F494475
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1511 | 726 | 3022 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300049823|Ga0501044_0025287|Ga0501044_0025287_1518_2342 |
| Length | 267 |
| Sequence | MQLNPIGRTEAPVPDLPSTLGVDLQENGIAVLRLMRPEKRNALDNVTVLGLHRFFAAPPAGVKVVVVDGQGEHFSAGLDLSAEGVGHSMMWHEAFRHIQFGKVPVIAVLHGAVIGGGLELAASAHVRIAEPSSFYALPEGQRGIFVGGGGSVRIPRLIGVARMMDMMLTGRVYDAAEGHAIGLSQYLVGAGEGMVRAMELAAKIAGNAPMTNFAVMHALPRIAETSPESGYMMEAMISSIAQADIEAKTRIRDFLEKRAAKVGKAKT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 91 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 92 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 122 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 123 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 124 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 125 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 201 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 202 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 203 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 211 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 213 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 214 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 216 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 217 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 218 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 219 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 220 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 222 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 226 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 227 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 228 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 231 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 232 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 233 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 235 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 236 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 237 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 238 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 239 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 240 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 241 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 242 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 250 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 257 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 258 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 259 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 264 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 265 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 266 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 267 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 268 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 271 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 272 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 273 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 274 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 276 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 277 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 278 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 279 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 280 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 281 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 282 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 283 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 284 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 285 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 286 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 287 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 288 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 289 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 290 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 291 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 292 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 372 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 373 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 374 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 375 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 376 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 377 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 380 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 381 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 382 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 383 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 384 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 385 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 386 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 387 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 388 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 389 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 390 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 391 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 392 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 393 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 394 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 395 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 396 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 426 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 427 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 428 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 429 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 430 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 431 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 434 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 436 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 440 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 441 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 442 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 443 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 444 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 445 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 446 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 447 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 448 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 449 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 450 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 451 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 452 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 453 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 454 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 455 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 456 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 457 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 458 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 459 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 460 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 461 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 462 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 463 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 464 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 465 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 466 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 467 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 468 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 469 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 470 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 471 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 472 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 473 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 474 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 475 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 476 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 477 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 478 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 479 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 480 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 481 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 482 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 483 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 484 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 485 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 486 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 487 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 488 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 489 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 490 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 491 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 493 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 494 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 495 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 496 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 497 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 498 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 499 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 500 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 501 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 502 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 503 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 504 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 505 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 506 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 507 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 508 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 509 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 510 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 511 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 512 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 513 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 514 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 515 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 516 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 517 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 518 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 519 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 520 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 521 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 522 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 523 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 524 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 525 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 526 | 2734482000 | Kineosporia rhizophila JCM 9960 | Isolate | Unclassified |
| 527 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 528 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 529 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 530 | 2791355199 | |||
| 531 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 532 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 533 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 534 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 535 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 536 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 537 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 538 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 539 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 540 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 541 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 542 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 543 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 544 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 545 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 546 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 547 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 548 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 549 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 550 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 551 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 552 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 553 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 554 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 555 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 556 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 557 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 558 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 559 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 560 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 561 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 562 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 563 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 564 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 565 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 566 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 567 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 568 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 569 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 570 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 571 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 572 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 573 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 574 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 575 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 576 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 577 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 578 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 579 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 580 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 581 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 582 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 583 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 584 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 585 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 586 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 587 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 588 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 589 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 590 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 591 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 592 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 593 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 594 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 595 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 596 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 597 | 2904699407 | |||
| 598 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 599 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 600 | 2906610324 | |||
| 601 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 602 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 603 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 604 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 605 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 606 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 607 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 608 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 609 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 610 | 2922368715 | |||
| 611 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 612 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 613 | 2922425934 | |||
| 614 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 615 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 616 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 617 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 618 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 619 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 620 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 621 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 622 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 623 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 624 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 625 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 626 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 627 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 628 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 629 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 630 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 631 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 632 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 633 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 634 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 635 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 636 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 637 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 638 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 639 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 640 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 641 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 642 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 643 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 644 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 645 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 646 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 647 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 648 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 649 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 650 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 651 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 652 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 653 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 654 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 655 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 656 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 657 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 658 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 659 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 660 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 661 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 662 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 663 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 664 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 665 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 666 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 667 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 668 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 669 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 670 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 671 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 672 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 673 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 674 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 675 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 676 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 677 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 678 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 679 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 680 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 681 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 682 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 683 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 684 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 685 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 686 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 687 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 688 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 689 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 690 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 691 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 692 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 693 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 694 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 695 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 696 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 697 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 698 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 699 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 700 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 701 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 702 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 703 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 704 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 705 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 706 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 707 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 708 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 709 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 710 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 711 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 712 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 713 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 714 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 715 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 716 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 717 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 718 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 719 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 720 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 721 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 722 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 723 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 724 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 725 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 726 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.79 |
| Metatranscriptomes | 0.07 |
| Isolates | 15.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.64 |
| Nodule | 12.18 |
| Rhizoplane | 4.63 |
| Rhizosphere | 58.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501044_0025287 | 3300049823 | Bacteria | 6293 |
| 2 | JGI24745J21846_1004091 | 3300002073 | Bacteria | 1549 |
| 3 | JGI25406J46586_10000233 | 3300003203 | Bacteria | 24719 |
| 4 | JGI25406J46586_10008961 | 3300003203 | Bacteria | 4502 |
| 5 | JGI25153J46596_10003608 | 3300003215 | Bacteria | 8589 |
| 6 | JGI25153J46596_10009022 | 3300003215 | Bacteria | 4691 |
| 7 | JGI25404J52841_10011727 | 3300003659 | Bacteria | 1893 |
| 8 | JGI25404J52841_10017283 | 3300003659 | Bacteria | 1563 |
| 9 | JGI25404J52841_10018580 | 3300003659 | Bacteria | 1507 |
| 10 | JGI25404J52841_10036834 | 3300003659 | Bacteria | 1041 |
| 11 | Ga0055526_1047315 | 3300003771 | Bacteria | 1011 |
| 12 | Ga0055531_10013194 | 3300003794 | Bacteria | 3829 |
| 13 | Ga0065165_1000917 | 3300005262 | Bacteria | 37935 |
| 14 | Ga0065165_1001167 | 3300005262 | Bacteria | 30545 |
| 15 | Ga0065165_1009512 | 3300005262 | Bacteria | 4346 |
| 16 | Ga0070658_10071314 | 3300005327 | Bacteria | 2845 |
| 17 | Ga0070683_100254628 | 3300005329 | Bacteria | 1670 |
| 18 | Ga0070690_100164312 | 3300005330 | Bacteria | 1523 |
| 19 | Ga0068869_100117529 | 3300005334 | Bacteria | 2030 |
| 20 | Ga0068869_100130742 | 3300005334 | Bacteria | 1929 |
| 21 | Ga0068869_100138140 | 3300005334 | Bacteria | 1879 |
| 22 | Ga0070680_100102455 | 3300005336 | Bacteria | 2377 |
| 23 | Ga0070682_100067954 | 3300005337 | Bacteria | 2271 |
| 24 | Ga0070682_100242437 | 3300005337 | Bacteria | 1295 |
| 25 | Ga0068868_100009208 | 3300005338 | Bacteria | 7095 |
| 26 | Ga0068868_100133580 | 3300005338 | Bacteria | 2032 |
| 27 | Ga0068868_100140904 | 3300005338 | Bacteria | 1979 |
| 28 | Ga0070660_100015341 | 3300005339 | Bacteria | 5530 |
| 29 | Ga0070660_100299709 | 3300005339 | Bacteria | 1318 |
| 30 | Ga0070660_100309943 | 3300005339 | Bacteria | 1295 |
| 31 | Ga0070689_100134832 | 3300005340 | Bacteria | 1982 |
| 32 | Ga0070687_100221156 | 3300005343 | Bacteria | 1160 |
| 33 | Ga0070687_100304947 | 3300005343 | Bacteria | 1012 |
| 34 | Ga0070661_100047378 | 3300005344 | Bacteria | 3145 |
| 35 | Ga0070661_100058873 | 3300005344 | Bacteria | 2816 |
| 36 | Ga0070661_100138016 | 3300005344 | Bacteria | 1836 |
| 37 | Ga0070661_100342318 | 3300005344 | Bacteria | 1172 |
| 38 | Ga0070668_100009536 | 3300005347 | Bacteria | 7203 |
| 39 | Ga0070668_100013042 | 3300005347 | Bacteria | 6191 |
| 40 | Ga0070668_100066141 | 3300005347 | Bacteria | 2804 |
| 41 | Ga0070668_100230649 | 3300005347 | Bacteria | 1530 |
| 42 | Ga0070668_100292199 | 3300005347 | Bacteria | 1364 |
| 43 | Ga0070669_100163838 | 3300005353 | Bacteria | 1729 |
| 44 | Ga0070669_100224392 | 3300005353 | Bacteria | 1487 |
| 45 | Ga0070675_100193255 | 3300005354 | Bacteria | 1764 |
| 46 | Ga0070671_100000724 | 3300005355 | Bacteria | 23620 |
| 47 | Ga0070671_100107752 | 3300005355 | Bacteria | 2339 |
| 48 | Ga0070671_100138626 | 3300005355 | Bacteria | 2052 |
| 49 | Ga0070671_100677286 | 3300005355 | Bacteria | 894 |
| 50 | Ga0070674_100052855 | 3300005356 | Bacteria | 2803 |
| 51 | Ga0070674_100261447 | 3300005356 | Bacteria | 1364 |
| 52 | Ga0070674_100296307 | 3300005356 | Bacteria | 1288 |
| 53 | Ga0070673_100224362 | 3300005364 | Bacteria | 1628 |
| 54 | Ga0070688_100044579 | 3300005365 | Bacteria | 2737 |
| 55 | Ga0070659_100148271 | 3300005366 | Bacteria | 1912 |
| 56 | Ga0070667_100004331 | 3300005367 | Bacteria | 11978 |
| 57 | Ga0070667_100213017 | 3300005367 | Bacteria | 1718 |
| 58 | Ga0070667_100269039 | 3300005367 | Bacteria | 1528 |
| 59 | Ga0070709_10001520 | 3300005434 | Bacteria | 12532 |
| 60 | Ga0070709_10008885 | 3300005434 | Bacteria | 5530 |
| 61 | Ga0070709_10173983 | 3300005434 | Bacteria | 1507 |
| 62 | Ga0070714_100005907 | 3300005435 | Bacteria | 9391 |
| 63 | Ga0070713_100021890 | 3300005436 | Bacteria | 4929 |
| 64 | Ga0070713_100040858 | 3300005436 | Bacteria | 3774 |
| 65 | Ga0070713_100086571 | 3300005436 | Bacteria | 2686 |
| 66 | Ga0070713_100108114 | 3300005436 | Bacteria | 2421 |
| 67 | Ga0070713_100133311 | 3300005436 | Bacteria | 2193 |
| 68 | Ga0070713_100156609 | 3300005436 | Bacteria | 2031 |
| 69 | Ga0070710_10000733 | 3300005437 | Bacteria | 15629 |
| 70 | Ga0070710_10014290 | 3300005437 | Bacteria | 3994 |
| 71 | Ga0070711_100005326 | 3300005439 | Bacteria | 7689 |
| 72 | Ga0070711_100040962 | 3300005439 | Bacteria | 3126 |
| 73 | Ga0070700_100456363 | 3300005441 | Bacteria | 974 |
| 74 | Ga0070663_100039057 | 3300005455 | Bacteria | 3315 |
| 75 | Ga0070663_100058403 | 3300005455 | Bacteria | 2770 |
| 76 | Ga0070663_100061649 | 3300005455 | Bacteria | 2701 |
| 77 | Ga0070663_100113203 | 3300005455 | Bacteria | 2041 |
| 78 | Ga0070663_100135351 | 3300005455 | Bacteria | 1875 |
| 79 | Ga0070678_100024391 | 3300005456 | Bacteria | 4048 |
| 80 | Ga0070678_100115610 | 3300005456 | Bacteria | 2106 |
| 81 | Ga0070678_100356183 | 3300005456 | Bacteria | 1260 |
| 82 | Ga0070662_100048334 | 3300005457 | Bacteria | 3064 |
| 83 | Ga0070662_100193379 | 3300005457 | Bacteria | 1610 |
| 84 | Ga0070681_10131987 | 3300005458 | Bacteria | 2430 |
| 85 | Ga0070681_10258667 | 3300005458 | Bacteria | 1653 |
| 86 | Ga0070681_10272242 | 3300005458 | Bacteria | 1605 |
| 87 | Ga0068867_100209521 | 3300005459 | Bacteria | 1565 |
| 88 | Ga0068867_100287432 | 3300005459 | Bacteria | 1350 |
| 89 | Ga0068867_100501042 | 3300005459 | Bacteria | 1044 |
| 90 | Ga0070685_10222031 | 3300005466 | Bacteria | 1238 |
| 91 | Ga0070706_100000883 | 3300005467 | Bacteria | 32838 |
| 92 | Ga0070706_100338949 | 3300005467 | Bacteria | 1402 |
| 93 | Ga0070707_100048206 | 3300005468 | Bacteria | 4081 |
| 94 | Ga0070707_100216052 | 3300005468 | Bacteria | 1868 |
| 95 | Ga0070699_100224891 | 3300005518 | Bacteria | 1673 |
| 96 | Ga0070679_100080757 | 3300005530 | Bacteria | 3241 |
| 97 | Ga0070679_100086434 | 3300005530 | Bacteria | 3122 |
| 98 | Ga0070679_100289996 | 3300005530 | Bacteria | 1588 |
| 99 | Ga0070684_100089394 | 3300005535 | Bacteria | 2737 |
| 100 | Ga0070684_100495287 | 3300005535 | Bacteria | 1132 |
| 101 | Ga0070684_100612305 | 3300005535 | Bacteria | 1013 |
| 102 | Ga0070697_100096466 | 3300005536 | Bacteria | 2453 |
| 103 | Ga0068853_100037982 | 3300005539 | Bacteria | 4100 |
| 104 | Ga0068853_100208559 | 3300005539 | Bacteria | 1780 |
| 105 | Ga0068853_100316150 | 3300005539 | Bacteria | 1447 |
| 106 | Ga0068853_100477708 | 3300005539 | Bacteria | 1175 |
| 107 | Ga0068853_100521167 | 3300005539 | Bacteria | 1124 |
| 108 | Ga0068853_100560881 | 3300005539 | Bacteria | 1082 |
| 109 | Ga0068853_100604343 | 3300005539 | Bacteria | 1042 |
| 110 | Ga0070672_100177991 | 3300005543 | Bacteria | 1771 |
| 111 | Ga0070672_100216984 | 3300005543 | Bacteria | 1604 |
| 112 | Ga0070686_100068407 | 3300005544 | Unclassified | 2316 |
| 113 | Ga0070695_100096384 | 3300005545 | Bacteria | 1985 |
| 114 | Ga0070665_100004629 | 3300005548 | Bacteria | 14379 |
| 115 | Ga0070665_100071360 | 3300005548 | Bacteria | 3479 |
| 116 | Ga0070665_100105979 | 3300005548 | Bacteria | 2813 |
| 117 | Ga0070665_100144937 | 3300005548 | Bacteria | 2378 |
| 118 | Ga0070665_100237677 | 3300005548 | Bacteria | 1822 |
| 119 | Ga0068855_100031922 | 3300005563 | Bacteria | 6287 |
| 120 | Ga0068855_100069511 | 3300005563 | Bacteria | 4098 |
| 121 | Ga0068855_100096541 | 3300005563 | Bacteria | 3405 |
| 122 | Ga0068855_100245511 | 3300005563 | Bacteria | 1998 |
| 123 | Ga0070664_100011717 | 3300005564 | Bacteria | 7117 |
| 124 | Ga0070664_100108843 | 3300005564 | Bacteria | 2417 |
| 125 | Ga0070664_100285667 | 3300005564 | Bacteria | 1488 |
| 126 | Ga0070664_100483156 | 3300005564 | Bacteria | 1140 |
| 127 | Ga0068857_100026204 | 3300005577 | Bacteria | 5137 |
| 128 | Ga0068856_100000137 | 3300005614 | Bacteria | 73762 |
| 129 | Ga0070702_100118817 | 3300005615 | Bacteria | 1651 |
| 130 | Ga0068852_100026206 | 3300005616 | Bacteria | 4735 |
| 131 | Ga0068852_100067797 | 3300005616 | Bacteria | 3120 |
| 132 | Ga0068852_100144994 | 3300005616 | Bacteria | 2202 |
| 133 | Ga0068859_100001570 | 3300005617 | Bacteria | 23292 |
| 134 | Ga0068859_100780237 | 3300005617 | Bacteria | 1044 |
| 135 | Ga0068859_100870272 | 3300005617 | Bacteria | 987 |
| 136 | Ga0068864_100106901 | 3300005618 | Bacteria | 2489 |
| 137 | Ga0068864_100294206 | 3300005618 | Bacteria | 1518 |
| 138 | Ga0068864_100406660 | 3300005618 | Bacteria | 1294 |
| 139 | Ga0068866_10035306 | 3300005718 | Bacteria | 2441 |
| 140 | Ga0068861_100029805 | 3300005719 | Bacteria | 3994 |
| 141 | Ga0068861_100189556 | 3300005719 | Bacteria | 1718 |
| 142 | Ga0068861_100675561 | 3300005719 | Bacteria | 957 |
| 143 | Ga0068851_10011436 | 3300005834 | Bacteria | 4163 |
| 144 | Ga0068863_100001523 | 3300005841 | Bacteria | 22904 |
| 145 | Ga0068858_100011790 | 3300005842 | Bacteria | 8246 |
| 146 | Ga0068858_100057344 | 3300005842 | Bacteria | 3599 |
| 147 | Ga0068858_100252659 | 3300005842 | Bacteria | 1675 |
| 148 | Ga0068858_100381416 | 3300005842 | Bacteria | 1353 |
| 149 | Ga0068858_100458870 | 3300005842 | Bacteria | 1228 |
| 150 | Ga0068860_100068880 | 3300005843 | Bacteria | 3362 |
| 151 | Ga0068860_100191436 | 3300005843 | Bacteria | 1979 |
| 152 | Ga0068860_100316896 | 3300005843 | Bacteria | 1530 |
| 153 | Ga0068860_100451721 | 3300005843 | Bacteria | 1278 |
| 154 | Ga0068860_100553496 | 3300005843 | Bacteria | 1153 |
| 155 | Ga0068862_100064935 | 3300005844 | Bacteria | 3143 |
| 156 | Ga0068862_100417409 | 3300005844 | Bacteria | 1258 |
| 157 | Ga0068862_100489571 | 3300005844 | Bacteria | 1165 |
| 158 | Ga0068862_100617334 | 3300005844 | Bacteria | 1043 |
| 159 | Ga0081455_10011235 | 3300005937 | Bacteria | 9010 |
| 160 | Ga0081455_10056109 | 3300005937 | Bacteria | 3347 |
| 161 | Ga0081455_10080519 | 3300005937 | Bacteria | 2670 |
| 162 | Ga0081455_10281684 | 3300005937 | Bacteria | 1201 |
| 163 | Ga0081455_10307771 | 3300005937 | Bacteria | 1134 |
| 164 | Ga0081540_1005656 | 3300005983 | Bacteria | 9295 |
| 165 | Ga0081540_1005657 | 3300005983 | Bacteria | 9294 |
| 166 | Ga0081540_1010321 | 3300005983 | Bacteria | 6335 |
| 167 | Ga0081540_1016160 | 3300005983 | Bacteria | 4686 |
| 168 | Ga0081540_1021999 | 3300005983 | Bacteria | 3775 |
| 169 | Ga0081540_1026512 | 3300005983 | Bacteria | 3306 |
| 170 | Ga0081540_1046497 | 3300005983 | Bacteria | 2191 |
| 171 | Ga0081540_1077757 | 3300005983 | Bacteria | 1507 |
| 172 | Ga0081539_10000157 | 3300005985 | Bacteria | 158278 |
| 173 | Ga0081539_10002599 | 3300005985 | Bacteria | 24763 |
| 174 | Ga0081539_10037110 | 3300005985 | Bacteria | 2906 |
| 175 | Ga0070717_10001671 | 3300006028 | Bacteria | 15424 |
| 176 | Ga0070717_10011582 | 3300006028 | Bacteria | 6703 |
| 177 | Ga0070717_10111271 | 3300006028 | Bacteria | 2336 |
| 178 | Ga0070717_10149083 | 3300006028 | Bacteria | 2023 |
| 179 | Ga0070717_10273426 | 3300006028 | Bacteria | 1497 |
| 180 | Ga0070717_10363074 | 3300006028 | Bacteria | 1296 |
| 181 | Ga0070717_10678534 | 3300006028 | Bacteria | 936 |
| 182 | Ga0075365_10017395 | 3300006038 | Bacteria | 4398 |
| 183 | Ga0075365_10055725 | 3300006038 | Bacteria | 2625 |
| 184 | Ga0075365_10059683 | 3300006038 | Bacteria | 2543 |
| 185 | Ga0075365_10141939 | 3300006038 | Bacteria | 1667 |
| 186 | Ga0075365_10159603 | 3300006038 | Bacteria | 1571 |
| 187 | Ga0075365_10195741 | 3300006038 | Bacteria | 1415 |
| 188 | Ga0075365_10210341 | 3300006038 | Bacteria | 1363 |
| 189 | Ga0075365_10334329 | 3300006038 | Bacteria | 1067 |
| 190 | Ga0075368_10073538 | 3300006042 | Bacteria | 1383 |
| 191 | Ga0075368_10084711 | 3300006042 | Bacteria | 1292 |
| 192 | Ga0075363_100002704 | 3300006048 | Bacteria | 7338 |
| 193 | Ga0075364_10066567 | 3300006051 | Bacteria | 2367 |
| 194 | Ga0070715_10055748 | 3300006163 | Bacteria | 1717 |
| 195 | Ga0070716_100101944 | 3300006173 | Bacteria | 1761 |
| 196 | Ga0070716_100176294 | 3300006173 | Bacteria | 1399 |
| 197 | Ga0070716_100423302 | 3300006173 | Bacteria | 963 |
| 198 | Ga0070712_100002371 | 3300006175 | Bacteria | 11602 |
| 199 | Ga0070712_100031659 | 3300006175 | Bacteria | 3565 |
| 200 | Ga0070712_100101145 | 3300006175 | Bacteria | 2132 |
| 201 | Ga0070712_100104477 | 3300006175 | Bacteria | 2102 |
| 202 | Ga0075362_10006634 | 3300006177 | Bacteria | 4322 |
| 203 | Ga0075362_10150161 | 3300006177 | Bacteria | 1117 |
| 204 | Ga0075367_10005584 | 3300006178 | Bacteria | 6264 |
| 205 | Ga0075367_10021332 | 3300006178 | Bacteria | 3618 |
| 206 | Ga0075367_10089027 | 3300006178 | Bacteria | 1876 |
| 207 | Ga0075367_10198769 | 3300006178 | Bacteria | 1252 |
| 208 | Ga0075369_10004189 | 3300006186 | Bacteria | 5315 |
| 209 | Ga0075366_10022772 | 3300006195 | Bacteria | 3647 |
| 210 | Ga0075366_10046580 | 3300006195 | Bacteria | 2570 |
| 211 | Ga0075366_10101831 | 3300006195 | Bacteria | 1724 |
| 212 | Ga0097621_100191123 | 3300006237 | Bacteria | 1773 |
| 213 | Ga0097621_100222425 | 3300006237 | Bacteria | 1645 |
| 214 | Ga0097621_100290259 | 3300006237 | Bacteria | 1442 |
| 215 | Ga0075370_10001262 | 3300006353 | Bacteria | 10776 |
| 216 | Ga0075370_10011785 | 3300006353 | Bacteria | 4602 |
| 217 | Ga0075370_10024269 | 3300006353 | Bacteria | 3348 |
| 218 | Ga0075370_10040385 | 3300006353 | Bacteria | 2631 |
| 219 | Ga0075370_10066034 | 3300006353 | Bacteria | 2064 |
| 220 | Ga0075370_10095321 | 3300006353 | Bacteria | 1719 |
| 221 | Ga0075370_10118423 | 3300006353 | Bacteria | 1540 |
| 222 | Ga0068871_100100889 | 3300006358 | Bacteria | 2418 |
| 223 | Ga0068871_100589620 | 3300006358 | Bacteria | 1010 |
| 224 | Ga0068871_100685960 | 3300006358 | Bacteria | 937 |
| 225 | Ga0075428_100403065 | 3300006844 | Bacteria | 1466 |
| 226 | Ga0075430_100102784 | 3300006846 | Bacteria | 2386 |
| 227 | Ga0075431_100085325 | 3300006847 | Bacteria | 3259 |
| 228 | Ga0068865_100008510 | 3300006881 | Bacteria | 6343 |
| 229 | Ga0068865_100146318 | 3300006881 | Bacteria | 1787 |
| 230 | Ga0068865_100350766 | 3300006881 | Bacteria | 1195 |
| 231 | Ga0097620_100001570 | 3300006931 | Bacteria | 23292 |
| 232 | Ga0097620_100462275 | 3300006931 | Bacteria | 1365 |
| 233 | Ga0097620_100780186 | 3300006931 | Bacteria | 1044 |
| 234 | Ga0097620_100870290 | 3300006931 | Bacteria | 987 |
| 235 | Ga0099824_1008303 | 3300006942 | Bacteria | 13338 |
| 236 | Ga0099824_1010623 | 3300006942 | Bacteria | 10757 |
| 237 | Ga0099824_1040894 | 3300006942 | Bacteria | 1121 |
| 238 | Ga0099822_1000541 | 3300006943 | Bacteria | 35996 |
| 239 | Ga0099823_1031325 | 3300006944 | Bacteria | 4394 |
| 240 | Ga0099794_10183679 | 3300007265 | Bacteria | 1068 |
| 241 | Ga0099794_10251862 | 3300007265 | Bacteria | 911 |
| 242 | Ga0099795_10065592 | 3300007788 | Bacteria | 1358 |
| 243 | Ga0105240_10013303 | 3300009093 | Bacteria | 11310 |
| 244 | Ga0105240_10033754 | 3300009093 | Bacteria | 6607 |
| 245 | Ga0105240_10127891 | 3300009093 | Bacteria | 3050 |
| 246 | Ga0105240_10181246 | 3300009093 | Bacteria | 2485 |
| 247 | Ga0105240_10328790 | 3300009093 | Bacteria | 1740 |
| 248 | Ga0105245_10042563 | 3300009098 | Bacteria | 4053 |
| 249 | Ga0105245_10063488 | 3300009098 | Bacteria | 3335 |
| 250 | Ga0105245_10080927 | 3300009098 | Bacteria | 2968 |
| 251 | Ga0105245_10190761 | 3300009098 | Bacteria | 1963 |
| 252 | Ga0105245_10247879 | 3300009098 | Bacteria | 1729 |
| 253 | Ga0105245_10344362 | 3300009098 | Bacteria | 1475 |
| 254 | Ga0105245_10478747 | 3300009098 | Bacteria | 1258 |
| 255 | Ga0105247_10002542 | 3300009101 | Bacteria | 12378 |
| 256 | Ga0105247_10016513 | 3300009101 | Bacteria | 4425 |
| 257 | Ga0105247_10102046 | 3300009101 | Bacteria | 1835 |
| 258 | Ga0105243_10089266 | 3300009148 | Bacteria | 2534 |
| 259 | Ga0105243_10118066 | 3300009148 | Bacteria | 2231 |
| 260 | Ga0105243_10120396 | 3300009148 | Bacteria | 2212 |
| 261 | Ga0105243_10686139 | 3300009148 | Bacteria | 997 |
| 262 | Ga0105241_10004267 | 3300009174 | Bacteria | 10572 |
| 263 | Ga0105241_10024156 | 3300009174 | Bacteria | 4514 |
| 264 | Ga0105241_10036215 | 3300009174 | Bacteria | 3713 |
| 265 | Ga0105241_10112289 | 3300009174 | Bacteria | 2183 |
| 266 | Ga0105242_10338156 | 3300009176 | Bacteria | 1386 |
| 267 | Ga0105248_10028678 | 3300009177 | Bacteria | 6203 |
| 268 | Ga0105248_10199684 | 3300009177 | Bacteria | 2253 |
| 269 | Ga0105248_10292444 | 3300009177 | Bacteria | 1834 |
| 270 | Ga0105248_10586646 | 3300009177 | Bacteria | 1258 |
| 271 | Ga0105248_10789923 | 3300009177 | Bacteria | 1071 |
| 272 | Ga0105237_10017841 | 3300009545 | Bacteria | 7357 |
| 273 | Ga0105237_10020621 | 3300009545 | Bacteria | 6791 |
| 274 | Ga0105237_10031465 | 3300009545 | Bacteria | 5380 |
| 275 | Ga0105237_10037178 | 3300009545 | Bacteria | 4923 |
| 276 | Ga0105237_10087362 | 3300009545 | Bacteria | 3107 |
| 277 | Ga0105237_10167091 | 3300009545 | Bacteria | 2199 |
| 278 | Ga0105238_10047527 | 3300009551 | Bacteria | 4326 |
| 279 | Ga0105238_10074353 | 3300009551 | Bacteria | 3391 |
| 280 | Ga0105238_10267009 | 3300009551 | Bacteria | 1691 |
| 281 | Ga0105238_10418198 | 3300009551 | Bacteria | 1335 |
| 282 | Ga0105249_10008304 | 3300009553 | Bacteria | 9039 |
| 283 | Ga0105249_10072592 | 3300009553 | Bacteria | 3182 |
| 284 | Ga0105249_10191467 | 3300009553 | Bacteria | 1996 |
| 285 | Ga0105239_10072795 | 3300010375 | Bacteria | 3778 |
| 286 | Ga0105239_10103015 | 3300010375 | Bacteria | 3159 |
| 287 | Ga0105239_10149272 | 3300010375 | Bacteria | 2609 |
| 288 | Ga0105239_10150802 | 3300010375 | Bacteria | 2594 |
| 289 | Ga0105239_10245039 | 3300010375 | Bacteria | 2012 |
| 290 | Ga0105239_10245702 | 3300010375 | Bacteria | 2009 |
| 291 | Ga0105239_10250953 | 3300010375 | Bacteria | 1987 |
| 292 | Ga0105239_10289119 | 3300010375 | Bacteria | 1846 |
| 293 | Ga0105246_10049380 | 3300011119 | Bacteria | 2881 |
| 294 | Ga0105246_10179239 | 3300011119 | Bacteria | 1630 |
| 295 | Ga0157373_10032613 | 3300013100 | Bacteria | 3748 |
| 296 | Ga0157370_10057357 | 3300013104 | Bacteria | 3703 |
| 297 | Ga0157370_10091066 | 3300013104 | Bacteria | 2863 |
| 298 | Ga0157370_10648161 | 3300013104 | Bacteria | 965 |
| 299 | Ga0157369_10026988 | 3300013105 | Bacteria | 6368 |
| 300 | Ga0157369_10060406 | 3300013105 | Bacteria | 4088 |
| 301 | Ga0157369_10095007 | 3300013105 | Bacteria | 3182 |
| 302 | Ga0157369_10185643 | 3300013105 | Bacteria | 2187 |
| 303 | Ga0157374_10043641 | 3300013296 | Bacteria | 4143 |
| 304 | Ga0157378_10001192 | 3300013297 | Bacteria | 23599 |
| 305 | Ga0157378_10128040 | 3300013297 | Bacteria | 2347 |
| 306 | Ga0163162_10218914 | 3300013306 | Bacteria | 2034 |
| 307 | Ga0163162_10328957 | 3300013306 | Bacteria | 1661 |
| 308 | Ga0163162_10731118 | 3300013306 | Bacteria | 1110 |
| 309 | Ga0157372_10132541 | 3300013307 | Bacteria | 2868 |
| 310 | Ga0157372_10206646 | 3300013307 | Bacteria | 2275 |
| 311 | Ga0157375_10512151 | 3300013308 | Bacteria | 1364 |
| 312 | Ga0157375_10602449 | 3300013308 | Bacteria | 1258 |
| 313 | Ga0163163_10010769 | 3300014325 | Bacteria | 8250 |
| 314 | Ga0163163_10022075 | 3300014325 | Bacteria | 6020 |
| 315 | Ga0163163_10194424 | 3300014325 | Bacteria | 2076 |
| 316 | Ga0163163_10214083 | 3300014325 | Bacteria | 1976 |
| 317 | Ga0163163_10558072 | 3300014325 | Bacteria | 1208 |
| 318 | Ga0163163_10790756 | 3300014325 | Bacteria | 1012 |
| 319 | Ga0157380_10048748 | 3300014326 | Bacteria | 3337 |
| 320 | Ga0157379_10011061 | 3300014968 | Bacteria | 7865 |
| 321 | Ga0157379_10095785 | 3300014968 | Bacteria | 2663 |
| 322 | Ga0157379_10347339 | 3300014968 | Bacteria | 1358 |
| 323 | Ga0157379_10420007 | 3300014968 | Bacteria | 1231 |
| 324 | Ga0157376_10193426 | 3300014969 | Bacteria | 1867 |
| 325 | Ga0157376_10197979 | 3300014969 | Bacteria | 1846 |
| 326 | Ga0157376_10257277 | 3300014969 | Bacteria | 1634 |
| 327 | Ga0163161_10159037 | 3300017792 | Bacteria | 1722 |
| 328 | Ga0163161_10292901 | 3300017792 | Bacteria | 1280 |
| 329 | Ga0206356_11062778 | 3300020070 | Bacteria | 930 |
| 330 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 331 | Ga0214542_1000022 | 3300021321 | Bacteria | 193578 |
| 332 | Ga0214545_1000010 | 3300021324 | Bacteria | 193578 |
| 333 | Ga0214543_1000035 | 3300021327 | Bacteria | 183100 |
| 334 | Ga0214543_1026336 | 3300021327 | Bacteria | 3149 |
| 335 | Ga0213872_10088623 | 3300021361 | Bacteria | 1386 |
| 336 | Ga0213872_10149365 | 3300021361 | Bacteria | 1022 |
| 337 | Ga0213876_10157517 | 3300021384 | Bacteria | 1208 |
| 338 | Ga0213876_10174453 | 3300021384 | Bacteria | 1144 |
| 339 | Ga0213876_10226170 | 3300021384 | Bacteria | 995 |
| 340 | Ga0213876_10240098 | 3300021384 | Bacteria | 963 |
| 341 | Ga0209563_101110 | 3300025230 | Bacteria | 7671 |
| 342 | Ga0207425_1011267 | 3300025245 | Bacteria | 2140 |
| 343 | Ga0209677_100492 | 3300025253 | Bacteria | 22270 |
| 344 | Ga0209148_1000267 | 3300025254 | Bacteria | 81839 |
| 345 | Ga0209233_1001537 | 3300025261 | Bacteria | 9046 |
| 346 | Ga0209233_1005715 | 3300025261 | Bacteria | 4100 |
| 347 | Ga0209233_1040548 | 3300025261 | Bacteria | 1012 |
| 348 | Ga0209455_1001652 | 3300025272 | Bacteria | 9674 |
| 349 | Ga0209455_1004190 | 3300025272 | Bacteria | 4822 |
| 350 | Ga0209455_1007509 | 3300025272 | Bacteria | 3070 |
| 351 | Ga0209455_1020432 | 3300025272 | Bacteria | 1310 |
| 352 | Ga0209455_1026659 | 3300025272 | Bacteria | 1033 |
| 353 | Ga0209673_1021954 | 3300025273 | Bacteria | 2216 |
| 354 | Ga0209564_1000718 | 3300025295 | Bacteria | 47576 |
| 355 | Ga0209564_1005249 | 3300025295 | Bacteria | 7481 |
| 356 | Ga0209564_1017988 | 3300025295 | Bacteria | 2720 |
| 357 | Ga0209564_1029571 | 3300025295 | Bacteria | 1721 |
| 358 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 359 | Ga0209758_1000711 | 3300025297 | Bacteria | 49164 |
| 360 | Ga0209758_1000764 | 3300025297 | Bacteria | 46385 |
| 361 | Ga0209758_1001094 | 3300025297 | Bacteria | 35071 |
| 362 | Ga0209758_1001468 | 3300025297 | Bacteria | 27665 |
| 363 | Ga0209758_1004096 | 3300025297 | Bacteria | 12498 |
| 364 | Ga0209758_1007765 | 3300025297 | Bacteria | 7183 |
| 365 | Ga0209758_1022547 | 3300025297 | Bacteria | 2880 |
| 366 | Ga0209758_1023868 | 3300025297 | Bacteria | 2748 |
| 367 | Ga0209758_1070097 | 3300025297 | Bacteria | 1108 |
| 368 | Ga0209256_1010978 | 3300025299 | Bacteria | 3700 |
| 369 | Ga0207426_1000368 | 3300025302 | Bacteria | 79715 |
| 370 | Ga0207426_1005258 | 3300025302 | Bacteria | 5970 |
| 371 | Ga0207426_1027512 | 3300025302 | Bacteria | 1893 |
| 372 | Ga0209257_1001688 | 3300025304 | Bacteria | 24840 |
| 373 | Ga0207697_10127423 | 3300025315 | Bacteria | 1099 |
| 374 | Ga0207656_10047799 | 3300025321 | Bacteria | 1841 |
| 375 | Ga0207682_10154530 | 3300025893 | Bacteria | 1036 |
| 376 | Ga0207692_10015137 | 3300025898 | Bacteria | 3387 |
| 377 | Ga0207710_10000305 | 3300025900 | Bacteria | 38961 |
| 378 | Ga0207710_10132214 | 3300025900 | Bacteria | 1199 |
| 379 | Ga0207710_10156719 | 3300025900 | Bacteria | 1107 |
| 380 | Ga0207688_10052449 | 3300025901 | Bacteria | 2285 |
| 381 | Ga0207680_10021686 | 3300025903 | Bacteria | 3479 |
| 382 | Ga0207680_10335105 | 3300025903 | Bacteria | 1060 |
| 383 | Ga0207647_10012006 | 3300025904 | Bacteria | 6046 |
| 384 | Ga0207685_10077861 | 3300025905 | Bacteria | 1364 |
| 385 | Ga0207699_10001435 | 3300025906 | Bacteria | 11313 |
| 386 | Ga0207699_10006921 | 3300025906 | Bacteria | 5519 |
| 387 | Ga0207699_10084385 | 3300025906 | Bacteria | 1978 |
| 388 | Ga0207699_10136617 | 3300025906 | Bacteria | 1606 |
| 389 | Ga0207643_10002999 | 3300025908 | Bacteria | 9101 |
| 390 | Ga0207643_10020167 | 3300025908 | Bacteria | 3658 |
| 391 | Ga0207705_10018984 | 3300025909 | Bacteria | 4916 |
| 392 | Ga0207705_10247007 | 3300025909 | Bacteria | 1360 |
| 393 | Ga0207684_10013348 | 3300025910 | Bacteria | 7107 |
| 394 | Ga0207684_10175591 | 3300025910 | Bacteria | 1847 |
| 395 | Ga0207654_10007028 | 3300025911 | Bacteria | 5670 |
| 396 | Ga0207654_10014303 | 3300025911 | Bacteria | 4099 |
| 397 | Ga0207654_10051760 | 3300025911 | Bacteria | 2365 |
| 398 | Ga0207707_10000143 | 3300025912 | Bacteria | 74226 |
| 399 | Ga0207707_10000613 | 3300025912 | Bacteria | 35676 |
| 400 | Ga0207707_10022062 | 3300025912 | Bacteria | 5565 |
| 401 | Ga0207707_10514969 | 3300025912 | Bacteria | 1019 |
| 402 | Ga0207695_10000059 | 3300025913 | Bacteria | 363920 |
| 403 | Ga0207695_10288667 | 3300025913 | Bacteria | 1533 |
| 404 | Ga0207695_10490047 | 3300025913 | Bacteria | 1111 |
| 405 | Ga0207671_10069543 | 3300025914 | Bacteria | 2624 |
| 406 | Ga0207671_10096887 | 3300025914 | Bacteria | 2230 |
| 407 | Ga0207671_10101351 | 3300025914 | Bacteria | 2181 |
| 408 | Ga0207671_10116272 | 3300025914 | Bacteria | 2040 |
| 409 | Ga0207671_10140250 | 3300025914 | Bacteria | 1862 |
| 410 | Ga0207671_10382098 | 3300025914 | Bacteria | 1119 |
| 411 | Ga0207671_10479721 | 3300025914 | Bacteria | 991 |
| 412 | Ga0207693_10031785 | 3300025915 | Bacteria | 4171 |
| 413 | Ga0207693_10053203 | 3300025915 | Bacteria | 3177 |
| 414 | Ga0207693_10056172 | 3300025915 | Bacteria | 3087 |
| 415 | Ga0207693_10075584 | 3300025915 | Bacteria | 2638 |
| 416 | Ga0207693_10269291 | 3300025915 | Bacteria | 1335 |
| 417 | Ga0207663_10010613 | 3300025916 | Bacteria | 4911 |
| 418 | Ga0207663_10025244 | 3300025916 | Bacteria | 3432 |
| 419 | Ga0207660_10015097 | 3300025917 | Bacteria | 5092 |
| 420 | Ga0207660_10046492 | 3300025917 | Bacteria | 3063 |
| 421 | Ga0207660_10126351 | 3300025917 | Bacteria | 1942 |
| 422 | Ga0207662_10089318 | 3300025918 | Bacteria | 1893 |
| 423 | Ga0207657_10006552 | 3300025919 | Bacteria | 12056 |
| 424 | Ga0207657_10021660 | 3300025919 | Bacteria | 6041 |
| 425 | Ga0207657_10065923 | 3300025919 | Bacteria | 3084 |
| 426 | Ga0207657_10118716 | 3300025919 | Bacteria | 2177 |
| 427 | Ga0207657_10272645 | 3300025919 | Bacteria | 1345 |
| 428 | Ga0207649_10047973 | 3300025920 | Bacteria | 2632 |
| 429 | Ga0207649_10099291 | 3300025920 | Bacteria | 1923 |
| 430 | Ga0207652_10023997 | 3300025921 | Bacteria | 5058 |
| 431 | Ga0207652_10029772 | 3300025921 | Bacteria | 4568 |
| 432 | Ga0207652_10080629 | 3300025921 | Bacteria | 2846 |
| 433 | Ga0207646_10075813 | 3300025922 | Bacteria | 3005 |
| 434 | Ga0207646_10158675 | 3300025922 | Bacteria | 2041 |
| 435 | Ga0207694_10017116 | 3300025924 | Bacteria | 5476 |
| 436 | Ga0207694_10097981 | 3300025924 | Bacteria | 2321 |
| 437 | Ga0207694_10321432 | 3300025924 | Bacteria | 1277 |
| 438 | Ga0207659_10214897 | 3300025926 | Bacteria | 1543 |
| 439 | Ga0207687_10039513 | 3300025927 | Bacteria | 3231 |
| 440 | Ga0207687_10096868 | 3300025927 | Bacteria | 2163 |
| 441 | Ga0207687_10121735 | 3300025927 | Bacteria | 1952 |
| 442 | Ga0207700_10007542 | 3300025928 | Bacteria | 6659 |
| 443 | Ga0207700_10052862 | 3300025928 | Bacteria | 3040 |
| 444 | Ga0207700_10062576 | 3300025928 | Bacteria | 2827 |
| 445 | Ga0207700_10108631 | 3300025928 | Bacteria | 2228 |
| 446 | Ga0207700_10140200 | 3300025928 | Bacteria | 1986 |
| 447 | Ga0207664_10006581 | 3300025929 | Bacteria | 8002 |
| 448 | Ga0207664_10763492 | 3300025929 | Bacteria | 870 |
| 449 | Ga0207644_10003366 | 3300025931 | Bacteria | 10319 |
| 450 | Ga0207644_10146217 | 3300025931 | Bacteria | 1825 |
| 451 | Ga0207644_10320917 | 3300025931 | Bacteria | 1252 |
| 452 | Ga0207644_10341839 | 3300025931 | Bacteria | 1214 |
| 453 | Ga0207706_10025737 | 3300025933 | Bacteria | 5271 |
| 454 | Ga0207706_10041747 | 3300025933 | Bacteria | 4066 |
| 455 | Ga0207706_10122599 | 3300025933 | Bacteria | 2286 |
| 456 | Ga0207686_10458633 | 3300025934 | Bacteria | 982 |
| 457 | Ga0207686_10538824 | 3300025934 | Bacteria | 911 |
| 458 | Ga0207709_10097462 | 3300025935 | Bacteria | 1937 |
| 459 | Ga0207709_10203501 | 3300025935 | Bacteria | 1416 |
| 460 | Ga0207709_10385072 | 3300025935 | Bacteria | 1068 |
| 461 | Ga0207669_10016439 | 3300025937 | Bacteria | 3759 |
| 462 | Ga0207669_10282685 | 3300025937 | Bacteria | 1252 |
| 463 | Ga0207669_10509800 | 3300025937 | Bacteria | 964 |
| 464 | Ga0207704_10050647 | 3300025938 | Bacteria | 2506 |
| 465 | Ga0207704_10110116 | 3300025938 | Bacteria | 1859 |
| 466 | Ga0207665_10006088 | 3300025939 | Bacteria | 8010 |
| 467 | Ga0207665_10051953 | 3300025939 | Bacteria | 2761 |
| 468 | Ga0207665_10105835 | 3300025939 | Bacteria | 1970 |
| 469 | Ga0207691_10250782 | 3300025940 | Bacteria | 1528 |
| 470 | Ga0207691_10393549 | 3300025940 | Bacteria | 1182 |
| 471 | Ga0207711_10051856 | 3300025941 | Bacteria | 3515 |
| 472 | Ga0207711_10142028 | 3300025941 | Bacteria | 2161 |
| 473 | Ga0207711_10228050 | 3300025941 | Bacteria | 1705 |
| 474 | Ga0207711_10342004 | 3300025941 | Bacteria | 1385 |
| 475 | Ga0207711_10469806 | 3300025941 | Bacteria | 1171 |
| 476 | Ga0207711_10645336 | 3300025941 | Bacteria | 988 |
| 477 | Ga0207689_10090792 | 3300025942 | Bacteria | 2510 |
| 478 | Ga0207661_10015368 | 3300025944 | Bacteria | 5631 |
| 479 | Ga0207661_10046265 | 3300025944 | Bacteria | 3450 |
| 480 | Ga0207661_10133977 | 3300025944 | Bacteria | 2126 |
| 481 | Ga0207661_10252434 | 3300025944 | Bacteria | 1568 |
| 482 | Ga0207661_10465503 | 3300025944 | Bacteria | 1153 |
| 483 | Ga0207679_10025142 | 3300025945 | Bacteria | 4091 |
| 484 | Ga0207679_10135726 | 3300025945 | Bacteria | 1981 |
| 485 | Ga0207667_10028504 | 3300025949 | Bacteria | 6065 |
| 486 | Ga0207667_10035357 | 3300025949 | Bacteria | 5358 |
| 487 | Ga0207667_10214574 | 3300025949 | Bacteria | 1972 |
| 488 | Ga0207667_10301031 | 3300025949 | Bacteria | 1638 |
| 489 | Ga0207712_10018591 | 3300025961 | Bacteria | 4529 |
| 490 | Ga0207712_10133226 | 3300025961 | Bacteria | 1897 |
| 491 | Ga0207668_10010329 | 3300025972 | Bacteria | 5640 |
| 492 | Ga0207668_10168391 | 3300025972 | Bacteria | 1716 |
| 493 | Ga0207668_10187725 | 3300025972 | Bacteria | 1635 |
| 494 | Ga0207668_10250008 | 3300025972 | Bacteria | 1439 |
| 495 | Ga0207668_10421057 | 3300025972 | Bacteria | 1133 |
| 496 | Ga0207640_10019369 | 3300025981 | Bacteria | 4019 |
| 497 | Ga0207640_10083385 | 3300025981 | Bacteria | 2192 |
| 498 | Ga0207640_10154364 | 3300025981 | Bacteria | 1690 |
| 499 | Ga0207640_10290088 | 3300025981 | Bacteria | 1289 |
| 500 | Ga0207658_10005101 | 3300025986 | Bacteria | 9038 |
| 501 | Ga0207658_10195858 | 3300025986 | Bacteria | 1683 |
| 502 | Ga0207677_10016508 | 3300026023 | Bacteria | 4376 |
| 503 | Ga0207677_10020036 | 3300026023 | Bacteria | 4052 |
| 504 | Ga0207677_10176069 | 3300026023 | Bacteria | 1678 |
| 505 | Ga0207703_10005161 | 3300026035 | Bacteria | 10559 |
| 506 | Ga0207703_10038549 | 3300026035 | Bacteria | 3814 |
| 507 | Ga0207703_10126277 | 3300026035 | Bacteria | 2203 |
| 508 | Ga0207703_10383215 | 3300026035 | Bacteria | 1301 |
| 509 | Ga0207703_10393579 | 3300026035 | Bacteria | 1284 |
| 510 | Ga0207639_10018068 | 3300026041 | Bacteria | 5005 |
| 511 | Ga0207639_10143951 | 3300026041 | Bacteria | 1989 |
| 512 | Ga0207639_10276291 | 3300026041 | Bacteria | 1476 |
| 513 | Ga0207639_10295736 | 3300026041 | Bacteria | 1429 |
| 514 | Ga0207678_10016337 | 3300026067 | Bacteria | 6516 |
| 515 | Ga0207678_10042750 | 3300026067 | Bacteria | 3923 |
| 516 | Ga0207678_10047687 | 3300026067 | Bacteria | 3704 |
| 517 | Ga0207678_10052503 | 3300026067 | Bacteria | 3517 |
| 518 | Ga0207678_10065075 | 3300026067 | Bacteria | 3131 |
| 519 | Ga0207678_10067421 | 3300026067 | Bacteria | 3072 |
| 520 | Ga0207678_10100598 | 3300026067 | Bacteria | 2469 |
| 521 | Ga0207678_10109202 | 3300026067 | Bacteria | 2360 |
| 522 | Ga0207678_10117752 | 3300026067 | Bacteria | 2267 |
| 523 | Ga0207678_10146534 | 3300026067 | Bacteria | 2015 |
| 524 | Ga0207708_10036539 | 3300026075 | Bacteria | 3740 |
| 525 | Ga0207708_10135686 | 3300026075 | Bacteria | 1927 |
| 526 | Ga0207702_10000063 | 3300026078 | Bacteria | 123034 |
| 527 | Ga0207702_10170198 | 3300026078 | Bacteria | 1997 |
| 528 | Ga0207641_10013860 | 3300026088 | Bacteria | 6612 |
| 529 | Ga0207641_10176114 | 3300026088 | Bacteria | 1956 |
| 530 | Ga0207641_10190911 | 3300026088 | Bacteria | 1883 |
| 531 | Ga0207648_10151356 | 3300026089 | Bacteria | 2047 |
| 532 | Ga0207648_10206257 | 3300026089 | Bacteria | 1744 |
| 533 | Ga0207676_10245751 | 3300026095 | Bacteria | 1608 |
| 534 | Ga0207676_10289401 | 3300026095 | Bacteria | 1491 |
| 535 | Ga0207674_10059593 | 3300026116 | Bacteria | 3862 |
| 536 | Ga0207674_10114397 | 3300026116 | Bacteria | 2670 |
| 537 | Ga0207675_100012672 | 3300026118 | Bacteria | 7879 |
| 538 | Ga0207675_100025404 | 3300026118 | Bacteria | 5514 |
| 539 | Ga0207675_100032142 | 3300026118 | Bacteria | 4889 |
| 540 | Ga0207675_100066283 | 3300026118 | Bacteria | 3375 |
| 541 | Ga0207683_10032945 | 3300026121 | Bacteria | 4501 |
| 542 | Ga0207683_10085120 | 3300026121 | Bacteria | 2811 |
| 543 | Ga0207683_10116271 | 3300026121 | Bacteria | 2398 |
| 544 | Ga0207683_10185954 | 3300026121 | Bacteria | 1885 |
| 545 | Ga0207683_10186623 | 3300026121 | Bacteria | 1881 |
| 546 | Ga0207683_10500965 | 3300026121 | Bacteria | 1122 |
| 547 | Ga0207698_10120617 | 3300026142 | Bacteria | 2218 |
| 548 | Ga0207698_10179198 | 3300026142 | Bacteria | 1875 |
| 549 | Ga0207698_10218427 | 3300026142 | Bacteria | 1721 |
| 550 | Ga0207698_10351551 | 3300026142 | Bacteria | 1392 |
| 551 | Ga0209389_1000012 | 3300027296 | Bacteria | 213243 |
| 552 | Ga0209389_1000069 | 3300027296 | Bacteria | 98063 |
| 553 | Ga0209589_1000015 | 3300027357 | Bacteria | 225913 |
| 554 | Ga0209589_1000077 | 3300027357 | Bacteria | 98063 |
| 555 | Ga0209489_100015 | 3300027361 | Bacteria | 225913 |
| 556 | Ga0209489_100019 | 3300027361 | Bacteria | 213243 |
| 557 | Ga0209489_100020 | 3300027361 | Bacteria | 207541 |
| 558 | Ga0209700_100018 | 3300027363 | Bacteria | 238200 |
| 559 | Ga0209700_100025 | 3300027363 | Bacteria | 225913 |
| 560 | Ga0209179_1013181 | 3300027512 | Bacteria | 1498 |
| 561 | Ga0209588_1063300 | 3300027671 | Bacteria | 1195 |
| 562 | Ga0209588_1097525 | 3300027671 | Bacteria | 947 |
| 563 | Ga0268266_10003191 | 3300028379 | Bacteria | 16594 |
| 564 | Ga0268266_10003840 | 3300028379 | Bacteria | 14672 |
| 565 | Ga0268266_10008431 | 3300028379 | Bacteria | 9163 |
| 566 | Ga0268266_10021532 | 3300028379 | Bacteria | 5492 |
| 567 | Ga0268266_10155256 | 3300028379 | Bacteria | 2066 |
| 568 | Ga0268266_10189154 | 3300028379 | Bacteria | 1879 |
| 569 | Ga0268266_10195048 | 3300028379 | Bacteria | 1850 |
| 570 | Ga0268266_10206600 | 3300028379 | Bacteria | 1799 |
| 571 | Ga0268266_10324120 | 3300028379 | Bacteria | 1443 |
| 572 | Ga0268265_10086534 | 3300028380 | Bacteria | 2491 |
| 573 | Ga0268265_10100388 | 3300028380 | Bacteria | 2336 |
| 574 | Ga0268265_10364850 | 3300028380 | Bacteria | 1323 |
| 575 | Ga0268264_10000356 | 3300028381 | Bacteria | 68810 |
| 576 | Ga0268264_10012778 | 3300028381 | Bacteria | 6910 |
| 577 | Ga0268264_10106078 | 3300028381 | Bacteria | 2452 |
| 578 | Ga0268264_10127578 | 3300028381 | Bacteria | 2251 |
| 579 | Ga0268264_10278330 | 3300028381 | Bacteria | 1566 |
| 580 | Ga0268264_10340367 | 3300028381 | Bacteria | 1425 |
| 581 | Ga0268264_10396310 | 3300028381 | Bacteria | 1325 |
| 582 | Ga0268264_10427353 | 3300028381 | Bacteria | 1279 |
| 583 | Ga0268264_10951132 | 3300028381 | Bacteria | 864 |
| 584 | Ga0265319_1007649 | 3300028563 | Bacteria | 4826 |
| 585 | Ga0265334_10003382 | 3300028573 | Bacteria | 7274 |
| 586 | Ga0265323_10001977 | 3300028653 | Bacteria | 9666 |
| 587 | Ga0265336_10000850 | 3300028666 | Bacteria | 15908 |
| 588 | Ga0307517_10001423 | 3300028786 | Bacteria | 40213 |
| 589 | Ga0307515_10032146 | 3300028794 | Bacteria | 8708 |
| 590 | Ga0307515_10099632 | 3300028794 | Bacteria | 3526 |
| 591 | Ga0307515_10201913 | 3300028794 | Bacteria | 1861 |
| 592 | Ga0265338_10000417 | 3300028800 | Bacteria | 76249 |
| 593 | Ga0307511_10000008 | 3300030521 | Bacteria | 159928 |
| 594 | Ga0307511_10097728 | 3300030521 | Bacteria | 1948 |
| 595 | Ga0307512_10237852 | 3300030522 | Bacteria | 926 |
| 596 | Ga0316177_1163553 | 3300030731 | Bacteria | 1436 |
| 597 | Ga0316176_1070980 | 3300030732 | Bacteria | 4800 |
| 598 | Ga0314311_1086767 | 3300030733 | Bacteria | 5850 |
| 599 | Ga0265330_10011339 | 3300031235 | Bacteria | 4183 |
| 600 | Ga0265330_10026413 | 3300031235 | Bacteria | 2626 |
| 601 | Ga0265330_10097528 | 3300031235 | Bacteria | 1259 |
| 602 | Ga0265330_10110884 | 3300031235 | Bacteria | 1172 |
| 603 | Ga0265325_10159179 | 3300031241 | Bacteria | 1063 |
| 604 | Ga0265340_10034481 | 3300031247 | Bacteria | 2517 |
| 605 | Ga0265339_10003359 | 3300031249 | Bacteria | 11199 |
| 606 | Ga0265339_10191771 | 3300031249 | Bacteria | 1013 |
| 607 | Ga0265331_10100097 | 3300031250 | Bacteria | 1335 |
| 608 | Ga0307513_10065970 | 3300031456 | Bacteria | 3806 |
| 609 | Ga0307509_10000099 | 3300031507 | Bacteria | 121307 |
| 610 | Ga0307509_10009216 | 3300031507 | Bacteria | 12388 |
| 611 | Ga0307508_10000012 | 3300031616 | Bacteria | 243167 |
| 612 | Ga0307508_10013966 | 3300031616 | Bacteria | 7327 |
| 613 | Ga0307508_10084322 | 3300031616 | Bacteria | 2759 |
| 614 | Ga0307508_10109628 | 3300031616 | Bacteria | 2360 |
| 615 | Ga0307508_10119140 | 3300031616 | Bacteria | 2242 |
| 616 | Ga0307508_10159930 | 3300031616 | Bacteria | 1856 |
| 617 | Ga0265314_10031058 | 3300031711 | Bacteria | 3948 |
| 618 | Ga0265314_10035228 | 3300031711 | Bacteria | 3650 |
| 619 | Ga0265342_10179250 | 3300031712 | Bacteria | 1161 |
| 620 | Ga0307516_10005305 | 3300031730 | Bacteria | 15512 |
| 621 | Ga0307516_10095915 | 3300031730 | Bacteria | 2787 |
| 622 | Ga0307516_10196695 | 3300031730 | Bacteria | 1738 |
| 623 | Ga0307516_10218548 | 3300031730 | Bacteria | 1616 |
| 624 | Ga0307516_10268081 | 3300031730 | Bacteria | 1395 |
| 625 | Ga0307516_10276953 | 3300031730 | Bacteria | 1361 |
| 626 | Ga0307413_10069390 | 3300031824 | Bacteria | 2212 |
| 627 | Ga0307406_10449450 | 3300031901 | Bacteria | 1033 |
| 628 | Ga0307412_10131399 | 3300031911 | Bacteria | 1819 |
| 629 | Ga0307409_100020833 | 3300031995 | Bacteria | 4480 |
| 630 | Ga0307409_100021182 | 3300031995 | Bacteria | 4451 |
| 631 | Ga0307416_100536160 | 3300032002 | Bacteria | 1241 |
| 632 | Ga0307411_10152153 | 3300032005 | Bacteria | 1721 |
| 633 | Ga0307411_10297099 | 3300032005 | Bacteria | 1293 |
| 634 | Ga0307507_10018351 | 3300033179 | Bacteria | 7960 |
| 635 | Ga0307510_10015377 | 3300033180 | Bacteria | 9047 |
| 636 | Ga0307510_10023362 | 3300033180 | Bacteria | 7168 |
| 637 | Ga0307510_10047751 | 3300033180 | Bacteria | 4580 |
| 638 | Ga0307510_10104600 | 3300033180 | Bacteria | 2603 |
| 639 | Ga0307510_10227563 | 3300033180 | Bacteria | 1370 |
| 640 | Ga0315911_1000021 | 3300033442 | Bacteria | 124874 |
| 641 | Ga0373930_0052116 | 3300034816 | Bacteria | 896 |
| 642 | Ga0373929_0034705 | 3300035085 | Bacteria | 1095 |
| 643 | Ga0373934_0088182 | 3300035086 | Bacteria | 1249 |
| 644 | Ga0373944_0019917 | 3300035089 | Bacteria | 1929 |
| 645 | Ga0373932_0033069 | 3300035112 | Bacteria | 1450 |
| 646 | Ga0373936_0001098 | 3300035113 | Bacteria | 9698 |
| 647 | Ga0373953_0001769 | 3300035117 | Bacteria | 6378 |
| 648 | Ga0373953_0086399 | 3300035117 | Bacteria | 1309 |
| 649 | Ga0373954_0001440 | 3300035118 | Bacteria | 9662 |
| 650 | Ga0373954_0028874 | 3300035118 | Bacteria | 2552 |
| 651 | Ga0373954_0037561 | 3300035118 | Bacteria | 2251 |
| 652 | Ga0373956_0000376 | 3300035119 | Bacteria | 18268 |
| 653 | Ga0373957_0099827 | 3300035120 | Bacteria | 1161 |
| 654 | Ga0373943_0008191 | 3300035170 | Bacteria | 4691 |
| 655 | Ga0373946_0003124 | 3300035171 | Bacteria | 5867 |
| 656 | Ga0373946_0034331 | 3300035171 | Bacteria | 2048 |
| 657 | Ga0373946_0057107 | 3300035171 | Bacteria | 1650 |
| 658 | Ga0373955_0000325 | 3300035172 | Bacteria | 19823 |
| 659 | Ga0373955_0011981 | 3300035172 | Bacteria | 4155 |
| 660 | Ga0373924_0003814 | 3300035410 | Bacteria | 5215 |
| 661 | Ga0373924_0004645 | 3300035410 | Bacteria | 4813 |
| 662 | Ga0373931_0247935 | 3300035691 | Bacteria | 1082 |
| 663 | Ga0373935_0009726 | 3300035692 | Bacteria | 5757 |
| 664 | Ga0373935_0138447 | 3300035692 | Bacteria | 1642 |
| 665 | Ga0373935_0256045 | 3300035692 | Bacteria | 1226 |
| 666 | Ga0373927_0000137 | 3300035695 | Bacteria | 56546 |
| 667 | Ga0373927_0005689 | 3300035695 | Bacteria | 8558 |
| 668 | Ga0373927_0011599 | 3300035695 | Bacteria | 5869 |
| 669 | Ga0373927_0034887 | 3300035695 | Bacteria | 3272 |
| 670 | Ga0373927_0049382 | 3300035695 | Bacteria | 2720 |
| 671 | Ga0373927_0151498 | 3300035695 | Bacteria | 1518 |
| 672 | Ga0373927_0165713 | 3300035695 | Bacteria | 1448 |
| 673 | Ga0373927_0240955 | 3300035695 | Bacteria | 1188 |
| 674 | Ga0373933_0005894 | 3300035724 | Bacteria | 6664 |
| 675 | Ga0373933_0050314 | 3300035724 | Bacteria | 2487 |
| 676 | Ga0373947_0000902 | 3300035725 | Bacteria | 17985 |
| 677 | Ga0373947_0010663 | 3300035725 | Bacteria | 5275 |
| 678 | Ga0373947_0028351 | 3300035725 | Bacteria | 3282 |
| 679 | Ga0373947_0102210 | 3300035725 | Bacteria | 1802 |
| 680 | Ga0373937_0007855 | 3300036401 | Bacteria | 9247 |
| 681 | Ga0373937_0035311 | 3300036401 | Bacteria | 4550 |
| 682 | Ga0373925_0071767 | 3300037068 | Bacteria | 2619 |
| 683 | Ga0373925_0104780 | 3300037068 | Bacteria | 2178 |
| 684 | Ga0373925_0157515 | 3300037068 | Bacteria | 1787 |
| 685 | Ga0395900_0001756 | 3300037418 | Bacteria | 24872 |
| 686 | Ga0395900_0032032 | 3300037418 | Bacteria | 5405 |
| 687 | Ga0395898_0014127 | 3300037466 | Bacteria | 8208 |
| 688 | Ga0395898_0023431 | 3300037466 | Bacteria | 6239 |
| 689 | Ga0395898_0174446 | 3300037466 | Bacteria | 2055 |
| 690 | Ga0395905_0212851 | 3300037471 | Bacteria | 1810 |
| 691 | Ga0436364_0036306 | 3300037853 | Bacteria | 8345 |
| 692 | Ga0436364_0085858 | 3300037853 | Bacteria | 16249 |
| 693 | Ga0436364_0455523 | 3300037853 | Bacteria | 1141 |
| 694 | Ga0436364_1346733 | 3300037853 | Bacteria | 3002 |
| 695 | Ga0395901_0004622 | 3300038443 | Bacteria | 13894 |
| 696 | Ga0395901_0033726 | 3300038443 | Bacteria | 5286 |
| 697 | Ga0395901_0191631 | 3300038443 | Bacteria | 2144 |
| 698 | Ga0395901_0237445 | 3300038443 | Bacteria | 1902 |
| 699 | Ga0395901_0348822 | 3300038443 | Bacteria | 1528 |
| 700 | Ga0395901_0618935 | 3300038443 | Bacteria | 1090 |
| 701 | Ga0400485_10823 | 3300038735 | Bacteria | 11344 |
| 702 | Ga0400483_012731 | 3300039062 | Bacteria | 10321 |
| 703 | Ga0400483_029660 | 3300039062 | Bacteria | 2936 |
| 704 | Ga0400483_195596 | 3300039062 | Bacteria | 42851 |
| 705 | Ga0400483_208463 | 3300039062 | Bacteria | 3175 |
| 706 | Ga0400483_227670 | 3300039062 | Bacteria | 5938 |
| 707 | Ga0400487_38375 | 3300039110 | Bacteria | 1028 |
| 708 | Ga0400487_45671 | 3300039110 | Bacteria | 4917 |
| 709 | Ga0436365_0291034 | 3300039437 | Bacteria | 3381 |
| 710 | Ga0436365_0352699 | 3300039437 | Bacteria | 1365 |
| 711 | Ga0436365_0592130 | 3300039437 | Bacteria | 8188 |
| 712 | Ga0436365_0623836 | 3300039437 | Bacteria | 1124 |
| 713 | Ga0436365_1451371 | 3300039437 | Bacteria | 1362 |
| 714 | Ga0436365_1874811 | 3300039437 | Bacteria | 2098 |
| 715 | Ga0436360_0560711 | 3300039438 | Bacteria | 1141 |
| 716 | Ga0436360_0977178 | 3300039438 | Bacteria | 1126 |
| 717 | Ga0436361_1185290 | 3300039447 | Bacteria | 1674 |
| 718 | Ga0436361_1201280 | 3300039447 | Bacteria | 1731 |
| 719 | Ga0436363_1489411 | 3300039450 | Bacteria | 1658 |
| 720 | Ga0436362_0664428 | 3300039453 | Bacteria | 5651 |
| 721 | Ga0436362_0913305 | 3300039453 | Bacteria | 992 |
| 722 | Ga0451793_0643539 | 3300041452 | Bacteria | 1430 |
| 723 | Ga0451837_0165624 | 3300041494 | Bacteria | 1097 |
| 724 | Ga0451839_0993113 | 3300041496 | Bacteria | 1069 |
| 725 | Ga0439464_0037956 | 3300042439 | Bacteria | 1368 |
| 726 | Ga0439440_0035015 | 3300042993 | Bacteria | 1203 |
| 727 | Ga0466969_0006671 | 3300044656 | Bacteria | 6135 |
| 728 | Ga0466969_0023683 | 3300044656 | Bacteria | 3162 |
| 729 | Ga0466972_0000100 | 3300044658 | Bacteria | 76018 |
| 730 | Ga0466965_0000658 | 3300044683 | Bacteria | 12681 |
| 731 | Ga0466965_0118215 | 3300044683 | Bacteria | 1367 |
| 732 | Ga0466966_0001463 | 3300044684 | Bacteria | 15199 |
| 733 | Ga0466966_0005774 | 3300044684 | Bacteria | 8152 |
| 734 | Ga0466961_0000065 | 3300044693 | Bacteria | 63259 |
| 735 | Ga0466961_0003171 | 3300044693 | Bacteria | 10239 |
| 736 | Ga0466961_0207952 | 3300044693 | Bacteria | 1209 |
| 737 | Ga0466963_0047566 | 3300044694 | Bacteria | 2831 |
| 738 | Ga0466963_0057196 | 3300044694 | Bacteria | 2597 |
| 739 | Ga0466964_0003697 | 3300044706 | Bacteria | 5601 |
| 740 | Ga0466964_0058713 | 3300044706 | Bacteria | 1596 |
| 741 | Ga0466971_0000087 | 3300044719 | Bacteria | 33674 |
| 742 | Ga0466968_0015345 | 3300044735 | Bacteria | 3035 |
| 743 | Ga0466968_0033584 | 3300044735 | Bacteria | 2138 |
| 744 | Ga0466968_0054753 | 3300044735 | Bacteria | 1710 |
| 745 | Ga0466970_0000283 | 3300044765 | Bacteria | 24806 |
| 746 | Ga0466970_0028514 | 3300044765 | Bacteria | 2934 |
| 747 | Ga0466960_0009188 | 3300044901 | Bacteria | 4069 |
| 748 | Ga0466960_0021600 | 3300044901 | Bacteria | 2868 |
| 749 | Ga0466960_0026907 | 3300044901 | Bacteria | 2617 |
| 750 | Ga0466959_0000634 | 3300045049 | Bacteria | 20407 |
| 751 | Ga0466959_0009459 | 3300045049 | Bacteria | 6934 |
| 752 | Ga0466967_0090558 | 3300045976 | Bacteria | 2779 |
| 753 | Ga0466967_0112086 | 3300045976 | Bacteria | 2508 |
| 754 | Ga0466967_0118024 | 3300045976 | Bacteria | 2447 |
| 755 | Ga0466967_0207709 | 3300045976 | Bacteria | 1856 |
| 756 | Ga0466967_0265729 | 3300045976 | Bacteria | 1642 |
| 757 | Ga0466967_0292030 | 3300045976 | Bacteria | 1566 |
| 758 | Ga0495617_098735 | 3300046452 | Bacteria | 950 |
| 759 | Ga0495627_094140 | 3300046453 | Bacteria | 860 |
| 760 | Ga0495592_0000339 | 3300046454 | Bacteria | 38389 |
| 761 | Ga0495592_0029318 | 3300046454 | Bacteria | 4168 |
| 762 | Ga0495603_0004836 | 3300046455 | Bacteria | 8053 |
| 763 | Ga0495603_0050828 | 3300046455 | Bacteria | 2464 |
| 764 | Ga0495603_0052048 | 3300046455 | Bacteria | 2432 |
| 765 | Ga0495603_0062548 | 3300046455 | Bacteria | 2197 |
| 766 | Ga0495629_0000029 | 3300046459 | Bacteria | 127000 |
| 767 | Ga0495629_0001483 | 3300046459 | Bacteria | 18494 |
| 768 | Ga0495638_0014467 | 3300046460 | Bacteria | 5330 |
| 769 | Ga0495638_0014620 | 3300046460 | Bacteria | 5296 |
| 770 | Ga0495641_0003605 | 3300046461 | Bacteria | 11465 |
| 771 | Ga0495641_0089774 | 3300046461 | Bacteria | 1373 |
| 772 | Ga0495651_0015606 | 3300046462 | Bacteria | 5879 |
| 773 | Ga0495651_0017638 | 3300046462 | Bacteria | 5524 |
| 774 | Ga0495651_0068973 | 3300046462 | Bacteria | 2694 |
| 775 | Ga0495651_0284642 | 3300046462 | Bacteria | 1115 |
| 776 | Ga0495653_0001063 | 3300046463 | Bacteria | 21155 |
| 777 | Ga0495653_0300266 | 3300046463 | Bacteria | 1048 |
| 778 | Ga0495650_0092896 | 3300046471 | Bacteria | 1145 |
| 779 | Ga0495580_0002567 | 3300046472 | Bacteria | 15791 |
| 780 | Ga0495582_0000024 | 3300046473 | Bacteria | 82444 |
| 781 | Ga0495582_0020290 | 3300046473 | Bacteria | 3637 |
| 782 | Ga0495582_0214284 | 3300046473 | Bacteria | 1101 |
| 783 | Ga0495639_0000006 | 3300046475 | Bacteria | 100361 |
| 784 | Ga0495662_0000348 | 3300046476 | Bacteria | 20253 |
| 785 | Ga0495662_0093023 | 3300046476 | Bacteria | 1471 |
| 786 | Ga0495664_0016204 | 3300046477 | Bacteria | 4245 |
| 787 | Ga0495664_0021231 | 3300046477 | Bacteria | 3751 |
| 788 | Ga0495664_0105086 | 3300046477 | Bacteria | 1702 |
| 789 | Ga0495664_0120714 | 3300046477 | Bacteria | 1585 |
| 790 | Ga0495585_0074628 | 3300046492 | Bacteria | 1845 |
| 791 | Ga0495594_0000170 | 3300046499 | Bacteria | 31295 |
| 792 | Ga0495594_0036584 | 3300046499 | Bacteria | 2677 |
| 793 | Ga0495594_0047390 | 3300046499 | Bacteria | 2360 |
| 794 | Ga0495594_0056100 | 3300046499 | Bacteria | 2173 |
| 795 | Ga0495596_0035810 | 3300046500 | Bacteria | 1967 |
| 796 | Ga0495596_0058367 | 3300046500 | Bacteria | 1505 |
| 797 | Ga0495583_0092267 | 3300046506 | Bacteria | 1302 |
| 798 | Ga0495606_0011270 | 3300046507 | Bacteria | 7313 |
| 799 | Ga0495606_0018835 | 3300046507 | Bacteria | 5163 |
| 800 | Ga0495608_0002749 | 3300046511 | Bacteria | 12636 |
| 801 | Ga0495608_0015906 | 3300046511 | Bacteria | 5207 |
| 802 | Ga0495608_0148063 | 3300046511 | Bacteria | 1497 |
| 803 | Ga0495610_0017796 | 3300046512 | Bacteria | 4041 |
| 804 | Ga0495616_0099069 | 3300046513 | Bacteria | 1369 |
| 805 | Ga0495616_0180773 | 3300046513 | Bacteria | 937 |
| 806 | Ga0495618_0035917 | 3300046514 | Bacteria | 3110 |
| 807 | Ga0495618_0170053 | 3300046514 | Bacteria | 1387 |
| 808 | Ga0495618_0273196 | 3300046514 | Bacteria | 1056 |
| 809 | Ga0495620_0014280 | 3300046515 | Bacteria | 4040 |
| 810 | Ga0495628_0010789 | 3300046516 | Bacteria | 7737 |
| 811 | Ga0495630_0022330 | 3300046517 | Bacteria | 4674 |
| 812 | Ga0495630_0086064 | 3300046517 | Bacteria | 2373 |
| 813 | Ga0495631_0010813 | 3300046518 | Bacteria | 4508 |
| 814 | Ga0495632_0008791 | 3300046519 | Bacteria | 6154 |
| 815 | Ga0495632_0042897 | 3300046519 | Bacteria | 2265 |
| 816 | Ga0495632_0193414 | 3300046519 | Bacteria | 929 |
| 817 | Ga0495632_0206320 | 3300046519 | Bacteria | 893 |
| 818 | Ga0495643_0012456 | 3300046522 | Bacteria | 5131 |
| 819 | Ga0495643_0053465 | 3300046522 | Bacteria | 2165 |
| 820 | Ga0495648_0019042 | 3300046524 | Bacteria | 4841 |
| 821 | Ga0495666_0053731 | 3300046526 | Bacteria | 1932 |
| 822 | Ga0495652_0021359 | 3300046529 | Bacteria | 5757 |
| 823 | Ga0495652_0025147 | 3300046529 | Bacteria | 5271 |
| 824 | Ga0495652_0026600 | 3300046529 | Bacteria | 5108 |
| 825 | Ga0495652_0196766 | 3300046529 | Bacteria | 1533 |
| 826 | Ga0495665_0000178 | 3300046531 | Bacteria | 32333 |
| 827 | Ga0495665_0053691 | 3300046531 | Bacteria | 2130 |
| 828 | Ga0495640_0003797 | 3300046533 | Bacteria | 12127 |
| 829 | Ga0495640_0004410 | 3300046533 | Bacteria | 11233 |
| 830 | Ga0495640_0008433 | 3300046533 | Bacteria | 8084 |
| 831 | Ga0495640_0052678 | 3300046533 | Bacteria | 2793 |
| 832 | Ga0495586_0049167 | 3300046535 | Bacteria | 2280 |
| 833 | Ga0495587_0010898 | 3300046536 | Bacteria | 5768 |
| 834 | Ga0495587_0027904 | 3300046536 | Bacteria | 3437 |
| 835 | Ga0495597_0193830 | 3300046542 | Bacteria | 816 |
| 836 | Ga0495645_0004746 | 3300046543 | Bacteria | 9290 |
| 837 | Ga0495645_0052929 | 3300046543 | Bacteria | 2952 |
| 838 | Ga0495645_0060101 | 3300046543 | Bacteria | 2755 |
| 839 | Ga0495622_0002996 | 3300046557 | Bacteria | 8018 |
| 840 | Ga0495622_0010744 | 3300046557 | Bacteria | 4224 |
| 841 | Ga0495622_0045801 | 3300046557 | Bacteria | 2032 |
| 842 | Ga0495622_0052099 | 3300046557 | Bacteria | 1898 |
| 843 | Ga0495622_0087406 | 3300046557 | Bacteria | 1433 |
| 844 | Ga0495667_0003075 | 3300046559 | Bacteria | 11195 |
| 845 | Ga0495667_0011132 | 3300046559 | Bacteria | 6087 |
| 846 | Ga0495667_0053001 | 3300046559 | Bacteria | 2672 |
| 847 | Ga0495656_0006097 | 3300046615 | Bacteria | 4206 |
| 848 | Ga0495656_0023093 | 3300046615 | Bacteria | 2444 |
| 849 | Ga0495656_0063045 | 3300046615 | Bacteria | 1623 |
| 850 | Ga0495668_0034641 | 3300046616 | Bacteria | 2831 |
| 851 | Ga0495668_0085454 | 3300046616 | Bacteria | 1730 |
| 852 | Ga0495668_0103918 | 3300046616 | Bacteria | 1554 |
| 853 | Ga0495668_0133489 | 3300046616 | Bacteria | 1359 |
| 854 | Ga0495634_0000354 | 3300046642 | Bacteria | 44714 |
| 855 | Ga0495634_0002330 | 3300046642 | Bacteria | 15886 |
| 856 | Ga0495634_0057346 | 3300046642 | Bacteria | 2600 |
| 857 | Ga0495611_0178543 | 3300046648 | Bacteria | 992 |
| 858 | Ga0495625_0013541 | 3300046660 | Bacteria | 6544 |
| 859 | Ga0495625_0169771 | 3300046660 | Bacteria | 1457 |
| 860 | Ga0495635_0000917 | 3300046663 | Bacteria | 19365 |
| 861 | Ga0495635_0002291 | 3300046663 | Bacteria | 13017 |
| 862 | Ga0495635_0039894 | 3300046663 | Bacteria | 3247 |
| 863 | Ga0495635_0056088 | 3300046663 | Bacteria | 2713 |
| 864 | Ga0495661_0028715 | 3300046665 | Bacteria | 3557 |
| 865 | Ga0495588_0009296 | 3300046674 | Bacteria | 4539 |
| 866 | Ga0495588_0058730 | 3300046674 | Bacteria | 1988 |
| 867 | Ga0495588_0193433 | 3300046674 | Bacteria | 1074 |
| 868 | Ga0495657_0003543 | 3300046675 | Bacteria | 12725 |
| 869 | Ga0495657_0005133 | 3300046675 | Bacteria | 10381 |
| 870 | Ga0495657_0027263 | 3300046675 | Bacteria | 4034 |
| 871 | Ga0495599_0001780 | 3300046678 | Bacteria | 12490 |
| 872 | Ga0495599_0096712 | 3300046678 | Bacteria | 1841 |
| 873 | Ga0495599_0127936 | 3300046678 | Bacteria | 1578 |
| 874 | Ga0495599_0243513 | 3300046678 | Bacteria | 1096 |
| 875 | Ga0495623_0058222 | 3300046679 | Bacteria | 2429 |
| 876 | Ga0495623_0094099 | 3300046679 | Bacteria | 1833 |
| 877 | Ga0495623_0144152 | 3300046679 | Bacteria | 1414 |
| 878 | Ga0495623_0185421 | 3300046679 | Bacteria | 1206 |
| 879 | Ga0495646_0025247 | 3300046680 | Bacteria | 3739 |
| 880 | Ga0495646_0035304 | 3300046680 | Bacteria | 3102 |
| 881 | Ga0495646_0066004 | 3300046680 | Bacteria | 2141 |
| 882 | Ga0495646_0122095 | 3300046680 | Bacteria | 1473 |
| 883 | Ga0495647_0000068 | 3300046681 | Bacteria | 25521 |
| 884 | Ga0495658_0000428 | 3300046683 | Bacteria | 23516 |
| 885 | Ga0495658_0045383 | 3300046683 | Bacteria | 2466 |
| 886 | Ga0495658_0205755 | 3300046683 | Bacteria | 1228 |
| 887 | Ga0495669_0043701 | 3300046684 | Bacteria | 1995 |
| 888 | Ga0495613_0001078 | 3300046689 | Bacteria | 20808 |
| 889 | Ga0495613_0012318 | 3300046689 | Bacteria | 6353 |
| 890 | Ga0495613_0099574 | 3300046689 | Bacteria | 2100 |
| 891 | Ga0495624_0011428 | 3300046690 | Bacteria | 6100 |
| 892 | Ga0495624_0047038 | 3300046690 | Bacteria | 2742 |
| 893 | Ga0495624_0091301 | 3300046690 | Bacteria | 1879 |
| 894 | Ga0495624_0128678 | 3300046690 | Bacteria | 1553 |
| 895 | Ga0495624_0323140 | 3300046690 | Bacteria | 929 |
| 896 | Ga0495670_0019310 | 3300046691 | Bacteria | 3357 |
| 897 | Ga0495670_0161433 | 3300046691 | Bacteria | 1177 |
| 898 | Ga0495649_0072883 | 3300046694 | Bacteria | 1840 |
| 899 | Ga0495600_0002741 | 3300046809 | Bacteria | 10203 |
| 900 | Ga0495600_0030546 | 3300046809 | Bacteria | 3490 |
| 901 | Ga0495600_0114802 | 3300046809 | Bacteria | 1753 |
| 902 | Ga0495660_0146092 | 3300046810 | Bacteria | 1172 |
| 903 | Ga0495581_0000004 | 3300047315 | Bacteria | 84424 |
| 904 | Ga0495581_0040506 | 3300047315 | Bacteria | 2696 |
| 905 | Ga0495581_0088840 | 3300047315 | Bacteria | 1792 |
| 906 | Ga0495581_0093911 | 3300047315 | Bacteria | 1741 |
| 907 | Ga0495604_0007541 | 3300047317 | Bacteria | 8607 |
| 908 | Ga0495604_0007941 | 3300047317 | Bacteria | 8404 |
| 909 | Ga0495604_0129611 | 3300047317 | Bacteria | 1814 |
| 910 | Ga0495604_0188580 | 3300047317 | Bacteria | 1438 |
| 911 | Ga0495674_0000415 | 3300047319 | Bacteria | 38235 |
| 912 | Ga0495674_0007236 | 3300047319 | Bacteria | 10620 |
| 913 | Ga0495674_0064759 | 3300047319 | Bacteria | 3177 |
| 914 | Ga0495672_0014400 | 3300047320 | Bacteria | 5417 |
| 915 | Ga0495672_0020725 | 3300047320 | Bacteria | 4302 |
| 916 | Ga0495672_0062347 | 3300047320 | Bacteria | 2145 |
| 917 | Ga0495676_0005426 | 3300047321 | Bacteria | 11697 |
| 918 | Ga0495676_0014630 | 3300047321 | Bacteria | 7017 |
| 919 | Ga0495680_0001065 | 3300047322 | Bacteria | 30372 |
| 920 | Ga0495680_0001876 | 3300047322 | Bacteria | 22116 |
| 921 | Ga0495687_003727 | 3300047443 | Bacteria | 10810 |
| 922 | Ga0495687_021060 | 3300047443 | Bacteria | 3165 |
| 923 | Ga0495675_0000901 | 3300047444 | Bacteria | 18140 |
| 924 | Ga0495675_0120704 | 3300047444 | Bacteria | 1632 |
| 925 | Ga0495681_0087897 | 3300047470 | Bacteria | 1377 |
| 926 | Ga0495684_0000721 | 3300047471 | Bacteria | 26637 |
| 927 | Ga0495684_0035951 | 3300047471 | Bacteria | 3798 |
| 928 | Ga0495684_0071064 | 3300047471 | Bacteria | 2645 |
| 929 | Ga0495686_0033638 | 3300047472 | Bacteria | 3308 |
| 930 | Ga0495686_0098354 | 3300047472 | Bacteria | 1768 |
| 931 | Ga0495686_0282812 | 3300047472 | Bacteria | 921 |
| 932 | Ga0495593_0000198 | 3300047673 | Bacteria | 31587 |
| 933 | Ga0495593_0003019 | 3300047673 | Bacteria | 10137 |
| 934 | Ga0495593_0049151 | 3300047673 | Bacteria | 2239 |
| 935 | Ga0495593_0152910 | 3300047673 | Bacteria | 1167 |
| 936 | Ga0495593_0199560 | 3300047673 | Bacteria | 1005 |
| 937 | Ga0495602_0029916 | 3300048088 | Bacteria | 5175 |
| 938 | Ga0495602_0132190 | 3300048088 | Bacteria | 1988 |
| 939 | Ga0495614_0007486 | 3300048089 | Bacteria | 4861 |
| 940 | Ga0495626_0054347 | 3300048091 | Bacteria | 1839 |
| 941 | Ga0496100_0096658 | 3300048903 | Bacteria | 2027 |
| 942 | Ga0496100_0139213 | 3300048903 | Bacteria | 1718 |
| 943 | Ga0496100_0277907 | 3300048903 | Bacteria | 1247 |
| 944 | Ga0496101_0027879 | 3300048904 | Bacteria | 3939 |
| 945 | Ga0496101_0077660 | 3300048904 | Bacteria | 2447 |
| 946 | Ga0496101_0086032 | 3300048904 | Bacteria | 2331 |
| 947 | Ga0496101_0110967 | 3300048904 | Bacteria | 2064 |
| 948 | Ga0496101_0147933 | 3300048904 | Bacteria | 1795 |
| 949 | Ga0496102_0012964 | 3300048905 | Bacteria | 7219 |
| 950 | Ga0496102_0013853 | 3300048905 | Bacteria | 6997 |
| 951 | Ga0496102_0124408 | 3300048905 | Bacteria | 2410 |
| 952 | Ga0496102_0187334 | 3300048905 | Bacteria | 1950 |
| 953 | Ga0496102_0542760 | 3300048905 | Bacteria | 1085 |
| 954 | Ga0496102_0569556 | 3300048905 | Bacteria | 1055 |
| 955 | Ga0496102_0649462 | 3300048905 | Bacteria | 978 |
| 956 | Ga0496102_0694411 | 3300048905 | Bacteria | 941 |
| 957 | Ga0496103_0175961 | 3300048906 | Bacteria | 1375 |
| 958 | Ga0496104_0055427 | 3300048907 | Bacteria | 3748 |
| 959 | Ga0496104_0231539 | 3300048907 | Bacteria | 1759 |
| 960 | Ga0496104_0240597 | 3300048907 | Bacteria | 1722 |
| 961 | Ga0496104_0329557 | 3300048907 | Bacteria | 1440 |
| 962 | Ga0496105_0007733 | 3300048908 | Bacteria | 8340 |
| 963 | Ga0496105_0173234 | 3300048908 | Bacteria | 1768 |
| 964 | Ga0496105_0295595 | 3300048908 | Bacteria | 1303 |
| 965 | Ga0496105_0355940 | 3300048908 | Bacteria | 1168 |
| 966 | Ga0496106_0001953 | 3300048909 | Bacteria | 15491 |
| 967 | Ga0496106_0008314 | 3300048909 | Bacteria | 7679 |
| 968 | Ga0496106_0066768 | 3300048909 | Bacteria | 2741 |
| 969 | Ga0496106_0191804 | 3300048909 | Bacteria | 1625 |
| 970 | Ga0496106_0209800 | 3300048909 | Bacteria | 1551 |
| 971 | Ga0496106_0432557 | 3300048909 | Bacteria | 1057 |
| 972 | Ga0496107_0099178 | 3300048910 | Bacteria | 2134 |
| 973 | Ga0496107_0127229 | 3300048910 | Bacteria | 1880 |
| 974 | Ga0496107_0251629 | 3300048910 | Bacteria | 1314 |
| 975 | Ga0496107_0325862 | 3300048910 | Bacteria | 1143 |
| 976 | Ga0496108_0068160 | 3300048911 | Bacteria | 3001 |
| 977 | Ga0496108_0265072 | 3300048911 | Bacteria | 1495 |
| 978 | Ga0496109_0164822 | 3300048912 | Bacteria | 2077 |
| 979 | Ga0496109_0224299 | 3300048912 | Bacteria | 1768 |
| 980 | Ga0496109_0425431 | 3300048912 | Bacteria | 1254 |
| 981 | Ga0496109_0434186 | 3300048912 | Bacteria | 1240 |
| 982 | Ga0496110_0129377 | 3300048913 | Bacteria | 2279 |
| 983 | Ga0496110_0196058 | 3300048913 | Bacteria | 1834 |
| 984 | Ga0496110_0237240 | 3300048913 | Bacteria | 1659 |
| 985 | Ga0496110_0347350 | 3300048913 | Bacteria | 1351 |
| 986 | Ga0496111_0184293 | 3300048914 | Bacteria | 1552 |
| 987 | Ga0496111_0349585 | 3300048914 | Bacteria | 1094 |
| 988 | Ga0496111_0350091 | 3300048914 | Bacteria | 1093 |
| 989 | Ga0496112_0053717 | 3300048915 | Bacteria | 3957 |
| 990 | Ga0496112_0130672 | 3300048915 | Bacteria | 2482 |
| 991 | Ga0496112_0246316 | 3300048915 | Bacteria | 1739 |
| 992 | Ga0496112_0403057 | 3300048915 | Bacteria | 1307 |
| 993 | Ga0496112_0540012 | 3300048915 | Bacteria | 1100 |
| 994 | Ga0496113_0039173 | 3300048916 | Bacteria | 3487 |
| 995 | Ga0496113_0092599 | 3300048916 | Bacteria | 2331 |
| 996 | Ga0496113_0356131 | 3300048916 | Bacteria | 1174 |
| 997 | Ga0496114_0038373 | 3300048917 | Bacteria | 3963 |
| 998 | Ga0496114_0039555 | 3300048917 | Bacteria | 3902 |
| 999 | Ga0496114_0559041 | 3300048917 | Bacteria | 1010 |
| 1000 | Ga0496115_0004493 | 3300048918 | Bacteria | 10094 |
| 1001 | Ga0496115_0138953 | 3300048918 | Bacteria | 2004 |
| 1002 | Ga0496115_0221986 | 3300048918 | Bacteria | 1559 |
| 1003 | Ga0496115_0222086 | 3300048918 | Bacteria | 1559 |
| 1004 | Ga0496115_0246072 | 3300048918 | Bacteria | 1473 |
| 1005 | Ga0496115_0338616 | 3300048918 | Bacteria | 1228 |
| 1006 | Ga0496115_0341805 | 3300048918 | Bacteria | 1221 |
| 1007 | Ga0496115_0602661 | 3300048918 | Bacteria | 873 |
| 1008 | Ga0496116_0000965 | 3300048919 | Bacteria | 35491 |
| 1009 | Ga0496116_0036633 | 3300048919 | Bacteria | 3430 |
| 1010 | Ga0496117_0007318 | 3300048920 | Bacteria | 10829 |
| 1011 | Ga0496117_0162653 | 3300048920 | Bacteria | 1305 |
| 1012 | Ga0496117_0190332 | 3300048920 | Bacteria | 1169 |
| 1013 | Ga0496117_0191841 | 3300048920 | Bacteria | 1163 |
| 1014 | Ga0496118_0006555 | 3300048921 | Bacteria | 12729 |
| 1015 | Ga0496118_0011084 | 3300048921 | Bacteria | 8847 |
| 1016 | Ga0496118_0017995 | 3300048921 | Bacteria | 6401 |
| 1017 | Ga0496118_0034317 | 3300048921 | Bacteria | 4142 |
| 1018 | Ga0496118_0112628 | 3300048921 | Bacteria | 1800 |
| 1019 | Ga0496118_0112699 | 3300048921 | Bacteria | 1799 |
| 1020 | Ga0496119_0007397 | 3300048922 | Bacteria | 9903 |
| 1021 | Ga0496120_0003365 | 3300048923 | Bacteria | 14668 |
| 1022 | Ga0496121_0001622 | 3300048924 | Bacteria | 37285 |
| 1023 | Ga0496121_0002148 | 3300048924 | Bacteria | 30905 |
| 1024 | Ga0496121_0002744 | 3300048924 | Bacteria | 26189 |
| 1025 | Ga0496121_0003594 | 3300048924 | Bacteria | 21886 |
| 1026 | Ga0496121_0009316 | 3300048924 | Bacteria | 11324 |
| 1027 | Ga0496121_0017077 | 3300048924 | Bacteria | 7442 |
| 1028 | Ga0496121_0017170 | 3300048924 | Bacteria | 7411 |
| 1029 | Ga0496121_0040869 | 3300048924 | Bacteria | 4062 |
| 1030 | Ga0496121_0096011 | 3300048924 | Bacteria | 2302 |
| 1031 | Ga0496121_0096605 | 3300048924 | Bacteria | 2292 |
| 1032 | Ga0496121_0207124 | 3300048924 | Bacteria | 1392 |
| 1033 | Ga0496121_0235293 | 3300048924 | Bacteria | 1280 |
| 1034 | Ga0496121_0236725 | 3300048924 | Bacteria | 1275 |
| 1035 | Ga0496121_0270186 | 3300048924 | Bacteria | 1169 |
| 1036 | Ga0496122_0053150 | 3300048925 | Bacteria | 3057 |
| 1037 | Ga0496122_0055559 | 3300048925 | Bacteria | 2961 |
| 1038 | Ga0496122_0080386 | 3300048925 | Bacteria | 2273 |
| 1039 | Ga0496122_0092401 | 3300048925 | Bacteria | 2057 |
| 1040 | Ga0496122_0125553 | 3300048925 | Bacteria | 1643 |
| 1041 | Ga0496123_0006724 | 3300048926 | Bacteria | 11061 |
| 1042 | Ga0496123_0060320 | 3300048926 | Bacteria | 2447 |
| 1043 | Ga0496123_0101821 | 3300048926 | Bacteria | 1669 |
| 1044 | Ga0496124_0097640 | 3300048927 | Bacteria | 2385 |
| 1045 | Ga0496124_0179578 | 3300048927 | Bacteria | 1630 |
| 1046 | Ga0496125_0001356 | 3300048928 | Bacteria | 36075 |
| 1047 | Ga0496125_0001441 | 3300048928 | Bacteria | 34581 |
| 1048 | Ga0496125_0001630 | 3300048928 | Bacteria | 31638 |
| 1049 | Ga0496125_0010481 | 3300048928 | Bacteria | 9373 |
| 1050 | Ga0496125_0020105 | 3300048928 | Bacteria | 6277 |
| 1051 | Ga0496125_0028550 | 3300048928 | Bacteria | 5036 |
| 1052 | Ga0496125_0048905 | 3300048928 | Bacteria | 3520 |
| 1053 | Ga0496125_0049622 | 3300048928 | Bacteria | 3485 |
| 1054 | Ga0496125_0095013 | 3300048928 | Bacteria | 2219 |
| 1055 | Ga0496125_0124008 | 3300048928 | Bacteria | 1835 |
| 1056 | Ga0496125_0246448 | 3300048928 | Bacteria | 1130 |
| 1057 | Ga0496126_0003472 | 3300048929 | Bacteria | 19892 |
| 1058 | Ga0496126_0011331 | 3300048929 | Bacteria | 9244 |
| 1059 | Ga0496126_0014638 | 3300048929 | Bacteria | 7918 |
| 1060 | Ga0496126_0018186 | 3300048929 | Bacteria | 6973 |
| 1061 | Ga0496126_0069916 | 3300048929 | Bacteria | 3129 |
| 1062 | Ga0496126_0075361 | 3300048929 | Bacteria | 2994 |
| 1063 | Ga0496126_0095956 | 3300048929 | Bacteria | 2600 |
| 1064 | Ga0496126_0119755 | 3300048929 | Bacteria | 2284 |
| 1065 | Ga0496126_0220702 | 3300048929 | Bacteria | 1592 |
| 1066 | Ga0496126_0226612 | 3300048929 | Bacteria | 1567 |
| 1067 | Ga0496126_0240298 | 3300048929 | Bacteria | 1513 |
| 1068 | Ga0496126_0304957 | 3300048929 | Bacteria | 1312 |
| 1069 | Ga0496126_0319545 | 3300048929 | Bacteria | 1276 |
| 1070 | Ga0496126_0364791 | 3300048929 | Bacteria | 1179 |
| 1071 | Ga0496126_0373353 | 3300048929 | Bacteria | 1162 |
| 1072 | Ga0496126_0456643 | 3300048929 | Bacteria | 1027 |
| 1073 | Ga0495678_044771 | 3300049459 | Bacteria | 1749 |
| 1074 | Ga0495682_0054713 | 3300049460 | Bacteria | 1448 |
| 1075 | Ga0495682_0075916 | 3300049460 | Bacteria | 1209 |
| 1076 | Ga0501031_0001791 | 3300049568 | Bacteria | 13478 |
| 1077 | Ga0501031_0093802 | 3300049568 | Bacteria | 1959 |
| 1078 | Ga0501032_0000762 | 3300049569 | Bacteria | 26183 |
| 1079 | Ga0501033_0000136 | 3300049570 | Bacteria | 70952 |
| 1080 | Ga0501033_0049190 | 3300049570 | Bacteria | 3129 |
| 1081 | Ga0501033_0072284 | 3300049570 | Bacteria | 2533 |
| 1082 | Ga0501034_0000251 | 3300049571 | Bacteria | 99406 |
| 1083 | Ga0501034_0408270 | 3300049571 | Bacteria | 1280 |
| 1084 | Ga0501034_0711287 | 3300049571 | Bacteria | 902 |
| 1085 | Ga0501036_0000036 | 3300049572 | Bacteria | 87244 |
| 1086 | Ga0501036_0158394 | 3300049572 | Bacteria | 1909 |
| 1087 | Ga0501036_0344008 | 3300049572 | Bacteria | 1246 |
| 1088 | Ga0501038_0000428 | 3300049574 | Bacteria | 36623 |
| 1089 | Ga0501038_0049185 | 3300049574 | Bacteria | 3646 |
| 1090 | Ga0501039_0000273 | 3300049575 | Bacteria | 37431 |
| 1091 | Ga0501041_0179609 | 3300049577 | Bacteria | 1325 |
| 1092 | Ga0501042_0025922 | 3300049578 | Bacteria | 4120 |
| 1093 | Ga0501042_0301952 | 3300049578 | Bacteria | 1157 |
| 1094 | Ga0501043_0000165 | 3300049579 | Bacteria | 59980 |
| 1095 | Ga0501043_0009206 | 3300049579 | Bacteria | 7761 |
| 1096 | Ga0501046_0255598 | 3300049580 | Bacteria | 1288 |
| 1097 | Ga0501047_0000340 | 3300049581 | Bacteria | 53278 |
| 1098 | Ga0501047_0032110 | 3300049581 | Bacteria | 5067 |
| 1099 | Ga0501047_0034136 | 3300049581 | Bacteria | 4912 |
| 1100 | Ga0501047_0144948 | 3300049581 | Bacteria | 2252 |
| 1101 | Ga0501047_0270209 | 3300049581 | Bacteria | 1546 |
| 1102 | Ga0501048_0004509 | 3300049582 | Bacteria | 10606 |
| 1103 | Ga0501048_0277354 | 3300049582 | Bacteria | 1192 |
| 1104 | Ga0501067_0007630 | 3300049583 | Bacteria | 6013 |
| 1105 | Ga0501067_0174516 | 3300049583 | Bacteria | 1197 |
| 1106 | Ga0501067_0274302 | 3300049583 | Bacteria | 939 |
| 1107 | Ga0501068_0003807 | 3300049584 | Bacteria | 8179 |
| 1108 | Ga0501069_0007026 | 3300049585 | Bacteria | 5893 |
| 1109 | Ga0501069_0156702 | 3300049585 | Bacteria | 1310 |
| 1110 | Ga0501069_0213219 | 3300049585 | Bacteria | 1121 |
| 1111 | Ga0501070_0006502 | 3300049586 | Bacteria | 9938 |
| 1112 | Ga0501070_0072776 | 3300049586 | Bacteria | 2845 |
| 1113 | Ga0501070_0510108 | 3300049586 | Bacteria | 965 |
| 1114 | Ga0501071_0201631 | 3300049587 | Bacteria | 1494 |
| 1115 | Ga0501071_0211399 | 3300049587 | Bacteria | 1459 |
| 1116 | Ga0501072_0007916 | 3300049588 | Bacteria | 8069 |
| 1117 | Ga0501073_0000037 | 3300049589 | Bacteria | 87345 |
| 1118 | Ga0501074_0000167 | 3300049590 | Bacteria | 35108 |
| 1119 | Ga0501074_0043432 | 3300049590 | Bacteria | 3253 |
| 1120 | Ga0501074_0078814 | 3300049590 | Bacteria | 2364 |
| 1121 | Ga0501077_0054761 | 3300049593 | Bacteria | 2533 |
| 1122 | Ga0501079_0001057 | 3300049741 | Bacteria | 19118 |
| 1123 | Ga0501079_0325178 | 3300049741 | Bacteria | 1204 |
| 1124 | Ga0501079_0422650 | 3300049741 | Bacteria | 1046 |
| 1125 | Ga0501080_0003259 | 3300049742 | Bacteria | 14325 |
| 1126 | Ga0501080_0008505 | 3300049742 | Bacteria | 9306 |
| 1127 | Ga0501080_0411127 | 3300049742 | Bacteria | 1216 |
| 1128 | Ga0501083_0074634 | 3300049744 | Bacteria | 2252 |
| 1129 | Ga0501035_0000142 | 3300049822 | Bacteria | 87561 |
| 1130 | Ga0501035_0028360 | 3300049822 | Bacteria | 5111 |
| 1131 | Ga0501035_0042364 | 3300049822 | Bacteria | 4106 |
| 1132 | Ga0501035_0121416 | 3300049822 | Bacteria | 2283 |
| 1133 | Ga0501035_0178683 | 3300049822 | Bacteria | 1829 |
| 1134 | Ga0501044_0000414 | 3300049823 | Bacteria | 52784 |
| 1135 | Ga0501044_0038934 | 3300049823 | Bacteria | 4964 |
| 1136 | Ga0501044_0522934 | 3300049823 | Bacteria | 1086 |
| 1137 | Ga0501045_0036286 | 3300049824 | Bacteria | 3579 |
| 1138 | Ga0501045_0316604 | 3300049824 | Bacteria | 1161 |
| 1139 | nmdc:mga00v17_354586_c1 | 3300050491 | Bacteria | 954 |
| 1140 | nmdc:mga0yw44_18813_c1 | 3300050492 | Bacteria | 3793 |
| 1141 | nmdc:mga0yw44_196694_c1 | 3300050492 | Bacteria | 1331 |
| 1142 | nmdc:mga0yw44_31644_c1 | 3300050492 | Bacteria | 3078 |
| 1143 | nmdc:mga0yw44_411967_c1 | 3300050492 | Bacteria | 914 |
| 1144 | nmdc:mga0yw44_9428_c1 | 3300050492 | Bacteria | 4936 |
| 1145 | nmdc:mga0k408_10213_c1 | 3300050493 | Bacteria | 5076 |
| 1146 | nmdc:mga0k408_146316_c1 | 3300050493 | Bacteria | 1407 |
| 1147 | nmdc:mga0k408_198567_c1 | 3300050493 | Bacteria | 1197 |
| 1148 | nmdc:mga06z11_152149_c1 | 3300050494 | Bacteria | 1316 |
| 1149 | nmdc:mga06z11_25604_c1 | 3300050494 | Bacteria | 2799 |
| 1150 | nmdc:mga06z11_36801_c1 | 3300050494 | Bacteria | 2419 |
| 1151 | nmdc:mga06z11_40099_c1 | 3300050494 | Bacteria | 2335 |
| 1152 | nmdc:mga06z11_93465_c1 | 3300050494 | Bacteria | 1637 |
| 1153 | nmdc:mga04h51_8477_c1 | 3300050495 | Bacteria | 2751 |
| 1154 | nmdc:mga07m45_137705_c1 | 3300050496 | Bacteria | 1413 |
| 1155 | nmdc:mga07m45_16268_c1 | 3300050496 | Bacteria | 3981 |
| 1156 | nmdc:mga07m45_218_c2 | 3300050496 | Bacteria | 22025 |
| 1157 | nmdc:mga07m45_26680_c1 | 3300050496 | Bacteria | 3176 |
| 1158 | nmdc:mga07m45_4694_c2 | 3300050496 | Bacteria | 5936 |
| 1159 | nmdc:mga07m45_96347_c1 | 3300050496 | Bacteria | 1698 |
| 1160 | nmdc:mga06r32_285399_c1 | 3300050510 | Bacteria | 1637 |
| 1161 | nmdc:mga0n895_581158_c1 | 3300050512 | Bacteria | 1124 |
| 1162 | nmdc:mga0sz30_16997_c1 | 3300050516 | Bacteria | 2897 |
| 1163 | nmdc:mga0sz30_7855_c1 | 3300050516 | Bacteria | 4013 |
| 1164 | Ga0495612_0012967 | 3300053078 | Bacteria | 3358 |
| 1165 | Ga0500635_0005652 | 3300053080 | Bacteria | 3296 |
| 1166 | Ga0495655_0035400 | 3300053083 | Bacteria | 1242 |
| 1167 | Ga0495655_0039638 | 3300053083 | Bacteria | 1195 |
| 1168 | Ga0495595_0000828 | 3300053084 | Bacteria | 11843 |
| 1169 | Ga0495619_0000912 | 3300053085 | Bacteria | 19381 |
| 1170 | Ga0495619_0024324 | 3300053085 | Bacteria | 3884 |
| 1171 | Ga0495619_0246216 | 3300053085 | Bacteria | 1239 |
| 1172 | Ga0495619_0404713 | 3300053085 | Bacteria | 942 |
| 1173 | Ga0500578_0106338 | 3300053086 | Bacteria | 1772 |
| 1174 | Ga0500578_0163429 | 3300053086 | Bacteria | 1380 |
| 1175 | Ga0500578_0226712 | 3300053086 | Bacteria | 1134 |
| 1176 | Ga0500578_0235766 | 3300053086 | Bacteria | 1107 |
| 1177 | Ga0500643_000048 | 3300053087 | Bacteria | 147879 |
| 1178 | Ga0500643_011015 | 3300053087 | Bacteria | 3328 |
| 1179 | Ga0500581_151129 | 3300053089 | Bacteria | 1089 |
| 1180 | Ga0500647_0018699 | 3300053091 | Bacteria | 3212 |
| 1181 | Ga0500651_0037353 | 3300053093 | Bacteria | 3060 |
| 1182 | Ga0500651_0085355 | 3300053093 | Bacteria | 1951 |
| 1183 | Ga0500651_0120744 | 3300053093 | Bacteria | 1591 |
| 1184 | Ga0500566_0000223 | 3300053094 | Bacteria | 30380 |
| 1185 | Ga0500566_0004965 | 3300053094 | Bacteria | 7920 |
| 1186 | Ga0500566_0029885 | 3300053094 | Bacteria | 3181 |
| 1187 | Ga0500566_0153432 | 3300053094 | Bacteria | 1208 |
| 1188 | Ga0500641_0008158 | 3300053096 | Bacteria | 3733 |
| 1189 | Ga0500641_0012056 | 3300053096 | Bacteria | 3150 |
| 1190 | Ga0500641_0023712 | 3300053096 | Bacteria | 2362 |
| 1191 | Ga0500641_0043402 | 3300053096 | Bacteria | 1825 |
| 1192 | Ga0500650_0003714 | 3300053098 | Bacteria | 5373 |
| 1193 | Ga0500554_007050 | 3300053102 | Bacteria | 2563 |
| 1194 | Ga0500554_007778 | 3300053102 | Bacteria | 2483 |
| 1195 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 1196 | Ga0500557_000083 | 3300053105 | Bacteria | 32931 |
| 1197 | Ga0500569_014315 | 3300053109 | Bacteria | 1961 |
| 1198 | Ga0500569_055868 | 3300053109 | Bacteria | 1205 |
| 1199 | Ga0500572_001233 | 3300053111 | Bacteria | 7208 |
| 1200 | Ga0500572_004969 | 3300053111 | Bacteria | 3009 |
| 1201 | Ga0500591_048865 | 3300053115 | Bacteria | 1988 |
| 1202 | Ga0500592_001083 | 3300053116 | Bacteria | 4437 |
| 1203 | Ga0500592_028662 | 3300053116 | Bacteria | 898 |
| 1204 | Ga0500594_0054034 | 3300053118 | Bacteria | 1140 |
| 1205 | Ga0500595_000333 | 3300053119 | Bacteria | 30925 |
| 1206 | Ga0500595_005544 | 3300053119 | Bacteria | 5498 |
| 1207 | Ga0500595_008879 | 3300053119 | Bacteria | 4084 |
| 1208 | Ga0500595_012628 | 3300053119 | Bacteria | 3259 |
| 1209 | Ga0500595_019981 | 3300053119 | Bacteria | 2419 |
| 1210 | Ga0500595_029765 | 3300053119 | Bacteria | 1849 |
| 1211 | Ga0500607_181636 | 3300053121 | Bacteria | 931 |
| 1212 | Ga0500608_043820 | 3300053122 | Bacteria | 2148 |
| 1213 | Ga0500608_110735 | 3300053122 | Bacteria | 1259 |
| 1214 | Ga0500618_004999 | 3300053125 | Bacteria | 4101 |
| 1215 | Ga0500618_036580 | 3300053125 | Bacteria | 1137 |
| 1216 | Ga0500628_061835 | 3300053129 | Bacteria | 917 |
| 1217 | Ga0500642_0000015 | 3300053130 | Bacteria | 181424 |
| 1218 | Ga0500642_0000642 | 3300053130 | Bacteria | 10422 |
| 1219 | Ga0500652_000665 | 3300053131 | Bacteria | 11648 |
| 1220 | Ga0500559_0000230 | 3300053136 | Bacteria | 44504 |
| 1221 | Ga0500559_0001714 | 3300053136 | Bacteria | 12043 |
| 1222 | Ga0500559_0008650 | 3300053136 | Bacteria | 4450 |
| 1223 | Ga0500559_0019501 | 3300053136 | Bacteria | 2865 |
| 1224 | Ga0500559_0132321 | 3300053136 | Bacteria | 1165 |
| 1225 | Ga0500568_0000536 | 3300053139 | Bacteria | 27978 |
| 1226 | Ga0500568_0022102 | 3300053139 | Bacteria | 2728 |
| 1227 | Ga0500573_0048795 | 3300053140 | Bacteria | 2436 |
| 1228 | Ga0500577_0003157 | 3300053142 | Bacteria | 4266 |
| 1229 | Ga0500577_0179364 | 3300053142 | Bacteria | 908 |
| 1230 | Ga0500586_000256 | 3300053145 | Bacteria | 10561 |
| 1231 | Ga0500588_0077051 | 3300053146 | Bacteria | 1107 |
| 1232 | Ga0500588_0080561 | 3300053146 | Bacteria | 1088 |
| 1233 | Ga0500589_089297 | 3300053147 | Bacteria | 1360 |
| 1234 | Ga0500590_127074 | 3300053148 | Bacteria | 1185 |
| 1235 | Ga0500590_155056 | 3300053148 | Bacteria | 1028 |
| 1236 | Ga0500603_000178 | 3300053150 | Bacteria | 16265 |
| 1237 | Ga0500603_003757 | 3300053150 | Bacteria | 3249 |
| 1238 | Ga0500603_007176 | 3300053150 | Bacteria | 2442 |
| 1239 | Ga0500603_066455 | 3300053150 | Bacteria | 1019 |
| 1240 | Ga0500604_0002214 | 3300053151 | Bacteria | 5335 |
| 1241 | Ga0500616_0000033 | 3300053153 | Bacteria | 398830 |
| 1242 | Ga0500616_0064918 | 3300053153 | Bacteria | 1878 |
| 1243 | Ga0500619_039253 | 3300053154 | Bacteria | 1487 |
| 1244 | Ga0500620_025245 | 3300053155 | Bacteria | 1826 |
| 1245 | Ga0500622_0005267 | 3300053156 | Bacteria | 7803 |
| 1246 | Ga0500622_0132006 | 3300053156 | Bacteria | 1199 |
| 1247 | Ga0500630_011681 | 3300053159 | Bacteria | 4326 |
| 1248 | Ga0500633_0036030 | 3300053160 | Bacteria | 1633 |
| 1249 | Ga0500638_007384 | 3300053162 | Bacteria | 4593 |
| 1250 | Ga0500639_012544 | 3300053163 | Bacteria | 4450 |
| 1251 | Ga0500639_047881 | 3300053163 | Bacteria | 2232 |
| 1252 | Ga0500639_121973 | 3300053163 | Bacteria | 1250 |
| 1253 | Ga0500636_0000148 | 3300053177 | Bacteria | 36338 |
| 1254 | Ga0500636_0000686 | 3300053177 | Bacteria | 18167 |
| 1255 | Ga0500636_0015443 | 3300053177 | Bacteria | 4500 |
| 1256 | Ga0500636_0032865 | 3300053177 | Bacteria | 3071 |
| 1257 | Ga0500636_0045245 | 3300053177 | Bacteria | 2596 |
| 1258 | Ga0500637_0000060 | 3300053178 | Bacteria | 38881 |
| 1259 | Ga0500637_0003041 | 3300053178 | Bacteria | 7626 |
| 1260 | Ga0500637_0059295 | 3300053178 | Bacteria | 2190 |
| 1261 | Ga0500611_061900 | 3300053727 | Bacteria | 889 |
| 1262 | Ga0500625_007842 | 3300053729 | Bacteria | 4666 |
| 1263 | Ga0500645_020418 | 3300053730 | Bacteria | 2054 |
| 1264 | Ga0500645_028285 | 3300053730 | Bacteria | 1697 |
| 1265 | Ga0500645_079363 | 3300053730 | Bacteria | 937 |
| 1266 | Ga0500609_002230 | 3300053731 | Bacteria | 2766 |
| 1267 | Ga0500596_004552 | 3300053735 | Bacteria | 2529 |
| 1268 | Ga0500599_002662 | 3300053736 | Bacteria | 2155 |
| 1269 | Ga0500601_000452 | 3300053737 | Bacteria | 6662 |
| 1270 | Ga0500601_005123 | 3300053737 | Bacteria | 1432 |
| 1271 | Ga0501084_0445364 | 3300054114 | Bacteria | 1095 |
| 1272 | Ga0500661_025944 | 3300055283 | Bacteria | 1036 |
| 1273 | Ga0501082_0002719 | 3300060353 | Bacteria | 15447 |
| 1274 | Ga0501082_0197709 | 3300060353 | Bacteria | 1749 |
| 1275 | Ga0466962_0000093 | 3300061719 | Bacteria | 35862 |
| 1276 | Ga0466962_0112696 | 3300061719 | Bacteria | 1310 |
| 1277 | Ga0466962_0173982 | 3300061719 | Bacteria | 1049 |
| 1278 | Ga0530510_0051769 | 3300061734 | Bacteria | 2967 |
| 1279 | 2507505894 | 2507262055 | Bacteria | 8048963 |
| 1280 | 2508540085 | 2508501009 | Bacteria | 7784016 |
| 1281 | 2508696155 | 2508501042 | Bacteria | 8719808 |
| 1282 | 2509151554 | 2508501128 | Bacteria | 8613869 |
| 1283 | 2511396621 | 2511231028 | Bacteria | 8046582 |
| 1284 | 2513627468 | 2513237092 | Bacteria | 8341956 |
| 1285 | 2513638782 | 2513237094 | Bacteria | 8789602 |
| 1286 | 2513649868 | 2513237095 | Bacteria | 8976980 |
| 1287 | 2513659782 | 2513237096 | Bacteria | 8722461 |
| 1288 | 2513676893 | 2513237098 | Bacteria | 9902361 |
| 1289 | 2513694706 | 2513237101 | Bacteria | 7952346 |
| 1290 | 2513704353 | 2513237102 | Bacteria | 7703324 |
| 1291 | 2513715416 | 2513237104 | Bacteria | 10034502 |
| 1292 | 2513857243 | 2513237137 | Bacteria | 9558895 |
| 1293 | 2513877270 | 2513237139 | Bacteria | 8737671 |
| 1294 | 2513891635 | 2513237141 | Bacteria | 8496279 |
| 1295 | 2513918858 | 2513237145 | Bacteria | 8979722 |
| 1296 | 2514011243 | 2513237161 | Bacteria | 8871253 |
| 1297 | 2515631369 | 2515154112 | Bacteria | 8294334 |
| 1298 | 2517105693 | 2517093001 | Bacteria | 9002274 |
| 1299 | 2517888184 | 2517572143 | Bacteria | 9484767 |
| 1300 | 2524435437 | 2524023205 | Bacteria | 8918781 |
| 1301 | 2524468612 | 2524023210 | Bacteria | 9029266 |
| 1302 | 2524533359 | 2524023228 | Bacteria | 10118060 |
| 1303 | 2528855124 | 2528768022 | Bacteria | 10457665 |
| 1304 | 2603860084 | 2602042107 | Bacteria | 6226103 |
| 1305 | 2617347778 | 2617270735 | Bacteria | 9163226 |
| 1306 | 2617374506 | 2617270741 | Bacteria | 8201522 |
| 1307 | 2644290511 | 2643221651 | Bacteria | 4798932 |
| 1308 | 2671119357 | 2667528175 | Bacteria | 7532676 |
| 1309 | 2723842257 | 2721755755 | Bacteria | 8322773 |
| 1310 | 2728753841 | 2728368998 | Bacteria | 8720350 |
| 1311 | 2734973075 | 2734482000 | Bacteria | 5525167 |
| 1312 | 2745081399 | 2744054633 | Bacteria | 8678936 |
| 1313 | 2793061566 | 2791355196 | Bacteria | 7323613 |
| 1314 | 2793073862 | 2791355197 | Bacteria | 8420563 |
| 1315 | 2793077973 | |||
| 1316 | 2805916130 | 2802429603 | Bacteria | 8777136 |
| 1317 | 2816503849 | 2816332139 | Bacteria | 9138787 |
| 1318 | 2818240868 | 2816332527 | Bacteria | 8933356 |
| 1319 | 2824605527 | 2824600985 | Bacteria | 8488197 |
| 1320 | 2824610825 | 2824609381 | Bacteria | 8672835 |
| 1321 | 2824619360 | 2824617872 | Bacteria | 8814715 |
| 1322 | 2824627815 | 2824626560 | Bacteria | 8813858 |
| 1323 | 2824641893 | 2824635225 | Bacteria | 8785348 |
| 1324 | 2824651583 | 2824644064 | Bacteria | 8743947 |
| 1325 | 2824653877 | 2824653114 | Bacteria | 8493680 |
| 1326 | 2824663770 | 2824661429 | Bacteria | 9877870 |
| 1327 | 2824676110 | 2824671348 | Bacteria | 8369588 |
| 1328 | 2824680225 | 2824679649 | Bacteria | 8248951 |
| 1329 | 2824692463 | 2824687955 | Bacteria | 8360029 |
| 1330 | 2824699886 | 2824696289 | Bacteria | 8335049 |
| 1331 | 2824706068 | 2824704595 | Bacteria | 9667483 |
| 1332 | 2824720085 | 2824714736 | Bacteria | 8717648 |
| 1333 | 2824729447 | 2824723954 | Bacteria | 8758240 |
| 1334 | 2824736156 | 2824732956 | Bacteria | 7810675 |
| 1335 | 2824748032 | 2824746037 | Bacteria | 7911610 |
| 1336 | 2824760299 | 2824753945 | Bacteria | 9787441 |
| 1337 | 2824771538 | 2824763712 | Bacteria | 9792355 |
| 1338 | 2824775742 | 2824773399 | Bacteria | 8360218 |
| 1339 | 2838125115 | 2838122688 | Bacteria | 8803140 |
| 1340 | 2841945853 | 2841941048 | Bacteria | 8688029 |
| 1341 | 2841956820 | 2841949485 | Bacteria | 8680857 |
| 1342 | 2841965304 | 2841957949 | Bacteria | 8652217 |
| 1343 | 2841973336 | 2841966195 | Bacteria | 8673214 |
| 1344 | 2841979500 | 2841974524 | Bacteria | 8931498 |
| 1345 | 2841989375 | 2841983080 | Bacteria | 8395090 |
| 1346 | 2842044366 | 2842038055 | Bacteria | 8002051 |
| 1347 | 2842051645 | 2842045827 | Bacteria | 8006841 |
| 1348 | 2844321486 | 2844315083 | Bacteria | 8138177 |
| 1349 | 2847939470 | 2847930680 | Bacteria | 9342022 |
| 1350 | 2847941219 | 2847939898 | Bacteria | 8606328 |
| 1351 | 2849082211 | 2849076700 | Bacteria | 7039503 |
| 1352 | 2857513314 | 2857509624 | Bacteria | 7472071 |
| 1353 | 2874596368 | 2874590934 | Bacteria | 8299676 |
| 1354 | 2874610154 | 2874604998 | Bacteria | 7834745 |
| 1355 | 2874620219 | 2874612657 | Bacteria | 8252029 |
| 1356 | 2874633340 | 2874628541 | Bacteria | 8630250 |
| 1357 | 2874650356 | 2874645413 | Bacteria | 8214782 |
| 1358 | 2876761693 | 2876761206 | Bacteria | 10111113 |
| 1359 | 2876776833 | 2876771140 | Bacteria | 8287509 |
| 1360 | 2876815708 | 2876808645 | Bacteria | 8824342 |
| 1361 | 2876824623 | 2876818435 | Bacteria | 8274608 |
| 1362 | 2879080970 | 2879074833 | Bacteria | 8279565 |
| 1363 | 2879091088 | 2879083081 | Bacteria | 8587928 |
| 1364 | 2879106652 | 2879099564 | Bacteria | 10442239 |
| 1365 | 2879117030 | 2879110137 | Bacteria | 8907982 |
| 1366 | 2879128201 | 2879127579 | Bacteria | 8294491 |
| 1367 | 2879143556 | 2879142872 | Bacteria | 8267021 |
| 1368 | 2881369630 | 2881364244 | Bacteria | 7710352 |
| 1369 | 2881670153 | 2881665667 | Bacteria | 8175609 |
| 1370 | 2885367720 | 2885366525 | Bacteria | 8326213 |
| 1371 | 2885392255 | 2885383462 | Bacteria | 9473874 |
| 1372 | 2885418261 | 2885409591 | Bacteria | 9235467 |
| 1373 | 2888387741 | 2888378607 | Bacteria | 9652610 |
| 1374 | 2888389960 | 2888388044 | Bacteria | 7304136 |
| 1375 | 2888421140 | 2888419890 | Bacteria | 7857137 |
| 1376 | 2889036373 | 2889033259 | Bacteria | 9099371 |
| 1377 | 2893069654 | 2893066018 | Bacteria | 6158120 |
| 1378 | 2903727935 | 2903727486 | Bacteria | 8281579 |
| 1379 | 2903754035 | 2903748898 | Bacteria | 9972761 |
| 1380 | 2903776665 | 2903768456 | Bacteria | 9749579 |
| 1381 | 2904695757 | 2904690495 | Bacteria | 9412302 |
| 1382 | 2904710018 | |||
| 1383 | 2904718095 | 2904711408 | Bacteria | 9771557 |
| 1384 | 2906602581 | 2906602504 | Bacteria | 8295279 |
| 1385 | 2906614459 | |||
| 1386 | 2906629721 | 2906626472 | Bacteria | 8826946 |
| 1387 | 2906643418 | 2906635258 | Bacteria | 8601019 |
| 1388 | 2906651663 | 2906643746 | Bacteria | 8722424 |
| 1389 | 2906666610 | 2906660503 | Bacteria | 8595048 |
| 1390 | 2908746711 | 2908739725 | Bacteria | 8628932 |
| 1391 | 2908764273 | 2908756301 | Bacteria | 8864324 |
| 1392 | 2908776985 | 2908775508 | Bacteria | 8092255 |
| 1393 | 2919078955 | 2919073203 | Bacteria | 6531949 |
| 1394 | 2922366744 | 2922361189 | Bacteria | 7436256 |
| 1395 | 2922377446 | |||
| 1396 | 2922389353 | 2922386360 | Bacteria | 7017218 |
| 1397 | 2922393379 | 2922393267 | Bacteria | 8285685 |
| 1398 | 2922426293 | |||
| 1399 | 2929622238 | 2929615660 | Bacteria | 9193770 |
| 1400 | 2929630115 | 2929624759 | Bacteria | 9339455 |
| 1401 | 2932787952 | 2932784394 | Bacteria | 9704911 |
| 1402 | 2932799514 | 2932794094 | Bacteria | 7915132 |
| 1403 | 2932805180 | 2932801729 | Bacteria | 7987968 |
| 1404 | 2932813327 | 2932809354 | Bacteria | 9135765 |
| 1405 | 2932820024 | 2932818245 | Bacteria | 9955613 |
| 1406 | 2932832912 | 2932828146 | Bacteria | 9745859 |
| 1407 | 2933584148 | 2933577622 | Bacteria | 9116884 |
| 1408 | 2935614318 | 2935608549 | Bacteria | 8203142 |
| 1409 | 2935620397 | 2935616580 | Bacteria | 9032984 |
| 1410 | 2935632678 | 2935630451 | Bacteria | 8169952 |
| 1411 | 2935640721 | 2935638405 | Bacteria | 10015038 |
| 1412 | 2935649346 | 2935648319 | Bacteria | 8801166 |
| 1413 | 2935657882 | 2935656913 | Bacteria | 8965014 |
| 1414 | 2935668913 | 2935665750 | Bacteria | 9571747 |
| 1415 | 2935681361 | 2935675223 | Bacteria | 9928132 |
| 1416 | 2935687222 | 2935684952 | Bacteria | 9590419 |
| 1417 | 2935696807 | 2935694250 | Bacteria | 9291695 |
| 1418 | 2935709101 | 2935703347 | Bacteria | 10242284 |
| 1419 | 2935716910 | 2935713505 | Bacteria | 9608509 |
| 1420 | 2935722965 | 2935722832 | Bacteria | 9608746 |
| 1421 | 2935734522 | 2935732158 | Bacteria | 9706831 |
| 1422 | 2935744687 | 2935741537 | Bacteria | 9707219 |
| 1423 | 2935753188 | 2935750917 | Bacteria | 9590372 |
| 1424 | 2935767592 | 2935760218 | Bacteria | 9817913 |
| 1425 | 2935770186 | 2935769743 | Bacteria | 7878163 |
| 1426 | 2935777784 | 2935777560 | Bacteria | 8077691 |
| 1427 | 2935786760 | 2935785616 | Bacteria | 7962367 |
| 1428 | 2935794814 | 2935793552 | Bacteria | 8012592 |
| 1429 | 2935804831 | 2935801545 | Bacteria | 9301974 |
| 1430 | 2935815980 | 2935810662 | Bacteria | 9401221 |
| 1431 | 2935826536 | 2935819856 | Bacteria | 8261050 |
| 1432 | 2935832228 | 2935827899 | Bacteria | 10038562 |
| 1433 | 2935840942 | 2935837841 | Bacteria | 9454360 |
| 1434 | 2935851170 | 2935847175 | Bacteria | 8228321 |
| 1435 | 2935859283 | 2935855204 | Bacteria | 9035059 |
| 1436 | 2935864467 | 2935864058 | Bacteria | 9784707 |
| 1437 | 2935875181 | 2935873716 | Bacteria | 9632195 |
| 1438 | 2935887730 | 2935883170 | Bacteria | 7964738 |
| 1439 | 2935913219 | 2935908558 | Bacteria | 8568796 |
| 1440 | 2935922641 | 2935916978 | Bacteria | 9113783 |
| 1441 | 2935930856 | 2935926038 | Bacteria | 8601059 |
| 1442 | 2935939810 | 2935934488 | Bacteria | 8602579 |
| 1443 | 2935946759 | 2935942939 | Bacteria | 8599779 |
| 1444 | 2935956040 | 2935951376 | Bacteria | 8602333 |
| 1445 | 2935963880 | 2935959822 | Bacteria | 7869783 |
| 1446 | 2935972833 | 2935967501 | Bacteria | 8603075 |
| 1447 | 2935978250 | 2935975950 | Bacteria | 8347125 |
| 1448 | 2935985622 | 2935984226 | Bacteria | 8302647 |
| 1449 | 2935995844 | 2935992306 | Bacteria | 9802711 |
| 1450 | 2936005755 | 2936002035 | Bacteria | 9362176 |
| 1451 | 2936012101 | 2936011229 | Bacteria | 8801034 |
| 1452 | 2936020818 | 2936019824 | Bacteria | 8804134 |
| 1453 | 2936029394 | 2936028420 | Bacteria | 8965941 |
| 1454 | 2936041883 | 2936037263 | Bacteria | 9446081 |
| 1455 | 2936048282 | 2936046547 | Bacteria | 8903709 |
| 1456 | 2936056607 | 2936055302 | Bacteria | 8785755 |
| 1457 | 2940559101 | 2940556831 | Bacteria | 9590747 |
| 1458 | 2941508658 | 2941507105 | Bacteria | 8166816 |
| 1459 | 2941516488 | 2941515067 | Bacteria | 8166720 |
| 1460 | 2941524496 | 2941523033 | Bacteria | 8169134 |
| 1461 | 2941532066 | 2941531003 | Bacteria | 7653939 |
| 1462 | 2941541796 | 2941538514 | Bacteria | 9402094 |
| 1463 | 3003669727 | 3003665799 | Bacteria | 7279786 |
| 1464 | 3005475657 | 3005474847 | Bacteria | 9259049 |
| 1465 | 3005485842 | 3005483717 | Bacteria | 7877331 |
| 1466 | 3005510883 | 3005506211 | Bacteria | 6943378 |
| 1467 | 3005588832 | 3005587118 | Bacteria | 7794411 |
| 1468 | 3005601852 | 3005594810 | Bacteria | 8716512 |
| 1469 | 3005717591 | 3005710791 | Bacteria | 7622528 |
| 1470 | 3005724639 | 3005718088 | Bacteria | 8283608 |
| 1471 | 3006430886 | 3006425503 | Bacteria | 6491253 |
| 1472 | 8002779950 | 8002775197 | Bacteria | 10728764 |
| 1473 | 8002784702 | 8002784119 | Bacteria | 9788632 |
| 1474 | 8006932294 | 8006926726 | Bacteria | 6749210 |
| 1475 | 8006936997 | 8006933436 | Bacteria | 10410654 |
| 1476 | 8006966342 | 8006964411 | Bacteria | 8966052 |
| 1477 | 8006976962 | 8006973647 | Bacteria | 10679141 |
| 1478 | 8006993168 | 8006984368 | Bacteria | 9651211 |
| 1479 | 8006997007 | 8006994254 | Bacteria | 8309700 |
| 1480 | 8016526943 | 8016522445 | Bacteria | 8156687 |
| 1481 | 8016532028 | 8016530956 | Bacteria | 8155261 |
| 1482 | 8016545237 | 8016539877 | Bacteria | 8155419 |
| 1483 | 8016556851 | 8016548790 | Bacteria | 8155074 |
| 1484 | 8016565204 | 8016557553 | Bacteria | 8154380 |
| 1485 | 8016582863 | 8016575299 | Bacteria | 8154085 |
| 1486 | 8016585431 | 8016583857 | Bacteria | 10421953 |
| 1487 | 8016602847 | 8016595262 | Bacteria | 8149947 |
| 1488 | 8016605717 | 8016603502 | Bacteria | 8731218 |
| 1489 | 8016617624 | 8016613128 | Bacteria | 8794220 |
| 1490 | 8016623945 | 8016622563 | Bacteria | 7999408 |
| 1491 | 8016634920 | 8016630954 | Bacteria | 9217207 |
| 1492 | 8017059306 | 8017057580 | Bacteria | 10023680 |
| 1493 | 8019539685 | 8019538911 | Bacteria | 7872763 |
| 1494 | 8019550963 | 8019547302 | Bacteria | 7996444 |
| 1495 | 8019571754 | 8019565922 | Bacteria | 9639779 |
| 1496 | 8019576323 | 8019576017 | Bacteria | 10049540 |
| 1497 | 8019594195 | 8019586578 | Bacteria | 10212056 |
| 1498 | 8019607367 | 8019597564 | Bacteria | 10041141 |
| 1499 | 8019621995 | 8019619141 | Bacteria | 9218857 |
| 1500 | 8019631326 | 8019629233 | Bacteria | 8687553 |
| 1501 | 8019651713 | 8019648815 | Bacteria | 10014479 |
| 1502 | 8019668131 | 8019659431 | Bacteria | 8577854 |
| 1503 | 8019677597 | 8019668869 | Bacteria | 8791617 |
| 1504 | 8019687351 | 8019678201 | Bacteria | 8863603 |
| 1505 | 8019693328 | 8019687851 | Bacteria | 8712826 |
| 1506 | 8054478238 | 8054472261 | Bacteria | 7464355 |
| 1507 | 8055743513 | 8055742211 | Bacteria | 9226248 |
| 1508 | 8056678193 | 8056673599 | Bacteria | 7871253 |
| 1509 | 8056683415 | 8056681323 | Bacteria | 8472857 |
| 1510 | 8056692720 | 8056689827 | Bacteria | 6712655 |
| 1511 | 8056975362 | 8056967851 | Bacteria | 9038162 |
| 1512 | Ga0501044_0025287 | |||
| 1513 | JGI24745J21846_1004091 | |||
| 1514 | JGI25406J46586_10000233 | |||
| 1515 | JGI25406J46586_10008961 | |||
| 1516 | JGI25153J46596_10003608 | |||
| 1517 | JGI25153J46596_10009022 | |||
| 1518 | JGI25404J52841_10011727 | |||
| 1519 | JGI25404J52841_10017283 | |||
| 1520 | JGI25404J52841_10018580 | |||
| 1521 | JGI25404J52841_10036834 | |||
| 1522 | Ga0055526_1047315 | |||
| 1523 | Ga0055531_10013194 | |||
| 1524 | Ga0065165_1000917 | |||
| 1525 | Ga0065165_1001167 | |||
| 1526 | Ga0065165_1009512 | |||
| 1527 | Ga0070658_10071314 | |||
| 1528 | Ga0070683_100254628 | |||
| 1529 | Ga0070690_100164312 | |||
| 1530 | Ga0068869_100117529 | |||
| 1531 | Ga0068869_100130742 | |||
| 1532 | Ga0068869_100138140 | |||
| 1533 | Ga0070680_100102455 | |||
| 1534 | Ga0070682_100067954 | |||
| 1535 | Ga0070682_100242437 | |||
| 1536 | Ga0068868_100009208 | |||
| 1537 | Ga0068868_100133580 | |||
| 1538 | Ga0068868_100140904 | |||
| 1539 | Ga0070660_100015341 | |||
| 1540 | Ga0070660_100299709 | |||
| 1541 | Ga0070660_100309943 | |||
| 1542 | Ga0070689_100134832 | |||
| 1543 | Ga0070687_100221156 | |||
| 1544 | Ga0070687_100304947 | |||
| 1545 | Ga0070661_100047378 | |||
| 1546 | Ga0070661_100058873 | |||
| 1547 | Ga0070661_100138016 | |||
| 1548 | Ga0070661_100342318 | |||
| 1549 | Ga0070668_100009536 | |||
| 1550 | Ga0070668_100013042 | |||
| 1551 | Ga0070668_100066141 | |||
| 1552 | Ga0070668_100230649 | |||
| 1553 | Ga0070668_100292199 | |||
| 1554 | Ga0070669_100163838 | |||
| 1555 | Ga0070669_100224392 | |||
| 1556 | Ga0070675_100193255 | |||
| 1557 | Ga0070671_100000724 | |||
| 1558 | Ga0070671_100107752 | |||
| 1559 | Ga0070671_100138626 | |||
| 1560 | Ga0070671_100677286 | |||
| 1561 | Ga0070674_100052855 | |||
| 1562 | Ga0070674_100261447 | |||
| 1563 | Ga0070674_100296307 | |||
| 1564 | Ga0070673_100224362 | |||
| 1565 | Ga0070688_100044579 | |||
| 1566 | Ga0070659_100148271 | |||
| 1567 | Ga0070667_100004331 | |||
| 1568 | Ga0070667_100213017 | |||
| 1569 | Ga0070667_100269039 | |||
| 1570 | Ga0070709_10001520 | |||
| 1571 | Ga0070709_10008885 | |||
| 1572 | Ga0070709_10173983 | |||
| 1573 | Ga0070714_100005907 | |||
| 1574 | Ga0070713_100021890 | |||
| 1575 | Ga0070713_100040858 | |||
| 1576 | Ga0070713_100086571 | |||
| 1577 | Ga0070713_100108114 | |||
| 1578 | Ga0070713_100133311 | |||
| 1579 | Ga0070713_100156609 | |||
| 1580 | Ga0070710_10000733 | |||
| 1581 | Ga0070710_10014290 | |||
| 1582 | Ga0070711_100005326 | |||
| 1583 | Ga0070711_100040962 | |||
| 1584 | Ga0070700_100456363 | |||
| 1585 | Ga0070663_100039057 | |||
| 1586 | Ga0070663_100058403 | |||
| 1587 | Ga0070663_100061649 | |||
| 1588 | Ga0070663_100113203 | |||
| 1589 | Ga0070663_100135351 | |||
| 1590 | Ga0070678_100024391 | |||
| 1591 | Ga0070678_100115610 | |||
| 1592 | Ga0070678_100356183 | |||
| 1593 | Ga0070662_100048334 | |||
| 1594 | Ga0070662_100193379 | |||
| 1595 | Ga0070681_10131987 | |||
| 1596 | Ga0070681_10258667 | |||
| 1597 | Ga0070681_10272242 | |||
| 1598 | Ga0068867_100209521 | |||
| 1599 | Ga0068867_100287432 | |||
| 1600 | Ga0068867_100501042 | |||
| 1601 | Ga0070685_10222031 | |||
| 1602 | Ga0070706_100000883 | |||
| 1603 | Ga0070706_100338949 | |||
| 1604 | Ga0070707_100048206 | |||
| 1605 | Ga0070707_100216052 | |||
| 1606 | Ga0070699_100224891 | |||
| 1607 | Ga0070679_100080757 | |||
| 1608 | Ga0070679_100086434 | |||
| 1609 | Ga0070679_100289996 | |||
| 1610 | Ga0070684_100089394 | |||
| 1611 | Ga0070684_100495287 | |||
| 1612 | Ga0070684_100612305 | |||
| 1613 | Ga0070697_100096466 | |||
| 1614 | Ga0068853_100037982 | |||
| 1615 | Ga0068853_100208559 | |||
| 1616 | Ga0068853_100316150 | |||
| 1617 | Ga0068853_100477708 | |||
| 1618 | Ga0068853_100521167 | |||
| 1619 | Ga0068853_100560881 | |||
| 1620 | Ga0068853_100604343 | |||
| 1621 | Ga0070672_100177991 | |||
| 1622 | Ga0070672_100216984 | |||
| 1623 | Ga0070686_100068407 | |||
| 1624 | Ga0070695_100096384 | |||
| 1625 | Ga0070665_100004629 | |||
| 1626 | Ga0070665_100071360 | |||
| 1627 | Ga0070665_100105979 | |||
| 1628 | Ga0070665_100144937 | |||
| 1629 | Ga0070665_100237677 | |||
| 1630 | Ga0068855_100031922 | |||
| 1631 | Ga0068855_100069511 | |||
| 1632 | Ga0068855_100096541 | |||
| 1633 | Ga0068855_100245511 | |||
| 1634 | Ga0070664_100011717 | |||
| 1635 | Ga0070664_100108843 | |||
| 1636 | Ga0070664_100285667 | |||
| 1637 | Ga0070664_100483156 | |||
| 1638 | Ga0068857_100026204 | |||
| 1639 | Ga0068856_100000137 | |||
| 1640 | Ga0070702_100118817 | |||
| 1641 | Ga0068852_100026206 | |||
| 1642 | Ga0068852_100067797 | |||
| 1643 | Ga0068852_100144994 | |||
| 1644 | Ga0068859_100001570 | |||
| 1645 | Ga0068859_100780237 | |||
| 1646 | Ga0068859_100870272 | |||
| 1647 | Ga0068864_100106901 | |||
| 1648 | Ga0068864_100294206 | |||
| 1649 | Ga0068864_100406660 | |||
| 1650 | Ga0068866_10035306 | |||
| 1651 | Ga0068861_100029805 | |||
| 1652 | Ga0068861_100189556 | |||
| 1653 | Ga0068861_100675561 | |||
| 1654 | Ga0068851_10011436 | |||
| 1655 | Ga0068863_100001523 | |||
| 1656 | Ga0068858_100011790 | |||
| 1657 | Ga0068858_100057344 | |||
| 1658 | Ga0068858_100252659 | |||
| 1659 | Ga0068858_100381416 | |||
| 1660 | Ga0068858_100458870 | |||
| 1661 | Ga0068860_100068880 | |||
| 1662 | Ga0068860_100191436 | |||
| 1663 | Ga0068860_100316896 | |||
| 1664 | Ga0068860_100451721 | |||
| 1665 | Ga0068860_100553496 | |||
| 1666 | Ga0068862_100064935 | |||
| 1667 | Ga0068862_100417409 | |||
| 1668 | Ga0068862_100489571 | |||
| 1669 | Ga0068862_100617334 | |||
| 1670 | Ga0081455_10011235 | |||
| 1671 | Ga0081455_10056109 | |||
| 1672 | Ga0081455_10080519 | |||
| 1673 | Ga0081455_10281684 | |||
| 1674 | Ga0081455_10307771 | |||
| 1675 | Ga0081540_1005656 | |||
| 1676 | Ga0081540_1005657 | |||
| 1677 | Ga0081540_1010321 | |||
| 1678 | Ga0081540_1016160 | |||
| 1679 | Ga0081540_1021999 | |||
| 1680 | Ga0081540_1026512 | |||
| 1681 | Ga0081540_1046497 | |||
| 1682 | Ga0081540_1077757 | |||
| 1683 | Ga0081539_10000157 | |||
| 1684 | Ga0081539_10002599 | |||
| 1685 | Ga0081539_10037110 | |||
| 1686 | Ga0070717_10001671 | |||
| 1687 | Ga0070717_10011582 | |||
| 1688 | Ga0070717_10111271 | |||
| 1689 | Ga0070717_10149083 | |||
| 1690 | Ga0070717_10273426 | |||
| 1691 | Ga0070717_10363074 | |||
| 1692 | Ga0070717_10678534 | |||
| 1693 | Ga0075365_10017395 | |||
| 1694 | Ga0075365_10055725 | |||
| 1695 | Ga0075365_10059683 | |||
| 1696 | Ga0075365_10141939 | |||
| 1697 | Ga0075365_10159603 | |||
| 1698 | Ga0075365_10195741 | |||
| 1699 | Ga0075365_10210341 | |||
| 1700 | Ga0075365_10334329 | |||
| 1701 | Ga0075368_10073538 | |||
| 1702 | Ga0075368_10084711 | |||
| 1703 | Ga0075363_100002704 | |||
| 1704 | Ga0075364_10066567 | |||
| 1705 | Ga0070715_10055748 | |||
| 1706 | Ga0070716_100101944 | |||
| 1707 | Ga0070716_100176294 | |||
| 1708 | Ga0070716_100423302 | |||
| 1709 | Ga0070712_100002371 | |||
| 1710 | Ga0070712_100031659 | |||
| 1711 | Ga0070712_100101145 | |||
| 1712 | Ga0070712_100104477 | |||
| 1713 | Ga0075362_10006634 | |||
| 1714 | Ga0075362_10150161 | |||
| 1715 | Ga0075367_10005584 | |||
| 1716 | Ga0075367_10021332 | |||
| 1717 | Ga0075367_10089027 | |||
| 1718 | Ga0075367_10198769 | |||
| 1719 | Ga0075369_10004189 | |||
| 1720 | Ga0075366_10022772 | |||
| 1721 | Ga0075366_10046580 | |||
| 1722 | Ga0075366_10101831 | |||
| 1723 | Ga0097621_100191123 | |||
| 1724 | Ga0097621_100222425 | |||
| 1725 | Ga0097621_100290259 | |||
| 1726 | Ga0075370_10001262 | |||
| 1727 | Ga0075370_10011785 | |||
| 1728 | Ga0075370_10024269 | |||
| 1729 | Ga0075370_10040385 | |||
| 1730 | Ga0075370_10066034 | |||
| 1731 | Ga0075370_10095321 | |||
| 1732 | Ga0075370_10118423 | |||
| 1733 | Ga0068871_100100889 | |||
| 1734 | Ga0068871_100589620 | |||
| 1735 | Ga0068871_100685960 | |||
| 1736 | Ga0075428_100403065 | |||
| 1737 | Ga0075430_100102784 | |||
| 1738 | Ga0075431_100085325 | |||
| 1739 | Ga0068865_100008510 | |||
| 1740 | Ga0068865_100146318 | |||
| 1741 | Ga0068865_100350766 | |||
| 1742 | Ga0097620_100001570 | |||
| 1743 | Ga0097620_100462275 | |||
| 1744 | Ga0097620_100780186 | |||
| 1745 | Ga0097620_100870290 | |||
| 1746 | Ga0099824_1008303 | |||
| 1747 | Ga0099824_1010623 | |||
| 1748 | Ga0099824_1040894 | |||
| 1749 | Ga0099822_1000541 | |||
| 1750 | Ga0099823_1031325 | |||
| 1751 | Ga0099794_10183679 | |||
| 1752 | Ga0099794_10251862 | |||
| 1753 | Ga0099795_10065592 | |||
| 1754 | Ga0105240_10013303 | |||
| 1755 | Ga0105240_10033754 | |||
| 1756 | Ga0105240_10127891 | |||
| 1757 | Ga0105240_10181246 | |||
| 1758 | Ga0105240_10328790 | |||
| 1759 | Ga0105245_10042563 | |||
| 1760 | Ga0105245_10063488 | |||
| 1761 | Ga0105245_10080927 | |||
| 1762 | Ga0105245_10190761 | |||
| 1763 | Ga0105245_10247879 | |||
| 1764 | Ga0105245_10344362 | |||
| 1765 | Ga0105245_10478747 | |||
| 1766 | Ga0105247_10002542 | |||
| 1767 | Ga0105247_10016513 | |||
| 1768 | Ga0105247_10102046 | |||
| 1769 | Ga0105243_10089266 | |||
| 1770 | Ga0105243_10118066 | |||
| 1771 | Ga0105243_10120396 | |||
| 1772 | Ga0105243_10686139 | |||
| 1773 | Ga0105241_10004267 | |||
| 1774 | Ga0105241_10024156 | |||
| 1775 | Ga0105241_10036215 | |||
| 1776 | Ga0105241_10112289 | |||
| 1777 | Ga0105242_10338156 | |||
| 1778 | Ga0105248_10028678 | |||
| 1779 | Ga0105248_10199684 | |||
| 1780 | Ga0105248_10292444 | |||
| 1781 | Ga0105248_10586646 | |||
| 1782 | Ga0105248_10789923 | |||
| 1783 | Ga0105237_10017841 | |||
| 1784 | Ga0105237_10020621 | |||
| 1785 | Ga0105237_10031465 | |||
| 1786 | Ga0105237_10037178 | |||
| 1787 | Ga0105237_10087362 | |||
| 1788 | Ga0105237_10167091 | |||
| 1789 | Ga0105238_10047527 | |||
| 1790 | Ga0105238_10074353 | |||
| 1791 | Ga0105238_10267009 | |||
| 1792 | Ga0105238_10418198 | |||
| 1793 | Ga0105249_10008304 | |||
| 1794 | Ga0105249_10072592 | |||
| 1795 | Ga0105249_10191467 | |||
| 1796 | Ga0105239_10072795 | |||
| 1797 | Ga0105239_10103015 | |||
| 1798 | Ga0105239_10149272 | |||
| 1799 | Ga0105239_10150802 | |||
| 1800 | Ga0105239_10245039 | |||
| 1801 | Ga0105239_10245702 | |||
| 1802 | Ga0105239_10250953 | |||
| 1803 | Ga0105239_10289119 | |||
| 1804 | Ga0105246_10049380 | |||
| 1805 | Ga0105246_10179239 | |||
| 1806 | Ga0157373_10032613 | |||
| 1807 | Ga0157370_10057357 | |||
| 1808 | Ga0157370_10091066 | |||
| 1809 | Ga0157370_10648161 | |||
| 1810 | Ga0157369_10026988 | |||
| 1811 | Ga0157369_10060406 | |||
| 1812 | Ga0157369_10095007 | |||
| 1813 | Ga0157369_10185643 | |||
| 1814 | Ga0157374_10043641 | |||
| 1815 | Ga0157378_10001192 | |||
| 1816 | Ga0157378_10128040 | |||
| 1817 | Ga0163162_10218914 | |||
| 1818 | Ga0163162_10328957 | |||
| 1819 | Ga0163162_10731118 | |||
| 1820 | Ga0157372_10132541 | |||
| 1821 | Ga0157372_10206646 | |||
| 1822 | Ga0157375_10512151 | |||
| 1823 | Ga0157375_10602449 | |||
| 1824 | Ga0163163_10010769 | |||
| 1825 | Ga0163163_10022075 | |||
| 1826 | Ga0163163_10194424 | |||
| 1827 | Ga0163163_10214083 | |||
| 1828 | Ga0163163_10558072 | |||
| 1829 | Ga0163163_10790756 | |||
| 1830 | Ga0157380_10048748 | |||
| 1831 | Ga0157379_10011061 | |||
| 1832 | Ga0157379_10095785 | |||
| 1833 | Ga0157379_10347339 | |||
| 1834 | Ga0157379_10420007 | |||
| 1835 | Ga0157376_10193426 | |||
| 1836 | Ga0157376_10197979 | |||
| 1837 | Ga0157376_10257277 | |||
| 1838 | Ga0163161_10159037 | |||
| 1839 | Ga0163161_10292901 | |||
| 1840 | Ga0206356_11062778 | |||
| 1841 | Ga0214544_1000003 | |||
| 1842 | Ga0214542_1000022 | |||
| 1843 | Ga0214545_1000010 | |||
| 1844 | Ga0214543_1000035 | |||
| 1845 | Ga0214543_1026336 | |||
| 1846 | Ga0213872_10088623 | |||
| 1847 | Ga0213872_10149365 | |||
| 1848 | Ga0213876_10157517 | |||
| 1849 | Ga0213876_10174453 | |||
| 1850 | Ga0213876_10226170 | |||
| 1851 | Ga0213876_10240098 | |||
| 1852 | Ga0209563_101110 | |||
| 1853 | Ga0207425_1011267 | |||
| 1854 | Ga0209677_100492 | |||
| 1855 | Ga0209148_1000267 | |||
| 1856 | Ga0209233_1001537 | |||
| 1857 | Ga0209233_1005715 | |||
| 1858 | Ga0209233_1040548 | |||
| 1859 | Ga0209455_1001652 | |||
| 1860 | Ga0209455_1004190 | |||
| 1861 | Ga0209455_1007509 | |||
| 1862 | Ga0209455_1020432 | |||
| 1863 | Ga0209455_1026659 | |||
| 1864 | Ga0209673_1021954 | |||
| 1865 | Ga0209564_1000718 | |||
| 1866 | Ga0209564_1005249 | |||
| 1867 | Ga0209564_1017988 | |||
| 1868 | Ga0209564_1029571 | |||
| 1869 | Ga0209758_1000015 | |||
| 1870 | Ga0209758_1000711 | |||
| 1871 | Ga0209758_1000764 | |||
| 1872 | Ga0209758_1001094 | |||
| 1873 | Ga0209758_1001468 | |||
| 1874 | Ga0209758_1004096 | |||
| 1875 | Ga0209758_1007765 | |||
| 1876 | Ga0209758_1022547 | |||
| 1877 | Ga0209758_1023868 | |||
| 1878 | Ga0209758_1070097 | |||
| 1879 | Ga0209256_1010978 | |||
| 1880 | Ga0207426_1000368 | |||
| 1881 | Ga0207426_1005258 | |||
| 1882 | Ga0207426_1027512 | |||
| 1883 | Ga0209257_1001688 | |||
| 1884 | Ga0207697_10127423 | |||
| 1885 | Ga0207656_10047799 | |||
| 1886 | Ga0207682_10154530 | |||
| 1887 | Ga0207692_10015137 | |||
| 1888 | Ga0207710_10000305 | |||
| 1889 | Ga0207710_10132214 | |||
| 1890 | Ga0207710_10156719 | |||
| 1891 | Ga0207688_10052449 | |||
| 1892 | Ga0207680_10021686 | |||
| 1893 | Ga0207680_10335105 | |||
| 1894 | Ga0207647_10012006 | |||
| 1895 | Ga0207685_10077861 | |||
| 1896 | Ga0207699_10001435 | |||
| 1897 | Ga0207699_10006921 | |||
| 1898 | Ga0207699_10084385 | |||
| 1899 | Ga0207699_10136617 | |||
| 1900 | Ga0207643_10002999 | |||
| 1901 | Ga0207643_10020167 | |||
| 1902 | Ga0207705_10018984 | |||
| 1903 | Ga0207705_10247007 | |||
| 1904 | Ga0207684_10013348 | |||
| 1905 | Ga0207684_10175591 | |||
| 1906 | Ga0207654_10007028 | |||
| 1907 | Ga0207654_10014303 | |||
| 1908 | Ga0207654_10051760 | |||
| 1909 | Ga0207707_10000143 | |||
| 1910 | Ga0207707_10000613 | |||
| 1911 | Ga0207707_10022062 | |||
| 1912 | Ga0207707_10514969 | |||
| 1913 | Ga0207695_10000059 | |||
| 1914 | Ga0207695_10288667 | |||
| 1915 | Ga0207695_10490047 | |||
| 1916 | Ga0207671_10069543 | |||
| 1917 | Ga0207671_10096887 | |||
| 1918 | Ga0207671_10101351 | |||
| 1919 | Ga0207671_10116272 | |||
| 1920 | Ga0207671_10140250 | |||
| 1921 | Ga0207671_10382098 | |||
| 1922 | Ga0207671_10479721 | |||
| 1923 | Ga0207693_10031785 | |||
| 1924 | Ga0207693_10053203 | |||
| 1925 | Ga0207693_10056172 | |||
| 1926 | Ga0207693_10075584 | |||
| 1927 | Ga0207693_10269291 | |||
| 1928 | Ga0207663_10010613 | |||
| 1929 | Ga0207663_10025244 | |||
| 1930 | Ga0207660_10015097 | |||
| 1931 | Ga0207660_10046492 | |||
| 1932 | Ga0207660_10126351 | |||
| 1933 | Ga0207662_10089318 | |||
| 1934 | Ga0207657_10006552 | |||
| 1935 | Ga0207657_10021660 | |||
| 1936 | Ga0207657_10065923 | |||
| 1937 | Ga0207657_10118716 | |||
| 1938 | Ga0207657_10272645 | |||
| 1939 | Ga0207649_10047973 | |||
| 1940 | Ga0207649_10099291 | |||
| 1941 | Ga0207652_10023997 | |||
| 1942 | Ga0207652_10029772 | |||
| 1943 | Ga0207652_10080629 | |||
| 1944 | Ga0207646_10075813 | |||
| 1945 | Ga0207646_10158675 | |||
| 1946 | Ga0207694_10017116 | |||
| 1947 | Ga0207694_10097981 | |||
| 1948 | Ga0207694_10321432 | |||
| 1949 | Ga0207659_10214897 | |||
| 1950 | Ga0207687_10039513 | |||
| 1951 | Ga0207687_10096868 | |||
| 1952 | Ga0207687_10121735 | |||
| 1953 | Ga0207700_10007542 | |||
| 1954 | Ga0207700_10052862 | |||
| 1955 | Ga0207700_10062576 | |||
| 1956 | Ga0207700_10108631 | |||
| 1957 | Ga0207700_10140200 | |||
| 1958 | Ga0207664_10006581 | |||
| 1959 | Ga0207664_10763492 | |||
| 1960 | Ga0207644_10003366 | |||
| 1961 | Ga0207644_10146217 | |||
| 1962 | Ga0207644_10320917 | |||
| 1963 | Ga0207644_10341839 | |||
| 1964 | Ga0207706_10025737 | |||
| 1965 | Ga0207706_10041747 | |||
| 1966 | Ga0207706_10122599 | |||
| 1967 | Ga0207686_10458633 | |||
| 1968 | Ga0207686_10538824 | |||
| 1969 | Ga0207709_10097462 | |||
| 1970 | Ga0207709_10203501 | |||
| 1971 | Ga0207709_10385072 | |||
| 1972 | Ga0207669_10016439 | |||
| 1973 | Ga0207669_10282685 | |||
| 1974 | Ga0207669_10509800 | |||
| 1975 | Ga0207704_10050647 | |||
| 1976 | Ga0207704_10110116 | |||
| 1977 | Ga0207665_10006088 | |||
| 1978 | Ga0207665_10051953 | |||
| 1979 | Ga0207665_10105835 | |||
| 1980 | Ga0207691_10250782 | |||
| 1981 | Ga0207691_10393549 | |||
| 1982 | Ga0207711_10051856 | |||
| 1983 | Ga0207711_10142028 | |||
| 1984 | Ga0207711_10228050 | |||
| 1985 | Ga0207711_10342004 | |||
| 1986 | Ga0207711_10469806 | |||
| 1987 | Ga0207711_10645336 | |||
| 1988 | Ga0207689_10090792 | |||
| 1989 | Ga0207661_10015368 | |||
| 1990 | Ga0207661_10046265 | |||
| 1991 | Ga0207661_10133977 | |||
| 1992 | Ga0207661_10252434 | |||
| 1993 | Ga0207661_10465503 | |||
| 1994 | Ga0207679_10025142 | |||
| 1995 | Ga0207679_10135726 | |||
| 1996 | Ga0207667_10028504 | |||
| 1997 | Ga0207667_10035357 | |||
| 1998 | Ga0207667_10214574 | |||
| 1999 | Ga0207667_10301031 | |||
| 2000 | Ga0207712_10018591 | |||
| 2001 | Ga0207712_10133226 | |||
| 2002 | Ga0207668_10010329 | |||
| 2003 | Ga0207668_10168391 | |||
| 2004 | Ga0207668_10187725 | |||
| 2005 | Ga0207668_10250008 | |||
| 2006 | Ga0207668_10421057 | |||
| 2007 | Ga0207640_10019369 | |||
| 2008 | Ga0207640_10083385 | |||
| 2009 | Ga0207640_10154364 | |||
| 2010 | Ga0207640_10290088 | |||
| 2011 | Ga0207658_10005101 | |||
| 2012 | Ga0207658_10195858 | |||
| 2013 | Ga0207677_10016508 | |||
| 2014 | Ga0207677_10020036 | |||
| 2015 | Ga0207677_10176069 | |||
| 2016 | Ga0207703_10005161 | |||
| 2017 | Ga0207703_10038549 | |||
| 2018 | Ga0207703_10126277 | |||
| 2019 | Ga0207703_10383215 | |||
| 2020 | Ga0207703_10393579 | |||
| 2021 | Ga0207639_10018068 | |||
| 2022 | Ga0207639_10143951 | |||
| 2023 | Ga0207639_10276291 | |||
| 2024 | Ga0207639_10295736 | |||
| 2025 | Ga0207678_10016337 | |||
| 2026 | Ga0207678_10042750 | |||
| 2027 | Ga0207678_10047687 | |||
| 2028 | Ga0207678_10052503 | |||
| 2029 | Ga0207678_10065075 | |||
| 2030 | Ga0207678_10067421 | |||
| 2031 | Ga0207678_10100598 | |||
| 2032 | Ga0207678_10109202 | |||
| 2033 | Ga0207678_10117752 | |||
| 2034 | Ga0207678_10146534 | |||
| 2035 | Ga0207708_10036539 | |||
| 2036 | Ga0207708_10135686 | |||
| 2037 | Ga0207702_10000063 | |||
| 2038 | Ga0207702_10170198 | |||
| 2039 | Ga0207641_10013860 | |||
| 2040 | Ga0207641_10176114 | |||
| 2041 | Ga0207641_10190911 | |||
| 2042 | Ga0207648_10151356 | |||
| 2043 | Ga0207648_10206257 | |||
| 2044 | Ga0207676_10245751 | |||
| 2045 | Ga0207676_10289401 | |||
| 2046 | Ga0207674_10059593 | |||
| 2047 | Ga0207674_10114397 | |||
| 2048 | Ga0207675_100012672 | |||
| 2049 | Ga0207675_100025404 | |||
| 2050 | Ga0207675_100032142 | |||
| 2051 | Ga0207675_100066283 | |||
| 2052 | Ga0207683_10032945 | |||
| 2053 | Ga0207683_10085120 | |||
| 2054 | Ga0207683_10116271 | |||
| 2055 | Ga0207683_10185954 | |||
| 2056 | Ga0207683_10186623 | |||
| 2057 | Ga0207683_10500965 | |||
| 2058 | Ga0207698_10120617 | |||
| 2059 | Ga0207698_10179198 | |||
| 2060 | Ga0207698_10218427 | |||
| 2061 | Ga0207698_10351551 | |||
| 2062 | Ga0209389_1000012 | |||
| 2063 | Ga0209389_1000069 | |||
| 2064 | Ga0209589_1000015 | |||
| 2065 | Ga0209589_1000077 | |||
| 2066 | Ga0209489_100015 | |||
| 2067 | Ga0209489_100019 | |||
| 2068 | Ga0209489_100020 | |||
| 2069 | Ga0209700_100018 | |||
| 2070 | Ga0209700_100025 | |||
| 2071 | Ga0209179_1013181 | |||
| 2072 | Ga0209588_1063300 | |||
| 2073 | Ga0209588_1097525 | |||
| 2074 | Ga0268266_10003191 | |||
| 2075 | Ga0268266_10003840 | |||
| 2076 | Ga0268266_10008431 | |||
| 2077 | Ga0268266_10021532 | |||
| 2078 | Ga0268266_10155256 | |||
| 2079 | Ga0268266_10189154 | |||
| 2080 | Ga0268266_10195048 | |||
| 2081 | Ga0268266_10206600 | |||
| 2082 | Ga0268266_10324120 | |||
| 2083 | Ga0268265_10086534 | |||
| 2084 | Ga0268265_10100388 | |||
| 2085 | Ga0268265_10364850 | |||
| 2086 | Ga0268264_10000356 | |||
| 2087 | Ga0268264_10012778 | |||
| 2088 | Ga0268264_10106078 | |||
| 2089 | Ga0268264_10127578 | |||
| 2090 | Ga0268264_10278330 | |||
| 2091 | Ga0268264_10340367 | |||
| 2092 | Ga0268264_10396310 | |||
| 2093 | Ga0268264_10427353 | |||
| 2094 | Ga0268264_10951132 | |||
| 2095 | Ga0265319_1007649 | |||
| 2096 | Ga0265334_10003382 | |||
| 2097 | Ga0265323_10001977 | |||
| 2098 | Ga0265336_10000850 | |||
| 2099 | Ga0307517_10001423 | |||
| 2100 | Ga0307515_10032146 | |||
| 2101 | Ga0307515_10099632 | |||
| 2102 | Ga0307515_10201913 | |||
| 2103 | Ga0265338_10000417 | |||
| 2104 | Ga0307511_10000008 | |||
| 2105 | Ga0307511_10097728 | |||
| 2106 | Ga0307512_10237852 | |||
| 2107 | Ga0316177_1163553 | |||
| 2108 | Ga0316176_1070980 | |||
| 2109 | Ga0314311_1086767 | |||
| 2110 | Ga0265330_10011339 | |||
| 2111 | Ga0265330_10026413 | |||
| 2112 | Ga0265330_10097528 | |||
| 2113 | Ga0265330_10110884 | |||
| 2114 | Ga0265325_10159179 | |||
| 2115 | Ga0265340_10034481 | |||
| 2116 | Ga0265339_10003359 | |||
| 2117 | Ga0265339_10191771 | |||
| 2118 | Ga0265331_10100097 | |||
| 2119 | Ga0307513_10065970 | |||
| 2120 | Ga0307509_10000099 | |||
| 2121 | Ga0307509_10009216 | |||
| 2122 | Ga0307508_10000012 | |||
| 2123 | Ga0307508_10013966 | |||
| 2124 | Ga0307508_10084322 | |||
| 2125 | Ga0307508_10109628 | |||
| 2126 | Ga0307508_10119140 | |||
| 2127 | Ga0307508_10159930 | |||
| 2128 | Ga0265314_10031058 | |||
| 2129 | Ga0265314_10035228 | |||
| 2130 | Ga0265342_10179250 | |||
| 2131 | Ga0307516_10005305 | |||
| 2132 | Ga0307516_10095915 | |||
| 2133 | Ga0307516_10196695 | |||
| 2134 | Ga0307516_10218548 | |||
| 2135 | Ga0307516_10268081 | |||
| 2136 | Ga0307516_10276953 | |||
| 2137 | Ga0307413_10069390 | |||
| 2138 | Ga0307406_10449450 | |||
| 2139 | Ga0307412_10131399 | |||
| 2140 | Ga0307409_100020833 | |||
| 2141 | Ga0307409_100021182 | |||
| 2142 | Ga0307416_100536160 | |||
| 2143 | Ga0307411_10152153 | |||
| 2144 | Ga0307411_10297099 | |||
| 2145 | Ga0307507_10018351 | |||
| 2146 | Ga0307510_10015377 | |||
| 2147 | Ga0307510_10023362 | |||
| 2148 | Ga0307510_10047751 | |||
| 2149 | Ga0307510_10104600 | |||
| 2150 | Ga0307510_10227563 | |||
| 2151 | Ga0315911_1000021 | |||
| 2152 | Ga0373930_0052116 | |||
| 2153 | Ga0373929_0034705 | |||
| 2154 | Ga0373934_0088182 | |||
| 2155 | Ga0373944_0019917 | |||
| 2156 | Ga0373932_0033069 | |||
| 2157 | Ga0373936_0001098 | |||
| 2158 | Ga0373953_0001769 | |||
| 2159 | Ga0373953_0086399 | |||
| 2160 | Ga0373954_0001440 | |||
| 2161 | Ga0373954_0028874 | |||
| 2162 | Ga0373954_0037561 | |||
| 2163 | Ga0373956_0000376 | |||
| 2164 | Ga0373957_0099827 | |||
| 2165 | Ga0373943_0008191 | |||
| 2166 | Ga0373946_0003124 | |||
| 2167 | Ga0373946_0034331 | |||
| 2168 | Ga0373946_0057107 | |||
| 2169 | Ga0373955_0000325 | |||
| 2170 | Ga0373955_0011981 | |||
| 2171 | Ga0373924_0003814 | |||
| 2172 | Ga0373924_0004645 | |||
| 2173 | Ga0373931_0247935 | |||
| 2174 | Ga0373935_0009726 | |||
| 2175 | Ga0373935_0138447 | |||
| 2176 | Ga0373935_0256045 | |||
| 2177 | Ga0373927_0000137 | |||
| 2178 | Ga0373927_0005689 | |||
| 2179 | Ga0373927_0011599 | |||
| 2180 | Ga0373927_0034887 | |||
| 2181 | Ga0373927_0049382 | |||
| 2182 | Ga0373927_0151498 | |||
| 2183 | Ga0373927_0165713 | |||
| 2184 | Ga0373927_0240955 | |||
| 2185 | Ga0373933_0005894 | |||
| 2186 | Ga0373933_0050314 | |||
| 2187 | Ga0373947_0000902 | |||
| 2188 | Ga0373947_0010663 | |||
| 2189 | Ga0373947_0028351 | |||
| 2190 | Ga0373947_0102210 | |||
| 2191 | Ga0373937_0007855 | |||
| 2192 | Ga0373937_0035311 | |||
| 2193 | Ga0373925_0071767 | |||
| 2194 | Ga0373925_0104780 | |||
| 2195 | Ga0373925_0157515 | |||
| 2196 | Ga0395900_0001756 | |||
| 2197 | Ga0395900_0032032 | |||
| 2198 | Ga0395898_0014127 | |||
| 2199 | Ga0395898_0023431 | |||
| 2200 | Ga0395898_0174446 | |||
| 2201 | Ga0395905_0212851 | |||
| 2202 | Ga0436364_0036306 | |||
| 2203 | Ga0436364_0085858 | |||
| 2204 | Ga0436364_0455523 | |||
| 2205 | Ga0436364_1346733 | |||
| 2206 | Ga0395901_0004622 | |||
| 2207 | Ga0395901_0033726 | |||
| 2208 | Ga0395901_0191631 | |||
| 2209 | Ga0395901_0237445 | |||
| 2210 | Ga0395901_0348822 | |||
| 2211 | Ga0395901_0618935 | |||
| 2212 | Ga0400485_10823 | |||
| 2213 | Ga0400483_012731 | |||
| 2214 | Ga0400483_029660 | |||
| 2215 | Ga0400483_195596 | |||
| 2216 | Ga0400483_208463 | |||
| 2217 | Ga0400483_227670 | |||
| 2218 | Ga0400487_38375 | |||
| 2219 | Ga0400487_45671 | |||
| 2220 | Ga0436365_0291034 | |||
| 2221 | Ga0436365_0352699 | |||
| 2222 | Ga0436365_0592130 | |||
| 2223 | Ga0436365_0623836 | |||
| 2224 | Ga0436365_1451371 | |||
| 2225 | Ga0436365_1874811 | |||
| 2226 | Ga0436360_0560711 | |||
| 2227 | Ga0436360_0977178 | |||
| 2228 | Ga0436361_1185290 | |||
| 2229 | Ga0436361_1201280 | |||
| 2230 | Ga0436363_1489411 | |||
| 2231 | Ga0436362_0664428 | |||
| 2232 | Ga0436362_0913305 | |||
| 2233 | Ga0451793_0643539 | |||
| 2234 | Ga0451837_0165624 | |||
| 2235 | Ga0451839_0993113 | |||
| 2236 | Ga0439464_0037956 | |||
| 2237 | Ga0439440_0035015 | |||
| 2238 | Ga0466969_0006671 | |||
| 2239 | Ga0466969_0023683 | |||
| 2240 | Ga0466972_0000100 | |||
| 2241 | Ga0466965_0000658 | |||
| 2242 | Ga0466965_0118215 | |||
| 2243 | Ga0466966_0001463 | |||
| 2244 | Ga0466966_0005774 | |||
| 2245 | Ga0466961_0000065 | |||
| 2246 | Ga0466961_0003171 | |||
| 2247 | Ga0466961_0207952 | |||
| 2248 | Ga0466963_0047566 | |||
| 2249 | Ga0466963_0057196 | |||
| 2250 | Ga0466964_0003697 | |||
| 2251 | Ga0466964_0058713 | |||
| 2252 | Ga0466971_0000087 | |||
| 2253 | Ga0466968_0015345 | |||
| 2254 | Ga0466968_0033584 | |||
| 2255 | Ga0466968_0054753 | |||
| 2256 | Ga0466970_0000283 | |||
| 2257 | Ga0466970_0028514 | |||
| 2258 | Ga0466960_0009188 | |||
| 2259 | Ga0466960_0021600 | |||
| 2260 | Ga0466960_0026907 | |||
| 2261 | Ga0466959_0000634 | |||
| 2262 | Ga0466959_0009459 | |||
| 2263 | Ga0466967_0090558 | |||
| 2264 | Ga0466967_0112086 | |||
| 2265 | Ga0466967_0118024 | |||
| 2266 | Ga0466967_0207709 | |||
| 2267 | Ga0466967_0265729 | |||
| 2268 | Ga0466967_0292030 | |||
| 2269 | Ga0495617_098735 | |||
| 2270 | Ga0495627_094140 | |||
| 2271 | Ga0495592_0000339 | |||
| 2272 | Ga0495592_0029318 | |||
| 2273 | Ga0495603_0004836 | |||
| 2274 | Ga0495603_0050828 | |||
| 2275 | Ga0495603_0052048 | |||
| 2276 | Ga0495603_0062548 | |||
| 2277 | Ga0495629_0000029 | |||
| 2278 | Ga0495629_0001483 | |||
| 2279 | Ga0495638_0014467 | |||
| 2280 | Ga0495638_0014620 | |||
| 2281 | Ga0495641_0003605 | |||
| 2282 | Ga0495641_0089774 | |||
| 2283 | Ga0495651_0015606 | |||
| 2284 | Ga0495651_0017638 | |||
| 2285 | Ga0495651_0068973 | |||
| 2286 | Ga0495651_0284642 | |||
| 2287 | Ga0495653_0001063 | |||
| 2288 | Ga0495653_0300266 | |||
| 2289 | Ga0495650_0092896 | |||
| 2290 | Ga0495580_0002567 | |||
| 2291 | Ga0495582_0000024 | |||
| 2292 | Ga0495582_0020290 | |||
| 2293 | Ga0495582_0214284 | |||
| 2294 | Ga0495639_0000006 | |||
| 2295 | Ga0495662_0000348 | |||
| 2296 | Ga0495662_0093023 | |||
| 2297 | Ga0495664_0016204 | |||
| 2298 | Ga0495664_0021231 | |||
| 2299 | Ga0495664_0105086 | |||
| 2300 | Ga0495664_0120714 | |||
| 2301 | Ga0495585_0074628 | |||
| 2302 | Ga0495594_0000170 | |||
| 2303 | Ga0495594_0036584 | |||
| 2304 | Ga0495594_0047390 | |||
| 2305 | Ga0495594_0056100 | |||
| 2306 | Ga0495596_0035810 | |||
| 2307 | Ga0495596_0058367 | |||
| 2308 | Ga0495583_0092267 | |||
| 2309 | Ga0495606_0011270 | |||
| 2310 | Ga0495606_0018835 | |||
| 2311 | Ga0495608_0002749 | |||
| 2312 | Ga0495608_0015906 | |||
| 2313 | Ga0495608_0148063 | |||
| 2314 | Ga0495610_0017796 | |||
| 2315 | Ga0495616_0099069 | |||
| 2316 | Ga0495616_0180773 | |||
| 2317 | Ga0495618_0035917 | |||
| 2318 | Ga0495618_0170053 | |||
| 2319 | Ga0495618_0273196 | |||
| 2320 | Ga0495620_0014280 | |||
| 2321 | Ga0495628_0010789 | |||
| 2322 | Ga0495630_0022330 | |||
| 2323 | Ga0495630_0086064 | |||
| 2324 | Ga0495631_0010813 | |||
| 2325 | Ga0495632_0008791 | |||
| 2326 | Ga0495632_0042897 | |||
| 2327 | Ga0495632_0193414 | |||
| 2328 | Ga0495632_0206320 | |||
| 2329 | Ga0495643_0012456 | |||
| 2330 | Ga0495643_0053465 | |||
| 2331 | Ga0495648_0019042 | |||
| 2332 | Ga0495666_0053731 | |||
| 2333 | Ga0495652_0021359 | |||
| 2334 | Ga0495652_0025147 | |||
| 2335 | Ga0495652_0026600 | |||
| 2336 | Ga0495652_0196766 | |||
| 2337 | Ga0495665_0000178 | |||
| 2338 | Ga0495665_0053691 | |||
| 2339 | Ga0495640_0003797 | |||
| 2340 | Ga0495640_0004410 | |||
| 2341 | Ga0495640_0008433 | |||
| 2342 | Ga0495640_0052678 | |||
| 2343 | Ga0495586_0049167 | |||
| 2344 | Ga0495587_0010898 | |||
| 2345 | Ga0495587_0027904 | |||
| 2346 | Ga0495597_0193830 | |||
| 2347 | Ga0495645_0004746 | |||
| 2348 | Ga0495645_0052929 | |||
| 2349 | Ga0495645_0060101 | |||
| 2350 | Ga0495622_0002996 | |||
| 2351 | Ga0495622_0010744 | |||
| 2352 | Ga0495622_0045801 | |||
| 2353 | Ga0495622_0052099 | |||
| 2354 | Ga0495622_0087406 | |||
| 2355 | Ga0495667_0003075 | |||
| 2356 | Ga0495667_0011132 | |||
| 2357 | Ga0495667_0053001 | |||
| 2358 | Ga0495656_0006097 | |||
| 2359 | Ga0495656_0023093 | |||
| 2360 | Ga0495656_0063045 | |||
| 2361 | Ga0495668_0034641 | |||
| 2362 | Ga0495668_0085454 | |||
| 2363 | Ga0495668_0103918 | |||
| 2364 | Ga0495668_0133489 | |||
| 2365 | Ga0495634_0000354 | |||
| 2366 | Ga0495634_0002330 | |||
| 2367 | Ga0495634_0057346 | |||
| 2368 | Ga0495611_0178543 | |||
| 2369 | Ga0495625_0013541 | |||
| 2370 | Ga0495625_0169771 | |||
| 2371 | Ga0495635_0000917 | |||
| 2372 | Ga0495635_0002291 | |||
| 2373 | Ga0495635_0039894 | |||
| 2374 | Ga0495635_0056088 | |||
| 2375 | Ga0495661_0028715 | |||
| 2376 | Ga0495588_0009296 | |||
| 2377 | Ga0495588_0058730 | |||
| 2378 | Ga0495588_0193433 | |||
| 2379 | Ga0495657_0003543 | |||
| 2380 | Ga0495657_0005133 | |||
| 2381 | Ga0495657_0027263 | |||
| 2382 | Ga0495599_0001780 | |||
| 2383 | Ga0495599_0096712 | |||
| 2384 | Ga0495599_0127936 | |||
| 2385 | Ga0495599_0243513 | |||
| 2386 | Ga0495623_0058222 | |||
| 2387 | Ga0495623_0094099 | |||
| 2388 | Ga0495623_0144152 | |||
| 2389 | Ga0495623_0185421 | |||
| 2390 | Ga0495646_0025247 | |||
| 2391 | Ga0495646_0035304 | |||
| 2392 | Ga0495646_0066004 | |||
| 2393 | Ga0495646_0122095 | |||
| 2394 | Ga0495647_0000068 | |||
| 2395 | Ga0495658_0000428 | |||
| 2396 | Ga0495658_0045383 | |||
| 2397 | Ga0495658_0205755 | |||
| 2398 | Ga0495669_0043701 | |||
| 2399 | Ga0495613_0001078 | |||
| 2400 | Ga0495613_0012318 | |||
| 2401 | Ga0495613_0099574 | |||
| 2402 | Ga0495624_0011428 | |||
| 2403 | Ga0495624_0047038 | |||
| 2404 | Ga0495624_0091301 | |||
| 2405 | Ga0495624_0128678 | |||
| 2406 | Ga0495624_0323140 | |||
| 2407 | Ga0495670_0019310 | |||
| 2408 | Ga0495670_0161433 | |||
| 2409 | Ga0495649_0072883 | |||
| 2410 | Ga0495600_0002741 | |||
| 2411 | Ga0495600_0030546 | |||
| 2412 | Ga0495600_0114802 | |||
| 2413 | Ga0495660_0146092 | |||
| 2414 | Ga0495581_0000004 | |||
| 2415 | Ga0495581_0040506 | |||
| 2416 | Ga0495581_0088840 | |||
| 2417 | Ga0495581_0093911 | |||
| 2418 | Ga0495604_0007541 | |||
| 2419 | Ga0495604_0007941 | |||
| 2420 | Ga0495604_0129611 | |||
| 2421 | Ga0495604_0188580 | |||
| 2422 | Ga0495674_0000415 | |||
| 2423 | Ga0495674_0007236 | |||
| 2424 | Ga0495674_0064759 | |||
| 2425 | Ga0495672_0014400 | |||
| 2426 | Ga0495672_0020725 | |||
| 2427 | Ga0495672_0062347 | |||
| 2428 | Ga0495676_0005426 | |||
| 2429 | Ga0495676_0014630 | |||
| 2430 | Ga0495680_0001065 | |||
| 2431 | Ga0495680_0001876 | |||
| 2432 | Ga0495687_003727 | |||
| 2433 | Ga0495687_021060 | |||
| 2434 | Ga0495675_0000901 | |||
| 2435 | Ga0495675_0120704 | |||
| 2436 | Ga0495681_0087897 | |||
| 2437 | Ga0495684_0000721 | |||
| 2438 | Ga0495684_0035951 | |||
| 2439 | Ga0495684_0071064 | |||
| 2440 | Ga0495686_0033638 | |||
| 2441 | Ga0495686_0098354 | |||
| 2442 | Ga0495686_0282812 | |||
| 2443 | Ga0495593_0000198 | |||
| 2444 | Ga0495593_0003019 | |||
| 2445 | Ga0495593_0049151 | |||
| 2446 | Ga0495593_0152910 | |||
| 2447 | Ga0495593_0199560 | |||
| 2448 | Ga0495602_0029916 | |||
| 2449 | Ga0495602_0132190 | |||
| 2450 | Ga0495614_0007486 | |||
| 2451 | Ga0495626_0054347 | |||
| 2452 | Ga0496100_0096658 | |||
| 2453 | Ga0496100_0139213 | |||
| 2454 | Ga0496100_0277907 | |||
| 2455 | Ga0496101_0027879 | |||
| 2456 | Ga0496101_0077660 | |||
| 2457 | Ga0496101_0086032 | |||
| 2458 | Ga0496101_0110967 | |||
| 2459 | Ga0496101_0147933 | |||
| 2460 | Ga0496102_0012964 | |||
| 2461 | Ga0496102_0013853 | |||
| 2462 | Ga0496102_0124408 | |||
| 2463 | Ga0496102_0187334 | |||
| 2464 | Ga0496102_0542760 | |||
| 2465 | Ga0496102_0569556 | |||
| 2466 | Ga0496102_0649462 | |||
| 2467 | Ga0496102_0694411 | |||
| 2468 | Ga0496103_0175961 | |||
| 2469 | Ga0496104_0055427 | |||
| 2470 | Ga0496104_0231539 | |||
| 2471 | Ga0496104_0240597 | |||
| 2472 | Ga0496104_0329557 | |||
| 2473 | Ga0496105_0007733 | |||
| 2474 | Ga0496105_0173234 | |||
| 2475 | Ga0496105_0295595 | |||
| 2476 | Ga0496105_0355940 | |||
| 2477 | Ga0496106_0001953 | |||
| 2478 | Ga0496106_0008314 | |||
| 2479 | Ga0496106_0066768 | |||
| 2480 | Ga0496106_0191804 | |||
| 2481 | Ga0496106_0209800 | |||
| 2482 | Ga0496106_0432557 | |||
| 2483 | Ga0496107_0099178 | |||
| 2484 | Ga0496107_0127229 | |||
| 2485 | Ga0496107_0251629 | |||
| 2486 | Ga0496107_0325862 | |||
| 2487 | Ga0496108_0068160 | |||
| 2488 | Ga0496108_0265072 | |||
| 2489 | Ga0496109_0164822 | |||
| 2490 | Ga0496109_0224299 | |||
| 2491 | Ga0496109_0425431 | |||
| 2492 | Ga0496109_0434186 | |||
| 2493 | Ga0496110_0129377 | |||
| 2494 | Ga0496110_0196058 | |||
| 2495 | Ga0496110_0237240 | |||
| 2496 | Ga0496110_0347350 | |||
| 2497 | Ga0496111_0184293 | |||
| 2498 | Ga0496111_0349585 | |||
| 2499 | Ga0496111_0350091 | |||
| 2500 | Ga0496112_0053717 | |||
| 2501 | Ga0496112_0130672 | |||
| 2502 | Ga0496112_0246316 | |||
| 2503 | Ga0496112_0403057 | |||
| 2504 | Ga0496112_0540012 | |||
| 2505 | Ga0496113_0039173 | |||
| 2506 | Ga0496113_0092599 | |||
| 2507 | Ga0496113_0356131 | |||
| 2508 | Ga0496114_0038373 | |||
| 2509 | Ga0496114_0039555 | |||
| 2510 | Ga0496114_0559041 | |||
| 2511 | Ga0496115_0004493 | |||
| 2512 | Ga0496115_0138953 | |||
| 2513 | Ga0496115_0221986 | |||
| 2514 | Ga0496115_0222086 | |||
| 2515 | Ga0496115_0246072 | |||
| 2516 | Ga0496115_0338616 | |||
| 2517 | Ga0496115_0341805 | |||
| 2518 | Ga0496115_0602661 | |||
| 2519 | Ga0496116_0000965 | |||
| 2520 | Ga0496116_0036633 | |||
| 2521 | Ga0496117_0007318 | |||
| 2522 | Ga0496117_0162653 | |||
| 2523 | Ga0496117_0190332 | |||
| 2524 | Ga0496117_0191841 | |||
| 2525 | Ga0496118_0006555 | |||
| 2526 | Ga0496118_0011084 | |||
| 2527 | Ga0496118_0017995 | |||
| 2528 | Ga0496118_0034317 | |||
| 2529 | Ga0496118_0112628 | |||
| 2530 | Ga0496118_0112699 | |||
| 2531 | Ga0496119_0007397 | |||
| 2532 | Ga0496120_0003365 | |||
| 2533 | Ga0496121_0001622 | |||
| 2534 | Ga0496121_0002148 | |||
| 2535 | Ga0496121_0002744 | |||
| 2536 | Ga0496121_0003594 | |||
| 2537 | Ga0496121_0009316 | |||
| 2538 | Ga0496121_0017077 | |||
| 2539 | Ga0496121_0017170 | |||
| 2540 | Ga0496121_0040869 | |||
| 2541 | Ga0496121_0096011 | |||
| 2542 | Ga0496121_0096605 | |||
| 2543 | Ga0496121_0207124 | |||
| 2544 | Ga0496121_0235293 | |||
| 2545 | Ga0496121_0236725 | |||
| 2546 | Ga0496121_0270186 | |||
| 2547 | Ga0496122_0053150 | |||
| 2548 | Ga0496122_0055559 | |||
| 2549 | Ga0496122_0080386 | |||
| 2550 | Ga0496122_0092401 | |||
| 2551 | Ga0496122_0125553 | |||
| 2552 | Ga0496123_0006724 | |||
| 2553 | Ga0496123_0060320 | |||
| 2554 | Ga0496123_0101821 | |||
| 2555 | Ga0496124_0097640 | |||
| 2556 | Ga0496124_0179578 | |||
| 2557 | Ga0496125_0001356 | |||
| 2558 | Ga0496125_0001441 | |||
| 2559 | Ga0496125_0001630 | |||
| 2560 | Ga0496125_0010481 | |||
| 2561 | Ga0496125_0020105 | |||
| 2562 | Ga0496125_0028550 | |||
| 2563 | Ga0496125_0048905 | |||
| 2564 | Ga0496125_0049622 | |||
| 2565 | Ga0496125_0095013 | |||
| 2566 | Ga0496125_0124008 | |||
| 2567 | Ga0496125_0246448 | |||
| 2568 | Ga0496126_0003472 | |||
| 2569 | Ga0496126_0011331 | |||
| 2570 | Ga0496126_0014638 | |||
| 2571 | Ga0496126_0018186 | |||
| 2572 | Ga0496126_0069916 | |||
| 2573 | Ga0496126_0075361 | |||
| 2574 | Ga0496126_0095956 | |||
| 2575 | Ga0496126_0119755 | |||
| 2576 | Ga0496126_0220702 | |||
| 2577 | Ga0496126_0226612 | |||
| 2578 | Ga0496126_0240298 | |||
| 2579 | Ga0496126_0304957 | |||
| 2580 | Ga0496126_0319545 | |||
| 2581 | Ga0496126_0364791 | |||
| 2582 | Ga0496126_0373353 | |||
| 2583 | Ga0496126_0456643 | |||
| 2584 | Ga0495678_044771 | |||
| 2585 | Ga0495682_0054713 | |||
| 2586 | Ga0495682_0075916 | |||
| 2587 | Ga0501031_0001791 | |||
| 2588 | Ga0501031_0093802 | |||
| 2589 | Ga0501032_0000762 | |||
| 2590 | Ga0501033_0000136 | |||
| 2591 | Ga0501033_0049190 | |||
| 2592 | Ga0501033_0072284 | |||
| 2593 | Ga0501034_0000251 | |||
| 2594 | Ga0501034_0408270 | |||
| 2595 | Ga0501034_0711287 | |||
| 2596 | Ga0501036_0000036 | |||
| 2597 | Ga0501036_0158394 | |||
| 2598 | Ga0501036_0344008 | |||
| 2599 | Ga0501038_0000428 | |||
| 2600 | Ga0501038_0049185 | |||
| 2601 | Ga0501039_0000273 | |||
| 2602 | Ga0501041_0179609 | |||
| 2603 | Ga0501042_0025922 | |||
| 2604 | Ga0501042_0301952 | |||
| 2605 | Ga0501043_0000165 | |||
| 2606 | Ga0501043_0009206 | |||
| 2607 | Ga0501046_0255598 | |||
| 2608 | Ga0501047_0000340 | |||
| 2609 | Ga0501047_0032110 | |||
| 2610 | Ga0501047_0034136 | |||
| 2611 | Ga0501047_0144948 | |||
| 2612 | Ga0501047_0270209 | |||
| 2613 | Ga0501048_0004509 | |||
| 2614 | Ga0501048_0277354 | |||
| 2615 | Ga0501067_0007630 | |||
| 2616 | Ga0501067_0174516 | |||
| 2617 | Ga0501067_0274302 | |||
| 2618 | Ga0501068_0003807 | |||
| 2619 | Ga0501069_0007026 | |||
| 2620 | Ga0501069_0156702 | |||
| 2621 | Ga0501069_0213219 | |||
| 2622 | Ga0501070_0006502 | |||
| 2623 | Ga0501070_0072776 | |||
| 2624 | Ga0501070_0510108 | |||
| 2625 | Ga0501071_0201631 | |||
| 2626 | Ga0501071_0211399 | |||
| 2627 | Ga0501072_0007916 | |||
| 2628 | Ga0501073_0000037 | |||
| 2629 | Ga0501074_0000167 | |||
| 2630 | Ga0501074_0043432 | |||
| 2631 | Ga0501074_0078814 | |||
| 2632 | Ga0501077_0054761 | |||
| 2633 | Ga0501079_0001057 | |||
| 2634 | Ga0501079_0325178 | |||
| 2635 | Ga0501079_0422650 | |||
| 2636 | Ga0501080_0003259 | |||
| 2637 | Ga0501080_0008505 | |||
| 2638 | Ga0501080_0411127 | |||
| 2639 | Ga0501083_0074634 | |||
| 2640 | Ga0501035_0000142 | |||
| 2641 | Ga0501035_0028360 | |||
| 2642 | Ga0501035_0042364 | |||
| 2643 | Ga0501035_0121416 | |||
| 2644 | Ga0501035_0178683 | |||
| 2645 | Ga0501044_0000414 | |||
| 2646 | Ga0501044_0038934 | |||
| 2647 | Ga0501044_0522934 | |||
| 2648 | Ga0501045_0036286 | |||
| 2649 | Ga0501045_0316604 | |||
| 2650 | nmdc:mga00v17_354586_c1 | |||
| 2651 | nmdc:mga0yw44_18813_c1 | |||
| 2652 | nmdc:mga0yw44_196694_c1 | |||
| 2653 | nmdc:mga0yw44_31644_c1 | |||
| 2654 | nmdc:mga0yw44_411967_c1 | |||
| 2655 | nmdc:mga0yw44_9428_c1 | |||
| 2656 | nmdc:mga0k408_10213_c1 | |||
| 2657 | nmdc:mga0k408_146316_c1 | |||
| 2658 | nmdc:mga0k408_198567_c1 | |||
| 2659 | nmdc:mga06z11_152149_c1 | |||
| 2660 | nmdc:mga06z11_25604_c1 | |||
| 2661 | nmdc:mga06z11_36801_c1 | |||
| 2662 | nmdc:mga06z11_40099_c1 | |||
| 2663 | nmdc:mga06z11_93465_c1 | |||
| 2664 | nmdc:mga04h51_8477_c1 | |||
| 2665 | nmdc:mga07m45_137705_c1 | |||
| 2666 | nmdc:mga07m45_16268_c1 | |||
| 2667 | nmdc:mga07m45_218_c2 | |||
| 2668 | nmdc:mga07m45_26680_c1 | |||
| 2669 | nmdc:mga07m45_4694_c2 | |||
| 2670 | nmdc:mga07m45_96347_c1 | |||
| 2671 | nmdc:mga06r32_285399_c1 | |||
| 2672 | nmdc:mga0n895_581158_c1 | |||
| 2673 | nmdc:mga0sz30_16997_c1 | |||
| 2674 | nmdc:mga0sz30_7855_c1 | |||
| 2675 | Ga0495612_0012967 | |||
| 2676 | Ga0500635_0005652 | |||
| 2677 | Ga0495655_0035400 | |||
| 2678 | Ga0495655_0039638 | |||
| 2679 | Ga0495595_0000828 | |||
| 2680 | Ga0495619_0000912 | |||
| 2681 | Ga0495619_0024324 | |||
| 2682 | Ga0495619_0246216 | |||
| 2683 | Ga0495619_0404713 | |||
| 2684 | Ga0500578_0106338 | |||
| 2685 | Ga0500578_0163429 | |||
| 2686 | Ga0500578_0226712 | |||
| 2687 | Ga0500578_0235766 | |||
| 2688 | Ga0500643_000048 | |||
| 2689 | Ga0500643_011015 | |||
| 2690 | Ga0500581_151129 | |||
| 2691 | Ga0500647_0018699 | |||
| 2692 | Ga0500651_0037353 | |||
| 2693 | Ga0500651_0085355 | |||
| 2694 | Ga0500651_0120744 | |||
| 2695 | Ga0500566_0000223 | |||
| 2696 | Ga0500566_0004965 | |||
| 2697 | Ga0500566_0029885 | |||
| 2698 | Ga0500566_0153432 | |||
| 2699 | Ga0500641_0008158 | |||
| 2700 | Ga0500641_0012056 | |||
| 2701 | Ga0500641_0023712 | |||
| 2702 | Ga0500641_0043402 | |||
| 2703 | Ga0500650_0003714 | |||
| 2704 | Ga0500554_007050 | |||
| 2705 | Ga0500554_007778 | |||
| 2706 | Ga0500556_0000003 | |||
| 2707 | Ga0500557_000083 | |||
| 2708 | Ga0500569_014315 | |||
| 2709 | Ga0500569_055868 | |||
| 2710 | Ga0500572_001233 | |||
| 2711 | Ga0500572_004969 | |||
| 2712 | Ga0500591_048865 | |||
| 2713 | Ga0500592_001083 | |||
| 2714 | Ga0500592_028662 | |||
| 2715 | Ga0500594_0054034 | |||
| 2716 | Ga0500595_000333 | |||
| 2717 | Ga0500595_005544 | |||
| 2718 | Ga0500595_008879 | |||
| 2719 | Ga0500595_012628 | |||
| 2720 | Ga0500595_019981 | |||
| 2721 | Ga0500595_029765 | |||
| 2722 | Ga0500607_181636 | |||
| 2723 | Ga0500608_043820 | |||
| 2724 | Ga0500608_110735 | |||
| 2725 | Ga0500618_004999 | |||
| 2726 | Ga0500618_036580 | |||
| 2727 | Ga0500628_061835 | |||
| 2728 | Ga0500642_0000015 | |||
| 2729 | Ga0500642_0000642 | |||
| 2730 | Ga0500652_000665 | |||
| 2731 | Ga0500559_0000230 | |||
| 2732 | Ga0500559_0001714 | |||
| 2733 | Ga0500559_0008650 | |||
| 2734 | Ga0500559_0019501 | |||
| 2735 | Ga0500559_0132321 | |||
| 2736 | Ga0500568_0000536 | |||
| 2737 | Ga0500568_0022102 | |||
| 2738 | Ga0500573_0048795 | |||
| 2739 | Ga0500577_0003157 | |||
| 2740 | Ga0500577_0179364 | |||
| 2741 | Ga0500586_000256 | |||
| 2742 | Ga0500588_0077051 | |||
| 2743 | Ga0500588_0080561 | |||
| 2744 | Ga0500589_089297 | |||
| 2745 | Ga0500590_127074 | |||
| 2746 | Ga0500590_155056 | |||
| 2747 | Ga0500603_000178 | |||
| 2748 | Ga0500603_003757 | |||
| 2749 | Ga0500603_007176 | |||
| 2750 | Ga0500603_066455 | |||
| 2751 | Ga0500604_0002214 | |||
| 2752 | Ga0500616_0000033 | |||
| 2753 | Ga0500616_0064918 | |||
| 2754 | Ga0500619_039253 | |||
| 2755 | Ga0500620_025245 | |||
| 2756 | Ga0500622_0005267 | |||
| 2757 | Ga0500622_0132006 | |||
| 2758 | Ga0500630_011681 | |||
| 2759 | Ga0500633_0036030 | |||
| 2760 | Ga0500638_007384 | |||
| 2761 | Ga0500639_012544 | |||
| 2762 | Ga0500639_047881 | |||
| 2763 | Ga0500639_121973 | |||
| 2764 | Ga0500636_0000148 | |||
| 2765 | Ga0500636_0000686 | |||
| 2766 | Ga0500636_0015443 | |||
| 2767 | Ga0500636_0032865 | |||
| 2768 | Ga0500636_0045245 | |||
| 2769 | Ga0500637_0000060 | |||
| 2770 | Ga0500637_0003041 | |||
| 2771 | Ga0500637_0059295 | |||
| 2772 | Ga0500611_061900 | |||
| 2773 | Ga0500625_007842 | |||
| 2774 | Ga0500645_020418 | |||
| 2775 | Ga0500645_028285 | |||
| 2776 | Ga0500645_079363 | |||
| 2777 | Ga0500609_002230 | |||
| 2778 | Ga0500596_004552 | |||
| 2779 | Ga0500599_002662 | |||
| 2780 | Ga0500601_000452 | |||
| 2781 | Ga0500601_005123 | |||
| 2782 | Ga0501084_0445364 | |||
| 2783 | Ga0500661_025944 | |||
| 2784 | Ga0501082_0002719 | |||
| 2785 | Ga0501082_0197709 | |||
| 2786 | Ga0466962_0000093 | |||
| 2787 | Ga0466962_0112696 | |||
| 2788 | Ga0466962_0173982 | |||
| 2789 | Ga0530510_0051769 | |||
| 2790 | 2507505894 | |||
| 2791 | 2508540085 | |||
| 2792 | 2508696155 | |||
| 2793 | 2509151554 | |||
| 2794 | 2511396621 | |||
| 2795 | 2513627468 | |||
| 2796 | 2513638782 | |||
| 2797 | 2513649868 | |||
| 2798 | 2513659782 | |||
| 2799 | 2513676893 | |||
| 2800 | 2513694706 | |||
| 2801 | 2513704353 | |||
| 2802 | 2513715416 | |||
| 2803 | 2513857243 | |||
| 2804 | 2513877270 | |||
| 2805 | 2513891635 | |||
| 2806 | 2513918858 | |||
| 2807 | 2514011243 | |||
| 2808 | 2515631369 | |||
| 2809 | 2517105693 | |||
| 2810 | 2517888184 | |||
| 2811 | 2524435437 | |||
| 2812 | 2524468612 | |||
| 2813 | 2524533359 | |||
| 2814 | 2528855124 | |||
| 2815 | 2603860084 | |||
| 2816 | 2617347778 | |||
| 2817 | 2617374506 | |||
| 2818 | 2644290511 | |||
| 2819 | 2671119357 | |||
| 2820 | 2723842257 | |||
| 2821 | 2728753841 | |||
| 2822 | 2734973075 | |||
| 2823 | 2745081399 | |||
| 2824 | 2793061566 | |||
| 2825 | 2793073862 | |||
| 2826 | 2793077973 | |||
| 2827 | 2805916130 | |||
| 2828 | 2816503849 | |||
| 2829 | 2818240868 | |||
| 2830 | 2824605527 | |||
| 2831 | 2824610825 | |||
| 2832 | 2824619360 | |||
| 2833 | 2824627815 | |||
| 2834 | 2824641893 | |||
| 2835 | 2824651583 | |||
| 2836 | 2824653877 | |||
| 2837 | 2824663770 | |||
| 2838 | 2824676110 | |||
| 2839 | 2824680225 | |||
| 2840 | 2824692463 | |||
| 2841 | 2824699886 | |||
| 2842 | 2824706068 | |||
| 2843 | 2824720085 | |||
| 2844 | 2824729447 | |||
| 2845 | 2824736156 | |||
| 2846 | 2824748032 | |||
| 2847 | 2824760299 | |||
| 2848 | 2824771538 | |||
| 2849 | 2824775742 | |||
| 2850 | 2838125115 | |||
| 2851 | 2841945853 | |||
| 2852 | 2841956820 | |||
| 2853 | 2841965304 | |||
| 2854 | 2841973336 | |||
| 2855 | 2841979500 | |||
| 2856 | 2841989375 | |||
| 2857 | 2842044366 | |||
| 2858 | 2842051645 | |||
| 2859 | 2844321486 | |||
| 2860 | 2847939470 | |||
| 2861 | 2847941219 | |||
| 2862 | 2849082211 | |||
| 2863 | 2857513314 | |||
| 2864 | 2874596368 | |||
| 2865 | 2874610154 | |||
| 2866 | 2874620219 | |||
| 2867 | 2874633340 | |||
| 2868 | 2874650356 | |||
| 2869 | 2876761693 | |||
| 2870 | 2876776833 | |||
| 2871 | 2876815708 | |||
| 2872 | 2876824623 | |||
| 2873 | 2879080970 | |||
| 2874 | 2879091088 | |||
| 2875 | 2879106652 | |||
| 2876 | 2879117030 | |||
| 2877 | 2879128201 | |||
| 2878 | 2879143556 | |||
| 2879 | 2881369630 | |||
| 2880 | 2881670153 | |||
| 2881 | 2885367720 | |||
| 2882 | 2885392255 | |||
| 2883 | 2885418261 | |||
| 2884 | 2888387741 | |||
| 2885 | 2888389960 | |||
| 2886 | 2888421140 | |||
| 2887 | 2889036373 | |||
| 2888 | 2893069654 | |||
| 2889 | 2903727935 | |||
| 2890 | 2903754035 | |||
| 2891 | 2903776665 | |||
| 2892 | 2904695757 | |||
| 2893 | 2904710018 | |||
| 2894 | 2904718095 | |||
| 2895 | 2906602581 | |||
| 2896 | 2906614459 | |||
| 2897 | 2906629721 | |||
| 2898 | 2906643418 | |||
| 2899 | 2906651663 | |||
| 2900 | 2906666610 | |||
| 2901 | 2908746711 | |||
| 2902 | 2908764273 | |||
| 2903 | 2908776985 | |||
| 2904 | 2919078955 | |||
| 2905 | 2922366744 | |||
| 2906 | 2922377446 | |||
| 2907 | 2922389353 | |||
| 2908 | 2922393379 | |||
| 2909 | 2922426293 | |||
| 2910 | 2929622238 | |||
| 2911 | 2929630115 | |||
| 2912 | 2932787952 | |||
| 2913 | 2932799514 | |||
| 2914 | 2932805180 | |||
| 2915 | 2932813327 | |||
| 2916 | 2932820024 | |||
| 2917 | 2932832912 | |||
| 2918 | 2933584148 | |||
| 2919 | 2935614318 | |||
| 2920 | 2935620397 | |||
| 2921 | 2935632678 | |||
| 2922 | 2935640721 | |||
| 2923 | 2935649346 | |||
| 2924 | 2935657882 | |||
| 2925 | 2935668913 | |||
| 2926 | 2935681361 | |||
| 2927 | 2935687222 | |||
| 2928 | 2935696807 | |||
| 2929 | 2935709101 | |||
| 2930 | 2935716910 | |||
| 2931 | 2935722965 | |||
| 2932 | 2935734522 | |||
| 2933 | 2935744687 | |||
| 2934 | 2935753188 | |||
| 2935 | 2935767592 | |||
| 2936 | 2935770186 | |||
| 2937 | 2935777784 | |||
| 2938 | 2935786760 | |||
| 2939 | 2935794814 | |||
| 2940 | 2935804831 | |||
| 2941 | 2935815980 | |||
| 2942 | 2935826536 | |||
| 2943 | 2935832228 | |||
| 2944 | 2935840942 | |||
| 2945 | 2935851170 | |||
| 2946 | 2935859283 | |||
| 2947 | 2935864467 | |||
| 2948 | 2935875181 | |||
| 2949 | 2935887730 | |||
| 2950 | 2935913219 | |||
| 2951 | 2935922641 | |||
| 2952 | 2935930856 | |||
| 2953 | 2935939810 | |||
| 2954 | 2935946759 | |||
| 2955 | 2935956040 | |||
| 2956 | 2935963880 | |||
| 2957 | 2935972833 | |||
| 2958 | 2935978250 | |||
| 2959 | 2935985622 | |||
| 2960 | 2935995844 | |||
| 2961 | 2936005755 | |||
| 2962 | 2936012101 | |||
| 2963 | 2936020818 | |||
| 2964 | 2936029394 | |||
| 2965 | 2936041883 | |||
| 2966 | 2936048282 | |||
| 2967 | 2936056607 | |||
| 2968 | 2940559101 | |||
| 2969 | 2941508658 | |||
| 2970 | 2941516488 | |||
| 2971 | 2941524496 | |||
| 2972 | 2941532066 | |||
| 2973 | 2941541796 | |||
| 2974 | 3003669727 | |||
| 2975 | 3005475657 | |||
| 2976 | 3005485842 | |||
| 2977 | 3005510883 | |||
| 2978 | 3005588832 | |||
| 2979 | 3005601852 | |||
| 2980 | 3005717591 | |||
| 2981 | 3005724639 | |||
| 2982 | 3006430886 | |||
| 2983 | 8002779950 | |||
| 2984 | 8002784702 | |||
| 2985 | 8006932294 | |||
| 2986 | 8006936997 | |||
| 2987 | 8006966342 | |||
| 2988 | 8006976962 | |||
| 2989 | 8006993168 | |||
| 2990 | 8006997007 | |||
| 2991 | 8016526943 | |||
| 2992 | 8016532028 | |||
| 2993 | 8016545237 | |||
| 2994 | 8016556851 | |||
| 2995 | 8016565204 | |||
| 2996 | 8016582863 | |||
| 2997 | 8016585431 | |||
| 2998 | 8016602847 | |||
| 2999 | 8016605717 | |||
| 3000 | 8016617624 | |||
| 3001 | 8016623945 | |||
| 3002 | 8016634920 | |||
| 3003 | 8017059306 | |||
| 3004 | 8019539685 | |||
| 3005 | 8019550963 | |||
| 3006 | 8019571754 | |||
| 3007 | 8019576323 | |||
| 3008 | 8019594195 | |||
| 3009 | 8019607367 | |||
| 3010 | 8019621995 | |||
| 3011 | 8019631326 | |||
| 3012 | 8019651713 | |||
| 3013 | 8019668131 | |||
| 3014 | 8019677597 | |||
| 3015 | 8019687351 | |||
| 3016 | 8019693328 | |||
| 3017 | 8054478238 | |||
| 3018 | 8055743513 | |||
| 3019 | 8056678193 | |||
| 3020 | 8056683415 | |||
| 3021 | 8056692720 | |||
| 3022 | 8056975362 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hin-assembly1.cif.gz_A | crystal structure of putative enoyl-coa hydratase from rhodopseudomonas palustris cga009 | 0.9482 | 9 | 259 |
| 5z7r-assembly1.cif.gz_A | crystal structure of crotonase from clostridium acetobutylicum | 0.9482 | 8 | 255 |
| 5zai-assembly1.cif.gz_D | crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula | 0.9456 | 9 | 255 |
| 4izb-assembly1.cif.gz_B | crystal structure of dmdd, a crotonase superfamily enzyme that catalyzes the hydration and hydrolysis of methylthioacryloyl-coa | 0.9391 | 1 | 247 |
| 7eum-assembly1.cif.gz_F | crystal structure of apo nmar_1308 protein at cryogenic temperature | 0.9378 | 11 | 245 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3hinB01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9712 | 9 | 204 | 3.90.226.10 |
| 5z7rC01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9569 | 8 | 204 | 3.90.226.10 |
| 3hinB01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9429 | 9 | 204 | 3.90.226.10 |
| af_B7F9R1_37_234_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.937 | 18 | 202 | 3.90.226.10 |
| 4izcA01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9354 | 1 | 204 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A260THM0-F1-model_v4 | deleted | 0.9772 | 6 | 260 |
|
| AF-A0A3N5GKA4-F1-model_v4 | Crotonase/enoyl-CoA hydratase family protein | 0.9761 | 9 | 196 |
GO:0003824
GO:0006635 |
| AF-A0A1Y2MVR8-F1-model_v4 | 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) | 0.9749 | 2 | 261 |
GO:0004300
GO:0006635 |
| AF-B3F475-F1-model_v4 | Putative enoyl-CoA hydratase/isomerase | 0.9705 | 10 | 261 |
GO:0006635
GO:0016836 GO:0016853 |
| AF-A0A7Y2DF79-F1-model_v4 | Crotonase/enoyl-CoA hydratase family protein | 0.9705 | 5 | 179 |
GO:0003824
|