F494475

General Info

Members Datasets Scaffolds Average Seq Length
1511 726 3022 267

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0025287|Ga0501044_0025287_1518_2342
Length 267
Sequence MQLNPIGRTEAPVPDLPSTLGVDLQENGIAVLRLMRPEKRNALDNVTVLGLHRFFAAPPAGVKVVVVDGQGEHFSAGLDLSAEGVGHSMMWHEAFRHIQFGKVPVIAVLHGAVIGGGLELAASAHVRIAEPSSFYALPEGQRGIFVGGGGSVRIPRLIGVARMMDMMLTGRVYDAAEGHAIGLSQYLVGAGEGMVRAMELAAKIAGNAPMTNFAVMHALPRIAETSPESGYMMEAMISSIAQADIEAKTRIRDFLEKRAAKVGKAKT

Samples

Sample ID Description Type Environment
1 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
91 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
92 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
122 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
123 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
124 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
129 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
132 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
200 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
201 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
202 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
203 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
209 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
210 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
211 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
212 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
215 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
216 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
217 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
218 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
219 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
220 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
221 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
222 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
226 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
227 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
231 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
232 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
233 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
234 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
235 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
236 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
237 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
238 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
239 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
240 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
241 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
242 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
245 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
247 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
248 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
249 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
258 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
259 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
267 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
268 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
271 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
272 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
273 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
274 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
275 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
276 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
277 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
278 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
279 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
280 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
281 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
282 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
283 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
284 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
285 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
286 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
287 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
288 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
289 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
290 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
291 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
292 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
293 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
294 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
295 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
296 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
297 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
298 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
299 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
300 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
301 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
302 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
303 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
304 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
305 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
306 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
307 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
308 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
309 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
310 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
311 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
312 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
313 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
314 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
315 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
316 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
317 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
318 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
319 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
320 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
321 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
322 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
323 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
324 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
325 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
326 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
327 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
328 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
329 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
330 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
331 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
332 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
333 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
334 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
335 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
336 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
337 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
338 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
339 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
340 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
341 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
342 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
343 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
344 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
345 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
346 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
347 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
348 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
349 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
350 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
351 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
352 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
353 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
354 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
355 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
356 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
357 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
358 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
359 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
360 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
361 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
362 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
363 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
364 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
365 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
366 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
367 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
368 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
369 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
370 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
371 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
372 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
373 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
374 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
375 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
376 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
377 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
378 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
379 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
380 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
381 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
382 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
383 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
384 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
385 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
386 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
387 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
388 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
389 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
390 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
391 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
392 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
393 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
394 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
395 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
396 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
397 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
398 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
412 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
413 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
414 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
415 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
416 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
417 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
418 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
419 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
420 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
421 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
422 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
423 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
425 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
426 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
427 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
428 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
429 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
430 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
431 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
432 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
433 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
434 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
435 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
436 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
437 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
438 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
439 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
440 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
441 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
442 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
443 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
444 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
445 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
446 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
447 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
448 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
449 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
450 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
451 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
452 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
453 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
454 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
455 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
456 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
457 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
458 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
459 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
460 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
461 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
462 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
463 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
464 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
465 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
466 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
467 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
468 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
469 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
470 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
471 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
472 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
473 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
474 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
475 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
476 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
477 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
478 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
479 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
480 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
481 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
482 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
483 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
484 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
485 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
486 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
487 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
488 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
489 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
490 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
491 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
492 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
493 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
494 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
495 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
496 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
497 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
498 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
499 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
500 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
501 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
502 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
503 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
504 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
505 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
506 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
507 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
508 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
509 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
510 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
511 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
512 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
513 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
514 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
515 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
516 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
517 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
518 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
519 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
520 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
521 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
522 2643221651 Afipia sp. Root123D2 Isolate Unclassified
523 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
524 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
525 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
526 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
527 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
528 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
529 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
530 2791355199
531 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
532 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
533 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
534 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
535 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
536 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
537 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
538 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
539 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
540 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
541 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
542 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
543 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
544 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
545 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
546 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
547 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
548 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
549 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
550 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
551 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
552 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
553 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
554 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
555 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
556 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
557 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
558 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
559 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
560 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
561 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
562 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
563 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
564 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
565 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
566 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
567 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
568 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
569 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
570 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
571 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
572 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
573 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
574 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
575 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
576 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
577 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
578 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
579 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
580 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
581 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
582 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
583 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
584 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
585 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
586 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
587 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
588 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
589 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
590 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
591 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
592 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
593 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
594 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
595 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
596 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
597 2904699407
598 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
599 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
600 2906610324
601 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
602 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
603 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
604 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
605 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
606 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
607 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
608 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
609 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
610 2922368715
611 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
612 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
613 2922425934
614 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
615 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
616 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
617 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
618 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
619 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
620 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
621 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
622 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
623 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
624 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
625 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
626 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
627 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
628 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
629 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
630 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
631 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
632 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
633 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
634 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
635 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
636 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
637 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
638 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
639 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
640 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
641 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
642 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
643 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
644 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
645 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
646 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
647 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
648 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
649 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
650 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
651 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
652 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
653 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
654 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
655 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
656 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
657 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
658 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
659 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
660 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
661 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
662 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
663 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
664 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
665 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
666 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
667 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
668 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
669 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
670 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
671 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
672 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
673 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
674 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
675 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
676 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
677 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
678 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
679 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
680 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
681 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
682 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
683 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
684 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
685 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
686 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
687 8002775197 Frankia nepalensis CN7 Isolate Nodule
688 8002784119 Frankia sp. AgB1.9 Isolate Nodule
689 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
690 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
691 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
692 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
693 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
694 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
695 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
696 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
697 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
698 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
699 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
700 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
701 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
702 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
703 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
704 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
705 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
706 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
707 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
708 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
709 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
710 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
711 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
712 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
713 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
714 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
715 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
716 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
717 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
718 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
719 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
720 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
721 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
722 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
723 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
724 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
725 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
726 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.79
Metatranscriptomes 0.07
Isolates 15.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.64
Nodule 12.18
Rhizoplane 4.63
Rhizosphere 58.44
Stem 0
Stem Tuber 0
Unclassified 0.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501044_0025287 3300049823 Bacteria 6293
2 JGI24745J21846_1004091 3300002073 Bacteria 1549
3 JGI25406J46586_10000233 3300003203 Bacteria 24719
4 JGI25406J46586_10008961 3300003203 Bacteria 4502
5 JGI25153J46596_10003608 3300003215 Bacteria 8589
6 JGI25153J46596_10009022 3300003215 Bacteria 4691
7 JGI25404J52841_10011727 3300003659 Bacteria 1893
8 JGI25404J52841_10017283 3300003659 Bacteria 1563
9 JGI25404J52841_10018580 3300003659 Bacteria 1507
10 JGI25404J52841_10036834 3300003659 Bacteria 1041
11 Ga0055526_1047315 3300003771 Bacteria 1011
12 Ga0055531_10013194 3300003794 Bacteria 3829
13 Ga0065165_1000917 3300005262 Bacteria 37935
14 Ga0065165_1001167 3300005262 Bacteria 30545
15 Ga0065165_1009512 3300005262 Bacteria 4346
16 Ga0070658_10071314 3300005327 Bacteria 2845
17 Ga0070683_100254628 3300005329 Bacteria 1670
18 Ga0070690_100164312 3300005330 Bacteria 1523
19 Ga0068869_100117529 3300005334 Bacteria 2030
20 Ga0068869_100130742 3300005334 Bacteria 1929
21 Ga0068869_100138140 3300005334 Bacteria 1879
22 Ga0070680_100102455 3300005336 Bacteria 2377
23 Ga0070682_100067954 3300005337 Bacteria 2271
24 Ga0070682_100242437 3300005337 Bacteria 1295
25 Ga0068868_100009208 3300005338 Bacteria 7095
26 Ga0068868_100133580 3300005338 Bacteria 2032
27 Ga0068868_100140904 3300005338 Bacteria 1979
28 Ga0070660_100015341 3300005339 Bacteria 5530
29 Ga0070660_100299709 3300005339 Bacteria 1318
30 Ga0070660_100309943 3300005339 Bacteria 1295
31 Ga0070689_100134832 3300005340 Bacteria 1982
32 Ga0070687_100221156 3300005343 Bacteria 1160
33 Ga0070687_100304947 3300005343 Bacteria 1012
34 Ga0070661_100047378 3300005344 Bacteria 3145
35 Ga0070661_100058873 3300005344 Bacteria 2816
36 Ga0070661_100138016 3300005344 Bacteria 1836
37 Ga0070661_100342318 3300005344 Bacteria 1172
38 Ga0070668_100009536 3300005347 Bacteria 7203
39 Ga0070668_100013042 3300005347 Bacteria 6191
40 Ga0070668_100066141 3300005347 Bacteria 2804
41 Ga0070668_100230649 3300005347 Bacteria 1530
42 Ga0070668_100292199 3300005347 Bacteria 1364
43 Ga0070669_100163838 3300005353 Bacteria 1729
44 Ga0070669_100224392 3300005353 Bacteria 1487
45 Ga0070675_100193255 3300005354 Bacteria 1764
46 Ga0070671_100000724 3300005355 Bacteria 23620
47 Ga0070671_100107752 3300005355 Bacteria 2339
48 Ga0070671_100138626 3300005355 Bacteria 2052
49 Ga0070671_100677286 3300005355 Bacteria 894
50 Ga0070674_100052855 3300005356 Bacteria 2803
51 Ga0070674_100261447 3300005356 Bacteria 1364
52 Ga0070674_100296307 3300005356 Bacteria 1288
53 Ga0070673_100224362 3300005364 Bacteria 1628
54 Ga0070688_100044579 3300005365 Bacteria 2737
55 Ga0070659_100148271 3300005366 Bacteria 1912
56 Ga0070667_100004331 3300005367 Bacteria 11978
57 Ga0070667_100213017 3300005367 Bacteria 1718
58 Ga0070667_100269039 3300005367 Bacteria 1528
59 Ga0070709_10001520 3300005434 Bacteria 12532
60 Ga0070709_10008885 3300005434 Bacteria 5530
61 Ga0070709_10173983 3300005434 Bacteria 1507
62 Ga0070714_100005907 3300005435 Bacteria 9391
63 Ga0070713_100021890 3300005436 Bacteria 4929
64 Ga0070713_100040858 3300005436 Bacteria 3774
65 Ga0070713_100086571 3300005436 Bacteria 2686
66 Ga0070713_100108114 3300005436 Bacteria 2421
67 Ga0070713_100133311 3300005436 Bacteria 2193
68 Ga0070713_100156609 3300005436 Bacteria 2031
69 Ga0070710_10000733 3300005437 Bacteria 15629
70 Ga0070710_10014290 3300005437 Bacteria 3994
71 Ga0070711_100005326 3300005439 Bacteria 7689
72 Ga0070711_100040962 3300005439 Bacteria 3126
73 Ga0070700_100456363 3300005441 Bacteria 974
74 Ga0070663_100039057 3300005455 Bacteria 3315
75 Ga0070663_100058403 3300005455 Bacteria 2770
76 Ga0070663_100061649 3300005455 Bacteria 2701
77 Ga0070663_100113203 3300005455 Bacteria 2041
78 Ga0070663_100135351 3300005455 Bacteria 1875
79 Ga0070678_100024391 3300005456 Bacteria 4048
80 Ga0070678_100115610 3300005456 Bacteria 2106
81 Ga0070678_100356183 3300005456 Bacteria 1260
82 Ga0070662_100048334 3300005457 Bacteria 3064
83 Ga0070662_100193379 3300005457 Bacteria 1610
84 Ga0070681_10131987 3300005458 Bacteria 2430
85 Ga0070681_10258667 3300005458 Bacteria 1653
86 Ga0070681_10272242 3300005458 Bacteria 1605
87 Ga0068867_100209521 3300005459 Bacteria 1565
88 Ga0068867_100287432 3300005459 Bacteria 1350
89 Ga0068867_100501042 3300005459 Bacteria 1044
90 Ga0070685_10222031 3300005466 Bacteria 1238
91 Ga0070706_100000883 3300005467 Bacteria 32838
92 Ga0070706_100338949 3300005467 Bacteria 1402
93 Ga0070707_100048206 3300005468 Bacteria 4081
94 Ga0070707_100216052 3300005468 Bacteria 1868
95 Ga0070699_100224891 3300005518 Bacteria 1673
96 Ga0070679_100080757 3300005530 Bacteria 3241
97 Ga0070679_100086434 3300005530 Bacteria 3122
98 Ga0070679_100289996 3300005530 Bacteria 1588
99 Ga0070684_100089394 3300005535 Bacteria 2737
100 Ga0070684_100495287 3300005535 Bacteria 1132
101 Ga0070684_100612305 3300005535 Bacteria 1013
102 Ga0070697_100096466 3300005536 Bacteria 2453
103 Ga0068853_100037982 3300005539 Bacteria 4100
104 Ga0068853_100208559 3300005539 Bacteria 1780
105 Ga0068853_100316150 3300005539 Bacteria 1447
106 Ga0068853_100477708 3300005539 Bacteria 1175
107 Ga0068853_100521167 3300005539 Bacteria 1124
108 Ga0068853_100560881 3300005539 Bacteria 1082
109 Ga0068853_100604343 3300005539 Bacteria 1042
110 Ga0070672_100177991 3300005543 Bacteria 1771
111 Ga0070672_100216984 3300005543 Bacteria 1604
112 Ga0070686_100068407 3300005544 Unclassified 2316
113 Ga0070695_100096384 3300005545 Bacteria 1985
114 Ga0070665_100004629 3300005548 Bacteria 14379
115 Ga0070665_100071360 3300005548 Bacteria 3479
116 Ga0070665_100105979 3300005548 Bacteria 2813
117 Ga0070665_100144937 3300005548 Bacteria 2378
118 Ga0070665_100237677 3300005548 Bacteria 1822
119 Ga0068855_100031922 3300005563 Bacteria 6287
120 Ga0068855_100069511 3300005563 Bacteria 4098
121 Ga0068855_100096541 3300005563 Bacteria 3405
122 Ga0068855_100245511 3300005563 Bacteria 1998
123 Ga0070664_100011717 3300005564 Bacteria 7117
124 Ga0070664_100108843 3300005564 Bacteria 2417
125 Ga0070664_100285667 3300005564 Bacteria 1488
126 Ga0070664_100483156 3300005564 Bacteria 1140
127 Ga0068857_100026204 3300005577 Bacteria 5137
128 Ga0068856_100000137 3300005614 Bacteria 73762
129 Ga0070702_100118817 3300005615 Bacteria 1651
130 Ga0068852_100026206 3300005616 Bacteria 4735
131 Ga0068852_100067797 3300005616 Bacteria 3120
132 Ga0068852_100144994 3300005616 Bacteria 2202
133 Ga0068859_100001570 3300005617 Bacteria 23292
134 Ga0068859_100780237 3300005617 Bacteria 1044
135 Ga0068859_100870272 3300005617 Bacteria 987
136 Ga0068864_100106901 3300005618 Bacteria 2489
137 Ga0068864_100294206 3300005618 Bacteria 1518
138 Ga0068864_100406660 3300005618 Bacteria 1294
139 Ga0068866_10035306 3300005718 Bacteria 2441
140 Ga0068861_100029805 3300005719 Bacteria 3994
141 Ga0068861_100189556 3300005719 Bacteria 1718
142 Ga0068861_100675561 3300005719 Bacteria 957
143 Ga0068851_10011436 3300005834 Bacteria 4163
144 Ga0068863_100001523 3300005841 Bacteria 22904
145 Ga0068858_100011790 3300005842 Bacteria 8246
146 Ga0068858_100057344 3300005842 Bacteria 3599
147 Ga0068858_100252659 3300005842 Bacteria 1675
148 Ga0068858_100381416 3300005842 Bacteria 1353
149 Ga0068858_100458870 3300005842 Bacteria 1228
150 Ga0068860_100068880 3300005843 Bacteria 3362
151 Ga0068860_100191436 3300005843 Bacteria 1979
152 Ga0068860_100316896 3300005843 Bacteria 1530
153 Ga0068860_100451721 3300005843 Bacteria 1278
154 Ga0068860_100553496 3300005843 Bacteria 1153
155 Ga0068862_100064935 3300005844 Bacteria 3143
156 Ga0068862_100417409 3300005844 Bacteria 1258
157 Ga0068862_100489571 3300005844 Bacteria 1165
158 Ga0068862_100617334 3300005844 Bacteria 1043
159 Ga0081455_10011235 3300005937 Bacteria 9010
160 Ga0081455_10056109 3300005937 Bacteria 3347
161 Ga0081455_10080519 3300005937 Bacteria 2670
162 Ga0081455_10281684 3300005937 Bacteria 1201
163 Ga0081455_10307771 3300005937 Bacteria 1134
164 Ga0081540_1005656 3300005983 Bacteria 9295
165 Ga0081540_1005657 3300005983 Bacteria 9294
166 Ga0081540_1010321 3300005983 Bacteria 6335
167 Ga0081540_1016160 3300005983 Bacteria 4686
168 Ga0081540_1021999 3300005983 Bacteria 3775
169 Ga0081540_1026512 3300005983 Bacteria 3306
170 Ga0081540_1046497 3300005983 Bacteria 2191
171 Ga0081540_1077757 3300005983 Bacteria 1507
172 Ga0081539_10000157 3300005985 Bacteria 158278
173 Ga0081539_10002599 3300005985 Bacteria 24763
174 Ga0081539_10037110 3300005985 Bacteria 2906
175 Ga0070717_10001671 3300006028 Bacteria 15424
176 Ga0070717_10011582 3300006028 Bacteria 6703
177 Ga0070717_10111271 3300006028 Bacteria 2336
178 Ga0070717_10149083 3300006028 Bacteria 2023
179 Ga0070717_10273426 3300006028 Bacteria 1497
180 Ga0070717_10363074 3300006028 Bacteria 1296
181 Ga0070717_10678534 3300006028 Bacteria 936
182 Ga0075365_10017395 3300006038 Bacteria 4398
183 Ga0075365_10055725 3300006038 Bacteria 2625
184 Ga0075365_10059683 3300006038 Bacteria 2543
185 Ga0075365_10141939 3300006038 Bacteria 1667
186 Ga0075365_10159603 3300006038 Bacteria 1571
187 Ga0075365_10195741 3300006038 Bacteria 1415
188 Ga0075365_10210341 3300006038 Bacteria 1363
189 Ga0075365_10334329 3300006038 Bacteria 1067
190 Ga0075368_10073538 3300006042 Bacteria 1383
191 Ga0075368_10084711 3300006042 Bacteria 1292
192 Ga0075363_100002704 3300006048 Bacteria 7338
193 Ga0075364_10066567 3300006051 Bacteria 2367
194 Ga0070715_10055748 3300006163 Bacteria 1717
195 Ga0070716_100101944 3300006173 Bacteria 1761
196 Ga0070716_100176294 3300006173 Bacteria 1399
197 Ga0070716_100423302 3300006173 Bacteria 963
198 Ga0070712_100002371 3300006175 Bacteria 11602
199 Ga0070712_100031659 3300006175 Bacteria 3565
200 Ga0070712_100101145 3300006175 Bacteria 2132
201 Ga0070712_100104477 3300006175 Bacteria 2102
202 Ga0075362_10006634 3300006177 Bacteria 4322
203 Ga0075362_10150161 3300006177 Bacteria 1117
204 Ga0075367_10005584 3300006178 Bacteria 6264
205 Ga0075367_10021332 3300006178 Bacteria 3618
206 Ga0075367_10089027 3300006178 Bacteria 1876
207 Ga0075367_10198769 3300006178 Bacteria 1252
208 Ga0075369_10004189 3300006186 Bacteria 5315
209 Ga0075366_10022772 3300006195 Bacteria 3647
210 Ga0075366_10046580 3300006195 Bacteria 2570
211 Ga0075366_10101831 3300006195 Bacteria 1724
212 Ga0097621_100191123 3300006237 Bacteria 1773
213 Ga0097621_100222425 3300006237 Bacteria 1645
214 Ga0097621_100290259 3300006237 Bacteria 1442
215 Ga0075370_10001262 3300006353 Bacteria 10776
216 Ga0075370_10011785 3300006353 Bacteria 4602
217 Ga0075370_10024269 3300006353 Bacteria 3348
218 Ga0075370_10040385 3300006353 Bacteria 2631
219 Ga0075370_10066034 3300006353 Bacteria 2064
220 Ga0075370_10095321 3300006353 Bacteria 1719
221 Ga0075370_10118423 3300006353 Bacteria 1540
222 Ga0068871_100100889 3300006358 Bacteria 2418
223 Ga0068871_100589620 3300006358 Bacteria 1010
224 Ga0068871_100685960 3300006358 Bacteria 937
225 Ga0075428_100403065 3300006844 Bacteria 1466
226 Ga0075430_100102784 3300006846 Bacteria 2386
227 Ga0075431_100085325 3300006847 Bacteria 3259
228 Ga0068865_100008510 3300006881 Bacteria 6343
229 Ga0068865_100146318 3300006881 Bacteria 1787
230 Ga0068865_100350766 3300006881 Bacteria 1195
231 Ga0097620_100001570 3300006931 Bacteria 23292
232 Ga0097620_100462275 3300006931 Bacteria 1365
233 Ga0097620_100780186 3300006931 Bacteria 1044
234 Ga0097620_100870290 3300006931 Bacteria 987
235 Ga0099824_1008303 3300006942 Bacteria 13338
236 Ga0099824_1010623 3300006942 Bacteria 10757
237 Ga0099824_1040894 3300006942 Bacteria 1121
238 Ga0099822_1000541 3300006943 Bacteria 35996
239 Ga0099823_1031325 3300006944 Bacteria 4394
240 Ga0099794_10183679 3300007265 Bacteria 1068
241 Ga0099794_10251862 3300007265 Bacteria 911
242 Ga0099795_10065592 3300007788 Bacteria 1358
243 Ga0105240_10013303 3300009093 Bacteria 11310
244 Ga0105240_10033754 3300009093 Bacteria 6607
245 Ga0105240_10127891 3300009093 Bacteria 3050
246 Ga0105240_10181246 3300009093 Bacteria 2485
247 Ga0105240_10328790 3300009093 Bacteria 1740
248 Ga0105245_10042563 3300009098 Bacteria 4053
249 Ga0105245_10063488 3300009098 Bacteria 3335
250 Ga0105245_10080927 3300009098 Bacteria 2968
251 Ga0105245_10190761 3300009098 Bacteria 1963
252 Ga0105245_10247879 3300009098 Bacteria 1729
253 Ga0105245_10344362 3300009098 Bacteria 1475
254 Ga0105245_10478747 3300009098 Bacteria 1258
255 Ga0105247_10002542 3300009101 Bacteria 12378
256 Ga0105247_10016513 3300009101 Bacteria 4425
257 Ga0105247_10102046 3300009101 Bacteria 1835
258 Ga0105243_10089266 3300009148 Bacteria 2534
259 Ga0105243_10118066 3300009148 Bacteria 2231
260 Ga0105243_10120396 3300009148 Bacteria 2212
261 Ga0105243_10686139 3300009148 Bacteria 997
262 Ga0105241_10004267 3300009174 Bacteria 10572
263 Ga0105241_10024156 3300009174 Bacteria 4514
264 Ga0105241_10036215 3300009174 Bacteria 3713
265 Ga0105241_10112289 3300009174 Bacteria 2183
266 Ga0105242_10338156 3300009176 Bacteria 1386
267 Ga0105248_10028678 3300009177 Bacteria 6203
268 Ga0105248_10199684 3300009177 Bacteria 2253
269 Ga0105248_10292444 3300009177 Bacteria 1834
270 Ga0105248_10586646 3300009177 Bacteria 1258
271 Ga0105248_10789923 3300009177 Bacteria 1071
272 Ga0105237_10017841 3300009545 Bacteria 7357
273 Ga0105237_10020621 3300009545 Bacteria 6791
274 Ga0105237_10031465 3300009545 Bacteria 5380
275 Ga0105237_10037178 3300009545 Bacteria 4923
276 Ga0105237_10087362 3300009545 Bacteria 3107
277 Ga0105237_10167091 3300009545 Bacteria 2199
278 Ga0105238_10047527 3300009551 Bacteria 4326
279 Ga0105238_10074353 3300009551 Bacteria 3391
280 Ga0105238_10267009 3300009551 Bacteria 1691
281 Ga0105238_10418198 3300009551 Bacteria 1335
282 Ga0105249_10008304 3300009553 Bacteria 9039
283 Ga0105249_10072592 3300009553 Bacteria 3182
284 Ga0105249_10191467 3300009553 Bacteria 1996
285 Ga0105239_10072795 3300010375 Bacteria 3778
286 Ga0105239_10103015 3300010375 Bacteria 3159
287 Ga0105239_10149272 3300010375 Bacteria 2609
288 Ga0105239_10150802 3300010375 Bacteria 2594
289 Ga0105239_10245039 3300010375 Bacteria 2012
290 Ga0105239_10245702 3300010375 Bacteria 2009
291 Ga0105239_10250953 3300010375 Bacteria 1987
292 Ga0105239_10289119 3300010375 Bacteria 1846
293 Ga0105246_10049380 3300011119 Bacteria 2881
294 Ga0105246_10179239 3300011119 Bacteria 1630
295 Ga0157373_10032613 3300013100 Bacteria 3748
296 Ga0157370_10057357 3300013104 Bacteria 3703
297 Ga0157370_10091066 3300013104 Bacteria 2863
298 Ga0157370_10648161 3300013104 Bacteria 965
299 Ga0157369_10026988 3300013105 Bacteria 6368
300 Ga0157369_10060406 3300013105 Bacteria 4088
301 Ga0157369_10095007 3300013105 Bacteria 3182
302 Ga0157369_10185643 3300013105 Bacteria 2187
303 Ga0157374_10043641 3300013296 Bacteria 4143
304 Ga0157378_10001192 3300013297 Bacteria 23599
305 Ga0157378_10128040 3300013297 Bacteria 2347
306 Ga0163162_10218914 3300013306 Bacteria 2034
307 Ga0163162_10328957 3300013306 Bacteria 1661
308 Ga0163162_10731118 3300013306 Bacteria 1110
309 Ga0157372_10132541 3300013307 Bacteria 2868
310 Ga0157372_10206646 3300013307 Bacteria 2275
311 Ga0157375_10512151 3300013308 Bacteria 1364
312 Ga0157375_10602449 3300013308 Bacteria 1258
313 Ga0163163_10010769 3300014325 Bacteria 8250
314 Ga0163163_10022075 3300014325 Bacteria 6020
315 Ga0163163_10194424 3300014325 Bacteria 2076
316 Ga0163163_10214083 3300014325 Bacteria 1976
317 Ga0163163_10558072 3300014325 Bacteria 1208
318 Ga0163163_10790756 3300014325 Bacteria 1012
319 Ga0157380_10048748 3300014326 Bacteria 3337
320 Ga0157379_10011061 3300014968 Bacteria 7865
321 Ga0157379_10095785 3300014968 Bacteria 2663
322 Ga0157379_10347339 3300014968 Bacteria 1358
323 Ga0157379_10420007 3300014968 Bacteria 1231
324 Ga0157376_10193426 3300014969 Bacteria 1867
325 Ga0157376_10197979 3300014969 Bacteria 1846
326 Ga0157376_10257277 3300014969 Bacteria 1634
327 Ga0163161_10159037 3300017792 Bacteria 1722
328 Ga0163161_10292901 3300017792 Bacteria 1280
329 Ga0206356_11062778 3300020070 Bacteria 930
330 Ga0214544_1000003 3300021320 Bacteria 643752
331 Ga0214542_1000022 3300021321 Bacteria 193578
332 Ga0214545_1000010 3300021324 Bacteria 193578
333 Ga0214543_1000035 3300021327 Bacteria 183100
334 Ga0214543_1026336 3300021327 Bacteria 3149
335 Ga0213872_10088623 3300021361 Bacteria 1386
336 Ga0213872_10149365 3300021361 Bacteria 1022
337 Ga0213876_10157517 3300021384 Bacteria 1208
338 Ga0213876_10174453 3300021384 Bacteria 1144
339 Ga0213876_10226170 3300021384 Bacteria 995
340 Ga0213876_10240098 3300021384 Bacteria 963
341 Ga0209563_101110 3300025230 Bacteria 7671
342 Ga0207425_1011267 3300025245 Bacteria 2140
343 Ga0209677_100492 3300025253 Bacteria 22270
344 Ga0209148_1000267 3300025254 Bacteria 81839
345 Ga0209233_1001537 3300025261 Bacteria 9046
346 Ga0209233_1005715 3300025261 Bacteria 4100
347 Ga0209233_1040548 3300025261 Bacteria 1012
348 Ga0209455_1001652 3300025272 Bacteria 9674
349 Ga0209455_1004190 3300025272 Bacteria 4822
350 Ga0209455_1007509 3300025272 Bacteria 3070
351 Ga0209455_1020432 3300025272 Bacteria 1310
352 Ga0209455_1026659 3300025272 Bacteria 1033
353 Ga0209673_1021954 3300025273 Bacteria 2216
354 Ga0209564_1000718 3300025295 Bacteria 47576
355 Ga0209564_1005249 3300025295 Bacteria 7481
356 Ga0209564_1017988 3300025295 Bacteria 2720
357 Ga0209564_1029571 3300025295 Bacteria 1721
358 Ga0209758_1000015 3300025297 Bacteria 851943
359 Ga0209758_1000711 3300025297 Bacteria 49164
360 Ga0209758_1000764 3300025297 Bacteria 46385
361 Ga0209758_1001094 3300025297 Bacteria 35071
362 Ga0209758_1001468 3300025297 Bacteria 27665
363 Ga0209758_1004096 3300025297 Bacteria 12498
364 Ga0209758_1007765 3300025297 Bacteria 7183
365 Ga0209758_1022547 3300025297 Bacteria 2880
366 Ga0209758_1023868 3300025297 Bacteria 2748
367 Ga0209758_1070097 3300025297 Bacteria 1108
368 Ga0209256_1010978 3300025299 Bacteria 3700
369 Ga0207426_1000368 3300025302 Bacteria 79715
370 Ga0207426_1005258 3300025302 Bacteria 5970
371 Ga0207426_1027512 3300025302 Bacteria 1893
372 Ga0209257_1001688 3300025304 Bacteria 24840
373 Ga0207697_10127423 3300025315 Bacteria 1099
374 Ga0207656_10047799 3300025321 Bacteria 1841
375 Ga0207682_10154530 3300025893 Bacteria 1036
376 Ga0207692_10015137 3300025898 Bacteria 3387
377 Ga0207710_10000305 3300025900 Bacteria 38961
378 Ga0207710_10132214 3300025900 Bacteria 1199
379 Ga0207710_10156719 3300025900 Bacteria 1107
380 Ga0207688_10052449 3300025901 Bacteria 2285
381 Ga0207680_10021686 3300025903 Bacteria 3479
382 Ga0207680_10335105 3300025903 Bacteria 1060
383 Ga0207647_10012006 3300025904 Bacteria 6046
384 Ga0207685_10077861 3300025905 Bacteria 1364
385 Ga0207699_10001435 3300025906 Bacteria 11313
386 Ga0207699_10006921 3300025906 Bacteria 5519
387 Ga0207699_10084385 3300025906 Bacteria 1978
388 Ga0207699_10136617 3300025906 Bacteria 1606
389 Ga0207643_10002999 3300025908 Bacteria 9101
390 Ga0207643_10020167 3300025908 Bacteria 3658
391 Ga0207705_10018984 3300025909 Bacteria 4916
392 Ga0207705_10247007 3300025909 Bacteria 1360
393 Ga0207684_10013348 3300025910 Bacteria 7107
394 Ga0207684_10175591 3300025910 Bacteria 1847
395 Ga0207654_10007028 3300025911 Bacteria 5670
396 Ga0207654_10014303 3300025911 Bacteria 4099
397 Ga0207654_10051760 3300025911 Bacteria 2365
398 Ga0207707_10000143 3300025912 Bacteria 74226
399 Ga0207707_10000613 3300025912 Bacteria 35676
400 Ga0207707_10022062 3300025912 Bacteria 5565
401 Ga0207707_10514969 3300025912 Bacteria 1019
402 Ga0207695_10000059 3300025913 Bacteria 363920
403 Ga0207695_10288667 3300025913 Bacteria 1533
404 Ga0207695_10490047 3300025913 Bacteria 1111
405 Ga0207671_10069543 3300025914 Bacteria 2624
406 Ga0207671_10096887 3300025914 Bacteria 2230
407 Ga0207671_10101351 3300025914 Bacteria 2181
408 Ga0207671_10116272 3300025914 Bacteria 2040
409 Ga0207671_10140250 3300025914 Bacteria 1862
410 Ga0207671_10382098 3300025914 Bacteria 1119
411 Ga0207671_10479721 3300025914 Bacteria 991
412 Ga0207693_10031785 3300025915 Bacteria 4171
413 Ga0207693_10053203 3300025915 Bacteria 3177
414 Ga0207693_10056172 3300025915 Bacteria 3087
415 Ga0207693_10075584 3300025915 Bacteria 2638
416 Ga0207693_10269291 3300025915 Bacteria 1335
417 Ga0207663_10010613 3300025916 Bacteria 4911
418 Ga0207663_10025244 3300025916 Bacteria 3432
419 Ga0207660_10015097 3300025917 Bacteria 5092
420 Ga0207660_10046492 3300025917 Bacteria 3063
421 Ga0207660_10126351 3300025917 Bacteria 1942
422 Ga0207662_10089318 3300025918 Bacteria 1893
423 Ga0207657_10006552 3300025919 Bacteria 12056
424 Ga0207657_10021660 3300025919 Bacteria 6041
425 Ga0207657_10065923 3300025919 Bacteria 3084
426 Ga0207657_10118716 3300025919 Bacteria 2177
427 Ga0207657_10272645 3300025919 Bacteria 1345
428 Ga0207649_10047973 3300025920 Bacteria 2632
429 Ga0207649_10099291 3300025920 Bacteria 1923
430 Ga0207652_10023997 3300025921 Bacteria 5058
431 Ga0207652_10029772 3300025921 Bacteria 4568
432 Ga0207652_10080629 3300025921 Bacteria 2846
433 Ga0207646_10075813 3300025922 Bacteria 3005
434 Ga0207646_10158675 3300025922 Bacteria 2041
435 Ga0207694_10017116 3300025924 Bacteria 5476
436 Ga0207694_10097981 3300025924 Bacteria 2321
437 Ga0207694_10321432 3300025924 Bacteria 1277
438 Ga0207659_10214897 3300025926 Bacteria 1543
439 Ga0207687_10039513 3300025927 Bacteria 3231
440 Ga0207687_10096868 3300025927 Bacteria 2163
441 Ga0207687_10121735 3300025927 Bacteria 1952
442 Ga0207700_10007542 3300025928 Bacteria 6659
443 Ga0207700_10052862 3300025928 Bacteria 3040
444 Ga0207700_10062576 3300025928 Bacteria 2827
445 Ga0207700_10108631 3300025928 Bacteria 2228
446 Ga0207700_10140200 3300025928 Bacteria 1986
447 Ga0207664_10006581 3300025929 Bacteria 8002
448 Ga0207664_10763492 3300025929 Bacteria 870
449 Ga0207644_10003366 3300025931 Bacteria 10319
450 Ga0207644_10146217 3300025931 Bacteria 1825
451 Ga0207644_10320917 3300025931 Bacteria 1252
452 Ga0207644_10341839 3300025931 Bacteria 1214
453 Ga0207706_10025737 3300025933 Bacteria 5271
454 Ga0207706_10041747 3300025933 Bacteria 4066
455 Ga0207706_10122599 3300025933 Bacteria 2286
456 Ga0207686_10458633 3300025934 Bacteria 982
457 Ga0207686_10538824 3300025934 Bacteria 911
458 Ga0207709_10097462 3300025935 Bacteria 1937
459 Ga0207709_10203501 3300025935 Bacteria 1416
460 Ga0207709_10385072 3300025935 Bacteria 1068
461 Ga0207669_10016439 3300025937 Bacteria 3759
462 Ga0207669_10282685 3300025937 Bacteria 1252
463 Ga0207669_10509800 3300025937 Bacteria 964
464 Ga0207704_10050647 3300025938 Bacteria 2506
465 Ga0207704_10110116 3300025938 Bacteria 1859
466 Ga0207665_10006088 3300025939 Bacteria 8010
467 Ga0207665_10051953 3300025939 Bacteria 2761
468 Ga0207665_10105835 3300025939 Bacteria 1970
469 Ga0207691_10250782 3300025940 Bacteria 1528
470 Ga0207691_10393549 3300025940 Bacteria 1182
471 Ga0207711_10051856 3300025941 Bacteria 3515
472 Ga0207711_10142028 3300025941 Bacteria 2161
473 Ga0207711_10228050 3300025941 Bacteria 1705
474 Ga0207711_10342004 3300025941 Bacteria 1385
475 Ga0207711_10469806 3300025941 Bacteria 1171
476 Ga0207711_10645336 3300025941 Bacteria 988
477 Ga0207689_10090792 3300025942 Bacteria 2510
478 Ga0207661_10015368 3300025944 Bacteria 5631
479 Ga0207661_10046265 3300025944 Bacteria 3450
480 Ga0207661_10133977 3300025944 Bacteria 2126
481 Ga0207661_10252434 3300025944 Bacteria 1568
482 Ga0207661_10465503 3300025944 Bacteria 1153
483 Ga0207679_10025142 3300025945 Bacteria 4091
484 Ga0207679_10135726 3300025945 Bacteria 1981
485 Ga0207667_10028504 3300025949 Bacteria 6065
486 Ga0207667_10035357 3300025949 Bacteria 5358
487 Ga0207667_10214574 3300025949 Bacteria 1972
488 Ga0207667_10301031 3300025949 Bacteria 1638
489 Ga0207712_10018591 3300025961 Bacteria 4529
490 Ga0207712_10133226 3300025961 Bacteria 1897
491 Ga0207668_10010329 3300025972 Bacteria 5640
492 Ga0207668_10168391 3300025972 Bacteria 1716
493 Ga0207668_10187725 3300025972 Bacteria 1635
494 Ga0207668_10250008 3300025972 Bacteria 1439
495 Ga0207668_10421057 3300025972 Bacteria 1133
496 Ga0207640_10019369 3300025981 Bacteria 4019
497 Ga0207640_10083385 3300025981 Bacteria 2192
498 Ga0207640_10154364 3300025981 Bacteria 1690
499 Ga0207640_10290088 3300025981 Bacteria 1289
500 Ga0207658_10005101 3300025986 Bacteria 9038
501 Ga0207658_10195858 3300025986 Bacteria 1683
502 Ga0207677_10016508 3300026023 Bacteria 4376
503 Ga0207677_10020036 3300026023 Bacteria 4052
504 Ga0207677_10176069 3300026023 Bacteria 1678
505 Ga0207703_10005161 3300026035 Bacteria 10559
506 Ga0207703_10038549 3300026035 Bacteria 3814
507 Ga0207703_10126277 3300026035 Bacteria 2203
508 Ga0207703_10383215 3300026035 Bacteria 1301
509 Ga0207703_10393579 3300026035 Bacteria 1284
510 Ga0207639_10018068 3300026041 Bacteria 5005
511 Ga0207639_10143951 3300026041 Bacteria 1989
512 Ga0207639_10276291 3300026041 Bacteria 1476
513 Ga0207639_10295736 3300026041 Bacteria 1429
514 Ga0207678_10016337 3300026067 Bacteria 6516
515 Ga0207678_10042750 3300026067 Bacteria 3923
516 Ga0207678_10047687 3300026067 Bacteria 3704
517 Ga0207678_10052503 3300026067 Bacteria 3517
518 Ga0207678_10065075 3300026067 Bacteria 3131
519 Ga0207678_10067421 3300026067 Bacteria 3072
520 Ga0207678_10100598 3300026067 Bacteria 2469
521 Ga0207678_10109202 3300026067 Bacteria 2360
522 Ga0207678_10117752 3300026067 Bacteria 2267
523 Ga0207678_10146534 3300026067 Bacteria 2015
524 Ga0207708_10036539 3300026075 Bacteria 3740
525 Ga0207708_10135686 3300026075 Bacteria 1927
526 Ga0207702_10000063 3300026078 Bacteria 123034
527 Ga0207702_10170198 3300026078 Bacteria 1997
528 Ga0207641_10013860 3300026088 Bacteria 6612
529 Ga0207641_10176114 3300026088 Bacteria 1956
530 Ga0207641_10190911 3300026088 Bacteria 1883
531 Ga0207648_10151356 3300026089 Bacteria 2047
532 Ga0207648_10206257 3300026089 Bacteria 1744
533 Ga0207676_10245751 3300026095 Bacteria 1608
534 Ga0207676_10289401 3300026095 Bacteria 1491
535 Ga0207674_10059593 3300026116 Bacteria 3862
536 Ga0207674_10114397 3300026116 Bacteria 2670
537 Ga0207675_100012672 3300026118 Bacteria 7879
538 Ga0207675_100025404 3300026118 Bacteria 5514
539 Ga0207675_100032142 3300026118 Bacteria 4889
540 Ga0207675_100066283 3300026118 Bacteria 3375
541 Ga0207683_10032945 3300026121 Bacteria 4501
542 Ga0207683_10085120 3300026121 Bacteria 2811
543 Ga0207683_10116271 3300026121 Bacteria 2398
544 Ga0207683_10185954 3300026121 Bacteria 1885
545 Ga0207683_10186623 3300026121 Bacteria 1881
546 Ga0207683_10500965 3300026121 Bacteria 1122
547 Ga0207698_10120617 3300026142 Bacteria 2218
548 Ga0207698_10179198 3300026142 Bacteria 1875
549 Ga0207698_10218427 3300026142 Bacteria 1721
550 Ga0207698_10351551 3300026142 Bacteria 1392
551 Ga0209389_1000012 3300027296 Bacteria 213243
552 Ga0209389_1000069 3300027296 Bacteria 98063
553 Ga0209589_1000015 3300027357 Bacteria 225913
554 Ga0209589_1000077 3300027357 Bacteria 98063
555 Ga0209489_100015 3300027361 Bacteria 225913
556 Ga0209489_100019 3300027361 Bacteria 213243
557 Ga0209489_100020 3300027361 Bacteria 207541
558 Ga0209700_100018 3300027363 Bacteria 238200
559 Ga0209700_100025 3300027363 Bacteria 225913
560 Ga0209179_1013181 3300027512 Bacteria 1498
561 Ga0209588_1063300 3300027671 Bacteria 1195
562 Ga0209588_1097525 3300027671 Bacteria 947
563 Ga0268266_10003191 3300028379 Bacteria 16594
564 Ga0268266_10003840 3300028379 Bacteria 14672
565 Ga0268266_10008431 3300028379 Bacteria 9163
566 Ga0268266_10021532 3300028379 Bacteria 5492
567 Ga0268266_10155256 3300028379 Bacteria 2066
568 Ga0268266_10189154 3300028379 Bacteria 1879
569 Ga0268266_10195048 3300028379 Bacteria 1850
570 Ga0268266_10206600 3300028379 Bacteria 1799
571 Ga0268266_10324120 3300028379 Bacteria 1443
572 Ga0268265_10086534 3300028380 Bacteria 2491
573 Ga0268265_10100388 3300028380 Bacteria 2336
574 Ga0268265_10364850 3300028380 Bacteria 1323
575 Ga0268264_10000356 3300028381 Bacteria 68810
576 Ga0268264_10012778 3300028381 Bacteria 6910
577 Ga0268264_10106078 3300028381 Bacteria 2452
578 Ga0268264_10127578 3300028381 Bacteria 2251
579 Ga0268264_10278330 3300028381 Bacteria 1566
580 Ga0268264_10340367 3300028381 Bacteria 1425
581 Ga0268264_10396310 3300028381 Bacteria 1325
582 Ga0268264_10427353 3300028381 Bacteria 1279
583 Ga0268264_10951132 3300028381 Bacteria 864
584 Ga0265319_1007649 3300028563 Bacteria 4826
585 Ga0265334_10003382 3300028573 Bacteria 7274
586 Ga0265323_10001977 3300028653 Bacteria 9666
587 Ga0265336_10000850 3300028666 Bacteria 15908
588 Ga0307517_10001423 3300028786 Bacteria 40213
589 Ga0307515_10032146 3300028794 Bacteria 8708
590 Ga0307515_10099632 3300028794 Bacteria 3526
591 Ga0307515_10201913 3300028794 Bacteria 1861
592 Ga0265338_10000417 3300028800 Bacteria 76249
593 Ga0307511_10000008 3300030521 Bacteria 159928
594 Ga0307511_10097728 3300030521 Bacteria 1948
595 Ga0307512_10237852 3300030522 Bacteria 926
596 Ga0316177_1163553 3300030731 Bacteria 1436
597 Ga0316176_1070980 3300030732 Bacteria 4800
598 Ga0314311_1086767 3300030733 Bacteria 5850
599 Ga0265330_10011339 3300031235 Bacteria 4183
600 Ga0265330_10026413 3300031235 Bacteria 2626
601 Ga0265330_10097528 3300031235 Bacteria 1259
602 Ga0265330_10110884 3300031235 Bacteria 1172
603 Ga0265325_10159179 3300031241 Bacteria 1063
604 Ga0265340_10034481 3300031247 Bacteria 2517
605 Ga0265339_10003359 3300031249 Bacteria 11199
606 Ga0265339_10191771 3300031249 Bacteria 1013
607 Ga0265331_10100097 3300031250 Bacteria 1335
608 Ga0307513_10065970 3300031456 Bacteria 3806
609 Ga0307509_10000099 3300031507 Bacteria 121307
610 Ga0307509_10009216 3300031507 Bacteria 12388
611 Ga0307508_10000012 3300031616 Bacteria 243167
612 Ga0307508_10013966 3300031616 Bacteria 7327
613 Ga0307508_10084322 3300031616 Bacteria 2759
614 Ga0307508_10109628 3300031616 Bacteria 2360
615 Ga0307508_10119140 3300031616 Bacteria 2242
616 Ga0307508_10159930 3300031616 Bacteria 1856
617 Ga0265314_10031058 3300031711 Bacteria 3948
618 Ga0265314_10035228 3300031711 Bacteria 3650
619 Ga0265342_10179250 3300031712 Bacteria 1161
620 Ga0307516_10005305 3300031730 Bacteria 15512
621 Ga0307516_10095915 3300031730 Bacteria 2787
622 Ga0307516_10196695 3300031730 Bacteria 1738
623 Ga0307516_10218548 3300031730 Bacteria 1616
624 Ga0307516_10268081 3300031730 Bacteria 1395
625 Ga0307516_10276953 3300031730 Bacteria 1361
626 Ga0307413_10069390 3300031824 Bacteria 2212
627 Ga0307406_10449450 3300031901 Bacteria 1033
628 Ga0307412_10131399 3300031911 Bacteria 1819
629 Ga0307409_100020833 3300031995 Bacteria 4480
630 Ga0307409_100021182 3300031995 Bacteria 4451
631 Ga0307416_100536160 3300032002 Bacteria 1241
632 Ga0307411_10152153 3300032005 Bacteria 1721
633 Ga0307411_10297099 3300032005 Bacteria 1293
634 Ga0307507_10018351 3300033179 Bacteria 7960
635 Ga0307510_10015377 3300033180 Bacteria 9047
636 Ga0307510_10023362 3300033180 Bacteria 7168
637 Ga0307510_10047751 3300033180 Bacteria 4580
638 Ga0307510_10104600 3300033180 Bacteria 2603
639 Ga0307510_10227563 3300033180 Bacteria 1370
640 Ga0315911_1000021 3300033442 Bacteria 124874
641 Ga0373930_0052116 3300034816 Bacteria 896
642 Ga0373929_0034705 3300035085 Bacteria 1095
643 Ga0373934_0088182 3300035086 Bacteria 1249
644 Ga0373944_0019917 3300035089 Bacteria 1929
645 Ga0373932_0033069 3300035112 Bacteria 1450
646 Ga0373936_0001098 3300035113 Bacteria 9698
647 Ga0373953_0001769 3300035117 Bacteria 6378
648 Ga0373953_0086399 3300035117 Bacteria 1309
649 Ga0373954_0001440 3300035118 Bacteria 9662
650 Ga0373954_0028874 3300035118 Bacteria 2552
651 Ga0373954_0037561 3300035118 Bacteria 2251
652 Ga0373956_0000376 3300035119 Bacteria 18268
653 Ga0373957_0099827 3300035120 Bacteria 1161
654 Ga0373943_0008191 3300035170 Bacteria 4691
655 Ga0373946_0003124 3300035171 Bacteria 5867
656 Ga0373946_0034331 3300035171 Bacteria 2048
657 Ga0373946_0057107 3300035171 Bacteria 1650
658 Ga0373955_0000325 3300035172 Bacteria 19823
659 Ga0373955_0011981 3300035172 Bacteria 4155
660 Ga0373924_0003814 3300035410 Bacteria 5215
661 Ga0373924_0004645 3300035410 Bacteria 4813
662 Ga0373931_0247935 3300035691 Bacteria 1082
663 Ga0373935_0009726 3300035692 Bacteria 5757
664 Ga0373935_0138447 3300035692 Bacteria 1642
665 Ga0373935_0256045 3300035692 Bacteria 1226
666 Ga0373927_0000137 3300035695 Bacteria 56546
667 Ga0373927_0005689 3300035695 Bacteria 8558
668 Ga0373927_0011599 3300035695 Bacteria 5869
669 Ga0373927_0034887 3300035695 Bacteria 3272
670 Ga0373927_0049382 3300035695 Bacteria 2720
671 Ga0373927_0151498 3300035695 Bacteria 1518
672 Ga0373927_0165713 3300035695 Bacteria 1448
673 Ga0373927_0240955 3300035695 Bacteria 1188
674 Ga0373933_0005894 3300035724 Bacteria 6664
675 Ga0373933_0050314 3300035724 Bacteria 2487
676 Ga0373947_0000902 3300035725 Bacteria 17985
677 Ga0373947_0010663 3300035725 Bacteria 5275
678 Ga0373947_0028351 3300035725 Bacteria 3282
679 Ga0373947_0102210 3300035725 Bacteria 1802
680 Ga0373937_0007855 3300036401 Bacteria 9247
681 Ga0373937_0035311 3300036401 Bacteria 4550
682 Ga0373925_0071767 3300037068 Bacteria 2619
683 Ga0373925_0104780 3300037068 Bacteria 2178
684 Ga0373925_0157515 3300037068 Bacteria 1787
685 Ga0395900_0001756 3300037418 Bacteria 24872
686 Ga0395900_0032032 3300037418 Bacteria 5405
687 Ga0395898_0014127 3300037466 Bacteria 8208
688 Ga0395898_0023431 3300037466 Bacteria 6239
689 Ga0395898_0174446 3300037466 Bacteria 2055
690 Ga0395905_0212851 3300037471 Bacteria 1810
691 Ga0436364_0036306 3300037853 Bacteria 8345
692 Ga0436364_0085858 3300037853 Bacteria 16249
693 Ga0436364_0455523 3300037853 Bacteria 1141
694 Ga0436364_1346733 3300037853 Bacteria 3002
695 Ga0395901_0004622 3300038443 Bacteria 13894
696 Ga0395901_0033726 3300038443 Bacteria 5286
697 Ga0395901_0191631 3300038443 Bacteria 2144
698 Ga0395901_0237445 3300038443 Bacteria 1902
699 Ga0395901_0348822 3300038443 Bacteria 1528
700 Ga0395901_0618935 3300038443 Bacteria 1090
701 Ga0400485_10823 3300038735 Bacteria 11344
702 Ga0400483_012731 3300039062 Bacteria 10321
703 Ga0400483_029660 3300039062 Bacteria 2936
704 Ga0400483_195596 3300039062 Bacteria 42851
705 Ga0400483_208463 3300039062 Bacteria 3175
706 Ga0400483_227670 3300039062 Bacteria 5938
707 Ga0400487_38375 3300039110 Bacteria 1028
708 Ga0400487_45671 3300039110 Bacteria 4917
709 Ga0436365_0291034 3300039437 Bacteria 3381
710 Ga0436365_0352699 3300039437 Bacteria 1365
711 Ga0436365_0592130 3300039437 Bacteria 8188
712 Ga0436365_0623836 3300039437 Bacteria 1124
713 Ga0436365_1451371 3300039437 Bacteria 1362
714 Ga0436365_1874811 3300039437 Bacteria 2098
715 Ga0436360_0560711 3300039438 Bacteria 1141
716 Ga0436360_0977178 3300039438 Bacteria 1126
717 Ga0436361_1185290 3300039447 Bacteria 1674
718 Ga0436361_1201280 3300039447 Bacteria 1731
719 Ga0436363_1489411 3300039450 Bacteria 1658
720 Ga0436362_0664428 3300039453 Bacteria 5651
721 Ga0436362_0913305 3300039453 Bacteria 992
722 Ga0451793_0643539 3300041452 Bacteria 1430
723 Ga0451837_0165624 3300041494 Bacteria 1097
724 Ga0451839_0993113 3300041496 Bacteria 1069
725 Ga0439464_0037956 3300042439 Bacteria 1368
726 Ga0439440_0035015 3300042993 Bacteria 1203
727 Ga0466969_0006671 3300044656 Bacteria 6135
728 Ga0466969_0023683 3300044656 Bacteria 3162
729 Ga0466972_0000100 3300044658 Bacteria 76018
730 Ga0466965_0000658 3300044683 Bacteria 12681
731 Ga0466965_0118215 3300044683 Bacteria 1367
732 Ga0466966_0001463 3300044684 Bacteria 15199
733 Ga0466966_0005774 3300044684 Bacteria 8152
734 Ga0466961_0000065 3300044693 Bacteria 63259
735 Ga0466961_0003171 3300044693 Bacteria 10239
736 Ga0466961_0207952 3300044693 Bacteria 1209
737 Ga0466963_0047566 3300044694 Bacteria 2831
738 Ga0466963_0057196 3300044694 Bacteria 2597
739 Ga0466964_0003697 3300044706 Bacteria 5601
740 Ga0466964_0058713 3300044706 Bacteria 1596
741 Ga0466971_0000087 3300044719 Bacteria 33674
742 Ga0466968_0015345 3300044735 Bacteria 3035
743 Ga0466968_0033584 3300044735 Bacteria 2138
744 Ga0466968_0054753 3300044735 Bacteria 1710
745 Ga0466970_0000283 3300044765 Bacteria 24806
746 Ga0466970_0028514 3300044765 Bacteria 2934
747 Ga0466960_0009188 3300044901 Bacteria 4069
748 Ga0466960_0021600 3300044901 Bacteria 2868
749 Ga0466960_0026907 3300044901 Bacteria 2617
750 Ga0466959_0000634 3300045049 Bacteria 20407
751 Ga0466959_0009459 3300045049 Bacteria 6934
752 Ga0466967_0090558 3300045976 Bacteria 2779
753 Ga0466967_0112086 3300045976 Bacteria 2508
754 Ga0466967_0118024 3300045976 Bacteria 2447
755 Ga0466967_0207709 3300045976 Bacteria 1856
756 Ga0466967_0265729 3300045976 Bacteria 1642
757 Ga0466967_0292030 3300045976 Bacteria 1566
758 Ga0495617_098735 3300046452 Bacteria 950
759 Ga0495627_094140 3300046453 Bacteria 860
760 Ga0495592_0000339 3300046454 Bacteria 38389
761 Ga0495592_0029318 3300046454 Bacteria 4168
762 Ga0495603_0004836 3300046455 Bacteria 8053
763 Ga0495603_0050828 3300046455 Bacteria 2464
764 Ga0495603_0052048 3300046455 Bacteria 2432
765 Ga0495603_0062548 3300046455 Bacteria 2197
766 Ga0495629_0000029 3300046459 Bacteria 127000
767 Ga0495629_0001483 3300046459 Bacteria 18494
768 Ga0495638_0014467 3300046460 Bacteria 5330
769 Ga0495638_0014620 3300046460 Bacteria 5296
770 Ga0495641_0003605 3300046461 Bacteria 11465
771 Ga0495641_0089774 3300046461 Bacteria 1373
772 Ga0495651_0015606 3300046462 Bacteria 5879
773 Ga0495651_0017638 3300046462 Bacteria 5524
774 Ga0495651_0068973 3300046462 Bacteria 2694
775 Ga0495651_0284642 3300046462 Bacteria 1115
776 Ga0495653_0001063 3300046463 Bacteria 21155
777 Ga0495653_0300266 3300046463 Bacteria 1048
778 Ga0495650_0092896 3300046471 Bacteria 1145
779 Ga0495580_0002567 3300046472 Bacteria 15791
780 Ga0495582_0000024 3300046473 Bacteria 82444
781 Ga0495582_0020290 3300046473 Bacteria 3637
782 Ga0495582_0214284 3300046473 Bacteria 1101
783 Ga0495639_0000006 3300046475 Bacteria 100361
784 Ga0495662_0000348 3300046476 Bacteria 20253
785 Ga0495662_0093023 3300046476 Bacteria 1471
786 Ga0495664_0016204 3300046477 Bacteria 4245
787 Ga0495664_0021231 3300046477 Bacteria 3751
788 Ga0495664_0105086 3300046477 Bacteria 1702
789 Ga0495664_0120714 3300046477 Bacteria 1585
790 Ga0495585_0074628 3300046492 Bacteria 1845
791 Ga0495594_0000170 3300046499 Bacteria 31295
792 Ga0495594_0036584 3300046499 Bacteria 2677
793 Ga0495594_0047390 3300046499 Bacteria 2360
794 Ga0495594_0056100 3300046499 Bacteria 2173
795 Ga0495596_0035810 3300046500 Bacteria 1967
796 Ga0495596_0058367 3300046500 Bacteria 1505
797 Ga0495583_0092267 3300046506 Bacteria 1302
798 Ga0495606_0011270 3300046507 Bacteria 7313
799 Ga0495606_0018835 3300046507 Bacteria 5163
800 Ga0495608_0002749 3300046511 Bacteria 12636
801 Ga0495608_0015906 3300046511 Bacteria 5207
802 Ga0495608_0148063 3300046511 Bacteria 1497
803 Ga0495610_0017796 3300046512 Bacteria 4041
804 Ga0495616_0099069 3300046513 Bacteria 1369
805 Ga0495616_0180773 3300046513 Bacteria 937
806 Ga0495618_0035917 3300046514 Bacteria 3110
807 Ga0495618_0170053 3300046514 Bacteria 1387
808 Ga0495618_0273196 3300046514 Bacteria 1056
809 Ga0495620_0014280 3300046515 Bacteria 4040
810 Ga0495628_0010789 3300046516 Bacteria 7737
811 Ga0495630_0022330 3300046517 Bacteria 4674
812 Ga0495630_0086064 3300046517 Bacteria 2373
813 Ga0495631_0010813 3300046518 Bacteria 4508
814 Ga0495632_0008791 3300046519 Bacteria 6154
815 Ga0495632_0042897 3300046519 Bacteria 2265
816 Ga0495632_0193414 3300046519 Bacteria 929
817 Ga0495632_0206320 3300046519 Bacteria 893
818 Ga0495643_0012456 3300046522 Bacteria 5131
819 Ga0495643_0053465 3300046522 Bacteria 2165
820 Ga0495648_0019042 3300046524 Bacteria 4841
821 Ga0495666_0053731 3300046526 Bacteria 1932
822 Ga0495652_0021359 3300046529 Bacteria 5757
823 Ga0495652_0025147 3300046529 Bacteria 5271
824 Ga0495652_0026600 3300046529 Bacteria 5108
825 Ga0495652_0196766 3300046529 Bacteria 1533
826 Ga0495665_0000178 3300046531 Bacteria 32333
827 Ga0495665_0053691 3300046531 Bacteria 2130
828 Ga0495640_0003797 3300046533 Bacteria 12127
829 Ga0495640_0004410 3300046533 Bacteria 11233
830 Ga0495640_0008433 3300046533 Bacteria 8084
831 Ga0495640_0052678 3300046533 Bacteria 2793
832 Ga0495586_0049167 3300046535 Bacteria 2280
833 Ga0495587_0010898 3300046536 Bacteria 5768
834 Ga0495587_0027904 3300046536 Bacteria 3437
835 Ga0495597_0193830 3300046542 Bacteria 816
836 Ga0495645_0004746 3300046543 Bacteria 9290
837 Ga0495645_0052929 3300046543 Bacteria 2952
838 Ga0495645_0060101 3300046543 Bacteria 2755
839 Ga0495622_0002996 3300046557 Bacteria 8018
840 Ga0495622_0010744 3300046557 Bacteria 4224
841 Ga0495622_0045801 3300046557 Bacteria 2032
842 Ga0495622_0052099 3300046557 Bacteria 1898
843 Ga0495622_0087406 3300046557 Bacteria 1433
844 Ga0495667_0003075 3300046559 Bacteria 11195
845 Ga0495667_0011132 3300046559 Bacteria 6087
846 Ga0495667_0053001 3300046559 Bacteria 2672
847 Ga0495656_0006097 3300046615 Bacteria 4206
848 Ga0495656_0023093 3300046615 Bacteria 2444
849 Ga0495656_0063045 3300046615 Bacteria 1623
850 Ga0495668_0034641 3300046616 Bacteria 2831
851 Ga0495668_0085454 3300046616 Bacteria 1730
852 Ga0495668_0103918 3300046616 Bacteria 1554
853 Ga0495668_0133489 3300046616 Bacteria 1359
854 Ga0495634_0000354 3300046642 Bacteria 44714
855 Ga0495634_0002330 3300046642 Bacteria 15886
856 Ga0495634_0057346 3300046642 Bacteria 2600
857 Ga0495611_0178543 3300046648 Bacteria 992
858 Ga0495625_0013541 3300046660 Bacteria 6544
859 Ga0495625_0169771 3300046660 Bacteria 1457
860 Ga0495635_0000917 3300046663 Bacteria 19365
861 Ga0495635_0002291 3300046663 Bacteria 13017
862 Ga0495635_0039894 3300046663 Bacteria 3247
863 Ga0495635_0056088 3300046663 Bacteria 2713
864 Ga0495661_0028715 3300046665 Bacteria 3557
865 Ga0495588_0009296 3300046674 Bacteria 4539
866 Ga0495588_0058730 3300046674 Bacteria 1988
867 Ga0495588_0193433 3300046674 Bacteria 1074
868 Ga0495657_0003543 3300046675 Bacteria 12725
869 Ga0495657_0005133 3300046675 Bacteria 10381
870 Ga0495657_0027263 3300046675 Bacteria 4034
871 Ga0495599_0001780 3300046678 Bacteria 12490
872 Ga0495599_0096712 3300046678 Bacteria 1841
873 Ga0495599_0127936 3300046678 Bacteria 1578
874 Ga0495599_0243513 3300046678 Bacteria 1096
875 Ga0495623_0058222 3300046679 Bacteria 2429
876 Ga0495623_0094099 3300046679 Bacteria 1833
877 Ga0495623_0144152 3300046679 Bacteria 1414
878 Ga0495623_0185421 3300046679 Bacteria 1206
879 Ga0495646_0025247 3300046680 Bacteria 3739
880 Ga0495646_0035304 3300046680 Bacteria 3102
881 Ga0495646_0066004 3300046680 Bacteria 2141
882 Ga0495646_0122095 3300046680 Bacteria 1473
883 Ga0495647_0000068 3300046681 Bacteria 25521
884 Ga0495658_0000428 3300046683 Bacteria 23516
885 Ga0495658_0045383 3300046683 Bacteria 2466
886 Ga0495658_0205755 3300046683 Bacteria 1228
887 Ga0495669_0043701 3300046684 Bacteria 1995
888 Ga0495613_0001078 3300046689 Bacteria 20808
889 Ga0495613_0012318 3300046689 Bacteria 6353
890 Ga0495613_0099574 3300046689 Bacteria 2100
891 Ga0495624_0011428 3300046690 Bacteria 6100
892 Ga0495624_0047038 3300046690 Bacteria 2742
893 Ga0495624_0091301 3300046690 Bacteria 1879
894 Ga0495624_0128678 3300046690 Bacteria 1553
895 Ga0495624_0323140 3300046690 Bacteria 929
896 Ga0495670_0019310 3300046691 Bacteria 3357
897 Ga0495670_0161433 3300046691 Bacteria 1177
898 Ga0495649_0072883 3300046694 Bacteria 1840
899 Ga0495600_0002741 3300046809 Bacteria 10203
900 Ga0495600_0030546 3300046809 Bacteria 3490
901 Ga0495600_0114802 3300046809 Bacteria 1753
902 Ga0495660_0146092 3300046810 Bacteria 1172
903 Ga0495581_0000004 3300047315 Bacteria 84424
904 Ga0495581_0040506 3300047315 Bacteria 2696
905 Ga0495581_0088840 3300047315 Bacteria 1792
906 Ga0495581_0093911 3300047315 Bacteria 1741
907 Ga0495604_0007541 3300047317 Bacteria 8607
908 Ga0495604_0007941 3300047317 Bacteria 8404
909 Ga0495604_0129611 3300047317 Bacteria 1814
910 Ga0495604_0188580 3300047317 Bacteria 1438
911 Ga0495674_0000415 3300047319 Bacteria 38235
912 Ga0495674_0007236 3300047319 Bacteria 10620
913 Ga0495674_0064759 3300047319 Bacteria 3177
914 Ga0495672_0014400 3300047320 Bacteria 5417
915 Ga0495672_0020725 3300047320 Bacteria 4302
916 Ga0495672_0062347 3300047320 Bacteria 2145
917 Ga0495676_0005426 3300047321 Bacteria 11697
918 Ga0495676_0014630 3300047321 Bacteria 7017
919 Ga0495680_0001065 3300047322 Bacteria 30372
920 Ga0495680_0001876 3300047322 Bacteria 22116
921 Ga0495687_003727 3300047443 Bacteria 10810
922 Ga0495687_021060 3300047443 Bacteria 3165
923 Ga0495675_0000901 3300047444 Bacteria 18140
924 Ga0495675_0120704 3300047444 Bacteria 1632
925 Ga0495681_0087897 3300047470 Bacteria 1377
926 Ga0495684_0000721 3300047471 Bacteria 26637
927 Ga0495684_0035951 3300047471 Bacteria 3798
928 Ga0495684_0071064 3300047471 Bacteria 2645
929 Ga0495686_0033638 3300047472 Bacteria 3308
930 Ga0495686_0098354 3300047472 Bacteria 1768
931 Ga0495686_0282812 3300047472 Bacteria 921
932 Ga0495593_0000198 3300047673 Bacteria 31587
933 Ga0495593_0003019 3300047673 Bacteria 10137
934 Ga0495593_0049151 3300047673 Bacteria 2239
935 Ga0495593_0152910 3300047673 Bacteria 1167
936 Ga0495593_0199560 3300047673 Bacteria 1005
937 Ga0495602_0029916 3300048088 Bacteria 5175
938 Ga0495602_0132190 3300048088 Bacteria 1988
939 Ga0495614_0007486 3300048089 Bacteria 4861
940 Ga0495626_0054347 3300048091 Bacteria 1839
941 Ga0496100_0096658 3300048903 Bacteria 2027
942 Ga0496100_0139213 3300048903 Bacteria 1718
943 Ga0496100_0277907 3300048903 Bacteria 1247
944 Ga0496101_0027879 3300048904 Bacteria 3939
945 Ga0496101_0077660 3300048904 Bacteria 2447
946 Ga0496101_0086032 3300048904 Bacteria 2331
947 Ga0496101_0110967 3300048904 Bacteria 2064
948 Ga0496101_0147933 3300048904 Bacteria 1795
949 Ga0496102_0012964 3300048905 Bacteria 7219
950 Ga0496102_0013853 3300048905 Bacteria 6997
951 Ga0496102_0124408 3300048905 Bacteria 2410
952 Ga0496102_0187334 3300048905 Bacteria 1950
953 Ga0496102_0542760 3300048905 Bacteria 1085
954 Ga0496102_0569556 3300048905 Bacteria 1055
955 Ga0496102_0649462 3300048905 Bacteria 978
956 Ga0496102_0694411 3300048905 Bacteria 941
957 Ga0496103_0175961 3300048906 Bacteria 1375
958 Ga0496104_0055427 3300048907 Bacteria 3748
959 Ga0496104_0231539 3300048907 Bacteria 1759
960 Ga0496104_0240597 3300048907 Bacteria 1722
961 Ga0496104_0329557 3300048907 Bacteria 1440
962 Ga0496105_0007733 3300048908 Bacteria 8340
963 Ga0496105_0173234 3300048908 Bacteria 1768
964 Ga0496105_0295595 3300048908 Bacteria 1303
965 Ga0496105_0355940 3300048908 Bacteria 1168
966 Ga0496106_0001953 3300048909 Bacteria 15491
967 Ga0496106_0008314 3300048909 Bacteria 7679
968 Ga0496106_0066768 3300048909 Bacteria 2741
969 Ga0496106_0191804 3300048909 Bacteria 1625
970 Ga0496106_0209800 3300048909 Bacteria 1551
971 Ga0496106_0432557 3300048909 Bacteria 1057
972 Ga0496107_0099178 3300048910 Bacteria 2134
973 Ga0496107_0127229 3300048910 Bacteria 1880
974 Ga0496107_0251629 3300048910 Bacteria 1314
975 Ga0496107_0325862 3300048910 Bacteria 1143
976 Ga0496108_0068160 3300048911 Bacteria 3001
977 Ga0496108_0265072 3300048911 Bacteria 1495
978 Ga0496109_0164822 3300048912 Bacteria 2077
979 Ga0496109_0224299 3300048912 Bacteria 1768
980 Ga0496109_0425431 3300048912 Bacteria 1254
981 Ga0496109_0434186 3300048912 Bacteria 1240
982 Ga0496110_0129377 3300048913 Bacteria 2279
983 Ga0496110_0196058 3300048913 Bacteria 1834
984 Ga0496110_0237240 3300048913 Bacteria 1659
985 Ga0496110_0347350 3300048913 Bacteria 1351
986 Ga0496111_0184293 3300048914 Bacteria 1552
987 Ga0496111_0349585 3300048914 Bacteria 1094
988 Ga0496111_0350091 3300048914 Bacteria 1093
989 Ga0496112_0053717 3300048915 Bacteria 3957
990 Ga0496112_0130672 3300048915 Bacteria 2482
991 Ga0496112_0246316 3300048915 Bacteria 1739
992 Ga0496112_0403057 3300048915 Bacteria 1307
993 Ga0496112_0540012 3300048915 Bacteria 1100
994 Ga0496113_0039173 3300048916 Bacteria 3487
995 Ga0496113_0092599 3300048916 Bacteria 2331
996 Ga0496113_0356131 3300048916 Bacteria 1174
997 Ga0496114_0038373 3300048917 Bacteria 3963
998 Ga0496114_0039555 3300048917 Bacteria 3902
999 Ga0496114_0559041 3300048917 Bacteria 1010
1000 Ga0496115_0004493 3300048918 Bacteria 10094
1001 Ga0496115_0138953 3300048918 Bacteria 2004
1002 Ga0496115_0221986 3300048918 Bacteria 1559
1003 Ga0496115_0222086 3300048918 Bacteria 1559
1004 Ga0496115_0246072 3300048918 Bacteria 1473
1005 Ga0496115_0338616 3300048918 Bacteria 1228
1006 Ga0496115_0341805 3300048918 Bacteria 1221
1007 Ga0496115_0602661 3300048918 Bacteria 873
1008 Ga0496116_0000965 3300048919 Bacteria 35491
1009 Ga0496116_0036633 3300048919 Bacteria 3430
1010 Ga0496117_0007318 3300048920 Bacteria 10829
1011 Ga0496117_0162653 3300048920 Bacteria 1305
1012 Ga0496117_0190332 3300048920 Bacteria 1169
1013 Ga0496117_0191841 3300048920 Bacteria 1163
1014 Ga0496118_0006555 3300048921 Bacteria 12729
1015 Ga0496118_0011084 3300048921 Bacteria 8847
1016 Ga0496118_0017995 3300048921 Bacteria 6401
1017 Ga0496118_0034317 3300048921 Bacteria 4142
1018 Ga0496118_0112628 3300048921 Bacteria 1800
1019 Ga0496118_0112699 3300048921 Bacteria 1799
1020 Ga0496119_0007397 3300048922 Bacteria 9903
1021 Ga0496120_0003365 3300048923 Bacteria 14668
1022 Ga0496121_0001622 3300048924 Bacteria 37285
1023 Ga0496121_0002148 3300048924 Bacteria 30905
1024 Ga0496121_0002744 3300048924 Bacteria 26189
1025 Ga0496121_0003594 3300048924 Bacteria 21886
1026 Ga0496121_0009316 3300048924 Bacteria 11324
1027 Ga0496121_0017077 3300048924 Bacteria 7442
1028 Ga0496121_0017170 3300048924 Bacteria 7411
1029 Ga0496121_0040869 3300048924 Bacteria 4062
1030 Ga0496121_0096011 3300048924 Bacteria 2302
1031 Ga0496121_0096605 3300048924 Bacteria 2292
1032 Ga0496121_0207124 3300048924 Bacteria 1392
1033 Ga0496121_0235293 3300048924 Bacteria 1280
1034 Ga0496121_0236725 3300048924 Bacteria 1275
1035 Ga0496121_0270186 3300048924 Bacteria 1169
1036 Ga0496122_0053150 3300048925 Bacteria 3057
1037 Ga0496122_0055559 3300048925 Bacteria 2961
1038 Ga0496122_0080386 3300048925 Bacteria 2273
1039 Ga0496122_0092401 3300048925 Bacteria 2057
1040 Ga0496122_0125553 3300048925 Bacteria 1643
1041 Ga0496123_0006724 3300048926 Bacteria 11061
1042 Ga0496123_0060320 3300048926 Bacteria 2447
1043 Ga0496123_0101821 3300048926 Bacteria 1669
1044 Ga0496124_0097640 3300048927 Bacteria 2385
1045 Ga0496124_0179578 3300048927 Bacteria 1630
1046 Ga0496125_0001356 3300048928 Bacteria 36075
1047 Ga0496125_0001441 3300048928 Bacteria 34581
1048 Ga0496125_0001630 3300048928 Bacteria 31638
1049 Ga0496125_0010481 3300048928 Bacteria 9373
1050 Ga0496125_0020105 3300048928 Bacteria 6277
1051 Ga0496125_0028550 3300048928 Bacteria 5036
1052 Ga0496125_0048905 3300048928 Bacteria 3520
1053 Ga0496125_0049622 3300048928 Bacteria 3485
1054 Ga0496125_0095013 3300048928 Bacteria 2219
1055 Ga0496125_0124008 3300048928 Bacteria 1835
1056 Ga0496125_0246448 3300048928 Bacteria 1130
1057 Ga0496126_0003472 3300048929 Bacteria 19892
1058 Ga0496126_0011331 3300048929 Bacteria 9244
1059 Ga0496126_0014638 3300048929 Bacteria 7918
1060 Ga0496126_0018186 3300048929 Bacteria 6973
1061 Ga0496126_0069916 3300048929 Bacteria 3129
1062 Ga0496126_0075361 3300048929 Bacteria 2994
1063 Ga0496126_0095956 3300048929 Bacteria 2600
1064 Ga0496126_0119755 3300048929 Bacteria 2284
1065 Ga0496126_0220702 3300048929 Bacteria 1592
1066 Ga0496126_0226612 3300048929 Bacteria 1567
1067 Ga0496126_0240298 3300048929 Bacteria 1513
1068 Ga0496126_0304957 3300048929 Bacteria 1312
1069 Ga0496126_0319545 3300048929 Bacteria 1276
1070 Ga0496126_0364791 3300048929 Bacteria 1179
1071 Ga0496126_0373353 3300048929 Bacteria 1162
1072 Ga0496126_0456643 3300048929 Bacteria 1027
1073 Ga0495678_044771 3300049459 Bacteria 1749
1074 Ga0495682_0054713 3300049460 Bacteria 1448
1075 Ga0495682_0075916 3300049460 Bacteria 1209
1076 Ga0501031_0001791 3300049568 Bacteria 13478
1077 Ga0501031_0093802 3300049568 Bacteria 1959
1078 Ga0501032_0000762 3300049569 Bacteria 26183
1079 Ga0501033_0000136 3300049570 Bacteria 70952
1080 Ga0501033_0049190 3300049570 Bacteria 3129
1081 Ga0501033_0072284 3300049570 Bacteria 2533
1082 Ga0501034_0000251 3300049571 Bacteria 99406
1083 Ga0501034_0408270 3300049571 Bacteria 1280
1084 Ga0501034_0711287 3300049571 Bacteria 902
1085 Ga0501036_0000036 3300049572 Bacteria 87244
1086 Ga0501036_0158394 3300049572 Bacteria 1909
1087 Ga0501036_0344008 3300049572 Bacteria 1246
1088 Ga0501038_0000428 3300049574 Bacteria 36623
1089 Ga0501038_0049185 3300049574 Bacteria 3646
1090 Ga0501039_0000273 3300049575 Bacteria 37431
1091 Ga0501041_0179609 3300049577 Bacteria 1325
1092 Ga0501042_0025922 3300049578 Bacteria 4120
1093 Ga0501042_0301952 3300049578 Bacteria 1157
1094 Ga0501043_0000165 3300049579 Bacteria 59980
1095 Ga0501043_0009206 3300049579 Bacteria 7761
1096 Ga0501046_0255598 3300049580 Bacteria 1288
1097 Ga0501047_0000340 3300049581 Bacteria 53278
1098 Ga0501047_0032110 3300049581 Bacteria 5067
1099 Ga0501047_0034136 3300049581 Bacteria 4912
1100 Ga0501047_0144948 3300049581 Bacteria 2252
1101 Ga0501047_0270209 3300049581 Bacteria 1546
1102 Ga0501048_0004509 3300049582 Bacteria 10606
1103 Ga0501048_0277354 3300049582 Bacteria 1192
1104 Ga0501067_0007630 3300049583 Bacteria 6013
1105 Ga0501067_0174516 3300049583 Bacteria 1197
1106 Ga0501067_0274302 3300049583 Bacteria 939
1107 Ga0501068_0003807 3300049584 Bacteria 8179
1108 Ga0501069_0007026 3300049585 Bacteria 5893
1109 Ga0501069_0156702 3300049585 Bacteria 1310
1110 Ga0501069_0213219 3300049585 Bacteria 1121
1111 Ga0501070_0006502 3300049586 Bacteria 9938
1112 Ga0501070_0072776 3300049586 Bacteria 2845
1113 Ga0501070_0510108 3300049586 Bacteria 965
1114 Ga0501071_0201631 3300049587 Bacteria 1494
1115 Ga0501071_0211399 3300049587 Bacteria 1459
1116 Ga0501072_0007916 3300049588 Bacteria 8069
1117 Ga0501073_0000037 3300049589 Bacteria 87345
1118 Ga0501074_0000167 3300049590 Bacteria 35108
1119 Ga0501074_0043432 3300049590 Bacteria 3253
1120 Ga0501074_0078814 3300049590 Bacteria 2364
1121 Ga0501077_0054761 3300049593 Bacteria 2533
1122 Ga0501079_0001057 3300049741 Bacteria 19118
1123 Ga0501079_0325178 3300049741 Bacteria 1204
1124 Ga0501079_0422650 3300049741 Bacteria 1046
1125 Ga0501080_0003259 3300049742 Bacteria 14325
1126 Ga0501080_0008505 3300049742 Bacteria 9306
1127 Ga0501080_0411127 3300049742 Bacteria 1216
1128 Ga0501083_0074634 3300049744 Bacteria 2252
1129 Ga0501035_0000142 3300049822 Bacteria 87561
1130 Ga0501035_0028360 3300049822 Bacteria 5111
1131 Ga0501035_0042364 3300049822 Bacteria 4106
1132 Ga0501035_0121416 3300049822 Bacteria 2283
1133 Ga0501035_0178683 3300049822 Bacteria 1829
1134 Ga0501044_0000414 3300049823 Bacteria 52784
1135 Ga0501044_0038934 3300049823 Bacteria 4964
1136 Ga0501044_0522934 3300049823 Bacteria 1086
1137 Ga0501045_0036286 3300049824 Bacteria 3579
1138 Ga0501045_0316604 3300049824 Bacteria 1161
1139 nmdc:mga00v17_354586_c1 3300050491 Bacteria 954
1140 nmdc:mga0yw44_18813_c1 3300050492 Bacteria 3793
1141 nmdc:mga0yw44_196694_c1 3300050492 Bacteria 1331
1142 nmdc:mga0yw44_31644_c1 3300050492 Bacteria 3078
1143 nmdc:mga0yw44_411967_c1 3300050492 Bacteria 914
1144 nmdc:mga0yw44_9428_c1 3300050492 Bacteria 4936
1145 nmdc:mga0k408_10213_c1 3300050493 Bacteria 5076
1146 nmdc:mga0k408_146316_c1 3300050493 Bacteria 1407
1147 nmdc:mga0k408_198567_c1 3300050493 Bacteria 1197
1148 nmdc:mga06z11_152149_c1 3300050494 Bacteria 1316
1149 nmdc:mga06z11_25604_c1 3300050494 Bacteria 2799
1150 nmdc:mga06z11_36801_c1 3300050494 Bacteria 2419
1151 nmdc:mga06z11_40099_c1 3300050494 Bacteria 2335
1152 nmdc:mga06z11_93465_c1 3300050494 Bacteria 1637
1153 nmdc:mga04h51_8477_c1 3300050495 Bacteria 2751
1154 nmdc:mga07m45_137705_c1 3300050496 Bacteria 1413
1155 nmdc:mga07m45_16268_c1 3300050496 Bacteria 3981
1156 nmdc:mga07m45_218_c2 3300050496 Bacteria 22025
1157 nmdc:mga07m45_26680_c1 3300050496 Bacteria 3176
1158 nmdc:mga07m45_4694_c2 3300050496 Bacteria 5936
1159 nmdc:mga07m45_96347_c1 3300050496 Bacteria 1698
1160 nmdc:mga06r32_285399_c1 3300050510 Bacteria 1637
1161 nmdc:mga0n895_581158_c1 3300050512 Bacteria 1124
1162 nmdc:mga0sz30_16997_c1 3300050516 Bacteria 2897
1163 nmdc:mga0sz30_7855_c1 3300050516 Bacteria 4013
1164 Ga0495612_0012967 3300053078 Bacteria 3358
1165 Ga0500635_0005652 3300053080 Bacteria 3296
1166 Ga0495655_0035400 3300053083 Bacteria 1242
1167 Ga0495655_0039638 3300053083 Bacteria 1195
1168 Ga0495595_0000828 3300053084 Bacteria 11843
1169 Ga0495619_0000912 3300053085 Bacteria 19381
1170 Ga0495619_0024324 3300053085 Bacteria 3884
1171 Ga0495619_0246216 3300053085 Bacteria 1239
1172 Ga0495619_0404713 3300053085 Bacteria 942
1173 Ga0500578_0106338 3300053086 Bacteria 1772
1174 Ga0500578_0163429 3300053086 Bacteria 1380
1175 Ga0500578_0226712 3300053086 Bacteria 1134
1176 Ga0500578_0235766 3300053086 Bacteria 1107
1177 Ga0500643_000048 3300053087 Bacteria 147879
1178 Ga0500643_011015 3300053087 Bacteria 3328
1179 Ga0500581_151129 3300053089 Bacteria 1089
1180 Ga0500647_0018699 3300053091 Bacteria 3212
1181 Ga0500651_0037353 3300053093 Bacteria 3060
1182 Ga0500651_0085355 3300053093 Bacteria 1951
1183 Ga0500651_0120744 3300053093 Bacteria 1591
1184 Ga0500566_0000223 3300053094 Bacteria 30380
1185 Ga0500566_0004965 3300053094 Bacteria 7920
1186 Ga0500566_0029885 3300053094 Bacteria 3181
1187 Ga0500566_0153432 3300053094 Bacteria 1208
1188 Ga0500641_0008158 3300053096 Bacteria 3733
1189 Ga0500641_0012056 3300053096 Bacteria 3150
1190 Ga0500641_0023712 3300053096 Bacteria 2362
1191 Ga0500641_0043402 3300053096 Bacteria 1825
1192 Ga0500650_0003714 3300053098 Bacteria 5373
1193 Ga0500554_007050 3300053102 Bacteria 2563
1194 Ga0500554_007778 3300053102 Bacteria 2483
1195 Ga0500556_0000003 3300053104 Bacteria 679379
1196 Ga0500557_000083 3300053105 Bacteria 32931
1197 Ga0500569_014315 3300053109 Bacteria 1961
1198 Ga0500569_055868 3300053109 Bacteria 1205
1199 Ga0500572_001233 3300053111 Bacteria 7208
1200 Ga0500572_004969 3300053111 Bacteria 3009
1201 Ga0500591_048865 3300053115 Bacteria 1988
1202 Ga0500592_001083 3300053116 Bacteria 4437
1203 Ga0500592_028662 3300053116 Bacteria 898
1204 Ga0500594_0054034 3300053118 Bacteria 1140
1205 Ga0500595_000333 3300053119 Bacteria 30925
1206 Ga0500595_005544 3300053119 Bacteria 5498
1207 Ga0500595_008879 3300053119 Bacteria 4084
1208 Ga0500595_012628 3300053119 Bacteria 3259
1209 Ga0500595_019981 3300053119 Bacteria 2419
1210 Ga0500595_029765 3300053119 Bacteria 1849
1211 Ga0500607_181636 3300053121 Bacteria 931
1212 Ga0500608_043820 3300053122 Bacteria 2148
1213 Ga0500608_110735 3300053122 Bacteria 1259
1214 Ga0500618_004999 3300053125 Bacteria 4101
1215 Ga0500618_036580 3300053125 Bacteria 1137
1216 Ga0500628_061835 3300053129 Bacteria 917
1217 Ga0500642_0000015 3300053130 Bacteria 181424
1218 Ga0500642_0000642 3300053130 Bacteria 10422
1219 Ga0500652_000665 3300053131 Bacteria 11648
1220 Ga0500559_0000230 3300053136 Bacteria 44504
1221 Ga0500559_0001714 3300053136 Bacteria 12043
1222 Ga0500559_0008650 3300053136 Bacteria 4450
1223 Ga0500559_0019501 3300053136 Bacteria 2865
1224 Ga0500559_0132321 3300053136 Bacteria 1165
1225 Ga0500568_0000536 3300053139 Bacteria 27978
1226 Ga0500568_0022102 3300053139 Bacteria 2728
1227 Ga0500573_0048795 3300053140 Bacteria 2436
1228 Ga0500577_0003157 3300053142 Bacteria 4266
1229 Ga0500577_0179364 3300053142 Bacteria 908
1230 Ga0500586_000256 3300053145 Bacteria 10561
1231 Ga0500588_0077051 3300053146 Bacteria 1107
1232 Ga0500588_0080561 3300053146 Bacteria 1088
1233 Ga0500589_089297 3300053147 Bacteria 1360
1234 Ga0500590_127074 3300053148 Bacteria 1185
1235 Ga0500590_155056 3300053148 Bacteria 1028
1236 Ga0500603_000178 3300053150 Bacteria 16265
1237 Ga0500603_003757 3300053150 Bacteria 3249
1238 Ga0500603_007176 3300053150 Bacteria 2442
1239 Ga0500603_066455 3300053150 Bacteria 1019
1240 Ga0500604_0002214 3300053151 Bacteria 5335
1241 Ga0500616_0000033 3300053153 Bacteria 398830
1242 Ga0500616_0064918 3300053153 Bacteria 1878
1243 Ga0500619_039253 3300053154 Bacteria 1487
1244 Ga0500620_025245 3300053155 Bacteria 1826
1245 Ga0500622_0005267 3300053156 Bacteria 7803
1246 Ga0500622_0132006 3300053156 Bacteria 1199
1247 Ga0500630_011681 3300053159 Bacteria 4326
1248 Ga0500633_0036030 3300053160 Bacteria 1633
1249 Ga0500638_007384 3300053162 Bacteria 4593
1250 Ga0500639_012544 3300053163 Bacteria 4450
1251 Ga0500639_047881 3300053163 Bacteria 2232
1252 Ga0500639_121973 3300053163 Bacteria 1250
1253 Ga0500636_0000148 3300053177 Bacteria 36338
1254 Ga0500636_0000686 3300053177 Bacteria 18167
1255 Ga0500636_0015443 3300053177 Bacteria 4500
1256 Ga0500636_0032865 3300053177 Bacteria 3071
1257 Ga0500636_0045245 3300053177 Bacteria 2596
1258 Ga0500637_0000060 3300053178 Bacteria 38881
1259 Ga0500637_0003041 3300053178 Bacteria 7626
1260 Ga0500637_0059295 3300053178 Bacteria 2190
1261 Ga0500611_061900 3300053727 Bacteria 889
1262 Ga0500625_007842 3300053729 Bacteria 4666
1263 Ga0500645_020418 3300053730 Bacteria 2054
1264 Ga0500645_028285 3300053730 Bacteria 1697
1265 Ga0500645_079363 3300053730 Bacteria 937
1266 Ga0500609_002230 3300053731 Bacteria 2766
1267 Ga0500596_004552 3300053735 Bacteria 2529
1268 Ga0500599_002662 3300053736 Bacteria 2155
1269 Ga0500601_000452 3300053737 Bacteria 6662
1270 Ga0500601_005123 3300053737 Bacteria 1432
1271 Ga0501084_0445364 3300054114 Bacteria 1095
1272 Ga0500661_025944 3300055283 Bacteria 1036
1273 Ga0501082_0002719 3300060353 Bacteria 15447
1274 Ga0501082_0197709 3300060353 Bacteria 1749
1275 Ga0466962_0000093 3300061719 Bacteria 35862
1276 Ga0466962_0112696 3300061719 Bacteria 1310
1277 Ga0466962_0173982 3300061719 Bacteria 1049
1278 Ga0530510_0051769 3300061734 Bacteria 2967
1279 2507505894 2507262055 Bacteria 8048963
1280 2508540085 2508501009 Bacteria 7784016
1281 2508696155 2508501042 Bacteria 8719808
1282 2509151554 2508501128 Bacteria 8613869
1283 2511396621 2511231028 Bacteria 8046582
1284 2513627468 2513237092 Bacteria 8341956
1285 2513638782 2513237094 Bacteria 8789602
1286 2513649868 2513237095 Bacteria 8976980
1287 2513659782 2513237096 Bacteria 8722461
1288 2513676893 2513237098 Bacteria 9902361
1289 2513694706 2513237101 Bacteria 7952346
1290 2513704353 2513237102 Bacteria 7703324
1291 2513715416 2513237104 Bacteria 10034502
1292 2513857243 2513237137 Bacteria 9558895
1293 2513877270 2513237139 Bacteria 8737671
1294 2513891635 2513237141 Bacteria 8496279
1295 2513918858 2513237145 Bacteria 8979722
1296 2514011243 2513237161 Bacteria 8871253
1297 2515631369 2515154112 Bacteria 8294334
1298 2517105693 2517093001 Bacteria 9002274
1299 2517888184 2517572143 Bacteria 9484767
1300 2524435437 2524023205 Bacteria 8918781
1301 2524468612 2524023210 Bacteria 9029266
1302 2524533359 2524023228 Bacteria 10118060
1303 2528855124 2528768022 Bacteria 10457665
1304 2603860084 2602042107 Bacteria 6226103
1305 2617347778 2617270735 Bacteria 9163226
1306 2617374506 2617270741 Bacteria 8201522
1307 2644290511 2643221651 Bacteria 4798932
1308 2671119357 2667528175 Bacteria 7532676
1309 2723842257 2721755755 Bacteria 8322773
1310 2728753841 2728368998 Bacteria 8720350
1311 2734973075 2734482000 Bacteria 5525167
1312 2745081399 2744054633 Bacteria 8678936
1313 2793061566 2791355196 Bacteria 7323613
1314 2793073862 2791355197 Bacteria 8420563
1315 2793077973
1316 2805916130 2802429603 Bacteria 8777136
1317 2816503849 2816332139 Bacteria 9138787
1318 2818240868 2816332527 Bacteria 8933356
1319 2824605527 2824600985 Bacteria 8488197
1320 2824610825 2824609381 Bacteria 8672835
1321 2824619360 2824617872 Bacteria 8814715
1322 2824627815 2824626560 Bacteria 8813858
1323 2824641893 2824635225 Bacteria 8785348
1324 2824651583 2824644064 Bacteria 8743947
1325 2824653877 2824653114 Bacteria 8493680
1326 2824663770 2824661429 Bacteria 9877870
1327 2824676110 2824671348 Bacteria 8369588
1328 2824680225 2824679649 Bacteria 8248951
1329 2824692463 2824687955 Bacteria 8360029
1330 2824699886 2824696289 Bacteria 8335049
1331 2824706068 2824704595 Bacteria 9667483
1332 2824720085 2824714736 Bacteria 8717648
1333 2824729447 2824723954 Bacteria 8758240
1334 2824736156 2824732956 Bacteria 7810675
1335 2824748032 2824746037 Bacteria 7911610
1336 2824760299 2824753945 Bacteria 9787441
1337 2824771538 2824763712 Bacteria 9792355
1338 2824775742 2824773399 Bacteria 8360218
1339 2838125115 2838122688 Bacteria 8803140
1340 2841945853 2841941048 Bacteria 8688029
1341 2841956820 2841949485 Bacteria 8680857
1342 2841965304 2841957949 Bacteria 8652217
1343 2841973336 2841966195 Bacteria 8673214
1344 2841979500 2841974524 Bacteria 8931498
1345 2841989375 2841983080 Bacteria 8395090
1346 2842044366 2842038055 Bacteria 8002051
1347 2842051645 2842045827 Bacteria 8006841
1348 2844321486 2844315083 Bacteria 8138177
1349 2847939470 2847930680 Bacteria 9342022
1350 2847941219 2847939898 Bacteria 8606328
1351 2849082211 2849076700 Bacteria 7039503
1352 2857513314 2857509624 Bacteria 7472071
1353 2874596368 2874590934 Bacteria 8299676
1354 2874610154 2874604998 Bacteria 7834745
1355 2874620219 2874612657 Bacteria 8252029
1356 2874633340 2874628541 Bacteria 8630250
1357 2874650356 2874645413 Bacteria 8214782
1358 2876761693 2876761206 Bacteria 10111113
1359 2876776833 2876771140 Bacteria 8287509
1360 2876815708 2876808645 Bacteria 8824342
1361 2876824623 2876818435 Bacteria 8274608
1362 2879080970 2879074833 Bacteria 8279565
1363 2879091088 2879083081 Bacteria 8587928
1364 2879106652 2879099564 Bacteria 10442239
1365 2879117030 2879110137 Bacteria 8907982
1366 2879128201 2879127579 Bacteria 8294491
1367 2879143556 2879142872 Bacteria 8267021
1368 2881369630 2881364244 Bacteria 7710352
1369 2881670153 2881665667 Bacteria 8175609
1370 2885367720 2885366525 Bacteria 8326213
1371 2885392255 2885383462 Bacteria 9473874
1372 2885418261 2885409591 Bacteria 9235467
1373 2888387741 2888378607 Bacteria 9652610
1374 2888389960 2888388044 Bacteria 7304136
1375 2888421140 2888419890 Bacteria 7857137
1376 2889036373 2889033259 Bacteria 9099371
1377 2893069654 2893066018 Bacteria 6158120
1378 2903727935 2903727486 Bacteria 8281579
1379 2903754035 2903748898 Bacteria 9972761
1380 2903776665 2903768456 Bacteria 9749579
1381 2904695757 2904690495 Bacteria 9412302
1382 2904710018
1383 2904718095 2904711408 Bacteria 9771557
1384 2906602581 2906602504 Bacteria 8295279
1385 2906614459
1386 2906629721 2906626472 Bacteria 8826946
1387 2906643418 2906635258 Bacteria 8601019
1388 2906651663 2906643746 Bacteria 8722424
1389 2906666610 2906660503 Bacteria 8595048
1390 2908746711 2908739725 Bacteria 8628932
1391 2908764273 2908756301 Bacteria 8864324
1392 2908776985 2908775508 Bacteria 8092255
1393 2919078955 2919073203 Bacteria 6531949
1394 2922366744 2922361189 Bacteria 7436256
1395 2922377446
1396 2922389353 2922386360 Bacteria 7017218
1397 2922393379 2922393267 Bacteria 8285685
1398 2922426293
1399 2929622238 2929615660 Bacteria 9193770
1400 2929630115 2929624759 Bacteria 9339455
1401 2932787952 2932784394 Bacteria 9704911
1402 2932799514 2932794094 Bacteria 7915132
1403 2932805180 2932801729 Bacteria 7987968
1404 2932813327 2932809354 Bacteria 9135765
1405 2932820024 2932818245 Bacteria 9955613
1406 2932832912 2932828146 Bacteria 9745859
1407 2933584148 2933577622 Bacteria 9116884
1408 2935614318 2935608549 Bacteria 8203142
1409 2935620397 2935616580 Bacteria 9032984
1410 2935632678 2935630451 Bacteria 8169952
1411 2935640721 2935638405 Bacteria 10015038
1412 2935649346 2935648319 Bacteria 8801166
1413 2935657882 2935656913 Bacteria 8965014
1414 2935668913 2935665750 Bacteria 9571747
1415 2935681361 2935675223 Bacteria 9928132
1416 2935687222 2935684952 Bacteria 9590419
1417 2935696807 2935694250 Bacteria 9291695
1418 2935709101 2935703347 Bacteria 10242284
1419 2935716910 2935713505 Bacteria 9608509
1420 2935722965 2935722832 Bacteria 9608746
1421 2935734522 2935732158 Bacteria 9706831
1422 2935744687 2935741537 Bacteria 9707219
1423 2935753188 2935750917 Bacteria 9590372
1424 2935767592 2935760218 Bacteria 9817913
1425 2935770186 2935769743 Bacteria 7878163
1426 2935777784 2935777560 Bacteria 8077691
1427 2935786760 2935785616 Bacteria 7962367
1428 2935794814 2935793552 Bacteria 8012592
1429 2935804831 2935801545 Bacteria 9301974
1430 2935815980 2935810662 Bacteria 9401221
1431 2935826536 2935819856 Bacteria 8261050
1432 2935832228 2935827899 Bacteria 10038562
1433 2935840942 2935837841 Bacteria 9454360
1434 2935851170 2935847175 Bacteria 8228321
1435 2935859283 2935855204 Bacteria 9035059
1436 2935864467 2935864058 Bacteria 9784707
1437 2935875181 2935873716 Bacteria 9632195
1438 2935887730 2935883170 Bacteria 7964738
1439 2935913219 2935908558 Bacteria 8568796
1440 2935922641 2935916978 Bacteria 9113783
1441 2935930856 2935926038 Bacteria 8601059
1442 2935939810 2935934488 Bacteria 8602579
1443 2935946759 2935942939 Bacteria 8599779
1444 2935956040 2935951376 Bacteria 8602333
1445 2935963880 2935959822 Bacteria 7869783
1446 2935972833 2935967501 Bacteria 8603075
1447 2935978250 2935975950 Bacteria 8347125
1448 2935985622 2935984226 Bacteria 8302647
1449 2935995844 2935992306 Bacteria 9802711
1450 2936005755 2936002035 Bacteria 9362176
1451 2936012101 2936011229 Bacteria 8801034
1452 2936020818 2936019824 Bacteria 8804134
1453 2936029394 2936028420 Bacteria 8965941
1454 2936041883 2936037263 Bacteria 9446081
1455 2936048282 2936046547 Bacteria 8903709
1456 2936056607 2936055302 Bacteria 8785755
1457 2940559101 2940556831 Bacteria 9590747
1458 2941508658 2941507105 Bacteria 8166816
1459 2941516488 2941515067 Bacteria 8166720
1460 2941524496 2941523033 Bacteria 8169134
1461 2941532066 2941531003 Bacteria 7653939
1462 2941541796 2941538514 Bacteria 9402094
1463 3003669727 3003665799 Bacteria 7279786
1464 3005475657 3005474847 Bacteria 9259049
1465 3005485842 3005483717 Bacteria 7877331
1466 3005510883 3005506211 Bacteria 6943378
1467 3005588832 3005587118 Bacteria 7794411
1468 3005601852 3005594810 Bacteria 8716512
1469 3005717591 3005710791 Bacteria 7622528
1470 3005724639 3005718088 Bacteria 8283608
1471 3006430886 3006425503 Bacteria 6491253
1472 8002779950 8002775197 Bacteria 10728764
1473 8002784702 8002784119 Bacteria 9788632
1474 8006932294 8006926726 Bacteria 6749210
1475 8006936997 8006933436 Bacteria 10410654
1476 8006966342 8006964411 Bacteria 8966052
1477 8006976962 8006973647 Bacteria 10679141
1478 8006993168 8006984368 Bacteria 9651211
1479 8006997007 8006994254 Bacteria 8309700
1480 8016526943 8016522445 Bacteria 8156687
1481 8016532028 8016530956 Bacteria 8155261
1482 8016545237 8016539877 Bacteria 8155419
1483 8016556851 8016548790 Bacteria 8155074
1484 8016565204 8016557553 Bacteria 8154380
1485 8016582863 8016575299 Bacteria 8154085
1486 8016585431 8016583857 Bacteria 10421953
1487 8016602847 8016595262 Bacteria 8149947
1488 8016605717 8016603502 Bacteria 8731218
1489 8016617624 8016613128 Bacteria 8794220
1490 8016623945 8016622563 Bacteria 7999408
1491 8016634920 8016630954 Bacteria 9217207
1492 8017059306 8017057580 Bacteria 10023680
1493 8019539685 8019538911 Bacteria 7872763
1494 8019550963 8019547302 Bacteria 7996444
1495 8019571754 8019565922 Bacteria 9639779
1496 8019576323 8019576017 Bacteria 10049540
1497 8019594195 8019586578 Bacteria 10212056
1498 8019607367 8019597564 Bacteria 10041141
1499 8019621995 8019619141 Bacteria 9218857
1500 8019631326 8019629233 Bacteria 8687553
1501 8019651713 8019648815 Bacteria 10014479
1502 8019668131 8019659431 Bacteria 8577854
1503 8019677597 8019668869 Bacteria 8791617
1504 8019687351 8019678201 Bacteria 8863603
1505 8019693328 8019687851 Bacteria 8712826
1506 8054478238 8054472261 Bacteria 7464355
1507 8055743513 8055742211 Bacteria 9226248
1508 8056678193 8056673599 Bacteria 7871253
1509 8056683415 8056681323 Bacteria 8472857
1510 8056692720 8056689827 Bacteria 6712655
1511 8056975362 8056967851 Bacteria 9038162
1512 Ga0501044_0025287
1513 JGI24745J21846_1004091
1514 JGI25406J46586_10000233
1515 JGI25406J46586_10008961
1516 JGI25153J46596_10003608
1517 JGI25153J46596_10009022
1518 JGI25404J52841_10011727
1519 JGI25404J52841_10017283
1520 JGI25404J52841_10018580
1521 JGI25404J52841_10036834
1522 Ga0055526_1047315
1523 Ga0055531_10013194
1524 Ga0065165_1000917
1525 Ga0065165_1001167
1526 Ga0065165_1009512
1527 Ga0070658_10071314
1528 Ga0070683_100254628
1529 Ga0070690_100164312
1530 Ga0068869_100117529
1531 Ga0068869_100130742
1532 Ga0068869_100138140
1533 Ga0070680_100102455
1534 Ga0070682_100067954
1535 Ga0070682_100242437
1536 Ga0068868_100009208
1537 Ga0068868_100133580
1538 Ga0068868_100140904
1539 Ga0070660_100015341
1540 Ga0070660_100299709
1541 Ga0070660_100309943
1542 Ga0070689_100134832
1543 Ga0070687_100221156
1544 Ga0070687_100304947
1545 Ga0070661_100047378
1546 Ga0070661_100058873
1547 Ga0070661_100138016
1548 Ga0070661_100342318
1549 Ga0070668_100009536
1550 Ga0070668_100013042
1551 Ga0070668_100066141
1552 Ga0070668_100230649
1553 Ga0070668_100292199
1554 Ga0070669_100163838
1555 Ga0070669_100224392
1556 Ga0070675_100193255
1557 Ga0070671_100000724
1558 Ga0070671_100107752
1559 Ga0070671_100138626
1560 Ga0070671_100677286
1561 Ga0070674_100052855
1562 Ga0070674_100261447
1563 Ga0070674_100296307
1564 Ga0070673_100224362
1565 Ga0070688_100044579
1566 Ga0070659_100148271
1567 Ga0070667_100004331
1568 Ga0070667_100213017
1569 Ga0070667_100269039
1570 Ga0070709_10001520
1571 Ga0070709_10008885
1572 Ga0070709_10173983
1573 Ga0070714_100005907
1574 Ga0070713_100021890
1575 Ga0070713_100040858
1576 Ga0070713_100086571
1577 Ga0070713_100108114
1578 Ga0070713_100133311
1579 Ga0070713_100156609
1580 Ga0070710_10000733
1581 Ga0070710_10014290
1582 Ga0070711_100005326
1583 Ga0070711_100040962
1584 Ga0070700_100456363
1585 Ga0070663_100039057
1586 Ga0070663_100058403
1587 Ga0070663_100061649
1588 Ga0070663_100113203
1589 Ga0070663_100135351
1590 Ga0070678_100024391
1591 Ga0070678_100115610
1592 Ga0070678_100356183
1593 Ga0070662_100048334
1594 Ga0070662_100193379
1595 Ga0070681_10131987
1596 Ga0070681_10258667
1597 Ga0070681_10272242
1598 Ga0068867_100209521
1599 Ga0068867_100287432
1600 Ga0068867_100501042
1601 Ga0070685_10222031
1602 Ga0070706_100000883
1603 Ga0070706_100338949
1604 Ga0070707_100048206
1605 Ga0070707_100216052
1606 Ga0070699_100224891
1607 Ga0070679_100080757
1608 Ga0070679_100086434
1609 Ga0070679_100289996
1610 Ga0070684_100089394
1611 Ga0070684_100495287
1612 Ga0070684_100612305
1613 Ga0070697_100096466
1614 Ga0068853_100037982
1615 Ga0068853_100208559
1616 Ga0068853_100316150
1617 Ga0068853_100477708
1618 Ga0068853_100521167
1619 Ga0068853_100560881
1620 Ga0068853_100604343
1621 Ga0070672_100177991
1622 Ga0070672_100216984
1623 Ga0070686_100068407
1624 Ga0070695_100096384
1625 Ga0070665_100004629
1626 Ga0070665_100071360
1627 Ga0070665_100105979
1628 Ga0070665_100144937
1629 Ga0070665_100237677
1630 Ga0068855_100031922
1631 Ga0068855_100069511
1632 Ga0068855_100096541
1633 Ga0068855_100245511
1634 Ga0070664_100011717
1635 Ga0070664_100108843
1636 Ga0070664_100285667
1637 Ga0070664_100483156
1638 Ga0068857_100026204
1639 Ga0068856_100000137
1640 Ga0070702_100118817
1641 Ga0068852_100026206
1642 Ga0068852_100067797
1643 Ga0068852_100144994
1644 Ga0068859_100001570
1645 Ga0068859_100780237
1646 Ga0068859_100870272
1647 Ga0068864_100106901
1648 Ga0068864_100294206
1649 Ga0068864_100406660
1650 Ga0068866_10035306
1651 Ga0068861_100029805
1652 Ga0068861_100189556
1653 Ga0068861_100675561
1654 Ga0068851_10011436
1655 Ga0068863_100001523
1656 Ga0068858_100011790
1657 Ga0068858_100057344
1658 Ga0068858_100252659
1659 Ga0068858_100381416
1660 Ga0068858_100458870
1661 Ga0068860_100068880
1662 Ga0068860_100191436
1663 Ga0068860_100316896
1664 Ga0068860_100451721
1665 Ga0068860_100553496
1666 Ga0068862_100064935
1667 Ga0068862_100417409
1668 Ga0068862_100489571
1669 Ga0068862_100617334
1670 Ga0081455_10011235
1671 Ga0081455_10056109
1672 Ga0081455_10080519
1673 Ga0081455_10281684
1674 Ga0081455_10307771
1675 Ga0081540_1005656
1676 Ga0081540_1005657
1677 Ga0081540_1010321
1678 Ga0081540_1016160
1679 Ga0081540_1021999
1680 Ga0081540_1026512
1681 Ga0081540_1046497
1682 Ga0081540_1077757
1683 Ga0081539_10000157
1684 Ga0081539_10002599
1685 Ga0081539_10037110
1686 Ga0070717_10001671
1687 Ga0070717_10011582
1688 Ga0070717_10111271
1689 Ga0070717_10149083
1690 Ga0070717_10273426
1691 Ga0070717_10363074
1692 Ga0070717_10678534
1693 Ga0075365_10017395
1694 Ga0075365_10055725
1695 Ga0075365_10059683
1696 Ga0075365_10141939
1697 Ga0075365_10159603
1698 Ga0075365_10195741
1699 Ga0075365_10210341
1700 Ga0075365_10334329
1701 Ga0075368_10073538
1702 Ga0075368_10084711
1703 Ga0075363_100002704
1704 Ga0075364_10066567
1705 Ga0070715_10055748
1706 Ga0070716_100101944
1707 Ga0070716_100176294
1708 Ga0070716_100423302
1709 Ga0070712_100002371
1710 Ga0070712_100031659
1711 Ga0070712_100101145
1712 Ga0070712_100104477
1713 Ga0075362_10006634
1714 Ga0075362_10150161
1715 Ga0075367_10005584
1716 Ga0075367_10021332
1717 Ga0075367_10089027
1718 Ga0075367_10198769
1719 Ga0075369_10004189
1720 Ga0075366_10022772
1721 Ga0075366_10046580
1722 Ga0075366_10101831
1723 Ga0097621_100191123
1724 Ga0097621_100222425
1725 Ga0097621_100290259
1726 Ga0075370_10001262
1727 Ga0075370_10011785
1728 Ga0075370_10024269
1729 Ga0075370_10040385
1730 Ga0075370_10066034
1731 Ga0075370_10095321
1732 Ga0075370_10118423
1733 Ga0068871_100100889
1734 Ga0068871_100589620
1735 Ga0068871_100685960
1736 Ga0075428_100403065
1737 Ga0075430_100102784
1738 Ga0075431_100085325
1739 Ga0068865_100008510
1740 Ga0068865_100146318
1741 Ga0068865_100350766
1742 Ga0097620_100001570
1743 Ga0097620_100462275
1744 Ga0097620_100780186
1745 Ga0097620_100870290
1746 Ga0099824_1008303
1747 Ga0099824_1010623
1748 Ga0099824_1040894
1749 Ga0099822_1000541
1750 Ga0099823_1031325
1751 Ga0099794_10183679
1752 Ga0099794_10251862
1753 Ga0099795_10065592
1754 Ga0105240_10013303
1755 Ga0105240_10033754
1756 Ga0105240_10127891
1757 Ga0105240_10181246
1758 Ga0105240_10328790
1759 Ga0105245_10042563
1760 Ga0105245_10063488
1761 Ga0105245_10080927
1762 Ga0105245_10190761
1763 Ga0105245_10247879
1764 Ga0105245_10344362
1765 Ga0105245_10478747
1766 Ga0105247_10002542
1767 Ga0105247_10016513
1768 Ga0105247_10102046
1769 Ga0105243_10089266
1770 Ga0105243_10118066
1771 Ga0105243_10120396
1772 Ga0105243_10686139
1773 Ga0105241_10004267
1774 Ga0105241_10024156
1775 Ga0105241_10036215
1776 Ga0105241_10112289
1777 Ga0105242_10338156
1778 Ga0105248_10028678
1779 Ga0105248_10199684
1780 Ga0105248_10292444
1781 Ga0105248_10586646
1782 Ga0105248_10789923
1783 Ga0105237_10017841
1784 Ga0105237_10020621
1785 Ga0105237_10031465
1786 Ga0105237_10037178
1787 Ga0105237_10087362
1788 Ga0105237_10167091
1789 Ga0105238_10047527
1790 Ga0105238_10074353
1791 Ga0105238_10267009
1792 Ga0105238_10418198
1793 Ga0105249_10008304
1794 Ga0105249_10072592
1795 Ga0105249_10191467
1796 Ga0105239_10072795
1797 Ga0105239_10103015
1798 Ga0105239_10149272
1799 Ga0105239_10150802
1800 Ga0105239_10245039
1801 Ga0105239_10245702
1802 Ga0105239_10250953
1803 Ga0105239_10289119
1804 Ga0105246_10049380
1805 Ga0105246_10179239
1806 Ga0157373_10032613
1807 Ga0157370_10057357
1808 Ga0157370_10091066
1809 Ga0157370_10648161
1810 Ga0157369_10026988
1811 Ga0157369_10060406
1812 Ga0157369_10095007
1813 Ga0157369_10185643
1814 Ga0157374_10043641
1815 Ga0157378_10001192
1816 Ga0157378_10128040
1817 Ga0163162_10218914
1818 Ga0163162_10328957
1819 Ga0163162_10731118
1820 Ga0157372_10132541
1821 Ga0157372_10206646
1822 Ga0157375_10512151
1823 Ga0157375_10602449
1824 Ga0163163_10010769
1825 Ga0163163_10022075
1826 Ga0163163_10194424
1827 Ga0163163_10214083
1828 Ga0163163_10558072
1829 Ga0163163_10790756
1830 Ga0157380_10048748
1831 Ga0157379_10011061
1832 Ga0157379_10095785
1833 Ga0157379_10347339
1834 Ga0157379_10420007
1835 Ga0157376_10193426
1836 Ga0157376_10197979
1837 Ga0157376_10257277
1838 Ga0163161_10159037
1839 Ga0163161_10292901
1840 Ga0206356_11062778
1841 Ga0214544_1000003
1842 Ga0214542_1000022
1843 Ga0214545_1000010
1844 Ga0214543_1000035
1845 Ga0214543_1026336
1846 Ga0213872_10088623
1847 Ga0213872_10149365
1848 Ga0213876_10157517
1849 Ga0213876_10174453
1850 Ga0213876_10226170
1851 Ga0213876_10240098
1852 Ga0209563_101110
1853 Ga0207425_1011267
1854 Ga0209677_100492
1855 Ga0209148_1000267
1856 Ga0209233_1001537
1857 Ga0209233_1005715
1858 Ga0209233_1040548
1859 Ga0209455_1001652
1860 Ga0209455_1004190
1861 Ga0209455_1007509
1862 Ga0209455_1020432
1863 Ga0209455_1026659
1864 Ga0209673_1021954
1865 Ga0209564_1000718
1866 Ga0209564_1005249
1867 Ga0209564_1017988
1868 Ga0209564_1029571
1869 Ga0209758_1000015
1870 Ga0209758_1000711
1871 Ga0209758_1000764
1872 Ga0209758_1001094
1873 Ga0209758_1001468
1874 Ga0209758_1004096
1875 Ga0209758_1007765
1876 Ga0209758_1022547
1877 Ga0209758_1023868
1878 Ga0209758_1070097
1879 Ga0209256_1010978
1880 Ga0207426_1000368
1881 Ga0207426_1005258
1882 Ga0207426_1027512
1883 Ga0209257_1001688
1884 Ga0207697_10127423
1885 Ga0207656_10047799
1886 Ga0207682_10154530
1887 Ga0207692_10015137
1888 Ga0207710_10000305
1889 Ga0207710_10132214
1890 Ga0207710_10156719
1891 Ga0207688_10052449
1892 Ga0207680_10021686
1893 Ga0207680_10335105
1894 Ga0207647_10012006
1895 Ga0207685_10077861
1896 Ga0207699_10001435
1897 Ga0207699_10006921
1898 Ga0207699_10084385
1899 Ga0207699_10136617
1900 Ga0207643_10002999
1901 Ga0207643_10020167
1902 Ga0207705_10018984
1903 Ga0207705_10247007
1904 Ga0207684_10013348
1905 Ga0207684_10175591
1906 Ga0207654_10007028
1907 Ga0207654_10014303
1908 Ga0207654_10051760
1909 Ga0207707_10000143
1910 Ga0207707_10000613
1911 Ga0207707_10022062
1912 Ga0207707_10514969
1913 Ga0207695_10000059
1914 Ga0207695_10288667
1915 Ga0207695_10490047
1916 Ga0207671_10069543
1917 Ga0207671_10096887
1918 Ga0207671_10101351
1919 Ga0207671_10116272
1920 Ga0207671_10140250
1921 Ga0207671_10382098
1922 Ga0207671_10479721
1923 Ga0207693_10031785
1924 Ga0207693_10053203
1925 Ga0207693_10056172
1926 Ga0207693_10075584
1927 Ga0207693_10269291
1928 Ga0207663_10010613
1929 Ga0207663_10025244
1930 Ga0207660_10015097
1931 Ga0207660_10046492
1932 Ga0207660_10126351
1933 Ga0207662_10089318
1934 Ga0207657_10006552
1935 Ga0207657_10021660
1936 Ga0207657_10065923
1937 Ga0207657_10118716
1938 Ga0207657_10272645
1939 Ga0207649_10047973
1940 Ga0207649_10099291
1941 Ga0207652_10023997
1942 Ga0207652_10029772
1943 Ga0207652_10080629
1944 Ga0207646_10075813
1945 Ga0207646_10158675
1946 Ga0207694_10017116
1947 Ga0207694_10097981
1948 Ga0207694_10321432
1949 Ga0207659_10214897
1950 Ga0207687_10039513
1951 Ga0207687_10096868
1952 Ga0207687_10121735
1953 Ga0207700_10007542
1954 Ga0207700_10052862
1955 Ga0207700_10062576
1956 Ga0207700_10108631
1957 Ga0207700_10140200
1958 Ga0207664_10006581
1959 Ga0207664_10763492
1960 Ga0207644_10003366
1961 Ga0207644_10146217
1962 Ga0207644_10320917
1963 Ga0207644_10341839
1964 Ga0207706_10025737
1965 Ga0207706_10041747
1966 Ga0207706_10122599
1967 Ga0207686_10458633
1968 Ga0207686_10538824
1969 Ga0207709_10097462
1970 Ga0207709_10203501
1971 Ga0207709_10385072
1972 Ga0207669_10016439
1973 Ga0207669_10282685
1974 Ga0207669_10509800
1975 Ga0207704_10050647
1976 Ga0207704_10110116
1977 Ga0207665_10006088
1978 Ga0207665_10051953
1979 Ga0207665_10105835
1980 Ga0207691_10250782
1981 Ga0207691_10393549
1982 Ga0207711_10051856
1983 Ga0207711_10142028
1984 Ga0207711_10228050
1985 Ga0207711_10342004
1986 Ga0207711_10469806
1987 Ga0207711_10645336
1988 Ga0207689_10090792
1989 Ga0207661_10015368
1990 Ga0207661_10046265
1991 Ga0207661_10133977
1992 Ga0207661_10252434
1993 Ga0207661_10465503
1994 Ga0207679_10025142
1995 Ga0207679_10135726
1996 Ga0207667_10028504
1997 Ga0207667_10035357
1998 Ga0207667_10214574
1999 Ga0207667_10301031
2000 Ga0207712_10018591
2001 Ga0207712_10133226
2002 Ga0207668_10010329
2003 Ga0207668_10168391
2004 Ga0207668_10187725
2005 Ga0207668_10250008
2006 Ga0207668_10421057
2007 Ga0207640_10019369
2008 Ga0207640_10083385
2009 Ga0207640_10154364
2010 Ga0207640_10290088
2011 Ga0207658_10005101
2012 Ga0207658_10195858
2013 Ga0207677_10016508
2014 Ga0207677_10020036
2015 Ga0207677_10176069
2016 Ga0207703_10005161
2017 Ga0207703_10038549
2018 Ga0207703_10126277
2019 Ga0207703_10383215
2020 Ga0207703_10393579
2021 Ga0207639_10018068
2022 Ga0207639_10143951
2023 Ga0207639_10276291
2024 Ga0207639_10295736
2025 Ga0207678_10016337
2026 Ga0207678_10042750
2027 Ga0207678_10047687
2028 Ga0207678_10052503
2029 Ga0207678_10065075
2030 Ga0207678_10067421
2031 Ga0207678_10100598
2032 Ga0207678_10109202
2033 Ga0207678_10117752
2034 Ga0207678_10146534
2035 Ga0207708_10036539
2036 Ga0207708_10135686
2037 Ga0207702_10000063
2038 Ga0207702_10170198
2039 Ga0207641_10013860
2040 Ga0207641_10176114
2041 Ga0207641_10190911
2042 Ga0207648_10151356
2043 Ga0207648_10206257
2044 Ga0207676_10245751
2045 Ga0207676_10289401
2046 Ga0207674_10059593
2047 Ga0207674_10114397
2048 Ga0207675_100012672
2049 Ga0207675_100025404
2050 Ga0207675_100032142
2051 Ga0207675_100066283
2052 Ga0207683_10032945
2053 Ga0207683_10085120
2054 Ga0207683_10116271
2055 Ga0207683_10185954
2056 Ga0207683_10186623
2057 Ga0207683_10500965
2058 Ga0207698_10120617
2059 Ga0207698_10179198
2060 Ga0207698_10218427
2061 Ga0207698_10351551
2062 Ga0209389_1000012
2063 Ga0209389_1000069
2064 Ga0209589_1000015
2065 Ga0209589_1000077
2066 Ga0209489_100015
2067 Ga0209489_100019
2068 Ga0209489_100020
2069 Ga0209700_100018
2070 Ga0209700_100025
2071 Ga0209179_1013181
2072 Ga0209588_1063300
2073 Ga0209588_1097525
2074 Ga0268266_10003191
2075 Ga0268266_10003840
2076 Ga0268266_10008431
2077 Ga0268266_10021532
2078 Ga0268266_10155256
2079 Ga0268266_10189154
2080 Ga0268266_10195048
2081 Ga0268266_10206600
2082 Ga0268266_10324120
2083 Ga0268265_10086534
2084 Ga0268265_10100388
2085 Ga0268265_10364850
2086 Ga0268264_10000356
2087 Ga0268264_10012778
2088 Ga0268264_10106078
2089 Ga0268264_10127578
2090 Ga0268264_10278330
2091 Ga0268264_10340367
2092 Ga0268264_10396310
2093 Ga0268264_10427353
2094 Ga0268264_10951132
2095 Ga0265319_1007649
2096 Ga0265334_10003382
2097 Ga0265323_10001977
2098 Ga0265336_10000850
2099 Ga0307517_10001423
2100 Ga0307515_10032146
2101 Ga0307515_10099632
2102 Ga0307515_10201913
2103 Ga0265338_10000417
2104 Ga0307511_10000008
2105 Ga0307511_10097728
2106 Ga0307512_10237852
2107 Ga0316177_1163553
2108 Ga0316176_1070980
2109 Ga0314311_1086767
2110 Ga0265330_10011339
2111 Ga0265330_10026413
2112 Ga0265330_10097528
2113 Ga0265330_10110884
2114 Ga0265325_10159179
2115 Ga0265340_10034481
2116 Ga0265339_10003359
2117 Ga0265339_10191771
2118 Ga0265331_10100097
2119 Ga0307513_10065970
2120 Ga0307509_10000099
2121 Ga0307509_10009216
2122 Ga0307508_10000012
2123 Ga0307508_10013966
2124 Ga0307508_10084322
2125 Ga0307508_10109628
2126 Ga0307508_10119140
2127 Ga0307508_10159930
2128 Ga0265314_10031058
2129 Ga0265314_10035228
2130 Ga0265342_10179250
2131 Ga0307516_10005305
2132 Ga0307516_10095915
2133 Ga0307516_10196695
2134 Ga0307516_10218548
2135 Ga0307516_10268081
2136 Ga0307516_10276953
2137 Ga0307413_10069390
2138 Ga0307406_10449450
2139 Ga0307412_10131399
2140 Ga0307409_100020833
2141 Ga0307409_100021182
2142 Ga0307416_100536160
2143 Ga0307411_10152153
2144 Ga0307411_10297099
2145 Ga0307507_10018351
2146 Ga0307510_10015377
2147 Ga0307510_10023362
2148 Ga0307510_10047751
2149 Ga0307510_10104600
2150 Ga0307510_10227563
2151 Ga0315911_1000021
2152 Ga0373930_0052116
2153 Ga0373929_0034705
2154 Ga0373934_0088182
2155 Ga0373944_0019917
2156 Ga0373932_0033069
2157 Ga0373936_0001098
2158 Ga0373953_0001769
2159 Ga0373953_0086399
2160 Ga0373954_0001440
2161 Ga0373954_0028874
2162 Ga0373954_0037561
2163 Ga0373956_0000376
2164 Ga0373957_0099827
2165 Ga0373943_0008191
2166 Ga0373946_0003124
2167 Ga0373946_0034331
2168 Ga0373946_0057107
2169 Ga0373955_0000325
2170 Ga0373955_0011981
2171 Ga0373924_0003814
2172 Ga0373924_0004645
2173 Ga0373931_0247935
2174 Ga0373935_0009726
2175 Ga0373935_0138447
2176 Ga0373935_0256045
2177 Ga0373927_0000137
2178 Ga0373927_0005689
2179 Ga0373927_0011599
2180 Ga0373927_0034887
2181 Ga0373927_0049382
2182 Ga0373927_0151498
2183 Ga0373927_0165713
2184 Ga0373927_0240955
2185 Ga0373933_0005894
2186 Ga0373933_0050314
2187 Ga0373947_0000902
2188 Ga0373947_0010663
2189 Ga0373947_0028351
2190 Ga0373947_0102210
2191 Ga0373937_0007855
2192 Ga0373937_0035311
2193 Ga0373925_0071767
2194 Ga0373925_0104780
2195 Ga0373925_0157515
2196 Ga0395900_0001756
2197 Ga0395900_0032032
2198 Ga0395898_0014127
2199 Ga0395898_0023431
2200 Ga0395898_0174446
2201 Ga0395905_0212851
2202 Ga0436364_0036306
2203 Ga0436364_0085858
2204 Ga0436364_0455523
2205 Ga0436364_1346733
2206 Ga0395901_0004622
2207 Ga0395901_0033726
2208 Ga0395901_0191631
2209 Ga0395901_0237445
2210 Ga0395901_0348822
2211 Ga0395901_0618935
2212 Ga0400485_10823
2213 Ga0400483_012731
2214 Ga0400483_029660
2215 Ga0400483_195596
2216 Ga0400483_208463
2217 Ga0400483_227670
2218 Ga0400487_38375
2219 Ga0400487_45671
2220 Ga0436365_0291034
2221 Ga0436365_0352699
2222 Ga0436365_0592130
2223 Ga0436365_0623836
2224 Ga0436365_1451371
2225 Ga0436365_1874811
2226 Ga0436360_0560711
2227 Ga0436360_0977178
2228 Ga0436361_1185290
2229 Ga0436361_1201280
2230 Ga0436363_1489411
2231 Ga0436362_0664428
2232 Ga0436362_0913305
2233 Ga0451793_0643539
2234 Ga0451837_0165624
2235 Ga0451839_0993113
2236 Ga0439464_0037956
2237 Ga0439440_0035015
2238 Ga0466969_0006671
2239 Ga0466969_0023683
2240 Ga0466972_0000100
2241 Ga0466965_0000658
2242 Ga0466965_0118215
2243 Ga0466966_0001463
2244 Ga0466966_0005774
2245 Ga0466961_0000065
2246 Ga0466961_0003171
2247 Ga0466961_0207952
2248 Ga0466963_0047566
2249 Ga0466963_0057196
2250 Ga0466964_0003697
2251 Ga0466964_0058713
2252 Ga0466971_0000087
2253 Ga0466968_0015345
2254 Ga0466968_0033584
2255 Ga0466968_0054753
2256 Ga0466970_0000283
2257 Ga0466970_0028514
2258 Ga0466960_0009188
2259 Ga0466960_0021600
2260 Ga0466960_0026907
2261 Ga0466959_0000634
2262 Ga0466959_0009459
2263 Ga0466967_0090558
2264 Ga0466967_0112086
2265 Ga0466967_0118024
2266 Ga0466967_0207709
2267 Ga0466967_0265729
2268 Ga0466967_0292030
2269 Ga0495617_098735
2270 Ga0495627_094140
2271 Ga0495592_0000339
2272 Ga0495592_0029318
2273 Ga0495603_0004836
2274 Ga0495603_0050828
2275 Ga0495603_0052048
2276 Ga0495603_0062548
2277 Ga0495629_0000029
2278 Ga0495629_0001483
2279 Ga0495638_0014467
2280 Ga0495638_0014620
2281 Ga0495641_0003605
2282 Ga0495641_0089774
2283 Ga0495651_0015606
2284 Ga0495651_0017638
2285 Ga0495651_0068973
2286 Ga0495651_0284642
2287 Ga0495653_0001063
2288 Ga0495653_0300266
2289 Ga0495650_0092896
2290 Ga0495580_0002567
2291 Ga0495582_0000024
2292 Ga0495582_0020290
2293 Ga0495582_0214284
2294 Ga0495639_0000006
2295 Ga0495662_0000348
2296 Ga0495662_0093023
2297 Ga0495664_0016204
2298 Ga0495664_0021231
2299 Ga0495664_0105086
2300 Ga0495664_0120714
2301 Ga0495585_0074628
2302 Ga0495594_0000170
2303 Ga0495594_0036584
2304 Ga0495594_0047390
2305 Ga0495594_0056100
2306 Ga0495596_0035810
2307 Ga0495596_0058367
2308 Ga0495583_0092267
2309 Ga0495606_0011270
2310 Ga0495606_0018835
2311 Ga0495608_0002749
2312 Ga0495608_0015906
2313 Ga0495608_0148063
2314 Ga0495610_0017796
2315 Ga0495616_0099069
2316 Ga0495616_0180773
2317 Ga0495618_0035917
2318 Ga0495618_0170053
2319 Ga0495618_0273196
2320 Ga0495620_0014280
2321 Ga0495628_0010789
2322 Ga0495630_0022330
2323 Ga0495630_0086064
2324 Ga0495631_0010813
2325 Ga0495632_0008791
2326 Ga0495632_0042897
2327 Ga0495632_0193414
2328 Ga0495632_0206320
2329 Ga0495643_0012456
2330 Ga0495643_0053465
2331 Ga0495648_0019042
2332 Ga0495666_0053731
2333 Ga0495652_0021359
2334 Ga0495652_0025147
2335 Ga0495652_0026600
2336 Ga0495652_0196766
2337 Ga0495665_0000178
2338 Ga0495665_0053691
2339 Ga0495640_0003797
2340 Ga0495640_0004410
2341 Ga0495640_0008433
2342 Ga0495640_0052678
2343 Ga0495586_0049167
2344 Ga0495587_0010898
2345 Ga0495587_0027904
2346 Ga0495597_0193830
2347 Ga0495645_0004746
2348 Ga0495645_0052929
2349 Ga0495645_0060101
2350 Ga0495622_0002996
2351 Ga0495622_0010744
2352 Ga0495622_0045801
2353 Ga0495622_0052099
2354 Ga0495622_0087406
2355 Ga0495667_0003075
2356 Ga0495667_0011132
2357 Ga0495667_0053001
2358 Ga0495656_0006097
2359 Ga0495656_0023093
2360 Ga0495656_0063045
2361 Ga0495668_0034641
2362 Ga0495668_0085454
2363 Ga0495668_0103918
2364 Ga0495668_0133489
2365 Ga0495634_0000354
2366 Ga0495634_0002330
2367 Ga0495634_0057346
2368 Ga0495611_0178543
2369 Ga0495625_0013541
2370 Ga0495625_0169771
2371 Ga0495635_0000917
2372 Ga0495635_0002291
2373 Ga0495635_0039894
2374 Ga0495635_0056088
2375 Ga0495661_0028715
2376 Ga0495588_0009296
2377 Ga0495588_0058730
2378 Ga0495588_0193433
2379 Ga0495657_0003543
2380 Ga0495657_0005133
2381 Ga0495657_0027263
2382 Ga0495599_0001780
2383 Ga0495599_0096712
2384 Ga0495599_0127936
2385 Ga0495599_0243513
2386 Ga0495623_0058222
2387 Ga0495623_0094099
2388 Ga0495623_0144152
2389 Ga0495623_0185421
2390 Ga0495646_0025247
2391 Ga0495646_0035304
2392 Ga0495646_0066004
2393 Ga0495646_0122095
2394 Ga0495647_0000068
2395 Ga0495658_0000428
2396 Ga0495658_0045383
2397 Ga0495658_0205755
2398 Ga0495669_0043701
2399 Ga0495613_0001078
2400 Ga0495613_0012318
2401 Ga0495613_0099574
2402 Ga0495624_0011428
2403 Ga0495624_0047038
2404 Ga0495624_0091301
2405 Ga0495624_0128678
2406 Ga0495624_0323140
2407 Ga0495670_0019310
2408 Ga0495670_0161433
2409 Ga0495649_0072883
2410 Ga0495600_0002741
2411 Ga0495600_0030546
2412 Ga0495600_0114802
2413 Ga0495660_0146092
2414 Ga0495581_0000004
2415 Ga0495581_0040506
2416 Ga0495581_0088840
2417 Ga0495581_0093911
2418 Ga0495604_0007541
2419 Ga0495604_0007941
2420 Ga0495604_0129611
2421 Ga0495604_0188580
2422 Ga0495674_0000415
2423 Ga0495674_0007236
2424 Ga0495674_0064759
2425 Ga0495672_0014400
2426 Ga0495672_0020725
2427 Ga0495672_0062347
2428 Ga0495676_0005426
2429 Ga0495676_0014630
2430 Ga0495680_0001065
2431 Ga0495680_0001876
2432 Ga0495687_003727
2433 Ga0495687_021060
2434 Ga0495675_0000901
2435 Ga0495675_0120704
2436 Ga0495681_0087897
2437 Ga0495684_0000721
2438 Ga0495684_0035951
2439 Ga0495684_0071064
2440 Ga0495686_0033638
2441 Ga0495686_0098354
2442 Ga0495686_0282812
2443 Ga0495593_0000198
2444 Ga0495593_0003019
2445 Ga0495593_0049151
2446 Ga0495593_0152910
2447 Ga0495593_0199560
2448 Ga0495602_0029916
2449 Ga0495602_0132190
2450 Ga0495614_0007486
2451 Ga0495626_0054347
2452 Ga0496100_0096658
2453 Ga0496100_0139213
2454 Ga0496100_0277907
2455 Ga0496101_0027879
2456 Ga0496101_0077660
2457 Ga0496101_0086032
2458 Ga0496101_0110967
2459 Ga0496101_0147933
2460 Ga0496102_0012964
2461 Ga0496102_0013853
2462 Ga0496102_0124408
2463 Ga0496102_0187334
2464 Ga0496102_0542760
2465 Ga0496102_0569556
2466 Ga0496102_0649462
2467 Ga0496102_0694411
2468 Ga0496103_0175961
2469 Ga0496104_0055427
2470 Ga0496104_0231539
2471 Ga0496104_0240597
2472 Ga0496104_0329557
2473 Ga0496105_0007733
2474 Ga0496105_0173234
2475 Ga0496105_0295595
2476 Ga0496105_0355940
2477 Ga0496106_0001953
2478 Ga0496106_0008314
2479 Ga0496106_0066768
2480 Ga0496106_0191804
2481 Ga0496106_0209800
2482 Ga0496106_0432557
2483 Ga0496107_0099178
2484 Ga0496107_0127229
2485 Ga0496107_0251629
2486 Ga0496107_0325862
2487 Ga0496108_0068160
2488 Ga0496108_0265072
2489 Ga0496109_0164822
2490 Ga0496109_0224299
2491 Ga0496109_0425431
2492 Ga0496109_0434186
2493 Ga0496110_0129377
2494 Ga0496110_0196058
2495 Ga0496110_0237240
2496 Ga0496110_0347350
2497 Ga0496111_0184293
2498 Ga0496111_0349585
2499 Ga0496111_0350091
2500 Ga0496112_0053717
2501 Ga0496112_0130672
2502 Ga0496112_0246316
2503 Ga0496112_0403057
2504 Ga0496112_0540012
2505 Ga0496113_0039173
2506 Ga0496113_0092599
2507 Ga0496113_0356131
2508 Ga0496114_0038373
2509 Ga0496114_0039555
2510 Ga0496114_0559041
2511 Ga0496115_0004493
2512 Ga0496115_0138953
2513 Ga0496115_0221986
2514 Ga0496115_0222086
2515 Ga0496115_0246072
2516 Ga0496115_0338616
2517 Ga0496115_0341805
2518 Ga0496115_0602661
2519 Ga0496116_0000965
2520 Ga0496116_0036633
2521 Ga0496117_0007318
2522 Ga0496117_0162653
2523 Ga0496117_0190332
2524 Ga0496117_0191841
2525 Ga0496118_0006555
2526 Ga0496118_0011084
2527 Ga0496118_0017995
2528 Ga0496118_0034317
2529 Ga0496118_0112628
2530 Ga0496118_0112699
2531 Ga0496119_0007397
2532 Ga0496120_0003365
2533 Ga0496121_0001622
2534 Ga0496121_0002148
2535 Ga0496121_0002744
2536 Ga0496121_0003594
2537 Ga0496121_0009316
2538 Ga0496121_0017077
2539 Ga0496121_0017170
2540 Ga0496121_0040869
2541 Ga0496121_0096011
2542 Ga0496121_0096605
2543 Ga0496121_0207124
2544 Ga0496121_0235293
2545 Ga0496121_0236725
2546 Ga0496121_0270186
2547 Ga0496122_0053150
2548 Ga0496122_0055559
2549 Ga0496122_0080386
2550 Ga0496122_0092401
2551 Ga0496122_0125553
2552 Ga0496123_0006724
2553 Ga0496123_0060320
2554 Ga0496123_0101821
2555 Ga0496124_0097640
2556 Ga0496124_0179578
2557 Ga0496125_0001356
2558 Ga0496125_0001441
2559 Ga0496125_0001630
2560 Ga0496125_0010481
2561 Ga0496125_0020105
2562 Ga0496125_0028550
2563 Ga0496125_0048905
2564 Ga0496125_0049622
2565 Ga0496125_0095013
2566 Ga0496125_0124008
2567 Ga0496125_0246448
2568 Ga0496126_0003472
2569 Ga0496126_0011331
2570 Ga0496126_0014638
2571 Ga0496126_0018186
2572 Ga0496126_0069916
2573 Ga0496126_0075361
2574 Ga0496126_0095956
2575 Ga0496126_0119755
2576 Ga0496126_0220702
2577 Ga0496126_0226612
2578 Ga0496126_0240298
2579 Ga0496126_0304957
2580 Ga0496126_0319545
2581 Ga0496126_0364791
2582 Ga0496126_0373353
2583 Ga0496126_0456643
2584 Ga0495678_044771
2585 Ga0495682_0054713
2586 Ga0495682_0075916
2587 Ga0501031_0001791
2588 Ga0501031_0093802
2589 Ga0501032_0000762
2590 Ga0501033_0000136
2591 Ga0501033_0049190
2592 Ga0501033_0072284
2593 Ga0501034_0000251
2594 Ga0501034_0408270
2595 Ga0501034_0711287
2596 Ga0501036_0000036
2597 Ga0501036_0158394
2598 Ga0501036_0344008
2599 Ga0501038_0000428
2600 Ga0501038_0049185
2601 Ga0501039_0000273
2602 Ga0501041_0179609
2603 Ga0501042_0025922
2604 Ga0501042_0301952
2605 Ga0501043_0000165
2606 Ga0501043_0009206
2607 Ga0501046_0255598
2608 Ga0501047_0000340
2609 Ga0501047_0032110
2610 Ga0501047_0034136
2611 Ga0501047_0144948
2612 Ga0501047_0270209
2613 Ga0501048_0004509
2614 Ga0501048_0277354
2615 Ga0501067_0007630
2616 Ga0501067_0174516
2617 Ga0501067_0274302
2618 Ga0501068_0003807
2619 Ga0501069_0007026
2620 Ga0501069_0156702
2621 Ga0501069_0213219
2622 Ga0501070_0006502
2623 Ga0501070_0072776
2624 Ga0501070_0510108
2625 Ga0501071_0201631
2626 Ga0501071_0211399
2627 Ga0501072_0007916
2628 Ga0501073_0000037
2629 Ga0501074_0000167
2630 Ga0501074_0043432
2631 Ga0501074_0078814
2632 Ga0501077_0054761
2633 Ga0501079_0001057
2634 Ga0501079_0325178
2635 Ga0501079_0422650
2636 Ga0501080_0003259
2637 Ga0501080_0008505
2638 Ga0501080_0411127
2639 Ga0501083_0074634
2640 Ga0501035_0000142
2641 Ga0501035_0028360
2642 Ga0501035_0042364
2643 Ga0501035_0121416
2644 Ga0501035_0178683
2645 Ga0501044_0000414
2646 Ga0501044_0038934
2647 Ga0501044_0522934
2648 Ga0501045_0036286
2649 Ga0501045_0316604
2650 nmdc:mga00v17_354586_c1
2651 nmdc:mga0yw44_18813_c1
2652 nmdc:mga0yw44_196694_c1
2653 nmdc:mga0yw44_31644_c1
2654 nmdc:mga0yw44_411967_c1
2655 nmdc:mga0yw44_9428_c1
2656 nmdc:mga0k408_10213_c1
2657 nmdc:mga0k408_146316_c1
2658 nmdc:mga0k408_198567_c1
2659 nmdc:mga06z11_152149_c1
2660 nmdc:mga06z11_25604_c1
2661 nmdc:mga06z11_36801_c1
2662 nmdc:mga06z11_40099_c1
2663 nmdc:mga06z11_93465_c1
2664 nmdc:mga04h51_8477_c1
2665 nmdc:mga07m45_137705_c1
2666 nmdc:mga07m45_16268_c1
2667 nmdc:mga07m45_218_c2
2668 nmdc:mga07m45_26680_c1
2669 nmdc:mga07m45_4694_c2
2670 nmdc:mga07m45_96347_c1
2671 nmdc:mga06r32_285399_c1
2672 nmdc:mga0n895_581158_c1
2673 nmdc:mga0sz30_16997_c1
2674 nmdc:mga0sz30_7855_c1
2675 Ga0495612_0012967
2676 Ga0500635_0005652
2677 Ga0495655_0035400
2678 Ga0495655_0039638
2679 Ga0495595_0000828
2680 Ga0495619_0000912
2681 Ga0495619_0024324
2682 Ga0495619_0246216
2683 Ga0495619_0404713
2684 Ga0500578_0106338
2685 Ga0500578_0163429
2686 Ga0500578_0226712
2687 Ga0500578_0235766
2688 Ga0500643_000048
2689 Ga0500643_011015
2690 Ga0500581_151129
2691 Ga0500647_0018699
2692 Ga0500651_0037353
2693 Ga0500651_0085355
2694 Ga0500651_0120744
2695 Ga0500566_0000223
2696 Ga0500566_0004965
2697 Ga0500566_0029885
2698 Ga0500566_0153432
2699 Ga0500641_0008158
2700 Ga0500641_0012056
2701 Ga0500641_0023712
2702 Ga0500641_0043402
2703 Ga0500650_0003714
2704 Ga0500554_007050
2705 Ga0500554_007778
2706 Ga0500556_0000003
2707 Ga0500557_000083
2708 Ga0500569_014315
2709 Ga0500569_055868
2710 Ga0500572_001233
2711 Ga0500572_004969
2712 Ga0500591_048865
2713 Ga0500592_001083
2714 Ga0500592_028662
2715 Ga0500594_0054034
2716 Ga0500595_000333
2717 Ga0500595_005544
2718 Ga0500595_008879
2719 Ga0500595_012628
2720 Ga0500595_019981
2721 Ga0500595_029765
2722 Ga0500607_181636
2723 Ga0500608_043820
2724 Ga0500608_110735
2725 Ga0500618_004999
2726 Ga0500618_036580
2727 Ga0500628_061835
2728 Ga0500642_0000015
2729 Ga0500642_0000642
2730 Ga0500652_000665
2731 Ga0500559_0000230
2732 Ga0500559_0001714
2733 Ga0500559_0008650
2734 Ga0500559_0019501
2735 Ga0500559_0132321
2736 Ga0500568_0000536
2737 Ga0500568_0022102
2738 Ga0500573_0048795
2739 Ga0500577_0003157
2740 Ga0500577_0179364
2741 Ga0500586_000256
2742 Ga0500588_0077051
2743 Ga0500588_0080561
2744 Ga0500589_089297
2745 Ga0500590_127074
2746 Ga0500590_155056
2747 Ga0500603_000178
2748 Ga0500603_003757
2749 Ga0500603_007176
2750 Ga0500603_066455
2751 Ga0500604_0002214
2752 Ga0500616_0000033
2753 Ga0500616_0064918
2754 Ga0500619_039253
2755 Ga0500620_025245
2756 Ga0500622_0005267
2757 Ga0500622_0132006
2758 Ga0500630_011681
2759 Ga0500633_0036030
2760 Ga0500638_007384
2761 Ga0500639_012544
2762 Ga0500639_047881
2763 Ga0500639_121973
2764 Ga0500636_0000148
2765 Ga0500636_0000686
2766 Ga0500636_0015443
2767 Ga0500636_0032865
2768 Ga0500636_0045245
2769 Ga0500637_0000060
2770 Ga0500637_0003041
2771 Ga0500637_0059295
2772 Ga0500611_061900
2773 Ga0500625_007842
2774 Ga0500645_020418
2775 Ga0500645_028285
2776 Ga0500645_079363
2777 Ga0500609_002230
2778 Ga0500596_004552
2779 Ga0500599_002662
2780 Ga0500601_000452
2781 Ga0500601_005123
2782 Ga0501084_0445364
2783 Ga0500661_025944
2784 Ga0501082_0002719
2785 Ga0501082_0197709
2786 Ga0466962_0000093
2787 Ga0466962_0112696
2788 Ga0466962_0173982
2789 Ga0530510_0051769
2790 2507505894
2791 2508540085
2792 2508696155
2793 2509151554
2794 2511396621
2795 2513627468
2796 2513638782
2797 2513649868
2798 2513659782
2799 2513676893
2800 2513694706
2801 2513704353
2802 2513715416
2803 2513857243
2804 2513877270
2805 2513891635
2806 2513918858
2807 2514011243
2808 2515631369
2809 2517105693
2810 2517888184
2811 2524435437
2812 2524468612
2813 2524533359
2814 2528855124
2815 2603860084
2816 2617347778
2817 2617374506
2818 2644290511
2819 2671119357
2820 2723842257
2821 2728753841
2822 2734973075
2823 2745081399
2824 2793061566
2825 2793073862
2826 2793077973
2827 2805916130
2828 2816503849
2829 2818240868
2830 2824605527
2831 2824610825
2832 2824619360
2833 2824627815
2834 2824641893
2835 2824651583
2836 2824653877
2837 2824663770
2838 2824676110
2839 2824680225
2840 2824692463
2841 2824699886
2842 2824706068
2843 2824720085
2844 2824729447
2845 2824736156
2846 2824748032
2847 2824760299
2848 2824771538
2849 2824775742
2850 2838125115
2851 2841945853
2852 2841956820
2853 2841965304
2854 2841973336
2855 2841979500
2856 2841989375
2857 2842044366
2858 2842051645
2859 2844321486
2860 2847939470
2861 2847941219
2862 2849082211
2863 2857513314
2864 2874596368
2865 2874610154
2866 2874620219
2867 2874633340
2868 2874650356
2869 2876761693
2870 2876776833
2871 2876815708
2872 2876824623
2873 2879080970
2874 2879091088
2875 2879106652
2876 2879117030
2877 2879128201
2878 2879143556
2879 2881369630
2880 2881670153
2881 2885367720
2882 2885392255
2883 2885418261
2884 2888387741
2885 2888389960
2886 2888421140
2887 2889036373
2888 2893069654
2889 2903727935
2890 2903754035
2891 2903776665
2892 2904695757
2893 2904710018
2894 2904718095
2895 2906602581
2896 2906614459
2897 2906629721
2898 2906643418
2899 2906651663
2900 2906666610
2901 2908746711
2902 2908764273
2903 2908776985
2904 2919078955
2905 2922366744
2906 2922377446
2907 2922389353
2908 2922393379
2909 2922426293
2910 2929622238
2911 2929630115
2912 2932787952
2913 2932799514
2914 2932805180
2915 2932813327
2916 2932820024
2917 2932832912
2918 2933584148
2919 2935614318
2920 2935620397
2921 2935632678
2922 2935640721
2923 2935649346
2924 2935657882
2925 2935668913
2926 2935681361
2927 2935687222
2928 2935696807
2929 2935709101
2930 2935716910
2931 2935722965
2932 2935734522
2933 2935744687
2934 2935753188
2935 2935767592
2936 2935770186
2937 2935777784
2938 2935786760
2939 2935794814
2940 2935804831
2941 2935815980
2942 2935826536
2943 2935832228
2944 2935840942
2945 2935851170
2946 2935859283
2947 2935864467
2948 2935875181
2949 2935887730
2950 2935913219
2951 2935922641
2952 2935930856
2953 2935939810
2954 2935946759
2955 2935956040
2956 2935963880
2957 2935972833
2958 2935978250
2959 2935985622
2960 2935995844
2961 2936005755
2962 2936012101
2963 2936020818
2964 2936029394
2965 2936041883
2966 2936048282
2967 2936056607
2968 2940559101
2969 2941508658
2970 2941516488
2971 2941524496
2972 2941532066
2973 2941541796
2974 3003669727
2975 3005475657
2976 3005485842
2977 3005510883
2978 3005588832
2979 3005601852
2980 3005717591
2981 3005724639
2982 3006430886
2983 8002779950
2984 8002784702
2985 8006932294
2986 8006936997
2987 8006966342
2988 8006976962
2989 8006993168
2990 8006997007
2991 8016526943
2992 8016532028
2993 8016545237
2994 8016556851
2995 8016565204
2996 8016582863
2997 8016585431
2998 8016602847
2999 8016605717
3000 8016617624
3001 8016623945
3002 8016634920
3003 8017059306
3004 8019539685
3005 8019550963
3006 8019571754
3007 8019576323
3008 8019594195
3009 8019607367
3010 8019621995
3011 8019631326
3012 8019651713
3013 8019668131
3014 8019677597
3015 8019687351
3016 8019693328
3017 8054478238
3018 8055743513
3019 8056678193
3020 8056683415
3021 8056692720
3022 8056975362

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

24

264

0.95

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

29

265

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hin-assembly1.cif.gz_A crystal structure of putative enoyl-coa hydratase from rhodopseudomonas palustris cga009 0.9482 9 259
5z7r-assembly1.cif.gz_A crystal structure of crotonase from clostridium acetobutylicum 0.9482 8 255
5zai-assembly1.cif.gz_D crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula 0.9456 9 255
4izb-assembly1.cif.gz_B crystal structure of dmdd, a crotonase superfamily enzyme that catalyzes the hydration and hydrolysis of methylthioacryloyl-coa 0.9391 1 247
7eum-assembly1.cif.gz_F crystal structure of apo nmar_1308 protein at cryogenic temperature 0.9378 11 245
ID Description Score Start End Superfamily
3hinB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9712 9 204 3.90.226.10
5z7rC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9569 8 204 3.90.226.10
3hinB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9429 9 204 3.90.226.10
af_B7F9R1_37_234_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.937 18 202 3.90.226.10
4izcA01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9354 1 204 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A260THM0-F1-model_v4 deleted 0.9772 6 260
AF-A0A3N5GKA4-F1-model_v4 Crotonase/enoyl-CoA hydratase family protein 0.9761 9 196 GO:0003824
GO:0006635
AF-A0A1Y2MVR8-F1-model_v4 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) 0.9749 2 261 GO:0004300
GO:0006635
AF-B3F475-F1-model_v4 Putative enoyl-CoA hydratase/isomerase 0.9705 10 261 GO:0006635
GO:0016836
GO:0016853
AF-A0A7Y2DF79-F1-model_v4 Crotonase/enoyl-CoA hydratase family protein 0.9705 5 179 GO:0003824

Map