809 Bacteria 6438790
1205 2724041687 2721755810 Bacteria 6479005
1206 2724101705 2721755822 Bacteria 6726041
1207 2724112762 2721755823 Bacteria 6752556
1208 2725948148 2724679232 Bacteria 7646494
1209 2728748888 2728368998 Bacteria 8720350
1210 2730110312 2728369352 Bacteria 6745171
1211 2730160757 2728369365 Bacteria 6555560
1212 2730301256 2728369397 Bacteria 6274511
1213 2738708860 2738541275 Bacteria 4830863
1214 2738712386 2738541275 Bacteria 4830863
1215 2738722211 2738541277 Bacteria 7458140
1216 2738800175 2738541293 Bacteria 7065685
1217 2738847285 2738541301 Bacteria 4834102
1218 2738850811 2738541301 Bacteria 4834102
1219 2738863014 2738541304 Bacteria 4833665
1220 2738866540 2738541304 Bacteria 4833665
1221 2738881300 2738541307 Bacteria 8606193
1222 2739033786 2738541333 Bacteria 7106503
1223 2739252598 2738543013 Bacteria 5618633
1224 2739282575 2738543019 Bacteria 7459457
1225 2739295532 2738543022 Bacteria 4835059
1226 2739299058 2738543022 Bacteria 4835059
1227 2739357210 2738543033 Bacteria 4833336
1228 2739360736 2738543033 Bacteria 4833336
1229 2753358241 2751185800 Bacteria 5467370
1230 2753763223 2751185897 Bacteria 5322941
1231 2753764518 2751185897 Bacteria 5322941
1232 2757569374 2757320392 Bacteria 3737298
1233 2758638982 2758568016 Bacteria 5645291
1234 2765466773 2765235802 Bacteria 5618596
1235 2766064861 2765235942 Bacteria 7445910
1236 2770196218 2767802442 Bacteria 5747986
1237 2776268409 2775506902 Bacteria 6208009
1238 2776285151 2775506904 Bacteria 5954060
1239 2776911308 2775507049 Bacteria 6284736
1240 2778175192 2775507266 Bacteria 7392367
1241 2792463669 2791355048 Bacteria 5832535
1242 2793297686 2791355256 Bacteria 6798008
1243 2793318067 2791355259 Bacteria 7254731
1244 2793322496 2791355260 Bacteria 6598818
1245 2793329256 2791355261 Bacteria 6661293
1246 2793336455 2791355262 Bacteria 6774204
1247 2793343692 2791355263 Bacteria 6872478
1248 2793345531 2791355264 Bacteria 6429314
1249 2793356215 2791355265 Bacteria 6539969
1250 2793359934 2791355266 Bacteria 7116587
1251 2793368456 2791355267 Bacteria 7222458
1252 2805928582 2802429605 Bacteria 6875453
1253 2806045892 2802429633 Bacteria 7341974
1254 2806053466 2802429634 Bacteria 7083200
1255 2806061180 2802429635 Bacteria 7650140
1256 2806066166 2802429636 Bacteria 7597525
1257 2806073253 2802429637 Bacteria 7067217
1258 2808988747 2808606387 Bacteria 5697198
1259 2817262145 2816332253 Bacteria 6764532
1260 2817279846 2816332256 Bacteria 6891714
1261 2817455549 2816332286 Bacteria 6853759
1262 2819537486 2818991435 Bacteria 5433759
1263 2819554039 2818991438 Bacteria 5793701
1264 2819561389 2818991439 Bacteria 6907412
1265 2819596351 2818991446 Bacteria 7757362
1266 2819607618 2818991448 Bacteria 6772224
1267 2819641654 2818991453 Bacteria 7181617
1268 2819642476 2818991453 Bacteria 7181617
1269 2819646452 2818991454 Bacteria 5563326
1270 2819714530 2818991466 Bacteria 4748179
1271 2821444685 2821443989 Bacteria 7658172
1272 2828306901 2828305725 Bacteria 4916900
1273 2831270304 2831265667 Bacteria 7184833
1274 2834580455 2834578030 Bacteria 3530182
1275 2837652193 2837651117 Bacteria 3772164
1276 2838016337 2838016132 Bacteria 6577831
1277 2838024800 2838022645 Bacteria 6494267
1278 2838046931 2838042994 Bacteria 6046894
1279 2838049541 2838048938 Bacteria 6044578
1280 2838056535 2838054893 Bacteria 7451788
1281 2838065282 2838061910 Bacteria 6794874
1282 2838068872 2838068647 Bacteria 6208656
1283 2838667661 2838661181 Bacteria 7385261
1284 2838668943 2838668709 Bacteria 6671819
1285 2838679459 2838675328 Bacteria 4909118
1286 2838685780 2838680041 Bacteria 6545511
1287 2838688085 2838686498 Bacteria 7807632
1288 2838700362 2838694306 Bacteria 6853137
1289 2838701397 2838701080 Bacteria 6669771
1290 2838713617 2838707686 Bacteria 6619912
1291 2838718816 2838714209 Bacteria 5525906
1292 2838723814 2838719591 Bacteria 5523910
1293 2838729137 2838724970 Bacteria 4908691
1294 2838732263 2838729681 Bacteria 7400765
1295 2838745318 2838742623 Bacteria 7396178
1296 2839142227 2839138175 Bacteria 6549354
1297 2840765176 2840764183 Bacteria 6358399
1298 2840880432 2840878972 Bacteria 5483153
1299 2841851095 2841846520 Bacteria 5345850
1300 2841851826 2841851746 Bacteria 7532261
1301 2841863900 2841859092 Bacteria 5436171
1302 2841869436 2841864319 Bacteria 6742987
1303 2842082788 2842077413 Bacteria 6508645
1304 2842116137 2842110456 Bacteria 7656360
1305 2842123906 2842118031 Bacteria 7033875
1306 2842129834 2842124991 Bacteria 5346824
1307 2842134422 2842130223 Bacteria 4909145
1308 2842146538 2842146304 Bacteria 5957337
1309 2842156418 2842152218 Bacteria 4908957
1310 2842159099 2842156927 Bacteria 6894975
1311 2842165994 2842163707 Bacteria 6916235
1312 2842175061 2842170452 Bacteria 5525737
1313 2842179978 2842175837 Bacteria 4908771
1314 2842182713 2842180545 Bacteria 6888678
1315 2842191604 2842187318 Bacteria 5524014
1316 2842194073 2842192696 Bacteria 6147454
1317 2842200095 2842198810 Bacteria 6608673
1318 2842210691 2842205361 Bacteria 6340321
1319 2842215921 2842211629 Bacteria 5523832
1320 2842222880 2842217011 Bacteria 7497767
1321 2842228579 2842224351 Bacteria 5524473
1322 2842233077 2842229732 Bacteria 7475766
1323 2842243020 2842237096 Bacteria 6620661
1324 2842247494 2842243621 Bacteria 7421798
1325 2842251232 2842250916 Bacteria 6579627
1326 2842261417 2842257432 Bacteria 7401195
1327 2842265210 2842264693 Bacteria 6472963
1328 2842272967 2842271015 Bacteria 7807131
1329 2842284149 2842278818 Bacteria 6340002
1330 2842297103 2842291075 Bacteria 7076806
1331 2842309554 2842304105 Bacteria 7023636
1332 2842315851 2842311132 Bacteria 6616990
1333 2842319480 2842317721 Bacteria 6793725
1334 2842346148 2842341865 Bacteria 7003929
1335 2842367972 2842363717 Bacteria 6844742
1336 2842376433 2842370503 Bacteria 7038661
1337 2842383444 2842377471 Bacteria 7140707
1338 2842390663 2842384541 Bacteria 7057858
1339 2842399470 2842395702 Bacteria 6780583
1340 2842423018 2842422224 Bacteria 6239196
1341 2842428737 2842428310 Bacteria 6767288
1342 2842435350 2842434925 Bacteria 6502746
1343 2842441787 2842441272 Bacteria 6769273
1344 2842448169 2842447887 Bacteria 6754142
1345 2842463161 2842462802 Bacteria 6588055
1346 2842469681 2842469257 Bacteria 6752936
1347 2842490831 2842489311 Bacteria 6620893
1348 2842498757 2842495871 Bacteria 6820686
1349 2842515514 2842509118 Bacteria 6850950
1350 2842520682 2842515876 Bacteria 5436280
1351 2842736104 2842733646 Bacteria 5716726
1352 2842748215 2842747753 Bacteria 5578255
1353 2842776210 2842775625 Bacteria 5587290
1354 2842782660 2842780639 Bacteria 4337790
1355 2842876310 2842871566 Bacteria 4827117
1356 2843746526 2843744320 Bacteria 5659202
1357 2844461863 2844454524 Bacteria 7952546
1358 2849561760 2849560528 Bacteria 5393480
1359 2849575019 2849573788 Bacteria 5421256
1360 2851157855 2851153111 Bacteria 5542585
1361 2852390708 2852387548 Bacteria 8025568
1362 2854913233 2854911287 Bacteria 5582813
1363 2854916668 2854911287 Bacteria 5582813
1364 2857507083 2857504554 Bacteria 5369913
1365 2857522504 2857516855 Bacteria 7787325
1366 2857551070 2857547612 Bacteria 6179999
1367 2863427295 2863421361 Bacteria 7300805
1368 2879164967 2879163058 Bacteria 4223965
1369 2883295609 2883291878 Bacteria 5894118
1370 2884961807 2884960567 Bacteria 5437054
1371 2885082808 2885080285 Bacteria 6355622
1372 2885199475 2885198086 Bacteria 7212419
1373 2885213252 2885211737 Bacteria 7212420
1374 2891049916 2891048133 Bacteria 4447501
1375 2891092038 2891088606 Bacteria 4762464
1376 2894024823 2894023352 Bacteria 5167372
1377 2894657422 2894652903 Bacteria 4587256
1378 2895523444 2895522137 Bacteria 3284416
1379 2898332498 2898329390 Bacteria 5168154
1380 2899794946 2899792073 Bacteria 4926588
1381 2899850426 2899845264 Bacteria 5672268
1382 2899925736 2899924645 Bacteria 7487985
1383 2904454760 2904449895 Bacteria 6927402
1384 2904460314 2904456579 Bacteria 6819253
1385 2904481476 2904479285 Bacteria 5073931
1386 2904546404 2904541872 Bacteria 8915136
1387 2904567679 2904564687 Bacteria 7609577
1388 2904574919 2904571731 Bacteria 7608790
1389 2904581703 2904578770 Bacteria 5302906
1390 2915652459 2915650412 Bacteria 4288180
1391 2919102887 2919100787 Bacteria 7710546
1392 2919118810 2919114240 Bacteria 5700270
1393 2919123367 2919119836 Bacteria 5208557
1394 2919141042 2919138771 Bacteria 5281312
1395 2919413915 2919408235 Bacteria 6149349
1396 2919480029 2919476304 Bacteria 5888696
1397 2919516561 2919513703 Bacteria 3844312
1398 2919678552 2919675420 Bacteria 3969095
1399 2923517086 2923516293 Bacteria 3716336
1400 2923559175 2923556063 Bacteria 6793593
1401 2926758169 2926754445 Bacteria 5964435
1402 2926764264 2926760298 Bacteria 5505990
1403 2928029192 2928027323 Bacteria 4382488
1404 2928038163 2928037797 Bacteria 7273642
1405 2928046232 2928044640 Bacteria 7271509
1406 2928053925 2928051484 Bacteria 7773759
1407 2928070853 2928064002 Bacteria 7419480
1408 2928076461 2928070936 Bacteria 8062541
1409 2928088756 2928084124 Bacteria 7159212
1410 2928102382 2928100450 Bacteria 4837635
1411 2928115953 2928115317 Bacteria 6477646
1412 2928162051 2928157003 Bacteria 7522202
1413 2928169281 2928163908 Bacteria 7561269
1414 2928526514 2928521798 Bacteria 4960112
1415 2928529032 2928526807 Bacteria 4760224
1416 2928536097 2928531327 Bacteria 5101314
1417 2928538990 2928536128 Bacteria 7657547
1418 2928961116 2928959182 Bacteria 4725774
1419 2928963296 2928959182 Bacteria 4725774
1420 2928968550 2928968154 Bacteria 4633371
1421 2928975389 2928972540 Bacteria 3058286
1422 2929164214 2929160207 Bacteria 9075316
1423 2929523802 2929520902 Bacteria 6765052
1424 2932404255 2932401849 Bacteria 4262978
1425 2932413352 2932410948 Bacteria 6312192
1426 2932417412 2932416698 Bacteria 6315112
1427 2932425832 2932422444 Bacteria 4678430
1428 2933011192 2933006813 Bacteria 4912075
1429 2933016269 2933011516 Bacteria 5439334
1430 2933019275 2933016740 Bacteria 6355406
1431 2933575999 2933570622 Bacteria 7023390
1432 2933592354 2933586486 Bacteria 7667493
1433 2933598981 2933594066 Bacteria 5594265
1434 2933599540 2933599457 Bacteria 5858799
1435 2935900226 2935894831 Bacteria 6620579
1436 2935906433 2935901341 Bacteria 7341747
1437 2936373668 2936367885 Bacteria 7324495
1438 2936378262 2936375103 Bacteria 6652732
1439 2936386709 2936381700 Bacteria 7006523
1440 2939670243 2939669807 Bacteria 5028511
1441 2946788456 2946787523 Bacteria 4366789
1442 2977241419 2977240413 Bacteria 3191065
1443 2979090635 2979089926 Bacteria 5670289
1444 2979096158 2979095461 Bacteria 5669583
1445 2979101686 2979100975 Bacteria 5423623
1446 2981992803 2981990288 Bacteria 7590678
1447 2984510361 2984509177 Bacteria 5274802
1448 2984518934 2984518228 Bacteria 5277463
1449 2984538710 2984537506 Bacteria 5277481
1450 2984555366 2984555340 Bacteria 4247089
1451 2984566495 2984564862 Bacteria 4339992
1452 2984605417 2984601300 Bacteria 5455244
1453 2993357534 2993356040 Bacteria 4247105
1454 2995395500 2995392953 Bacteria 4539380
1455 2996892961 2996887358 Bacteria 5795980
1456 2996895793 2996893221 Bacteria 5823108
1457 3000018432 3000017691 Bacteria 3772574
1458 3000868027 3000865235 Bacteria 3106258
1459 3002146084 3002141150 Bacteria 5254435
1460 3005422028 3005416602 Bacteria 7064308
1461 3005450832 3005445848 Bacteria 6906074
1462 3005454760 3005452660 Bacteria 5889319
1463 639645819 639633055 Bacteria 7751309
1464 642418054 641736154 Bacteria 7689995
1465 650843726 650716007 Bacteria 5573770
1466 8003574013 8003570095 Bacteria 5747666
1467 8005259273 8005258706 Bacteria 6184835
1468 8005276502 8005275841 Bacteria 6929066
1469 8005288714 8005282627 Bacteria 6675747
1470 8005290087 8005289223 Bacteria 6634003
1471 8005311665 8005307578 Bacteria 7395396
1472 8005321309 8005314921 Bacteria 7072929
1473 8005327488 8005321885 Bacteria 5795980
1474 8005382407 8005376324 Bacteria 6590079
1475 8005384430 8005382845 Bacteria 6732062
1476 8005397746 8005395548 Bacteria 6806915
1477 8005431823 8005430974 Bacteria 6689030
1478 8005489929 8005484373 Bacteria 6297373
1479 8005502654 8005497431 Bacteria 6477605
1480 8005545764 8005542996 Bacteria 7077758
1481 8005558680 8005556819 Bacteria 6908598
1482 8005563650 8005563573 Bacteria 7153261
1483 8005576434 8005570704 Bacteria 6957481
1484 8005623862 8005619151 Bacteria 7030230
1485 8005629118 8005626139 Bacteria 6534237
1486 8005645504 8005645114 Bacteria 6950293
1487 8005650814 8005645114 Bacteria 6950293
1488 8005661907 8005658619 Bacteria 4500593
1489 8005674083 8005668836 Bacteria 6953162
1490 8005700552 8005695170 Bacteria 6912330
1491 8018129007 8018127388 Bacteria 7351159
1492 8018154273 8018150411 Bacteria 5549903
1493 8018164034 8018163183 Bacteria 7277977
1494 8018177519 8018176218 Bacteria 6896178
1495 8020814249 8020807995 Bacteria 6801506
1496 8020940009 8020938398 Bacteria 7472757
1497 8020954708 8020953355 Bacteria 7439080
1498 8023686202 8023680758 Bacteria 7729763
1499 8024486433 8024479707 Bacteria 6954785
1500 8024487205 8024486573 Bacteria 6540512
1501 8024501888 8024501048 Bacteria 6427847
1502 8039104492 8039098773 Bacteria 6602928
1503 8040172104 8040167225 Bacteria 6542727
1504 8040173987 8040173305 Bacteria 6827067
1505 8046770501 8046767195 Bacteria 7547379
1506 8055435275 8055431914 Bacteria 4551896
1507 8056376390 8056375014 Bacteria 7006639
1508 8056383769 8056382006 Bacteria 6408074
1509 8057104045 8057101203 Bacteria 5034064
1510 8057576628 8057575449 Bacteria 7367519
1511 8057876853 8057874678 Bacteria 7494653
1512 Ga0207657_10155384
1513 JGI24741J21665_1000428
1514 JGI24741J21665_1000868
1515 JGI24740J21852_10003471
1516 JGI24740J21852_10020346
1517 JGI24739J22299_10001341
1518 JGI24739J22299_10004190
1519 JGI24737J22298_10000205
1520 JGI24735J21928_10022322
1521 JGI25162J39368_1000238
1522 JGI25152J39213_1002339
1523 JGI25152J39213_1002961
1524 JGI25152J39213_1003510
1525 JGI25152J39213_1006276
1526 JGI25152J39213_1006995
1527 JGI25150J39212_1000454
1528 JGI25150J39212_1001788
1529 JGI25150J39212_1002046
1530 JGI25150J39212_1005929
1531 JGI25159J45721_1000205
1532 JGI25159J45721_1000661
1533 JGI25151J46595_10000113
1534 JGI25151J46595_10000201
1535 JGI25151J46595_10002405
1536 JGI25151J46595_10004654
1537 JGI25151J46595_10004891
1538 JGI25151J46595_10008211
1539 JGI25151J46595_10009462
1540 JGI25165J46597_1000198
1541 JGI25165J46597_1000722
1542 JGI25165J46597_1002928
1543 JGI25165J46597_1003327
1544 JGI25153J46596_10000838
1545 JGI25153J46596_10005656
1546 JGI25153J46596_10006518
1547 JGI25153J46596_10013182
1548 JGI25153J46596_10014260
1549 rootH2_10019603
1550 rootH2_10019800
1551 rootH2_10026203
1552 rootH2_10051955
1553 rootH2_10064180
1554 rootH2_10110706
1555 rootH2_10263165
1556 rootL2_10000041
1557 rootL2_10008082
1558 rootL2_10044988
1559 rootL2_10243571
1560 rootH1_10049778
1561 JGI25160J50197_1000001
1562 JGI25160J50197_1001703
1563 JGI25160J50197_1005268
1564 JGI25160J50197_1008255
1565 JGI25161J50226_1000001
1566 JGI25161J50226_1000289
1567 JGI25161J50226_1003049
1568 Ga0006562J51391_1006860
1569 Ga0006562J51391_1010099
1570 Ga0006562J51391_1023697
1571 Ga0006562J51391_1076958
1572 Ga0006562J51391_1126239
1573 Ga0055532_1001435
1574 Ga0055535_1000537
1575 Ga0055542_1000378
1576 Ga0055542_1005522
1577 Ga0055542_1005980
1578 Ga0055529_1000758
1579 Ga0055526_1000513
1580 Ga0055526_1001716
1581 Ga0055526_1003200
1582 Ga0055526_1007655
1583 Ga0055526_1024485
1584 Ga0055524_1002072
1585 Ga0055524_1002429
1586 Ga0055524_1003530
1587 Ga0055524_1009778
1588 Ga0055524_1014768
1589 Ga0055524_1021336
1590 Ga0055536_1000367
1591 Ga0055536_1001335
1592 Ga0055536_1011881
1593 Ga0055536_1013976
1594 Ga0055536_1014247
1595 Ga0055534_1000528
1596 Ga0055528_1000109
1597 Ga0055528_1000243
1598 Ga0055528_1003440
1599 Ga0055528_1004308
1600 Ga0055528_1004616
1601 Ga0055528_1013526
1602 Ga0055530_10000772
1603 Ga0055530_10002375
1604 Ga0055530_10025240
1605 Ga0055530_10033990
1606 Ga0055540_1000695
1607 Ga0055540_1001122
1608 Ga0055540_1009808
1609 Ga0055531_10001330
1610 Ga0055531_10002874
1611 Ga0055531_10004218
1612 Ga0055531_10006570
1613 Ga0055531_10008536
1614 Ga0058692_1001219
1615 Ga0058692_1001492
1616 Ga0055543_1000023
1617 Ga0055543_1000089
1618 Ga0065165_1000008
1619 Ga0065165_1002567
1620 Ga0065165_1003159
1621 Ga0065165_1004507
1622 Ga0065165_1020294
1623 Ga0065704_10009095
1624 Ga0070658_10017121
1625 Ga0070658_10072771
1626 Ga0070670_100003836
1627 Ga0070666_10000489
1628 Ga0070660_100000001
1629 Ga0070691_10008314
1630 Ga0070661_100005583
1631 Ga0070661_100047773
1632 Ga0070668_100000951
1633 Ga0070668_100063622
1634 Ga0070668_100098134
1635 Ga0070669_100087075
1636 Ga0070669_100159210
1637 Ga0070675_100011142
1638 Ga0070671_100038181
1639 Ga0070674_100104529
1640 Ga0070674_100121632
1641 Ga0070667_100000202
1642 Ga0070667_100069642
1643 Ga0070667_100305905
1644 Ga0070709_10000184
1645 Ga0070663_100000078
1646 Ga0070663_100003655
1647 Ga0070678_100026881
1648 Ga0070678_100057252
1649 Ga0070681_10116633
1650 Ga0068853_100008803
1651 Ga0068853_100020228
1652 Ga0068853_100072784
1653 Ga0068853_100211697
1654 Ga0070672_100000181
1655 Ga0070665_100006150
1656 Ga0070665_100006563
1657 Ga0070665_100137401
1658 Ga0068855_100010767
1659 Ga0068855_100021482
1660 Ga0068855_100038667
1661 Ga0068855_100277451
1662 Ga0068855_100331974
1663 Ga0070664_100003704
1664 Ga0070664_100004146
1665 Ga0068857_100025243
1666 Ga0068854_100125748
1667 Ga0068856_100002978
1668 Ga0068856_100101326
1669 Ga0068856_100194770
1670 Ga0068852_100014873
1671 Ga0068852_100023291
1672 Ga0068852_100149202
1673 Ga0068859_100242909
1674 Ga0068864_100040752
1675 Ga0068864_100094806
1676 Ga0068861_100184990
1677 Ga0068851_10008273
1678 Ga0068851_10014019
1679 Ga0068863_100001922
1680 Ga0068863_100085818
1681 Ga0068858_100016145
1682 Ga0068858_100105015
1683 Ga0075365_10003546
1684 Ga0075365_10054061
1685 Ga0075365_10126580
1686 Ga0075368_10000685
1687 Ga0075368_10002173
1688 Ga0075363_100006947
1689 Ga0075363_100038875
1690 Ga0075364_10085358
1691 Ga0075364_10099076
1692 Ga0075362_10001502
1693 Ga0075362_10030828
1694 Ga0075367_10000830
1695 Ga0075367_10024181
1696 Ga0075367_10069970
1697 Ga0075367_10118711
1698 Ga0075369_10004003
1699 Ga0075369_10012656
1700 Ga0075366_10007556
1701 Ga0075366_10031365
1702 Ga0075366_10034852
1703 Ga0075366_10177884
1704 Ga0097621_100020431
1705 Ga0097621_100029468
1706 Ga0075370_10002015
1707 Ga0075370_10039891
1708 Ga0075370_10108261
1709 Ga0075370_10138093
1710 Ga0068871_100043413
1711 Ga0075431_100003896
1712 Ga0075429_100033155
1713 Ga0097620_100242902
1714 Ga0079104_1000098
1715 Ga0079104_1004606
1716 Ga0099826_10002179
1717 Ga0099826_10025592
1718 Ga0105251_10002576
1719 Ga0105250_10002823
1720 Ga0105240_10000287
1721 Ga0105240_10005351
1722 Ga0105240_10010309
1723 Ga0105240_10121147
1724 Ga0105245_10170034
1725 Ga0105243_10000536
1726 Ga0105243_10006193
1727 Ga0105241_10033388
1728 Ga0105241_10298240
1729 Ga0105242_10011693
1730 Ga0105242_10033155
1731 Ga0105242_10338053
1732 Ga0105248_10036416
1733 Ga0105237_10008586
1734 Ga0105237_10012980
1735 Ga0105237_10031795
1736 Ga0105237_10041529
1737 Ga0105238_10018532
1738 Ga0105238_10082420
1739 Ga0105238_10113255
1740 Ga0105238_10239979
1741 Ga0105249_10142837
1742 Ga0123341_1069336
1743 Ga0123342_1010365
1744 Ga0105239_10002709
1745 Ga0105239_10157019
1746 Ga0105239_10160954
1747 Ga0157373_10016155
1748 Ga0157373_10109767
1749 Ga0157371_10000018
1750 Ga0157371_10000219
1751 Ga0157370_10002266
1752 Ga0157370_10106353
1753 Ga0157370_10121460
1754 Ga0157369_10002426
1755 Ga0157369_10057634
1756 Ga0157369_10114225
1757 Ga0157378_10063839
1758 Ga0163162_10027351
1759 Ga0157372_10004734
1760 Ga0157372_10013381
1761 Ga0157375_10047086
1762 Ga0157375_10129812
1763 Ga0163163_10077400
1764 Ga0157380_10062652
1765 Ga0182008_10000330
1766 Ga0182008_10001836
1767 Ga0182008_10005195
1768 Ga0182008_10007938
1769 Ga0182008_10030817
1770 Ga0157379_10072549
1771 Ga0157379_10105858
1772 Ga0157376_10017836
1773 Ga0182006_1000035
1774 Ga0182006_1000054
1775 Ga0182006_1016546
1776 Ga0182006_1057876
1777 Ga0182007_10000678
1778 Ga0182007_10004694
1779 Ga0182007_10040059
1780 Ga0182005_1000012
1781 Ga0182005_1000025
1782 Ga0182005_1000606
1783 Ga0182005_1005953
1784 Ga0182005_1012661
1785 Ga0182005_1033924
1786 Ga0183362_10001
1787 Ga0183362_10008
1788 Ga0183363_1001
1789 Ga0163161_10001155
1790 Ga0213876_10082588
1791 Ga0209436_100053
1792 Ga0209436_103239
1793 Ga0209672_100046
1794 Ga0209672_100088
1795 Ga0209672_101237
1796 Ga0209147_100043
1797 Ga0209147_100130
1798 Ga0207427_105485
1799 Ga0209437_100042
1800 Ga0209437_100283
1801 Ga0209258_100023
1802 Ga0209258_100204
1803 Ga0209258_100449
1804 Ga0207425_1000055
1805 Ga0207425_1000688
1806 Ga0207425_1000968
1807 Ga0207425_1002682
1808 Ga0207425_1004908
1809 Ga0209677_103766
1810 Ga0209148_1000029
1811 Ga0209148_1000426
1812 Ga0209759_1008356
1813 Ga0209129_1000016
1814 Ga0209129_1000029
1815 Ga0209129_1000071
1816 Ga0209129_1000260
1817 Ga0209129_1004589
1818 Ga0209129_1005287
1819 Ga0209129_1006003
1820 Ga0209129_1006251
1821 Ga0209233_1000103
1822 Ga0209233_1000268
1823 Ga0209233_1000727
1824 Ga0209233_1001028
1825 Ga0209233_1004127
1826 Ga0209565_1000219
1827 Ga0209565_1001369
1828 Ga0209565_1015529
1829 Ga0209455_1000064
1830 Ga0209673_1000005
1831 Ga0209673_1000020
1832 Ga0209673_1000084
1833 Ga0209673_1000178
1834 Ga0209673_1002733
1835 Ga0209673_1002949
1836 Ga0209673_1003012
1837 Ga0209673_1003061
1838 Ga0209673_1004140
1839 Ga0209130_1000003
1840 Ga0209130_1000031
1841 Ga0209130_1000351
1842 Ga0209130_1000647
1843 Ga0209130_1000747
1844 Ga0209130_1002983
1845 Ga0209130_1024438
1846 Ga0209675_1000513
1847 Ga0209675_1001145
1848 Ga0209675_1001475
1849 Ga0209675_1004603
1850 Ga0209675_1016459
1851 Ga0209676_1000005
1852 Ga0209676_1000043
1853 Ga0209676_1000434
1854 Ga0209676_1001197
1855 Ga0209676_1001276
1856 Ga0209676_1015783
1857 Ga0209025_1000070
1858 Ga0209025_1000072
1859 Ga0209025_1000420
1860 Ga0209025_1000585
1861 Ga0209025_1001269
1862 Ga0209025_1003196
1863 Ga0209025_1004321
1864 Ga0209025_1008163
1865 Ga0209025_1010572
1866 Ga0209025_1013743
1867 Ga0209025_1017154
1868 Ga0209025_1017358
1869 Ga0209025_1040547
1870 Ga0209564_1000114
1871 Ga0209564_1000292
1872 Ga0209564_1000334
1873 Ga0209564_1000826
1874 Ga0209564_1001317
1875 Ga0209564_1002143
1876 Ga0209564_1024316
1877 Ga0209758_1000027
1878 Ga0209758_1000053
1879 Ga0209758_1000094
1880 Ga0209758_1000461
1881 Ga0209758_1002484
1882 Ga0209758_1003539
1883 Ga0209758_1005109
1884 Ga0209758_1006177
1885 Ga0209758_1008115
1886 Ga0209758_1010898
1887 Ga0209050_1000007
1888 Ga0209050_1000140
1889 Ga0209050_1000542
1890 Ga0209050_1000793
1891 Ga0209050_1001099
1892 Ga0209050_1001296
1893 Ga0209050_1003464
1894 Ga0209050_1009326
1895 Ga0209050_1027362
1896 Ga0209256_1000038
1897 Ga0209256_1000081
1898 Ga0209256_1000123
1899 Ga0209256_1000549
1900 Ga0209256_1000829
1901 Ga0209256_1002527
1902 Ga0209256_1013922
1903 Ga0207426_1000011
1904 Ga0207426_1000027
1905 Ga0207426_1000035
1906 Ga0207426_1000042
1907 Ga0207426_1000102
1908 Ga0207426_1000176
1909 Ga0207426_1001714
1910 Ga0209051_1000009
1911 Ga0209051_1000070
1912 Ga0209051_1000174
1913 Ga0209051_1000262
1914 Ga0209051_1001475
1915 Ga0209051_1001909
1916 Ga0209051_1010909
1917 Ga0209051_1016117
1918 Ga0209051_1026386
1919 Ga0209257_1000011
1920 Ga0209257_1000036
1921 Ga0209257_1000134
1922 Ga0209257_1000139
1923 Ga0209257_1001762
1924 Ga0209257_1020896
1925 Ga0209257_1021395
1926 Ga0207656_10007996
1927 Ga0207656_10029674
1928 Ga0207655_1006242
1929 Ga0207680_10025347
1930 Ga0207647_10092886
1931 Ga0207705_10038218
1932 Ga0207654_10024639
1933 Ga0207707_10183999
1934 Ga0207695_10000319
1935 Ga0207695_10001005
1936 Ga0207695_10004444
1937 Ga0207695_10016767
1938 Ga0207695_10052878
1939 Ga0207671_10000078
1940 Ga0207671_10027278
1941 Ga0207671_10031978
1942 Ga0207671_10127765
1943 Ga0207657_10000022
1944 Ga0207657_10022271
1945 Ga0207649_10010156
1946 Ga0207652_10252622
1947 Ga0207681_10069007
1948 Ga0207694_10002426
1949 Ga0207694_10008678
1950 Ga0207694_10010847
1951 Ga0207694_10229305
1952 Ga0207650_10002818
1953 Ga0207659_10042912
1954 Ga0207644_10077791
1955 Ga0207644_10220949
1956 Ga0207690_10000010
1957 Ga0207706_10086492
1958 Ga0207706_10217274
1959 Ga0207686_10002865
1960 Ga0207686_10140396
1961 Ga0207709_10000105
1962 Ga0207709_10000242
1963 Ga0207709_10006000
1964 Ga0207665_10044658
1965 Ga0207691_10010950
1966 Ga0207711_10021600
1967 Ga0207667_10014672
1968 Ga0207667_10022590
1969 Ga0207667_10027895
1970 Ga0207651_10003219
1971 Ga0207712_10132343
1972 Ga0207668_10000663
1973 Ga0207668_10031490
1974 Ga0207640_10113022
1975 Ga0207658_10000154
1976 Ga0207703_10111213
1977 Ga0207639_10021827
1978 Ga0207639_10071462
1979 Ga0207639_10128498
1980 Ga0207678_10000226
1981 Ga0207678_10027749
1982 Ga0207678_10030480
1983 Ga0207702_10005708
1984 Ga0207702_10038679
1985 Ga0207641_10000054
1986 Ga0207676_10045625
1987 Ga0207674_10021921
1988 Ga0207674_10042976
1989 Ga0207675_100240399
1990 Ga0207683_10013526
1991 Ga0207698_10003332
1992 Ga0207698_10081751
1993 Ga0209281_1000002
1994 Ga0209281_1010273
1995 Ga0209371_1000035
1996 Ga0209371_1000160
1997 Ga0209371_1001218
1998 Ga0209371_1001639
1999 Ga0209282_1000173
2000 Ga0209282_1005950
2001 Ga0209813_10000215
2002 Ga0268266_10002177
2003 Ga0268266_10082078
2004 Ga0268266_10227971
2005 Ga0307515_10000048
2006 Ga0307515_10000954
2007 Ga0307515_10001052
2008 Ga0307515_10010434
2009 Ga0265338_10004781
2010 Ga0265338_10007818
2011 Ga0265338_10011970
2012 Ga0265338_10062579
2013 Ga0265338_10065581
2014 Ga0265338_10192152
2015 Ga0268256_1000037
2016 Ga0268256_1000132
2017 Ga0268256_1003221
2018 Ga0268256_1008081
2019 Ga0307511_10025370
2020 Ga0307511_10082801
2021 Ga0316181_1213357
2022 Ga0316181_1285884
2023 Ga0265330_10004426
2024 Ga0265332_10058669
2025 Ga0265328_10011738
2026 Ga0265328_10041103
2027 Ga0265325_10003718
2028 Ga0265325_10003973
2029 Ga0265325_10013188
2030 Ga0265325_10052025
2031 Ga0265340_10002162
2032 Ga0265340_10002326
2033 Ga0265340_10003981
2034 Ga0265340_10018290
2035 Ga0265340_10022268
2036 Ga0265340_10022680
2037 Ga0265340_10044175
2038 Ga0265339_10005013
2039 Ga0265339_10013146
2040 Ga0265339_10064610
2041 Ga0265331_10018245
2042 Ga0265331_10028166
2043 Ga0265327_10001863
2044 Ga0265316_10049210
2045 Ga0265316_10059724
2046 Ga0265316_10094710
2047 Ga0265316_10152372
2048 Ga0307513_10013362
2049 Ga0307408_100130656
2050 Ga0307408_100145099
2051 Ga0265313_10000044
2052 Ga0265313_10004103
2053 Ga0265313_10061981
2054 Ga0307514_10003805
2055 Ga0316575_10003555
2056 Ga0316575_10010065
2057 Ga0316579_10002372
2058 Ga0265314_10000511
2059 Ga0265314_10024073
2060 Ga0265314_10053032
2061 Ga0265342_10008325
2062 Ga0265342_10014034
2063 Ga0265342_10087258
2064 Ga0316576_10016969
2065 Ga0316576_10055503
2066 Ga0316576_10070765
2067 Ga0307405_10097588
2068 Ga0316577_10036915
2069 Ga0316577_10037416
2070 Ga0307406_10005083
2071 Ga0307406_10295922
2072 Ga0307412_10001246
2073 Ga0307412_10002096
2074 Ga0307409_100111731
2075 Ga0307414_10044972
2076 Ga0316580_10010209
2077 Ga0307510_10004106
2078 Ga0307510_10067470
2079 Ga0373936_0057357
2080 Ga0373954_0015168
2081 Ga0373946_0017767
2082 Ga0373955_0020854
2083 Ga0316574_0027709
2084 Ga0316574_0117079
2085 Ga0373927_0003123
2086 Ga0373937_0116989
2087 Ga0373937_0142382
2088 Ga0316582_0018679
2089 Ga0316582_0044438
2090 Ga0316582_0059912
2091 Ga0316584_0023996
2092 Ga0316584_0058064
2093 Ga0316584_0076928
2094 Ga0373925_0000230
2095 Ga0395899_0000058
2096 Ga0395900_0000056
2097 Ga0395900_0038585
2098 Ga0395898_0000114
2099 Ga0395905_0000053
2100 Ga0316581_0019574
2101 Ga0395901_0000037
2102 Ga0400488_36896
2103 Ga0237816_00091
2104 Ga0436360_0650990
2105 Ga0436361_0473951
2106 Ga0439466_0009742
2107 Ga0439465_0010686
2108 Ga0451837_0233771
2109 Ga0451837_0285545
2110 Ga0451849_0629807
2111 Ga0451843_0088258
2112 Ga0439432_009880
2113 Ga0439449_0002907
2114 Ga0439452_009011
2115 Ga0439457_005237
2116 Ga0439462_0018070
2117 Ga0450911_001695
2118 Ga0450896_005461
2119 Ga0450904_000283
2120 Ga0439435_0006747
2121 Ga0495617_002663
2122 Ga0495627_000103
2123 Ga0495627_000509
2124 Ga0495627_028465
2125 Ga0495590_0001131
2126 Ga0495638_0000145
2127 Ga0495638_0000958
2128 Ga0495638_0001006
2129 Ga0495638_0001202
2130 Ga0495638_0001620
2131 Ga0495638_0003751
2132 Ga0495638_0014027
2133 Ga0495638_0072870
2134 Ga0495638_0084717
2135 Ga0495650_0000015
2136 Ga0495650_0000403
2137 Ga0495650_0017525
2138 Ga0495605_0001139
2139 Ga0495605_0080377
2140 Ga0495639_0025635
2141 Ga0495585_0005189
2142 Ga0495585_0024991
2143 Ga0495585_0089866
2144 Ga0495596_0000911
2145 Ga0495596_0080672
2146 Ga0495583_0000013
2147 Ga0495583_0010945
2148 Ga0495583_0026138
2149 Ga0495606_0007407
2150 Ga0495606_0008787
2151 Ga0495606_0025208
2152 Ga0495606_0025628
2153 Ga0495606_0059250
2154 Ga0495606_0117877
2155 Ga0495610_0000484
2156 Ga0495610_0000611
2157 Ga0495610_0001765
2158 Ga0495610_0001844
2159 Ga0495610_0002613
2160 Ga0495610_0004641
2161 Ga0495610_0012359
2162 Ga0495610_0017600
2163 Ga0495610_0023557
2164 Ga0495610_0028317
2165 Ga0495616_0000161
2166 Ga0495616_0000919
2167 Ga0495616_0040551
2168 Ga0495618_0039096
2169 Ga0495620_0000299
2170 Ga0495620_0025056
2171 Ga0495620_0052200
2172 Ga0495620_0054172
2173 Ga0495631_0000242
2174 Ga0495631_0019131
2175 Ga0495632_0008158
2176 Ga0495632_0011713
2177 Ga0495632_0048892
2178 Ga0495637_0021263
2179 Ga0495637_0026585
2180 Ga0495643_0001977
2181 Ga0495643_0003005
2182 Ga0495643_0108741
2183 Ga0495648_0000067
2184 Ga0495648_0001065
2185 Ga0495648_0030837
2186 Ga0495663_0000101
2187 Ga0495652_0216539
2188 Ga0495654_0000023
2189 Ga0495654_0001761
2190 Ga0495654_0101123
2191 Ga0495609_0035647
2192 Ga0495621_0029478
2193 Ga0495597_0000492
2194 Ga0495597_0018690
2195 Ga0495622_0013960
2196 Ga0495622_0060466
2197 Ga0495633_0001863
2198 Ga0495633_0003084
2199 Ga0495633_0035124
2200 Ga0495656_0000060
2201 Ga0495668_0000061
2202 Ga0495668_0013518
2203 Ga0495668_0015196
2204 Ga0495668_0020536
2205 Ga0495668_0028459
2206 Ga0495668_0053589
2207 Ga0495611_0000583
2208 Ga0495625_0000081
2209 Ga0495625_0000467
2210 Ga0495625_0000590
2211 Ga0495625_0001051
2212 Ga0495625_0015520
2213 Ga0495625_0021632
2214 Ga0495625_0050561
2215 Ga0495625_0061285
2216 Ga0495625_0081527
2217 Ga0495625_0110157
2218 Ga0495661_0003002
2219 Ga0495588_0001206
2220 Ga0495588_0029051
2221 Ga0495588_0077877
2222 Ga0495588_0079937
2223 Ga0495669_0036645
2224 Ga0495613_0000402
2225 Ga0495670_0000129
2226 Ga0495670_0028863
2227 Ga0495670_0064304
2228 Ga0495670_0070125
2229 Ga0495671_0000401
2230 Ga0495671_0031200
2231 Ga0495649_0000882
2232 Ga0495649_0011268
2233 Ga0495589_0008483
2234 Ga0495589_0068166
2235 Ga0495660_0002916
2236 Ga0495660_0039546
2237 Ga0495660_0056260
2238 Ga0495672_0000311
2239 Ga0495676_0087636
2240 Ga0495687_000478
2241 Ga0495687_000998
2242 Ga0495687_027903
2243 Ga0495687_030939
2244 Ga0495673_0000025
2245 Ga0495673_0001006
2246 Ga0495673_0014973
2247 Ga0495681_0000030
2248 Ga0495681_0000869
2249 Ga0495681_0001049
2250 Ga0495681_0022258
2251 Ga0495686_0000090
2252 Ga0495686_0000727
2253 Ga0495686_0001164
2254 Ga0495686_0049163
2255 Ga0495686_0050970
2256 Ga0495593_0096536
2257 Ga0495602_0155231
2258 Ga0495602_0224854
2259 Ga0495626_0001860
2260 Ga0495626_0039656
2261 Ga0496101_0004597
2262 Ga0496102_0000385
2263 Ga0496102_0001748
2264 Ga0496102_0021528
2265 Ga0496102_0139498
2266 Ga0496103_0000209
2267 Ga0496103_0000703
2268 Ga0496104_0001767
2269 Ga0496104_0005945
2270 Ga0496104_0288662
2271 Ga0496105_0001117
2272 Ga0496105_0032341
2273 Ga0496105_0057687
2274 Ga0496106_0000401
2275 Ga0496106_0017263
2276 Ga0496106_0121927
2277 Ga0496106_0246342
2278 Ga0496107_0035349
2279 Ga0496107_0076031
2280 Ga0496107_0112285
2281 Ga0496110_0035676
2282 Ga0496114_0005812
2283 Ga0496114_0041609
2284 Ga0496115_0022154
2285 Ga0496116_0000062
2286 Ga0496116_0001460
2287 Ga0496116_0007741
2288 Ga0496116_0010441
2289 Ga0496116_0012133
2290 Ga0496116_0016387
2291 Ga0496116_0017849
2292 Ga0496116_0056679
2293 Ga0496117_0000045
2294 Ga0496117_0000066
2295 Ga0496117_0001080
2296 Ga0496117_0002119
2297 Ga0496117_0003250
2298 Ga0496117_0007799
2299 Ga0496117_0014192
2300 Ga0496117_0022559
2301 Ga0496117_0050930
2302 Ga0496118_0000041
2303 Ga0496118_0000231
2304 Ga0496118_0000497
2305 Ga0496118_0000561
2306 Ga0496118_0002482
2307 Ga0496118_0005916
2308 Ga0496118_0014108
2309 Ga0496118_0018380
2310 Ga0496118_0021514
2311 Ga0496118_0025226
2312 Ga0496118_0028785
2313 Ga0496118_0031555
2314 Ga0496118_0041471
2315 Ga0496118_0041807
2316 Ga0496118_0074909
2317 Ga0496119_0002703
2318 Ga0496119_0008017
2319 Ga0496119_0013561
2320 Ga0496119_0040019
2321 Ga0496119_0045344
2322 Ga0496119_0045765
2323 Ga0496119_0064237
2324 Ga0496119_0126967
2325 Ga0496120_0001197
2326 Ga0496120_0001661
2327 Ga0496120_0013133
2328 Ga0496120_0058088
2329 Ga0496120_0086808
2330 Ga0496121_0000990
2331 Ga0496121_0001249
2332 Ga0496121_0002673
2333 Ga0496121_0004008
2334 Ga0496121_0004980
2335 Ga0496121_0019150
2336 Ga0496121_0037990
2337 Ga0496121_0039385
2338 Ga0496121_0066541
2339 Ga0496121_0150762
2340 Ga0496121_0163224
2341 Ga0496122_0000057
2342 Ga0496122_0000579
2343 Ga0496122_0000718
2344 Ga0496122_0004459
2345 Ga0496122_0004784
2346 Ga0496122_0006181
2347 Ga0496122_0008213
2348 Ga0496122_0011055
2349 Ga0496122_0012724
2350 Ga0496122_0019899
2351 Ga0496122_0028233
2352 Ga0496122_0036023
2353 Ga0496122_0039278
2354 Ga0496122_0059795
2355 Ga0496122_0074549
2356 Ga0496123_0000096
2357 Ga0496123_0000179
2358 Ga0496123_0000428
2359 Ga0496123_0002144
2360 Ga0496123_0002829
2361 Ga0496123_0003479
2362 Ga0496123_0004959
2363 Ga0496123_0005053
2364 Ga0496123_0005681
2365 Ga0496123_0011274
2366 Ga0496123_0015141
2367 Ga0496123_0017974
2368 Ga0496123_0066114
2369 Ga0496123_0105865
2370 Ga0496123_0131298
2371 Ga0496124_0000006
2372 Ga0496124_0000588
2373 Ga0496124_0000644
2374 Ga0496124_0000813
2375 Ga0496124_0000897
2376 Ga0496124_0001421
2377 Ga0496124_0001631
2378 Ga0496124_0004388
2379 Ga0496124_0018086
2380 Ga0496124_0023641
2381 Ga0496124_0034544
2382 Ga0496124_0039691
2383 Ga0496124_0043714
2384 Ga0496124_0044693
2385 Ga0496124_0048363
2386 Ga0496124_0057752
2387 Ga0496124_0058422
2388 Ga0496124_0065372
2389 Ga0496124_0076507
2390 Ga0496125_0000318
2391 Ga0496125_0001090
2392 Ga0496125_0001200
2393 Ga0496125_0001577
2394 Ga0496125_0003923
2395 Ga0496125_0008338
2396 Ga0496125_0008349
2397 Ga0496125_0013329
2398 Ga0496125_0039154
2399 Ga0496125_0046907
2400 Ga0496125_0048422
2401 Ga0496125_0051484
2402 Ga0496125_0059397
2403 Ga0496125_0065919
2404 Ga0496125_0079283
2405 Ga0496125_0195527
2406 Ga0496126_0000709
2407 Ga0496126_0002250
2408 Ga0496126_0014469
2409 Ga0496126_0062411
2410 Ga0496126_0070130
2411 Ga0496126_0082813
2412 Ga0496126_0104752
2413 Ga0496126_0142679
2414 Ga0496126_0205755
2415 Ga0495678_000322
2416 Ga0495678_000635
2417 Ga0495678_001397
2418 Ga0495678_024602
2419 Ga0495682_0000331
2420 Ga0495682_0007156
2421 Ga0495682_0013879
2422 Ga0501031_0094921
2423 Ga0501032_0012101
2424 Ga0501032_0046891
2425 Ga0501033_0007222
2426 Ga0501033_0014076
2427 Ga0501033_0020908
2428 Ga0501033_0073535
2429 Ga0501034_0000275
2430 Ga0501034_0000807
2431 Ga0501034_0039444
2432 Ga0501034_0161269
2433 Ga0501036_0032236
2434 Ga0501037_0014435
2435 Ga0501039_0204687
2436 Ga0501043_0176544
2437 Ga0501046_0259957
2438 Ga0501047_0091562
2439 Ga0501047_0109842
2440 Ga0501047_0150091
2441 Ga0501047_0170986
2442 Ga0501047_0290171
2443 Ga0501048_0040037
2444 Ga0501067_0072028
2445 Ga0501070_0067116
2446 Ga0501070_0113508
2447 Ga0501074_0069892
2448 Ga0501238_000574
2449 Ga0501238_000970
2450 Ga0501080_0025836
2451 Ga0501080_0042029
2452 Ga0501080_0069681
2453 Ga0501080_0356703
2454 Ga0501080_0368457
2455 Ga0501083_0002409
2456 Ga0501083_0050941
2457 Ga0501083_0086916
2458 Ga0501083_0109637
2459 Ga0501035_0002715
2460 Ga0501035_0050611
2461 Ga0501035_0113585
2462 Ga0501044_0017501
2463 Ga0501044_0029598
2464 Ga0501044_0037902
2465 Ga0501044_0041412
2466 Ga0501044_0180042
2467 nmdc:mga03683_10597_c1
2468 nmdc:mga03683_9897_c1
2469 nmdc:mga03n38_11110_c1
2470 nmdc:mga03n38_575_c1
2471 nmdc:mga00v17_59_c1
2472 nmdc:mga00v17_86361_c1
2473 nmdc:mga0yw44_105281_c1
2474 nmdc:mga0yw44_92488_c1
2475 nmdc:mga0yw44_967_c1
2476 nmdc:mga0k408_24688_c1
2477 nmdc:mga0k408_47702_c1
2478 nmdc:mga0k408_48063_c1
2479 nmdc:mga0k408_75180_c1
2480 nmdc:mga06z11_148_c1
2481 nmdc:mga06z11_53795_c1
2482 nmdc:mga04h51_66_c1
2483 nmdc:mga07m45_1121_c1
2484 nmdc:mga07m45_18025_c1
2485 nmdc:mga07m45_2027_c1
2486 nmdc:mga07m45_26942_c1
2487 nmdc:mga07m45_55169_c1
2488 nmdc:mga07m45_59309_c1
2489 nmdc:mga06r32_3451_c1
2490 nmdc:mga0n895_81699_c1
2491 nmdc:mga0sz30_347_c1
2492 nmdc:mga0sz30_3843_c1
2493 nmdc:mga0sz30_43589_c1
2494 Ga0495601_0036273
2495 Ga0500610_0000931
2496 Ga0500610_0000952
2497 Ga0500610_0001112
2498 Ga0495595_0023883
2499 Ga0495619_0125571
2500 Ga0495619_0196499
2501 Ga0500578_0000161
2502 Ga0500578_0001023
2503 Ga0500643_000225
2504 Ga0500643_015238
2505 Ga0500643_016884
2506 Ga0500644_0000166
2507 Ga0500583_0000368
2508 Ga0500651_0000099
2509 Ga0500651_0001548
2510 Ga0500651_0014566
2511 Ga0500566_0090726
2512 Ga0500566_0135977
2513 Ga0500641_0097189
2514 Ga0500554_004148
2515 Ga0500555_002310
2516 Ga0500555_003330
2517 Ga0500556_0002461
2518 Ga0500560_000388
2519 Ga0500562_002731
2520 Ga0500571_000006
2521 Ga0500593_028570
2522 Ga0500594_0000582
2523 Ga0500594_0000989
2524 Ga0500594_0002126
2525 Ga0500594_0021165
2526 Ga0500595_001494
2527 Ga0500597_002295
2528 Ga0500597_022646
2529 Ga0500607_006253
2530 Ga0500608_000239
2531 Ga0500608_000822
2532 Ga0500608_015072
2533 Ga0500618_000180
2534 Ga0500618_000668
2535 Ga0500618_001256
2536 Ga0500618_003845
2537 Ga0500626_013034
2538 Ga0500642_0000670
2539 Ga0500655_000132
2540 Ga0500655_000261
2541 Ga0500658_0000091
2542 Ga0500658_0000454
2543 Ga0500559_0000153
2544 Ga0500559_0000468
2545 Ga0500559_0003841
2546 Ga0500559_0015234
2547 Ga0500561_0000021
2548 Ga0500561_0001277
2549 Ga0500564_000129
2550 Ga0500564_031444
2551 Ga0500568_0000184
2552 Ga0500568_0005014
2553 Ga0500568_0016763
2554 Ga0500574_000035
2555 Ga0500574_000520
2556 Ga0500577_0027443
2557 Ga0500590_008115
2558 Ga0500590_013494
2559 Ga0500590_019355
2560 Ga0500616_0002258
2561 Ga0500616_0011006
2562 Ga0500616_0015599
2563 Ga0500616_0016864
2564 Ga0500619_000799
2565 Ga0500622_0000580
2566 Ga0500622_0003907
2567 Ga0500622_0006686
2568 Ga0500622_0009149
2569 Ga0500622_0015900
2570 Ga0500624_000002
2571 Ga0500624_000071
2572 Ga0500624_000211
2573 Ga0500624_001240
2574 Ga0500627_0024273
2575 Ga0500634_0000040
2576 Ga0500634_0000051
2577 Ga0500634_0030639
2578 Ga0500634_0036009
2579 Ga0500638_000049
2580 Ga0500636_0000596
2581 Ga0500636_0021086
2582 Ga0500636_0063244
2583 Ga0500637_0090764
2584 Ga0500567_019951
2585 Ga0500570_016713
2586 Ga0500596_001499
2587 Ga0501084_0178011
2588 Ga0501084_0242971
2589 Ga0501084_0267019
2590 Ga0500661_000041
2591 Ga0501082_0001697
2592 Ga0501082_0014699
2593 Ga0501082_0016188
2594 Ga0501082_0135197
2595 Ga0501082_0358940
2596 2509386250
2597 2509441661
2598 2510137749
2599 2510893606
2600 2511122929
2601 2511182627
2602 2511195208
2603 2511391757
2604 2512643188
2605 2513226931
2606 2513571808
2607 2513576130
2608 2513592283
2609 2513597964
2610 2513635307
2611 2513870037
2612 2513909991
2613 2514018943
2614 2515109332
2615 2515633541
2616 2515641576
2617 2515660419
2618 2515742445
2619 2517042204
2620 2517081591
2621 2517099607
2622 2517411805
2623 2519459861
2624 2520380133
2625 2530650012
2626 2535486480
2627 2535516953
2628 2537875701
2629 2554244871
2630 2559297295
2631 2585146548
2632 2585151668
2633 2585195458
2634 2585202131
2635 2585222322
2636 2585228370
2637 2585258416
2638 2585259731
2639 2585275218
2640 2585290623
2641 2585327202
2642 2585329233
2643 2585335212
2644 2585336667
2645 2585400805
2646 2585528667
2647 2585536800
2648 2585539335
2649 2585544726
2650 2585556500
2651 2585557364
2652 2585561067
2653 2585822293
2654 2585837289
2655 2585843321
2656 2585900864
2657 2585908343
2658 2587917679
2659 2587983622
2660 2599605843
2661 2599625788
2662 2599677465
2663 2599684022
2664 2599697253
2665 2600202729
2666 2600228672
2667 2600376285
2668 2601611602
2669 2601669863
2670 2601748846
2671 2616294408
2672 2616551991
2673 2617382919
2674 2643749169
2675 2643781284
2676 2643908356
2677 2643909525
2678 2643914658
2679 2643921836
2680 2643922867
2681 2643927135
2682 2643964354
2683 2644007180
2684 2644164329
2685 2644193598
2686 2644226803
2687 2644233728
2688 2644242425
2689 2644328703
2690 2644346398
2691 2644398024
2692 2644411094
2693 2644469273
2694 2644509056
2695 2644519804
2696 2671116239
2697 2671692138
2698 2719184642
2699 2719389083
2700 2719668447
2701 2719728662
2702 2720489140
2703 2720609833
2704 2720617263
2705 2720628405
2706 2721144353
2707 2721161148
2708 2721161723
2709 2721402602
2710 2722842868
2711 2722884914
2712 2723029779
2713 2723564148
2714 2723570158
2715 2724034668
2716 2724041687
2717 2724101705
2718 2724112762
2719 2725948148
2720 2728748888
2721 2730110312
2722 2730160757
2723 2730301256
2724 2738708860
2725 2738712386
2726 2738722211
2727 2738800175
2728 2738847285
2729 2738850811
2730 2738863014
2731 2738866540
2732 2738881300
2733 2739033786
2734 2739252598
2735 2739282575
2736 2739295532
2737 2739299058
2738 2739357210
2739 2739360736
2740 2753358241
2741 2753763223
2742 2753764518
2743 2757569374
2744 2758638982
2745 2765466773
2746 2766064861
2747 2770196218
2748 2776268409
2749 2776285151
2750 2776911308
2751 2778175192
2752 2792463669
2753 2793297686
2754 2793318067
2755 2793322496
2756 2793329256
2757 2793336455
2758 2793343692
2759 2793345531
2760 2793356215
2761 2793359934
2762 2793368456
2763 2805928582
2764 2806045892
2765 2806053466
2766 2806061180
2767 2806066166
2768 2806073253
2769 2808988747
2770 2817262145
2771 2817279846
2772 2817455549
2773 2819537486
2774 2819554039
2775 2819561389
2776 2819596351
2777 2819607618
2778 2819641654
2779 2819642476
2780 2819646452
2781 2819714530
2782 2821444685
2783 2828306901
2784 2831270304
2785 2834580455
2786 2837652193
2787 2838016337
2788 2838024800
2789 2838046931
2790 2838049541
2791 2838056535
2792 2838065282
2793 2838068872
2794 2838667661
2795 2838668943
2796 2838679459
2797 2838685780
2798 2838688085
2799 2838700362
2800 2838701397
2801 2838713617
2802 2838718816
2803 2838723814
2804 2838729137
2805 2838732263
2806 2838745318
2807 2839142227
2808 2840765176
2809 2840880432
2810 2841851095
2811 2841851826
2812 2841863900
2813 2841869436
2814 2842082788
2815 2842116137
2816 2842123906
2817 2842129834
2818 2842134422
2819 2842146538
2820 2842156418
2821 2842159099
2822 2842165994
2823 2842175061
2824 2842179978
2825 2842182713
2826 2842191604
2827 2842194073
2828 2842200095
2829 2842210691
2830 2842215921
2831 2842222880
2832 2842228579
2833 2842233077
2834 2842243020
2835 2842247494
2836 2842251232
2837 2842261417
2838 2842265210
2839 2842272967
2840 2842284149
2841 2842297103
2842 2842309554
2843 2842315851
2844 2842319480
2845 2842346148
2846 2842367972
2847 2842376433
2848 2842383444
2849 2842390663
2850 2842399470
2851 2842423018
2852 2842428737
2853 2842435350
2854 2842441787
2855 2842448169
2856 2842463161
2857 2842469681
2858 2842490831
2859 2842498757
2860 2842515514
2861 2842520682
2862 2842736104
2863 2842748215
2864 2842776210
2865 2842782660
2866 2842876310
2867 2843746526
2868 2844461863
2869 2849561760
2870 2849575019
2871 2851157855
2872 2852390708
2873 2854913233
2874 2854916668
2875 2857507083
2876 2857522504
2877 2857551070
2878 2863427295
2879 2879164967
2880 2883295609
2881 2884961807
2882 2885082808
2883 2885199475
2884 2885213252
2885 2891049916
2886 2891092038
2887 2894024823
2888 2894657422
2889 2895523444
2890 2898332498
2891 2899794946
2892 2899850426
2893 2899925736
2894 2904454760
2895 2904460314
2896 2904481476
2897 2904546404
2898 2904567679
2899 2904574919
2900 2904581703
2901 2915652459
2902 2919102887
2903 2919118810
2904 2919123367
2905 2919141042
2906 2919413915
2907 2919480029
2908 2919516561
2909 2919678552
2910 2923517086
2911 2923559175
2912 2926758169
2913 2926764264
2914 2928029192
2915 2928038163
2916 2928046232
2917 2928053925
2918 2928070853
2919 2928076461
2920 2928088756
2921 2928102382
2922 2928115953
2923 2928162051
2924 2928169281
2925 2928526514
2926 2928529032
2927 2928536097
2928 2928538990
2929 2928961116
2930 2928963296
2931 2928968550
2932 2928975389
2933 2929164214
2934 2929523802
2935 2932404255
2936 2932413352
2937 2932417412
2938 2932425832
2939 2933011192
2940 2933016269
2941 2933019275
2942 2933575999
2943 2933592354
2944 2933598981
2945 2933599540
2946 2935900226
2947 2935906433
2948 2936373668
2949 2936378262
2950 2936386709
2951 2939670243
2952 2946788456
2953 2977241419
2954 2979090635
2955 2979096158
2956 2979101686
2957 2981992803
2958 2984510361
2959 2984518934
2960 2984538710
2961 2984555366
2962 2984566495
2963 2984605417
2964 2993357534
2965 2995395500
2966 2996892961
2967 2996895793
2968 3000018432
2969 3000868027
2970 3002146084
2971 3005422028
2972 3005450832
2973 3005454760
2974 639645819
2975 642418054
2976 650843726
2977 8003574013
2978 8005259273
2979 8005276502
2980 8005288714
2981 8005290087
2982 8005311665
2983 8005321309
2984 8005327488
2985 8005382407
2986 8005384430
2987 8005397746
2988 8005431823
2989 8005489929
2990 8005502654
2991 8005545764
2992 8005558680
2993 8005563650
2994 8005576434
2995 8005623862
2996 8005629118
2997 8005645504
2998 8005650814
2999 8005661907
3000 8005674083
3001 8005700552
3002 8018129007
3003 8018154273
3004 8018164034
3005 8018177519
3006 8020814249
3007 8020940009
3008 8020954708
3009 8023686202
3010 8024486433
3011 8024487205
3012 8024501888
3013 8039104492
3014 8040172104
3015 8040173987
3016 8046770501
3017 8055435275
3018 8056376390
3019 8056383769
3020 8057104045
3021 8057576628
3022 8057876853

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02322

Cyt_bd_oxida_II

Cytochrome bd terminal oxidase subunit II

63

408

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rko-assembly1.cif.gz_B cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution 0.9757 5 382
7ose-assembly1.cif.gz_B cytochrome bd-ii type oxidase with bound aurachin d 0.9737 5 382
6rko-assembly1.cif.gz_B cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution 0.9732 5 382
7ose-assembly1.cif.gz_B cytochrome bd-ii type oxidase with bound aurachin d 0.9712 5 382
7nkz-assembly1.cif.gz_B cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.9219 9 373
ID Description Score Start End Superfamily
af_B6U466_3_118_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.6747 174 312 1.20.120.290
1t6qC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase 0.666 180 313 1.20.120.400
af_B6U466_3_118_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.6158 174 312 1.20.120.290
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5934 15 313 1.20.1630.10
1t6qC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase 0.591 180 313 1.20.120.400
ID Description Score Start End GO Terms
AF-A0A1I3ZGN7-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.994 1 382 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069
AF-A0A514WLP6-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9939 1 382 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069
AF-A0A257GAU3-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9936 1 382 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069
AF-A0A0W1G749-F1-model_v4 Cytochrome d ubiquinol oxidase subunit 2 0.9931 1 382 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069
AF-A0A7W5MUS4-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-) 0.9926 1 382 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069

Map