F494477

General Info

Members Datasets Scaffolds Average Seq Length
1512 795 3024 628

Family's Representative Sequence

Representative Sequence 2124908027|MRS2a_Contig_62|MRS2a_00485700
Length 690
Sequence LLCRFDRPIIHPKLNAIPVGARLAGDGVLEIAIAGKPCSYSKRAIDNKIVSTTGSRNMQRSIATVSLSGTLPEKLEAIAAAGFDGVEIFENDLLYYDGSPREIKQMCADLGIAITLFQPFRDFEGCRRDRLPRNLERAERKFDLMQELGTDLVLVCSNASADAIGDEQILIDDLRLLAEHAGARGLRIGYEALAWGRHVNTYQQVWNIVRQADHPNLGVLLDSFHTLSLKGDPSAIAEIPGDKIFFVQMADAPILAMDVLEWSRHFRCFPGQGEFDLPGFLAPIIKSGYTGPLSLEIFNDGFRAAPPRANAADGLRSLLYLEEKTRERLAQEAMPPATVDILFETPQASEYNGIEFLEFAVDESLGAKLSHWLERLGFVKAGQHRSKSVSLLRQGDINLILNSEPYSFAHSFFEAHGPSLXATAVRVKDSASALARAVAYKGQPYRGLVGPNELELAAVRAPDGSLIYLVDQDADVYGTDFNLQPSAVASGGLKRIDHMAMALPADSLDSWVLFYKSLLDFEADDEVVLPDPYGLVKSRALRSRDSSIRLPLNISENRNTAISHALSSYRGSGVHHIAFDCDDIFAEVSRAKEAGVPLLDIPLNYYDDLAARFDFDDEFLXELAYYNVLXDRDAXGGELFHVYTXPFEGRFFFXIIQRKNGYAGYGAANVAVRLAAMAKSRSGXVRQAKL

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
77 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
107 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
120 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
122 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
123 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
126 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
127 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
172 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
173 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
180 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
181 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
182 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
183 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
190 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
202 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
203 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
223 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
224 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
225 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
226 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
227 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
228 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
229 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
230 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
231 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
232 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
233 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
234 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
235 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
236 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
237 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
238 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
239 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
240 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
241 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
242 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
243 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
244 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
245 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
246 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
247 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
248 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
249 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
250 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
255 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
261 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
262 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
263 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
267 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
268 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
269 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
270 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
271 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
272 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
273 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
274 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
275 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
276 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
279 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
280 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
281 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
282 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
283 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
284 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
285 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
286 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
287 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
288 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
289 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
292 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
293 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
294 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
295 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
296 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
297 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
298 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
299 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
306 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
309 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
310 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
311 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
314 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
315 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
316 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
317 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
318 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
319 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
320 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
321 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
324 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
325 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
326 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
327 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
328 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
329 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
337 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
338 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
339 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
340 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
341 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
342 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
343 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
344 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
345 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
346 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
347 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
348 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
349 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
350 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
351 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
352 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
353 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
354 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
355 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
356 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
357 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
358 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
359 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
360 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
361 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
362 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
363 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
364 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
365 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
366 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
367 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
368 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
369 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
370 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
371 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
372 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
373 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
374 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
375 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
376 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
377 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
381 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
382 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
383 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
384 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
385 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
386 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
387 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
388 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
389 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
390 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
391 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
392 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
393 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
394 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
395 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
396 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
397 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
398 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
399 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
402 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
403 2506520008 Serratia plymuthica AS12 Isolate Unclassified
404 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
405 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
406 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
407 2511231004 Pseudomonas sp. GM102 Isolate Nodule
408 2511231006 Pseudomonas sp. GM17 Isolate Nodule
409 2511231007 Pseudomonas sp. GM18 Isolate Nodule
410 2511231008 Pseudomonas sp. GM21 Isolate Nodule
411 2511231010 Pseudomonas sp. GM25 Isolate Nodule
412 2511231011 Pseudomonas sp. GM30 Isolate Nodule
413 2511231012 Pseudomonas sp. GM33 Isolate Nodule
414 2511231014 Pseudomonas sp. GM48 Isolate Nodule
415 2511231015 Pseudomonas sp. GM49 Isolate Nodule
416 2511231016 Pseudomonas sp. GM50 Isolate Nodule
417 2511231017 Pseudomonas sp. GM55 Isolate Nodule
418 2511231018 Pseudomonas sp. GM60 Isolate Nodule
419 2511231019 Pseudomonas sp. GM67 Isolate Nodule
420 2511231020 Pseudomonas sp. GM74 Isolate Nodule
421 2511231021 Pseudomonas sp. GM78 Isolate Nodule
422 2511231022 Pseudomonas sp. GM79 Isolate Nodule
423 2511231023 Pseudomonas sp. GM80 Isolate Nodule
424 2511231024 Pseudomonas sp. GM84 Isolate Nodule
425 2511231031 Pseudomonas sp. GM16 Isolate Nodule
426 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
427 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
428 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
429 2519103095 Burkholderia sp. KJ006 Isolate Nodule
430 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
431 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
432 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
433 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
434 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
435 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
436 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
437 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
438 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
439 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
440 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
441 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
442 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
443 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
444 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
445 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
446 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
447 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
448 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
449 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
450 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
451 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
452 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
453 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
454 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
455 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
456 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
457 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
458 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
459 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
460 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
461 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
462 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
463 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
464 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
465 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
466 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
467 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
468 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
469 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
470 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
471 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
472 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
473 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
474 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
475 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
476 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
477 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
478 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
479 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
480 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
481 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
482 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
483 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
484 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
485 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
486 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
487 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
488 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
489 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
490 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
491 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
492 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
493 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
494 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
495 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
496 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
497 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
498 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
499 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
500 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
501 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
502 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
503 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
504 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
505 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
506 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
507 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
508 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
509 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
510 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
511 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
512 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
513 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
514 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
515 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
516 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
517 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
518 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
519 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
520 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
521 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
522 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
523 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
524 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
525 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
526 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
527 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
528 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
529 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
530 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
531 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
532 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
533 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
534 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
535 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
536 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
537 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
538 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
539 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
540 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
541 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
542 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
543 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
544 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
545 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
546 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
547 2636415599 Klebsiella variicola DX120E Isolate Unclassified
548 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
549 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
550 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
551 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
552 2643221629 Devosia sp. Root105 Isolate Unclassified
553 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
554 2643221647 Streptomyces sp. Root369 Isolate Unclassified
555 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
556 2643221662 Devosia sp. Root413D1 Isolate Unclassified
557 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
558 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
559 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
560 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
561 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
562 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
563 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
564 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
565 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
566 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
567 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
568 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
569 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
570 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
571 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
572 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
573 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
574 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
575 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
576 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
577 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
578 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
579 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
580 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
581 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
582 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
583 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
584 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
585 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
586 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
587 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
588 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
589 2765235841 Pseudomonas putida AA7 Isolate Unclassified
590 2773857670 Pseudomonas sp. 478 Isolate Unclassified
591 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
592 2773857673 Pseudomonas sp. 443 Isolate Unclassified
593 2775507074 Klebsiella sp. D5A Isolate Unclassified
594 2784132063 Pseudomonas sp. 424 Isolate Unclassified
595 2784132072 Pseudomonas sp. 460 Isolate Unclassified
596 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
597 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
598 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
599 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
600 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
601 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
602 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
603 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
604 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
605 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
606 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
607 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
608 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
609 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
610 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
611 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
612 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
613 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
614 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
615 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
616 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
617 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
618 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
619 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
620 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
621 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
622 2818991452 Burkholderia cepacia 561 Isolate Unclassified
623 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
624 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
625 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
626 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
627 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
628 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
629 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
630 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
631 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
632 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
633 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
634 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
635 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
636 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
637 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
638 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
639 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
640 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
641 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
642 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
643 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
644 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
645 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
646 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
647 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
648 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
649 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
650 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
651 2862574272 Streptomyces sp. AcE210 Isolate Nodule
652 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
653 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
654 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
655 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
656 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
657 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
658 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
659 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
660 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
661 2885266251 Ralstonia sp. SET104 Isolate Nodule
662 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
663 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
664 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
665 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
666 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
667 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
668 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
669 2904564687 Burkholderia sp. 571 Isolate Unclassified
670 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
671 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
672 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
673 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
674 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
675 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
676 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
677 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
678 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
679 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
680 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
681 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
682 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
683 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
684 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
685 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
686 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
687 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
688 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
689 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
690 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
691 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
692 2928058823 Ralstonia sp. 1138 Isolate Unclassified
693 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
694 2928163908 Burkholderia sp. 567 Isolate Unclassified
695 2928170801 Burkholderia sp. 572 Isolate Unclassified
696 2928536128 Burkholderia sola 565 Isolate Unclassified
697 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
698 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
699 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
700 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
701 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
702 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
703 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
704 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
705 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
706 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
707 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
708 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
709 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
710 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
711 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
712 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
713 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
714 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
715 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
716 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
717 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
718 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
719 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
720 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
721 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
722 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
723 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
724 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
725 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
726 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
727 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
728 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
729 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
730 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
731 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
732 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
733 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
734 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
735 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
736 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
737 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
738 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
739 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
740 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
741 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
742 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
743 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
744 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
745 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
746 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
747 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
748 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
749 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
750 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
751 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
752 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
753 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
754 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
755 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
756 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
757 8004592986 Serratia sp. S119 Isolate Unclassified
758 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
759 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
760 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
761 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
762 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
763 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
764 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
765 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
766 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
767 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
768 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
769 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
770 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
771 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
772 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
773 8052494512 Pseudomonas putida LD6 Isolate Unclassified
774 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
775 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
776 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
777 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
778 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
779 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
780 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
781 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
782 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
783 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
784 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
785 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
786 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
787 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
788 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
789 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
790 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
791 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
792 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
793 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
794 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
795 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.61
Metatranscriptomes 0.33
Isolates 26.06

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 7.74
Nodule 3.11
Rhizoplane 9.13
Rhizosphere 63.82
Stem 0
Stem Tuber 0
Unclassified 0.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_62 2124908027 Bacteria 15782
2 JGI24741J21665_1001052 3300001915 Bacteria 8268
3 JGI24740J21852_10000047 3300001979 Bacteria 39298
4 JGI24740J21852_10000084 3300001979 Bacteria 32275
5 JGI24739J22299_10000109 3300001989 Bacteria 25306
6 JGI24735J21928_10000736 3300002067 Bacteria 11637
7 JGI24735J21928_10001143 3300002067 Bacteria 9475
8 JGI25156J39149_1001527 3300002705 Bacteria 9611
9 JGI25156J39149_1007207 3300002705 Bacteria 2950
10 JGI25162J39368_1000136 3300002737 Bacteria 79587
11 JGI25162J39368_1000155 3300002737 Bacteria 75225
12 JGI25154J39366_1000668 3300002738 Bacteria 16003
13 JGI25163J39215_1001445 3300002771 Bacteria 3900
14 JGI25163J39215_1001478 3300002771 Bacteria 3794
15 JGI25164J39214_1000121 3300002772 Bacteria 75225
16 JGI25164J39214_1000258 3300002772 Bacteria 39842
17 JGI25406J46586_10003870 3300003203 Bacteria 6995
18 JGI25406J46586_10005301 3300003203 Bacteria 5981
19 JGI25406J46586_10011140 3300003203 Bacteria 3954
20 JGI25165J46597_1000037 3300003214 Bacteria 285722
21 JGI25165J46597_1000222 3300003214 Bacteria 79609
22 JGI25165J46597_1000240 3300003214 Bacteria 75225
23 JGI25160J50197_1000084 3300003354 Bacteria 97413
24 Ga0007417J51691_1020671 3300003544 Bacteria 3947
25 Ga0007416J51690_1015306 3300003577 Bacteria 3064
26 Ga0055538_1000065 3300003751 Bacteria 100831
27 Ga0055539_1000099 3300003752 Bacteria 100831
28 Ga0055539_1000203 3300003752 Bacteria 46893
29 Ga0055533_1000109 3300003756 Bacteria 100831
30 Ga0055533_1000963 3300003756 Bacteria 8469
31 Ga0055532_1000037 3300003758 Bacteria 205054
32 Ga0055532_1000094 3300003758 Bacteria 100832
33 Ga0055532_1001155 3300003758 Bacteria 8029
34 Ga0055532_1001302 3300003758 Bacteria 7244
35 Ga0055532_1001303 3300003758 Bacteria 7236
36 Ga0055525_1000143 3300003759 Bacteria 100831
37 Ga0055525_1000453 3300003759 Bacteria 23530
38 Ga0055527_1000487 3300003760 Bacteria 14308
39 Ga0055527_1000666 3300003760 Bacteria 10298
40 Ga0055535_1000018 3300003761 Bacteria 243804
41 Ga0055535_1002068 3300003761 Bacteria 8029
42 Ga0055535_1002073 3300003761 Bacteria 8011
43 Ga0055542_1000492 3300003762 Bacteria 36378
44 Ga0055542_1001925 3300003762 Bacteria 8160
45 Ga0055529_1000041 3300003763 Bacteria 226495
46 Ga0055529_1000398 3300003763 Bacteria 46298
47 Ga0055536_1000059 3300003781 Bacteria 103307
48 Ga0055536_1000403 3300003781 Bacteria 31444
49 Ga0055530_10000036 3300003791 Bacteria 117493
50 Ga0055530_10000096 3300003791 Bacteria 73950
51 Ga0055530_10000898 3300003791 Bacteria 24479
52 Ga0055530_10010435 3300003791 Bacteria 3434
53 Ga0055540_1000072 3300003792 Bacteria 117493
54 Ga0055540_1000084 3300003792 Bacteria 107482
55 Ga0055540_1000650 3300003792 Bacteria 24393
56 Ga0055531_10000266 3300003794 Bacteria 54559
57 Ga0055541_1000066 3300003841 Bacteria 100831
58 Ga0055541_1000400 3300003841 Bacteria 13001
59 Ga0058692_1003634 3300003856 Bacteria 4717
60 Ga0065165_1000329 3300005262 Bacteria 77564
61 Ga0065714_10004633 3300005288 Bacteria 5807
62 Ga0065714_10065746 3300005288 Bacteria 8656
63 Ga0065714_10066371 3300005288 Bacteria 6989
64 Ga0065714_10073413 3300005288 Bacteria 3191
65 Ga0065704_10000968 3300005289 Bacteria 13061
66 Ga0065704_10002901 3300005289 Bacteria 4740
67 Ga0070658_10005515 3300005327 Bacteria 10275
68 Ga0070670_100001749 3300005331 Bacteria 17689
69 Ga0070670_100002250 3300005331 Bacteria 15868
70 Ga0068869_100039777 3300005334 Bacteria 3359
71 Ga0070660_100000323 3300005339 Bacteria 31631
72 Ga0070661_100000131 3300005344 Bacteria 62870
73 Ga0070661_100000208 3300005344 Bacteria 48588
74 Ga0070668_100006472 3300005347 Bacteria 8685
75 Ga0070669_100000089 3300005353 Bacteria 88172
76 Ga0070669_100003603 3300005353 Bacteria 11183
77 Ga0070669_100059879 3300005353 Bacteria 2796
78 Ga0070674_100086613 3300005356 Bacteria 2250
79 Ga0070673_100024041 3300005364 Bacteria 4460
80 Ga0070688_100054230 3300005365 Bacteria 2510
81 Ga0070659_100000767 3300005366 Bacteria 23341
82 Ga0070659_100011714 3300005366 Bacteria 6492
83 Ga0070659_100034409 3300005366 Bacteria 3941
84 Ga0070667_100019878 3300005367 Bacteria 5573
85 Ga0070667_100069368 3300005367 Bacteria 3000
86 Ga0070713_100101859 3300005436 Bacteria 2488
87 Ga0070663_100000018 3300005455 Bacteria 115228
88 Ga0070663_100000054 3300005455 Bacteria 51309
89 Ga0070663_100005663 3300005455 Bacteria 7443
90 Ga0070662_100011108 3300005457 Bacteria 5929
91 Ga0070681_10030867 3300005458 Bacteria 5379
92 Ga0068867_100091068 3300005459 Bacteria 2314
93 Ga0070684_100019193 3300005535 Bacteria 5653
94 Ga0068853_100002936 3300005539 Bacteria 12967
95 Ga0068853_100009512 3300005539 Bacteria 7833
96 Ga0070665_100004426 3300005548 Bacteria 14759
97 Ga0070665_100025119 3300005548 Bacteria 6003
98 Ga0070665_100042556 3300005548 Bacteria 4566
99 Ga0070665_100073035 3300005548 Bacteria 3437
100 Ga0068855_100002550 3300005563 Bacteria 22446
101 Ga0068855_100058403 3300005563 Bacteria 4518
102 Ga0070664_100000040 3300005564 Bacteria 78303
103 Ga0070664_100000145 3300005564 Bacteria 48588
104 Ga0070664_100055941 3300005564 Bacteria 3352
105 Ga0068857_100049912 3300005577 Bacteria 3712
106 Ga0068854_100000034 3300005578 Bacteria 102389
107 Ga0068856_100000115 3300005614 Bacteria 79608
108 Ga0068856_100026846 3300005614 Bacteria 5616
109 Ga0068852_100028695 3300005616 Bacteria 4560
110 Ga0068859_100189613 3300005617 Bacteria 2140
111 Ga0068864_100032921 3300005618 Bacteria 4406
112 Ga0068851_10000002 3300005834 Bacteria 302756
113 Ga0081538_10002736 3300005981 Bacteria 16933
114 Ga0081538_10014327 3300005981 Bacteria 6213
115 Ga0081540_1007143 3300005983 Bacteria 8011
116 Ga0081539_10000195 3300005985 Bacteria 141188
117 Ga0081539_10000984 3300005985 Bacteria 53064
118 Ga0081539_10001258 3300005985 Bacteria 44901
119 Ga0075432_10000232 3300006058 Bacteria 14893
120 Ga0075432_10001524 3300006058 Bacteria 7586
121 Ga0075367_10019492 3300006178 Bacteria 3763
122 Ga0075428_100018426 3300006844 Bacteria 7720
123 Ga0075428_100054730 3300006844 Bacteria 4372
124 Ga0075430_100002673 3300006846 Bacteria 14878
125 Ga0075431_100002927 3300006847 Bacteria 16535
126 Ga0075433_10001156 3300006852 Bacteria 19171
127 Ga0075434_100001406 3300006871 Bacteria 20224
128 Ga0075429_100002737 3300006880 Bacteria 14885
129 Ga0075436_100001013 3300006914 Bacteria 18916
130 Ga0097620_100189594 3300006931 Bacteria 2140
131 Ga0099823_1000027 3300006944 Bacteria 69973
132 Ga0079104_1000116 3300006946 Bacteria 114868
133 Ga0079104_1000283 3300006946 Bacteria 65007
134 Ga0079104_1001497 3300006946 Bacteria 15530
135 Ga0099794_10028139 3300007265 Bacteria 2612
136 Ga0105251_10000050 3300009011 Bacteria 108597
137 Ga0105251_10000198 3300009011 Bacteria 60848
138 Ga0105251_10000214 3300009011 Bacteria 58941
139 Ga0105251_10000503 3300009011 Bacteria 37047
140 Ga0105251_10000587 3300009011 Bacteria 33436
141 Ga0105251_10000846 3300009011 Bacteria 27447
142 Ga0105251_10000972 3300009011 Bacteria 25444
143 Ga0105251_10001413 3300009011 Bacteria 20688
144 Ga0105251_10001672 3300009011 Bacteria 18688
145 Ga0105251_10015856 3300009011 Bacteria 4099
146 Ga0105244_10000037 3300009036 Bacteria 161621
147 Ga0105244_10000155 3300009036 Bacteria 71793
148 Ga0105244_10000312 3300009036 Bacteria 47271
149 Ga0105244_10000597 3300009036 Bacteria 32202
150 Ga0105244_10000983 3300009036 Bacteria 23917
151 Ga0105244_10001542 3300009036 Bacteria 18346
152 Ga0105244_10002341 3300009036 Bacteria 14395
153 Ga0105244_10002409 3300009036 Bacteria 14127
154 Ga0105244_10002423 3300009036 Bacteria 14083
155 Ga0105244_10003296 3300009036 Bacteria 11627
156 Ga0105244_10005647 3300009036 Bacteria 8263
157 Ga0105244_10006359 3300009036 Bacteria 7668
158 Ga0105244_10009740 3300009036 Bacteria 5875
159 Ga0105244_10017978 3300009036 Bacteria 3979
160 Ga0105244_10027743 3300009036 Bacteria 3048
161 Ga0105244_10046658 3300009036 Bacteria 2225
162 Ga0105250_10000130 3300009092 Bacteria 65133
163 Ga0105250_10000194 3300009092 Bacteria 51648
164 Ga0105250_10001047 3300009092 Bacteria 15843
165 Ga0105250_10001149 3300009092 Bacteria 14874
166 Ga0105250_10002250 3300009092 Bacteria 9803
167 Ga0105250_10006244 3300009092 Bacteria 5228
168 Ga0105240_10006023 3300009093 Bacteria 17927
169 Ga0105240_10031525 3300009093 Bacteria 6874
170 Ga0105240_10035859 3300009093 Bacteria 6387
171 Ga0105240_10040802 3300009093 Bacteria 5931
172 Ga0105240_10041129 3300009093 Bacteria 5903
173 Ga0105240_10129552 3300009093 Bacteria 3028
174 Ga0111539_10008028 3300009094 Bacteria 13461
175 Ga0105245_10012857 3300009098 Bacteria 7293
176 Ga0105245_10026163 3300009098 Bacteria 5135
177 Ga0105247_10000117 3300009101 Bacteria 77478
178 Ga0105243_10000115 3300009148 Bacteria 92572
179 Ga0105243_10001986 3300009148 Bacteria 17410
180 Ga0105243_10006536 3300009148 Bacteria 9003
181 Ga0105242_10008641 3300009176 Bacteria 7818
182 Ga0105248_10053252 3300009177 Bacteria 4541
183 Ga0105237_10002290 3300009545 Bacteria 23792
184 Ga0105237_10009645 3300009545 Bacteria 10333
185 Ga0105237_10018573 3300009545 Bacteria 7194
186 Ga0105238_10014016 3300009551 Bacteria 8108
187 Ga0105239_10004584 3300010375 Bacteria 16469
188 Ga0105239_10019132 3300010375 Bacteria 7568
189 Ga0105246_10000023 3300011119 Bacteria 56447
190 Ga0157373_10002554 3300013100 Bacteria 13841
191 Ga0157373_10007818 3300013100 Bacteria 7951
192 Ga0157373_10033515 3300013100 Bacteria 3695
193 Ga0157373_10045414 3300013100 Bacteria 3135
194 Ga0157373_10063394 3300013100 Bacteria 2617
195 Ga0157371_10000104 3300013102 Bacteria 128065
196 Ga0157371_10000185 3300013102 Bacteria 91305
197 Ga0157371_10000282 3300013102 Bacteria 68612
198 Ga0157371_10000427 3300013102 Bacteria 51636
199 Ga0157371_10028344 3300013102 Bacteria 4056
200 Ga0157371_10059770 3300013102 Bacteria 2702
201 Ga0157370_10000348 3300013104 Bacteria 58654
202 Ga0157370_10000558 3300013104 Bacteria 46503
203 Ga0157370_10001357 3300013104 Bacteria 30329
204 Ga0157370_10004203 3300013104 Bacteria 16650
205 Ga0157370_10010485 3300013104 Bacteria 9761
206 Ga0157370_10031441 3300013104 Bacteria 5191
207 Ga0157370_10039514 3300013104 Bacteria 4560
208 Ga0157370_10061262 3300013104 Bacteria 3571
209 Ga0157369_10005144 3300013105 Bacteria 15311
210 Ga0157369_10007420 3300013105 Bacteria 12626
211 Ga0157369_10014391 3300013105 Bacteria 8935
212 Ga0157369_10024104 3300013105 Bacteria 6772
213 Ga0157369_10033288 3300013105 Bacteria 5664
214 Ga0157374_10000053 3300013296 Bacteria 123609
215 Ga0163162_10000327 3300013306 Bacteria 43838
216 Ga0163162_10001680 3300013306 Bacteria 20756
217 Ga0163162_10002655 3300013306 Bacteria 16953
218 Ga0163162_10003675 3300013306 Bacteria 14709
219 Ga0157372_10000637 3300013307 Bacteria 38480
220 Ga0157372_10000654 3300013307 Bacteria 38081
221 Ga0157372_10003030 3300013307 Bacteria 18101
222 Ga0157375_10004869 3300013308 Bacteria 11667
223 Ga0157375_10023452 3300013308 Bacteria 5694
224 Ga0157375_10025963 3300013308 Bacteria 5453
225 Ga0163163_10059422 3300014325 Bacteria 3782
226 Ga0182008_10000852 3300014497 Bacteria 21165
227 Ga0182008_10004259 3300014497 Bacteria 8388
228 Ga0182008_10006951 3300014497 Bacteria 6281
229 Ga0182008_10008539 3300014497 Bacteria 5591
230 Ga0182008_10008870 3300014497 Bacteria 5457
231 Ga0182008_10012146 3300014497 Bacteria 4554
232 Ga0182008_10024794 3300014497 Bacteria 3050
233 Ga0182006_1000501 3300015261 Bacteria 30034
234 Ga0182006_1000547 3300015261 Bacteria 28375
235 Ga0182006_1001042 3300015261 Bacteria 18011
236 Ga0182006_1003853 3300015261 Bacteria 7530
237 Ga0182006_1004486 3300015261 Bacteria 6872
238 Ga0182006_1014013 3300015261 Bacteria 3462
239 Ga0182007_10000290 3300015262 Bacteria 32620
240 Ga0182007_10006145 3300015262 Bacteria 5186
241 Ga0182005_1000454 3300015265 Bacteria 21690
242 Ga0182005_1000471 3300015265 Bacteria 20927
243 Ga0182005_1016780 3300015265 Bacteria 2032
244 Ga0183367_1001 3300015688 Bacteria 1225545
245 Ga0183361_10024 3300016635 Bacteria 83513
246 Ga0163161_10000001 3300017792 Bacteria 2041488
247 Ga0163161_10001478 3300017792 Bacteria 17345
248 Ga0163161_10006343 3300017792 Bacteria 8182
249 Ga0163161_10016238 3300017792 Bacteria 5196
250 Ga0163161_10024717 3300017792 Bacteria 4247
251 Ga0163161_10039432 3300017792 Bacteria 3391
252 Ga0163161_10052082 3300017792 Bacteria 2967
253 Ga0163161_10060970 3300017792 Bacteria 2746
254 Ga0154015_1222406 3300020610 Bacteria 18981
255 Ga0213875_10000207 3300021388 Bacteria 60208
256 Ga0213875_10000315 3300021388 Bacteria 46146
257 Ga0213875_10037826 3300021388 Bacteria 2273
258 Ga0209760_100102 3300025207 Bacteria 65474
259 Ga0209760_100190 3300025207 Bacteria 30518
260 Ga0209784_100101 3300025224 Bacteria 100885
261 Ga0209784_100246 3300025224 Bacteria 34625
262 Ga0209784_100301 3300025224 Bacteria 26577
263 Ga0209784_101596 3300025224 Bacteria 2832
264 Ga0209566_100123 3300025225 Bacteria 100885
265 Ga0209566_100329 3300025225 Bacteria 42615
266 Ga0209566_100341 3300025225 Bacteria 40811
267 Ga0209566_100403 3300025225 Bacteria 34323
268 Ga0209566_102957 3300025225 Bacteria 2832
269 Ga0209674_100131 3300025226 Bacteria 118079
270 Ga0209674_100145 3300025226 Bacteria 100885
271 Ga0209674_100238 3300025226 Bacteria 46947
272 Ga0209674_100814 3300025226 Bacteria 10406
273 Ga0209672_100012 3300025228 Bacteria 795742
274 Ga0209672_100057 3300025228 Bacteria 215485
275 Ga0209672_100260 3300025228 Bacteria 39122
276 Ga0209672_100429 3300025228 Bacteria 24360
277 Ga0209147_100005 3300025229 Bacteria 1036530
278 Ga0209147_100007 3300025229 Bacteria 795684
279 Ga0209147_100047 3300025229 Bacteria 288873
280 Ga0209147_100151 3300025229 Bacteria 100885
281 Ga0209147_100241 3300025229 Bacteria 53164
282 Ga0209147_100747 3300025229 Bacteria 16061
283 Ga0209563_100128 3300025230 Bacteria 100885
284 Ga0209563_100170 3300025230 Bacteria 46947
285 Ga0209563_100197 3300025230 Bacteria 33048
286 Ga0207427_100056 3300025231 Bacteria 204343
287 Ga0207427_100063 3300025231 Bacteria 177711
288 Ga0209437_100065 3300025233 Bacteria 332417
289 Ga0209437_100133 3300025233 Bacteria 178493
290 Ga0209258_100007 3300025242 Bacteria 1036530
291 Ga0209258_100014 3300025242 Bacteria 720132
292 Ga0209258_100065 3300025242 Bacteria 288500
293 Ga0209258_100241 3300025242 Bacteria 100872
294 Ga0209646_1000058 3300025246 Bacteria 259999
295 Ga0209646_1000314 3300025246 Bacteria 38078
296 Ga0209026_1002579 3300025250 Bacteria 6668
297 Ga0209677_100094 3300025253 Bacteria 100885
298 Ga0209677_100206 3300025253 Bacteria 46947
299 Ga0209148_1000043 3300025254 Bacteria 461531
300 Ga0209148_1001167 3300025254 Bacteria 15255
301 Ga0209148_1001250 3300025254 Bacteria 14157
302 Ga0209759_1002975 3300025256 Bacteria 7043
303 Ga0209233_1000085 3300025261 Bacteria 333078
304 Ga0209233_1000133 3300025261 Bacteria 202716
305 Ga0209455_1000011 3300025272 Bacteria 947242
306 Ga0209455_1000074 3300025272 Bacteria 289143
307 Ga0209455_1002086 3300025272 Bacteria 7995
308 Ga0209673_1000198 3300025273 Bacteria 121230
309 Ga0209675_1001502 3300025291 Bacteria 13383
310 Ga0209676_1000076 3300025292 Bacteria 301393
311 Ga0209676_1000264 3300025292 Bacteria 110593
312 Ga0209676_1000313 3300025292 Bacteria 94925
313 Ga0209676_1000825 3300025292 Bacteria 40324
314 Ga0209676_1003296 3300025292 Bacteria 10116
315 Ga0209676_1003301 3300025292 Bacteria 10105
316 Ga0209564_1010435 3300025295 Bacteria 4281
317 Ga0209050_1000063 3300025298 Bacteria 314955
318 Ga0209050_1000080 3300025298 Bacteria 275154
319 Ga0209050_1000106 3300025298 Bacteria 224396
320 Ga0209050_1001454 3300025298 Bacteria 25396
321 Ga0207426_1000128 3300025302 Bacteria 211383
322 Ga0207426_1007653 3300025302 Bacteria 4490
323 Ga0209051_1000045 3300025303 Bacteria 297882
324 Ga0209051_1000082 3300025303 Bacteria 193133
325 Ga0209051_1000139 3300025303 Bacteria 136281
326 Ga0209051_1009142 3300025303 Bacteria 5143
327 Ga0209257_1000539 3300025304 Bacteria 64964
328 Ga0207656_10000010 3300025321 Bacteria 192224
329 Ga0207696_1000001 3300025711 Bacteria 2579611
330 Ga0207696_1000023 3300025711 Bacteria 422195
331 Ga0207696_1000047 3300025711 Bacteria 285005
332 Ga0207696_1000116 3300025711 Bacteria 148125
333 Ga0207696_1000126 3300025711 Bacteria 136197
334 Ga0207696_1000255 3300025711 Bacteria 69740
335 Ga0207696_1001069 3300025711 Bacteria 16167
336 Ga0207696_1002513 3300025711 Bacteria 8954
337 Ga0207696_1006398 3300025711 Bacteria 4752
338 Ga0207655_1000015 3300025728 Bacteria 600662
339 Ga0207655_1000027 3300025728 Bacteria 444552
340 Ga0207655_1000039 3300025728 Bacteria 341249
341 Ga0207655_1000117 3300025728 Bacteria 161655
342 Ga0207655_1000120 3300025728 Bacteria 157018
343 Ga0207655_1000378 3300025728 Bacteria 62082
344 Ga0207655_1000862 3300025728 Bacteria 32286
345 Ga0207655_1001095 3300025728 Bacteria 26574
346 Ga0207655_1004674 3300025728 Bacteria 9601
347 Ga0207655_1008994 3300025728 Bacteria 6260
348 Ga0207655_1010449 3300025728 Bacteria 5627
349 Ga0207655_1012990 3300025728 Bacteria 4814
350 Ga0207655_1012996 3300025728 Bacteria 4813
351 Ga0207655_1016086 3300025728 Bacteria 4116
352 Ga0207655_1020666 3300025728 Bacteria 3372
353 Ga0207655_1021364 3300025728 Bacteria 3287
354 Ga0207655_1030107 3300025728 Bacteria 2530
355 Ga0207655_1032009 3300025728 Bacteria 2411
356 Ga0207713_1000002 3300025735 Bacteria 1061749
357 Ga0207713_1000003 3300025735 Bacteria 860698
358 Ga0207713_1000016 3300025735 Bacteria 421689
359 Ga0207713_1000049 3300025735 Bacteria 227882
360 Ga0207713_1000229 3300025735 Bacteria 75343
361 Ga0207713_1000233 3300025735 Bacteria 74522
362 Ga0207713_1000245 3300025735 Bacteria 69586
363 Ga0207713_1000335 3300025735 Bacteria 52501
364 Ga0207713_1002628 3300025735 Bacteria 12923
365 Ga0207713_1003264 3300025735 Bacteria 11173
366 Ga0207713_1004283 3300025735 Bacteria 9308
367 Ga0207713_1005351 3300025735 Bacteria 8059
368 Ga0207713_1009539 3300025735 Bacteria 5459
369 Ga0207713_1012366 3300025735 Bacteria 4570
370 Ga0207713_1017097 3300025735 Bacteria 3652
371 Ga0207682_10000400 3300025893 Bacteria 19971
372 Ga0207710_10000185 3300025900 Bacteria 61135
373 Ga0207647_10004131 3300025904 Bacteria 10778
374 Ga0207647_10007845 3300025904 Bacteria 7680
375 Ga0207699_10028304 3300025906 Bacteria 3113
376 Ga0207645_10053771 3300025907 Bacteria 2572
377 Ga0207705_10016715 3300025909 Bacteria 5254
378 Ga0207695_10003825 3300025913 Bacteria 20862
379 Ga0207695_10005348 3300025913 Bacteria 17077
380 Ga0207695_10011262 3300025913 Bacteria 10845
381 Ga0207695_10098771 3300025913 Bacteria 2918
382 Ga0207671_10000613 3300025914 Bacteria 47054
383 Ga0207671_10033514 3300025914 Bacteria 3820
384 Ga0207671_10070977 3300025914 Bacteria 2597
385 Ga0207662_10011739 3300025918 Bacteria 4867
386 Ga0207657_10000152 3300025919 Bacteria 70647
387 Ga0207657_10013134 3300025919 Bacteria 8132
388 Ga0207649_10000023 3300025920 Bacteria 188467
389 Ga0207649_10000315 3300025920 Bacteria 36740
390 Ga0207681_10000134 3300025923 Bacteria 60646
391 Ga0207694_10023900 3300025924 Bacteria 4641
392 Ga0207694_10076953 3300025924 Bacteria 2614
393 Ga0207650_10000231 3300025925 Bacteria 62555
394 Ga0207650_10001368 3300025925 Bacteria 17607
395 Ga0207690_10000038 3300025932 Bacteria 136549
396 Ga0207690_10007440 3300025932 Bacteria 6499
397 Ga0207706_10000056 3300025933 Bacteria 113022
398 Ga0207706_10008880 3300025933 Bacteria 9252
399 Ga0207709_10000030 3300025935 Bacteria 331710
400 Ga0207709_10000127 3300025935 Bacteria 112650
401 Ga0207709_10017068 3300025935 Bacteria 4046
402 Ga0207670_10034626 3300025936 Bacteria 3266
403 Ga0207711_10090384 3300025941 Bacteria 2692
404 Ga0207679_10000017 3300025945 Bacteria 253004
405 Ga0207679_10000041 3300025945 Bacteria 127201
406 Ga0207667_10001407 3300025949 Bacteria 30184
407 Ga0207667_10062639 3300025949 Bacteria 3888
408 Ga0207668_10062336 3300025972 Bacteria 2625
409 Ga0207640_10000252 3300025981 Bacteria 36460
410 Ga0207639_10000871 3300026041 Bacteria 20523
411 Ga0207678_10000027 3300026067 Bacteria 115784
412 Ga0207678_10000109 3300026067 Bacteria 67556
413 Ga0207702_10000059 3300026078 Bacteria 127076
414 Ga0207702_10037315 3300026078 Bacteria 4067
415 Ga0207648_10087023 3300026089 Bacteria 2726
416 Ga0207676_10020555 3300026095 Bacteria 4832
417 Ga0207674_10042715 3300026116 Bacteria 4679
418 Ga0207674_10042812 3300026116 Bacteria 4673
419 Ga0207683_10007005 3300026121 Bacteria 9666
420 Ga0207698_10036300 3300026142 Bacteria 3616
421 Ga0209281_1000070 3300027111 Bacteria 277098
422 Ga0209281_1000127 3300027111 Bacteria 200036
423 Ga0209281_1001234 3300027111 Bacteria 16952
424 Ga0209281_1005195 3300027111 Bacteria 3674
425 Ga0209389_1000118 3300027296 Bacteria 70923
426 Ga0209371_1000236 3300027312 Bacteria 69437
427 Ga0209371_1000368 3300027312 Bacteria 48559
428 Ga0209371_1000629 3300027312 Bacteria 31275
429 Ga0209371_1002412 3300027312 Bacteria 10500
430 Ga0209974_10012108 3300027876 Bacteria 2888
431 Ga0207428_10000808 3300027907 Bacteria 35392
432 Ga0207428_10003112 3300027907 Bacteria 16302
433 Ga0207428_10015193 3300027907 Bacteria 6663
434 Ga0207428_10026098 3300027907 Bacteria 4881
435 Ga0207428_10048502 3300027907 Bacteria 3407
436 Ga0207428_10062798 3300027907 Bacteria 2936
437 Ga0268266_10032610 3300028379 Bacteria 4425
438 Ga0307517_10001714 3300028786 Bacteria 36146
439 Ga0307517_10027262 3300028786 Bacteria 6869
440 Ga0307515_10011157 3300028794 Bacteria 17083
441 Ga0307515_10014250 3300028794 Bacteria 14769
442 Ga0307515_10056015 3300028794 Bacteria 5742
443 Ga0268256_1000220 3300030500 Bacteria 63155
444 Ga0268256_1000313 3300030500 Bacteria 48562
445 Ga0268256_1000723 3300030500 Bacteria 24334
446 Ga0268256_1002142 3300030500 Bacteria 10500
447 Ga0307511_10002619 3300030521 Bacteria 18768
448 Ga0307511_10026933 3300030521 Bacteria 5261
449 Ga0307512_10002928 3300030522 Bacteria 20643
450 Ga0307512_10009670 3300030522 Bacteria 9266
451 Ga0314311_1018153 3300030733 Bacteria 6021
452 Ga0316178_1041886 3300030735 Bacteria 28881
453 Ga0265332_10001867 3300031238 Bacteria 11197
454 Ga0265316_10073510 3300031344 Bacteria 2633
455 Ga0307513_10004264 3300031456 Bacteria 19132
456 Ga0307509_10022042 3300031507 Bacteria 7191
457 Ga0307408_100000013 3300031548 Bacteria 386212
458 Ga0307408_100008150 3300031548 Bacteria 6919
459 Ga0307408_100009474 3300031548 Bacteria 6424
460 Ga0307408_100041361 3300031548 Bacteria 3267
461 Ga0307508_10001385 3300031616 Bacteria 27340
462 Ga0307516_10000208 3300031730 Bacteria 75300
463 Ga0307516_10021811 3300031730 Bacteria 6583
464 Ga0307516_10128845 3300031730 Bacteria 2312
465 Ga0307405_10000226 3300031731 Bacteria 20355
466 Ga0307405_10006873 3300031731 Bacteria 5641
467 Ga0307518_10023816 3300031838 Bacteria 4413
468 Ga0307518_10039030 3300031838 Bacteria 3452
469 Ga0307410_10012564 3300031852 Bacteria 4904
470 Ga0307406_10015120 3300031901 Bacteria 4459
471 Ga0307412_10000963 3300031911 Bacteria 16440
472 Ga0307412_10004042 3300031911 Bacteria 8175
473 Ga0307412_10008009 3300031911 Bacteria 6026
474 Ga0307412_10058182 3300031911 Bacteria 2584
475 Ga0307412_10069045 3300031911 Bacteria 2404
476 Ga0307409_100020194 3300031995 Bacteria 4534
477 Ga0307409_100022951 3300031995 Bacteria 4312
478 Ga0307416_100030774 3300032002 Bacteria 4031
479 Ga0307414_10003912 3300032004 Bacteria 8029
480 Ga0307414_10090762 3300032004 Bacteria 2268
481 Ga0307411_10081424 3300032005 Bacteria 2229
482 Ga0307415_100000639 3300032126 Bacteria 15379
483 Ga0307507_10014438 3300033179 Bacteria 9417
484 Ga0307510_10010329 3300033180 Bacteria 11085
485 Ga0373951_0000081 3300035091 Bacteria 37714
486 Ga0373936_0000845 3300035113 Bacteria 10905
487 Ga0373953_0003820 3300035117 Bacteria 4740
488 Ga0373955_0000697 3300035172 Bacteria 14439
489 Ga0373924_0000297 3300035410 Bacteria 15359
490 Ga0373935_0000530 3300035692 Bacteria 19893
491 Ga0373927_0004554 3300035695 Bacteria 9687
492 Ga0373933_0002386 3300035724 Bacteria 10610
493 Ga0373947_0001048 3300035725 Bacteria 16869
494 Ga0373937_0000212 3300036401 Bacteria 55966
495 Ga0373925_0000002 3300037068 Bacteria 368879
496 Ga0395899_0000023 3300037312 Bacteria 367159
497 Ga0395900_0000019 3300037418 Bacteria 357240
498 Ga0395900_0011145 3300037418 Bacteria 9189
499 Ga0395898_0000016 3300037466 Bacteria 435585
500 Ga0395898_0029092 3300037466 Bacteria 5535
501 Ga0395905_0000139 3300037471 Bacteria 120342
502 Ga0436364_0796339 3300037853 Bacteria 8115
503 Ga0436364_1383349 3300037853 Bacteria 102720
504 Ga0436364_1481155 3300037853 Bacteria 87951
505 Ga0436364_1483536 3300037853 Bacteria 14223
506 Ga0395901_0000038 3300038443 Bacteria 210534
507 Ga0237819_00203 3300038705 Bacteria 21713
508 Ga0436365_0208634 3300039437 Unclassified 2144
509 Ga0436365_0505152 3300039437 Bacteria 3986
510 Ga0436365_0622916 3300039437 Bacteria 21905
511 Ga0436365_1168445 3300039437 Bacteria 4026
512 Ga0436365_1888304 3300039437 Bacteria 4920
513 Ga0436361_1051656 3300039447 Bacteria 5711
514 Ga0436361_1158602 3300039447 Bacteria 3243
515 Ga0436361_1163181 3300039447 Bacteria 14246
516 Ga0436363_0168519 3300039450 Bacteria 7820
517 Ga0436362_0823318 3300039453 Bacteria 5819
518 Ga0439436_0002355 3300041404 Bacteria 5658
519 Ga0439438_001110 3300041405 Bacteria 11990
520 Ga0439438_002344 3300041405 Bacteria 8075
521 Ga0439438_002767 3300041405 Bacteria 7342
522 Ga0439438_003268 3300041405 Bacteria 6625
523 Ga0439438_004274 3300041405 Bacteria 5539
524 Ga0439438_004325 3300041405 Bacteria 5484
525 Ga0439438_007582 3300041405 Bacteria 3694
526 Ga0439438_010915 3300041405 Bacteria 2852
527 Ga0439438_014171 3300041405 Bacteria 2379
528 Ga0439447_000104 3300041407 Bacteria 29012
529 Ga0439447_000895 3300041407 Bacteria 10892
530 Ga0439453_0000241 3300041408 Bacteria 5506
531 Ga0439466_0000970 3300041411 Bacteria 11035
532 Ga0439466_0009195 3300041411 Bacteria 3700
533 Ga0439466_0011495 3300041411 Bacteria 3275
534 Ga0439466_0020606 3300041411 Bacteria 2348
535 Ga0439448_0000969 3300042005 Bacteria 7107
536 Ga0439432_002681 3300042006 Bacteria 6662
537 Ga0439432_003740 3300042006 Bacteria 5622
538 Ga0439432_006543 3300042006 Bacteria 4157
539 Ga0439432_021032 3300042006 Bacteria 2165
540 Ga0439451_000619 3300042009 Bacteria 6753
541 Ga0439452_000009 3300042010 Bacteria 569493
542 Ga0439452_000085 3300042010 Bacteria 79496
543 Ga0439452_000136 3300042010 Bacteria 55807
544 Ga0439452_000149 3300042010 Bacteria 51740
545 Ga0439452_008205 3300042010 Bacteria 3156
546 Ga0439456_000013 3300042013 Bacteria 72544
547 Ga0439456_005766 3300042013 Bacteria 2518
548 Ga0439463_000698 3300042016 Bacteria 9297
549 Ga0450911_001434 3300042115 Bacteria 5492
550 Ga0450890_000250 3300042127 Bacteria 8037
551 Ga0450904_002253 3300042139 Bacteria 2347
552 Ga0450905_000018 3300042142 Bacteria 15231
553 Ga0450906_006644 3300042145 Bacteria 2320
554 Ga0450907_000025 3300042146 Bacteria 72853
555 Ga0450907_002473 3300042146 Bacteria 3517
556 Ga0450909_001728 3300042185 Bacteria 3065
557 Ga0439434_0004591 3300042435 Bacteria 4043
558 Ga0439460_0010550 3300042461 Bacteria 2368
559 Ga0466986_0004181 3300044650 Bacteria 7699
560 Ga0466969_0000375 3300044656 Bacteria 24528
561 Ga0466969_0002196 3300044656 Bacteria 10427
562 Ga0466969_0014453 3300044656 Bacteria 4151
563 Ga0466972_0003056 3300044658 Bacteria 8303
564 Ga0466973_0010320 3300044659 Bacteria 8611
565 Ga0466978_0016238 3300044671 Bacteria 4293
566 Ga0466982_0026631 3300044672 Bacteria 3378
567 Ga0466966_0000020 3300044684 Bacteria 119360
568 Ga0466966_0010767 3300044684 Bacteria 6079
569 Ga0466961_0000024 3300044693 Bacteria 96595
570 Ga0466961_0000043 3300044693 Bacteria 76269
571 Ga0466961_0000622 3300044693 Bacteria 22250
572 Ga0466961_0000999 3300044693 Bacteria 17449
573 Ga0466961_0008631 3300044693 Bacteria 6494
574 Ga0466961_0017210 3300044693 Bacteria 4643
575 Ga0466963_0004216 3300044694 Bacteria 8337
576 Ga0466963_0027977 3300044694 Bacteria 3615
577 Ga0466964_0003088 3300044706 Bacteria 6056
578 Ga0466964_0005300 3300044706 Bacteria 4785
579 Ga0466971_0006666 3300044719 Bacteria 5024
580 Ga0466970_0000611 3300044765 Bacteria 17530
581 Ga0466970_0002332 3300044765 Bacteria 9177
582 Ga0466970_0020134 3300044765 Bacteria 3463
583 Ga0466957_0038248 3300044842 Bacteria 2890
584 Ga0466960_0045580 3300044901 Bacteria 2095
585 Ga0466959_0002813 3300045049 Bacteria 11205
586 Ga0466959_0039214 3300045049 Bacteria 3500
587 Ga0466958_0001628 3300045836 Bacteria 10806
588 Ga0466967_0015670 3300045976 Bacteria 5951
589 Ga0466967_0070991 3300045976 Bacteria 3117
590 Ga0495617_000168 3300046452 Bacteria 41777
591 Ga0495627_000020 3300046453 Bacteria 291866
592 Ga0495627_000060 3300046453 Bacteria 140874
593 Ga0495627_000154 3300046453 Bacteria 80512
594 Ga0495627_000221 3300046453 Bacteria 61299
595 Ga0495627_001421 3300046453 Bacteria 14086
596 Ga0495627_004126 3300046453 Bacteria 6168
597 Ga0495592_0000265 3300046454 Bacteria 44816
598 Ga0495592_0006424 3300046454 Bacteria 8750
599 Ga0495603_0001706 3300046455 Bacteria 12940
600 Ga0495603_0003656 3300046455 Bacteria 9147
601 Ga0495603_0005348 3300046455 Bacteria 7660
602 Ga0495603_0005980 3300046455 Bacteria 7274
603 Ga0495603_0011355 3300046455 Bacteria 5393
604 Ga0495590_0000447 3300046457 Bacteria 20404
605 Ga0495590_0001119 3300046457 Bacteria 11744
606 Ga0495590_0009784 3300046457 Bacteria 3630
607 Ga0495590_0018094 3300046457 Bacteria 2525
608 Ga0495590_0018589 3300046457 Bacteria 2487
609 Ga0495591_000058 3300046458 Bacteria 130659
610 Ga0495591_000074 3300046458 Bacteria 114062
611 Ga0495591_000165 3300046458 Bacteria 70496
612 Ga0495591_000419 3300046458 Bacteria 35268
613 Ga0495591_006472 3300046458 Bacteria 5176
614 Ga0495591_007109 3300046458 Bacteria 4817
615 Ga0495591_008093 3300046458 Bacteria 4348
616 Ga0495591_011332 3300046458 Bacteria 3383
617 Ga0495591_012070 3300046458 Bacteria 3236
618 Ga0495629_0000238 3300046459 Bacteria 48096
619 Ga0495629_0013407 3300046459 Bacteria 5914
620 Ga0495629_0016863 3300046459 Bacteria 5242
621 Ga0495638_0000428 3300046460 Bacteria 50789
622 Ga0495638_0001172 3300046460 Bacteria 25142
623 Ga0495638_0005050 3300046460 Bacteria 9895
624 Ga0495638_0006257 3300046460 Bacteria 8689
625 Ga0495638_0015145 3300046460 Bacteria 5186
626 Ga0495638_0015253 3300046460 Bacteria 5164
627 Ga0495638_0017295 3300046460 Bacteria 4813
628 Ga0495638_0038299 3300046460 Bacteria 3048
629 Ga0495651_0014887 3300046462 Bacteria 6013
630 Ga0495653_0000006 3300046463 Bacteria 363285
631 Ga0495653_0000332 3300046463 Bacteria 38593
632 Ga0495653_0005802 3300046463 Bacteria 10101
633 Ga0495653_0019424 3300046463 Bacteria 5512
634 Ga0495653_0056660 3300046463 Bacteria 2986
635 Ga0495650_0000765 3300046471 Bacteria 39770
636 Ga0495650_0000966 3300046471 Bacteria 32946
637 Ga0495650_0006120 3300046471 Bacteria 7573
638 Ga0495650_0006565 3300046471 Bacteria 7230
639 Ga0495580_0035115 3300046472 Bacteria 3605
640 Ga0495605_0000048 3300046474 Bacteria 170182
641 Ga0495605_0000091 3300046474 Bacteria 115482
642 Ga0495605_0000953 3300046474 Bacteria 19725
643 Ga0495605_0003434 3300046474 Bacteria 9418
644 Ga0495605_0005869 3300046474 Bacteria 7095
645 Ga0495605_0012168 3300046474 Bacteria 4780
646 Ga0495605_0026464 3300046474 Bacteria 3015
647 Ga0495605_0031113 3300046474 Bacteria 2728
648 Ga0495639_0000041 3300046475 Bacteria 55786
649 Ga0495662_0001839 3300046476 Bacteria 10633
650 Ga0495664_0000002 3300046477 Bacteria 625183
651 Ga0495664_0000843 3300046477 Bacteria 15738
652 Ga0495584_0003348 3300046491 Bacteria 8853
653 Ga0495584_0003833 3300046491 Bacteria 8175
654 Ga0495584_0004401 3300046491 Bacteria 7586
655 Ga0495584_0006209 3300046491 Bacteria 6269
656 Ga0495584_0015515 3300046491 Bacteria 3881
657 Ga0495585_0000937 3300046492 Bacteria 24621
658 Ga0495585_0003124 3300046492 Bacteria 11357
659 Ga0495585_0005080 3300046492 Bacteria 8387
660 Ga0495585_0008082 3300046492 Bacteria 6393
661 Ga0495585_0009962 3300046492 Bacteria 5679
662 Ga0495585_0014914 3300046492 Bacteria 4519
663 Ga0495594_0011179 3300046499 Bacteria 4661
664 Ga0495596_0000109 3300046500 Bacteria 57203
665 Ga0495607_0000139 3300046501 Bacteria 76715
666 Ga0495607_0000190 3300046501 Bacteria 65339
667 Ga0495607_0000330 3300046501 Bacteria 49138
668 Ga0495607_0000395 3300046501 Bacteria 44371
669 Ga0495607_0001876 3300046501 Bacteria 17826
670 Ga0495607_0002335 3300046501 Bacteria 15526
671 Ga0495607_0002507 3300046501 Bacteria 14881
672 Ga0495607_0007196 3300046501 Bacteria 7729
673 Ga0495607_0007963 3300046501 Bacteria 7284
674 Ga0495607_0021823 3300046501 Bacteria 4026
675 Ga0495607_0021851 3300046501 Bacteria 4023
676 Ga0495607_0034982 3300046501 Bacteria 3043
677 Ga0495607_0041655 3300046501 Bacteria 2726
678 Ga0495607_0049523 3300046501 Bacteria 2449
679 Ga0495583_0000187 3300046506 Bacteria 104971
680 Ga0495583_0000206 3300046506 Bacteria 99380
681 Ga0495583_0001258 3300046506 Bacteria 26665
682 Ga0495583_0002463 3300046506 Bacteria 15807
683 Ga0495583_0002998 3300046506 Bacteria 13523
684 Ga0495583_0012055 3300046506 Bacteria 4922
685 Ga0495583_0014705 3300046506 Bacteria 4300
686 Ga0495583_0033154 3300046506 Bacteria 2485
687 Ga0495606_0000177 3300046507 Bacteria 112843
688 Ga0495606_0000287 3300046507 Bacteria 87639
689 Ga0495606_0000324 3300046507 Bacteria 82321
690 Ga0495606_0001537 3300046507 Bacteria 30458
691 Ga0495606_0004243 3300046507 Bacteria 14498
692 Ga0495606_0004992 3300046507 Bacteria 12939
693 Ga0495606_0006124 3300046507 Bacteria 11229
694 Ga0495606_0019151 3300046507 Bacteria 5103
695 Ga0495606_0020543 3300046507 Bacteria 4864
696 Ga0495606_0021126 3300046507 Bacteria 4773
697 Ga0495606_0027210 3300046507 Bacteria 4060
698 Ga0495608_0000006 3300046511 Bacteria 324334
699 Ga0495610_0011194 3300046512 Bacteria 5501
700 Ga0495616_0005222 3300046513 Bacteria 8027
701 Ga0495616_0008607 3300046513 Bacteria 6026
702 Ga0495616_0012882 3300046513 Bacteria 4730
703 Ga0495616_0044536 3300046513 Bacteria 2250
704 Ga0495618_0000282 3300046514 Bacteria 36848
705 Ga0495620_0000012 3300046515 Bacteria 166395
706 Ga0495620_0000742 3300046515 Bacteria 20067
707 Ga0495620_0001923 3300046515 Bacteria 12178
708 Ga0495620_0003045 3300046515 Bacteria 9633
709 Ga0495620_0003619 3300046515 Bacteria 8820
710 Ga0495620_0004446 3300046515 Bacteria 7901
711 Ga0495620_0014976 3300046515 Bacteria 3925
712 Ga0495620_0023845 3300046515 Bacteria 2917
713 Ga0495628_0000002 3300046516 Bacteria 589399
714 Ga0495628_0022270 3300046516 Bacteria 5206
715 Ga0495628_0060872 3300046516 Bacteria 2962
716 Ga0495630_0005689 3300046517 Bacteria 8812
717 Ga0495631_0000423 3300046518 Bacteria 29200
718 Ga0495631_0000472 3300046518 Bacteria 27165
719 Ga0495631_0002057 3300046518 Bacteria 11723
720 Ga0495631_0004989 3300046518 Bacteria 6997
721 Ga0495632_0000803 3300046519 Bacteria 27828
722 Ga0495632_0002609 3300046519 Bacteria 13579
723 Ga0495632_0003915 3300046519 Bacteria 10341
724 Ga0495632_0006163 3300046519 Bacteria 7767
725 Ga0495632_0014674 3300046519 Bacteria 4423
726 Ga0495632_0019983 3300046519 Bacteria 3637
727 Ga0495632_0038915 3300046519 Bacteria 2404
728 Ga0495637_0000016 3300046520 Bacteria 226914
729 Ga0495637_0000409 3300046520 Bacteria 31750
730 Ga0495637_0002003 3300046520 Bacteria 11491
731 Ga0495637_0002806 3300046520 Bacteria 9442
732 Ga0495637_0003940 3300046520 Bacteria 7774
733 Ga0495637_0004776 3300046520 Bacteria 6991
734 Ga0495637_0006218 3300046520 Bacteria 6004
735 Ga0495637_0007095 3300046520 Bacteria 5579
736 Ga0495637_0013562 3300046520 Bacteria 3864
737 Ga0495643_0000593 3300046522 Bacteria 43905
738 Ga0495643_0001236 3300046522 Bacteria 24581
739 Ga0495643_0006380 3300046522 Bacteria 7786
740 Ga0495643_0016201 3300046522 Bacteria 4383
741 Ga0495643_0019417 3300046522 Bacteria 3932
742 Ga0495643_0020324 3300046522 Bacteria 3829
743 Ga0495643_0039549 3300046522 Bacteria 2578
744 Ga0495644_0006100 3300046523 Bacteria 4685
745 Ga0495644_0011746 3300046523 Bacteria 3371
746 Ga0495648_0002180 3300046524 Bacteria 18392
747 Ga0495648_0003559 3300046524 Bacteria 13634
748 Ga0495648_0008219 3300046524 Bacteria 8229
749 Ga0495648_0012385 3300046524 Bacteria 6368
750 Ga0495648_0015509 3300046524 Bacteria 5530
751 Ga0495648_0048448 3300046524 Bacteria 2615
752 Ga0495648_0057452 3300046524 Bacteria 2333
753 Ga0495666_0009349 3300046526 Bacteria 4903
754 Ga0495642_0003556 3300046528 Bacteria 6135
755 Ga0495642_0028116 3300046528 Bacteria 2239
756 Ga0495652_0000004 3300046529 Bacteria 588877
757 Ga0495652_0045709 3300046529 Bacteria 3762
758 Ga0495654_0000341 3300046530 Bacteria 40691
759 Ga0495654_0000771 3300046530 Bacteria 24701
760 Ga0495654_0001231 3300046530 Bacteria 18082
761 Ga0495654_0001742 3300046530 Bacteria 14591
762 Ga0495654_0001915 3300046530 Bacteria 13817
763 Ga0495654_0002274 3300046530 Bacteria 12427
764 Ga0495654_0007083 3300046530 Bacteria 6307
765 Ga0495654_0007255 3300046530 Bacteria 6212
766 Ga0495654_0031333 3300046530 Bacteria 2699
767 Ga0495654_0032387 3300046530 Bacteria 2650
768 Ga0495654_0062948 3300046530 Bacteria 1777
769 Ga0495640_0000007 3300046533 Bacteria 265481
770 Ga0495586_0027131 3300046535 Bacteria 3065
771 Ga0495587_0000031 3300046536 Bacteria 126721
772 Ga0495587_0001669 3300046536 Bacteria 14811
773 Ga0495587_0011584 3300046536 Bacteria 5583
774 Ga0495609_0000231 3300046538 Bacteria 53219
775 Ga0495609_0001798 3300046538 Bacteria 13765
776 Ga0495609_0002652 3300046538 Bacteria 10843
777 Ga0495609_0005747 3300046538 Bacteria 6448
778 Ga0495609_0005771 3300046538 Bacteria 6434
779 Ga0495597_0000175 3300046542 Bacteria 56934
780 Ga0495597_0000837 3300046542 Bacteria 24200
781 Ga0495597_0002042 3300046542 Bacteria 13491
782 Ga0495597_0003647 3300046542 Bacteria 8845
783 Ga0495597_0003687 3300046542 Bacteria 8784
784 Ga0495597_0009080 3300046542 Bacteria 4937
785 Ga0495597_0021139 3300046542 Bacteria 3026
786 Ga0495597_0029025 3300046542 Bacteria 2527
787 Ga0495645_0000003 3300046543 Bacteria 570133
788 Ga0495645_0001142 3300046543 Bacteria 18002
789 Ga0495622_0001392 3300046557 Bacteria 12300
790 Ga0495622_0003639 3300046557 Bacteria 7231
791 Ga0495622_0004703 3300046557 Bacteria 6328
792 Ga0495622_0008750 3300046557 Bacteria 4690
793 Ga0495633_0002225 3300046558 Bacteria 13863
794 Ga0495633_0007192 3300046558 Bacteria 6449
795 Ga0495633_0007220 3300046558 Bacteria 6431
796 Ga0495667_0000002 3300046559 Bacteria 437535
797 Ga0495668_0000469 3300046616 Bacteria 51055
798 Ga0495668_0008984 3300046616 Bacteria 6171
799 Ga0495668_0009110 3300046616 Bacteria 6122
800 Ga0495668_0015020 3300046616 Bacteria 4530
801 Ga0495634_0000110 3300046642 Bacteria 68101
802 Ga0495634_0007128 3300046642 Bacteria 8430
803 Ga0495634_0023082 3300046642 Bacteria 4378
804 Ga0495634_0054992 3300046642 Bacteria 2663
805 Ga0495611_0000122 3300046648 Bacteria 55685
806 Ga0495611_0000663 3300046648 Bacteria 19615
807 Ga0495611_0001621 3300046648 Bacteria 10945
808 Ga0495611_0002019 3300046648 Bacteria 9593
809 Ga0495611_0031117 3300046648 Bacteria 2348
810 Ga0495625_0000015 3300046660 Bacteria 317237
811 Ga0495625_0001457 3300046660 Bacteria 28713
812 Ga0495625_0002724 3300046660 Bacteria 18731
813 Ga0495625_0004443 3300046660 Bacteria 13258
814 Ga0495625_0018911 3300046660 Bacteria 5362
815 Ga0495625_0022007 3300046660 Bacteria 4895
816 Ga0495625_0030056 3300046660 Bacteria 4056
817 Ga0495625_0052325 3300046660 Bacteria 2925
818 Ga0495635_0000022 3300046663 Bacteria 160907
819 Ga0495635_0000520 3300046663 Bacteria 24388
820 Ga0495635_0015127 3300046663 Bacteria 5396
821 Ga0495659_0001226 3300046664 Bacteria 8873
822 Ga0495661_0000001 3300046665 Bacteria 898372
823 Ga0495661_0000075 3300046665 Bacteria 119777
824 Ga0495661_0000491 3300046665 Bacteria 41378
825 Ga0495661_0001678 3300046665 Bacteria 18051
826 Ga0495661_0002674 3300046665 Bacteria 13637
827 Ga0495661_0022703 3300046665 Bacteria 4080
828 Ga0495661_0024597 3300046665 Bacteria 3899
829 Ga0495657_0002481 3300046675 Bacteria 15518
830 Ga0495599_0000001 3300046678 Bacteria 537563
831 Ga0495623_0000898 3300046679 Bacteria 20166
832 Ga0495646_0000007 3300046680 Bacteria 236764
833 Ga0495646_0006657 3300046680 Bacteria 7326
834 Ga0495646_0008412 3300046680 Bacteria 6552
835 Ga0495613_0001531 3300046689 Bacteria 17600
836 Ga0495613_0014177 3300046689 Bacteria 5913
837 Ga0495613_0042616 3300046689 Bacteria 3358
838 Ga0495624_0006117 3300046690 Bacteria 8573
839 Ga0495670_0000195 3300046691 Bacteria 27168
840 Ga0495670_0003338 3300046691 Bacteria 7902
841 Ga0495670_0032037 3300046691 Bacteria 2613
842 Ga0495671_0000011 3300046692 Bacteria 365582
843 Ga0495671_0000348 3300046692 Bacteria 38480
844 Ga0495671_0001149 3300046692 Bacteria 18190
845 Ga0495671_0002810 3300046692 Bacteria 10894
846 Ga0495671_0006736 3300046692 Bacteria 6612
847 Ga0495671_0008036 3300046692 Bacteria 5962
848 Ga0495671_0009197 3300046692 Bacteria 5522
849 Ga0495671_0009230 3300046692 Bacteria 5513
850 Ga0495671_0019129 3300046692 Bacteria 3624
851 Ga0495671_0032706 3300046692 Bacteria 2654
852 Ga0495671_0051075 3300046692 Bacteria 2057
853 Ga0495649_0000272 3300046694 Bacteria 46077
854 Ga0495649_0002881 3300046694 Bacteria 11921
855 Ga0495649_0003495 3300046694 Bacteria 10581
856 Ga0495649_0012114 3300046694 Bacteria 5032
857 Ga0495649_0014303 3300046694 Bacteria 4552
858 Ga0495649_0024100 3300046694 Bacteria 3396
859 Ga0495649_0026241 3300046694 Bacteria 3242
860 Ga0495649_0027247 3300046694 Bacteria 3171
861 Ga0495649_0045078 3300046694 Bacteria 2405
862 Ga0495649_0060125 3300046694 Bacteria 2044
863 Ga0495589_0000576 3300046794 Bacteria 25355
864 Ga0495589_0001356 3300046794 Bacteria 14319
865 Ga0495589_0002374 3300046794 Bacteria 10574
866 Ga0495589_0006384 3300046794 Bacteria 6227
867 Ga0495589_0007131 3300046794 Bacteria 5856
868 Ga0495589_0012439 3300046794 Bacteria 4407
869 Ga0495660_0000829 3300046810 Bacteria 22990
870 Ga0495660_0001599 3300046810 Bacteria 15207
871 Ga0495660_0014955 3300046810 Bacteria 4488
872 Ga0495660_0018964 3300046810 Bacteria 3949
873 Ga0495660_0031227 3300046810 Bacteria 2995
874 Ga0495660_0048045 3300046810 Bacteria 2334
875 Ga0495660_0048956 3300046810 Bacteria 2309
876 Ga0495581_0001847 3300047315 Bacteria 11846
877 Ga0495581_0008885 3300047315 Bacteria 5817
878 Ga0495581_0012229 3300047315 Bacteria 4970
879 Ga0495604_0000005 3300047317 Bacteria 424516
880 Ga0495604_0006222 3300047317 Bacteria 9473
881 Ga0495604_0034073 3300047317 Bacteria 4029
882 Ga0495636_0001195 3300047318 Bacteria 9808
883 Ga0495674_0000003 3300047319 Bacteria 562126
884 Ga0495674_0017007 3300047319 Bacteria 6778
885 Ga0495672_0000059 3300047320 Bacteria 217302
886 Ga0495672_0002933 3300047320 Bacteria 15047
887 Ga0495672_0004094 3300047320 Bacteria 12161
888 Ga0495672_0004404 3300047320 Bacteria 11546
889 Ga0495672_0004737 3300047320 Bacteria 10986
890 Ga0495672_0005320 3300047320 Bacteria 10242
891 Ga0495672_0006304 3300047320 Bacteria 9224
892 Ga0495672_0006980 3300047320 Bacteria 8583
893 Ga0495672_0015319 3300047320 Bacteria 5211
894 Ga0495672_0033075 3300047320 Bacteria 3207
895 Ga0495672_0037276 3300047320 Bacteria 2976
896 Ga0495672_0039134 3300047320 Bacteria 2885
897 Ga0495672_0078362 3300047320 Bacteria 1848
898 Ga0495676_0000001 3300047321 Bacteria 624167
899 Ga0495676_0002451 3300047321 Bacteria 16487
900 Ga0495676_0003597 3300047321 Bacteria 14067
901 Ga0495676_0015876 3300047321 Bacteria 6693
902 Ga0495680_0000091 3300047322 Bacteria 81622
903 Ga0495680_0005855 3300047322 Bacteria 11506
904 Ga0495683_0000043 3300047323 Bacteria 136876
905 Ga0495683_0001732 3300047323 Bacteria 13792
906 Ga0495683_0003532 3300047323 Bacteria 9097
907 Ga0495683_0003604 3300047323 Bacteria 8984
908 Ga0495683_0009926 3300047323 Bacteria 5056
909 Ga0495683_0010099 3300047323 Bacteria 5003
910 Ga0495683_0030225 3300047323 Bacteria 2765
911 Ga0495687_000015 3300047443 Bacteria 365627
912 Ga0495687_002768 3300047443 Bacteria 13581
913 Ga0495687_005668 3300047443 Bacteria 7885
914 Ga0495687_007146 3300047443 Bacteria 6651
915 Ga0495687_014931 3300047443 Bacteria 3969
916 Ga0495687_018435 3300047443 Bacteria 3450
917 Ga0495675_0000133 3300047444 Bacteria 52544
918 Ga0495679_000071 3300047446 Bacteria 97677
919 Ga0495679_000081 3300047446 Bacteria 88918
920 Ga0495679_002408 3300047446 Bacteria 9549
921 Ga0495679_002727 3300047446 Bacteria 8793
922 Ga0495679_021932 3300047446 Bacteria 2195
923 Ga0495685_007417 3300047447 Bacteria 3621
924 Ga0495673_0000013 3300047469 Bacteria 612902
925 Ga0495673_0000924 3300047469 Bacteria 26657
926 Ga0495673_0001422 3300047469 Bacteria 19169
927 Ga0495673_0001817 3300047469 Bacteria 16119
928 Ga0495673_0001954 3300047469 Bacteria 15301
929 Ga0495673_0004535 3300047469 Bacteria 8672
930 Ga0495673_0004601 3300047469 Bacteria 8591
931 Ga0495673_0006740 3300047469 Bacteria 6713
932 Ga0495681_0000483 3300047470 Bacteria 30581
933 Ga0495681_0001489 3300047470 Bacteria 17496
934 Ga0495681_0002540 3300047470 Bacteria 12998
935 Ga0495681_0004310 3300047470 Bacteria 9736
936 Ga0495681_0004383 3300047470 Bacteria 9641
937 Ga0495681_0006550 3300047470 Bacteria 7630
938 Ga0495681_0007466 3300047470 Bacteria 6978
939 Ga0495681_0008329 3300047470 Bacteria 6510
940 Ga0495681_0018160 3300047470 Bacteria 3882
941 Ga0495681_0021832 3300047470 Bacteria 3439
942 Ga0495681_0027722 3300047470 Bacteria 2925
943 Ga0495684_0000035 3300047471 Bacteria 107768
944 Ga0495686_0000042 3300047472 Bacteria 293968
945 Ga0495686_0010349 3300047472 Bacteria 6639
946 Ga0495686_0020449 3300047472 Bacteria 4413
947 Ga0495686_0021463 3300047472 Bacteria 4288
948 Ga0495686_0064621 3300047472 Bacteria 2264
949 Ga0495593_0000746 3300047673 Bacteria 18929
950 Ga0495593_0003672 3300047673 Bacteria 9162
951 Ga0495602_0000029 3300048088 Bacteria 142344
952 Ga0495602_0019220 3300048088 Bacteria 6792
953 Ga0495614_0002106 3300048089 Bacteria 8792
954 Ga0495626_0000008 3300048091 Bacteria 271853
955 Ga0495626_0000364 3300048091 Bacteria 47517
956 Ga0495626_0000705 3300048091 Bacteria 31675
957 Ga0495626_0000767 3300048091 Bacteria 29487
958 Ga0495626_0002131 3300048091 Bacteria 14326
959 Ga0495626_0004194 3300048091 Bacteria 8931
960 Ga0495626_0005203 3300048091 Bacteria 7701
961 Ga0495626_0005475 3300048091 Bacteria 7410
962 Ga0495626_0008184 3300048091 Bacteria 5760
963 Ga0495626_0046058 3300048091 Bacteria 2033
964 Ga0496100_0004321 3300048903 Bacteria 7525
965 Ga0496100_0005571 3300048903 Bacteria 6797
966 Ga0496100_0023145 3300048903 Bacteria 3769
967 Ga0496100_0027976 3300048903 Bacteria 3473
968 Ga0496101_0000269 3300048904 Bacteria 36730
969 Ga0496101_0008618 3300048904 Bacteria 6667
970 Ga0496101_0020118 3300048904 Bacteria 4565
971 Ga0496102_0000138 3300048905 Bacteria 98703
972 Ga0496103_0002580 3300048906 Bacteria 11345
973 Ga0496104_0029919 3300048907 Bacteria 5057
974 Ga0496105_0011836 3300048908 Bacteria 6910
975 Ga0496105_0028840 3300048908 Bacteria 4541
976 Ga0496106_0006861 3300048909 Bacteria 8427
977 Ga0496106_0018839 3300048909 Bacteria 5114
978 Ga0496106_0078080 3300048909 Bacteria 2540
979 Ga0496108_0006388 3300048911 Bacteria 9554
980 Ga0496109_0007921 3300048912 Bacteria 9005
981 Ga0496110_0019961 3300048913 Bacteria 5649
982 Ga0496111_0028924 3300048914 Bacteria 3930
983 Ga0496112_0001121 3300048915 Bacteria 19909
984 Ga0496112_0015288 3300048915 Bacteria 7156
985 Ga0496112_0026647 3300048915 Bacteria 5567
986 Ga0496113_0017878 3300048916 Bacteria 4928
987 Ga0496113_0033341 3300048916 Bacteria 3748
988 Ga0496114_0003352 3300048917 Bacteria 12312
989 Ga0496114_0018376 3300048917 Bacteria 5653
990 Ga0496115_0137830 3300048918 Bacteria 2012
991 Ga0496116_0000001 3300048919 Bacteria 1501681
992 Ga0496116_0000065 3300048919 Bacteria 265193
993 Ga0496116_0000267 3300048919 Bacteria 91320
994 Ga0496116_0000605 3300048919 Bacteria 47467
995 Ga0496116_0003570 3300048919 Bacteria 15289
996 Ga0496116_0013688 3300048919 Bacteria 6522
997 Ga0496116_0038985 3300048919 Bacteria 3290
998 Ga0496116_0053700 3300048919 Bacteria 2659
999 Ga0496117_0000245 3300048920 Bacteria 102799
1000 Ga0496117_0000345 3300048920 Bacteria 82051
1001 Ga0496117_0000866 3300048920 Bacteria 46705
1002 Ga0496117_0001344 3300048920 Bacteria 36059
1003 Ga0496117_0002196 3300048920 Bacteria 25381
1004 Ga0496117_0002910 3300048920 Bacteria 20715
1005 Ga0496117_0002920 3300048920 Bacteria 20685
1006 Ga0496117_0004635 3300048920 Bacteria 14976
1007 Ga0496117_0005308 3300048920 Bacteria 13623
1008 Ga0496117_0021683 3300048920 Bacteria 5184
1009 Ga0496117_0030146 3300048920 Bacteria 4168
1010 Ga0496117_0049549 3300048920 Bacteria 2986
1011 Ga0496117_0063403 3300048920 Bacteria 2526
1012 Ga0496118_0001300 3300048921 Bacteria 38048
1013 Ga0496118_0004485 3300048921 Bacteria 16529
1014 Ga0496118_0008231 3300048921 Bacteria 10819
1015 Ga0496118_0008529 3300048921 Bacteria 10578
1016 Ga0496118_0011583 3300048921 Bacteria 8588
1017 Ga0496118_0023500 3300048921 Bacteria 5351
1018 Ga0496118_0024914 3300048921 Bacteria 5149
1019 Ga0496118_0034968 3300048921 Bacteria 4089
1020 Ga0496118_0035394 3300048921 Bacteria 4054
1021 Ga0496118_0039498 3300048921 Bacteria 3764
1022 Ga0496118_0049144 3300048921 Bacteria 3250
1023 Ga0496118_0056964 3300048921 Bacteria 2933
1024 Ga0496119_0000011 3300048922 Bacteria 438315
1025 Ga0496119_0001557 3300048922 Bacteria 27320
1026 Ga0496119_0007379 3300048922 Bacteria 9926
1027 Ga0496120_0000306 3300048923 Bacteria 81699
1028 Ga0496120_0001332 3300048923 Bacteria 30475
1029 Ga0496120_0029590 3300048923 Bacteria 3342
1030 Ga0496121_0000366 3300048924 Bacteria 92773
1031 Ga0496121_0000487 3300048924 Bacteria 76772
1032 Ga0496121_0000670 3300048924 Bacteria 63957
1033 Ga0496121_0010504 3300048924 Bacteria 10430
1034 Ga0496121_0014728 3300048924 Bacteria 8263
1035 Ga0496121_0027246 3300048924 Bacteria 5352
1036 Ga0496121_0031160 3300048924 Bacteria 4878
1037 Ga0496121_0087404 3300048924 Bacteria 2447
1038 Ga0496122_0000221 3300048925 Bacteria 127004
1039 Ga0496122_0000292 3300048925 Bacteria 110793
1040 Ga0496122_0001617 3300048925 Bacteria 35202
1041 Ga0496122_0009392 3300048925 Bacteria 10317
1042 Ga0496122_0009594 3300048925 Bacteria 10140
1043 Ga0496122_0011780 3300048925 Bacteria 8804
1044 Ga0496122_0019468 3300048925 Bacteria 6198
1045 Ga0496122_0068190 3300048925 Bacteria 2556
1046 Ga0496123_0000037 3300048926 Bacteria 262238
1047 Ga0496123_0000989 3300048926 Bacteria 43699
1048 Ga0496123_0001885 3300048926 Bacteria 27375
1049 Ga0496123_0003653 3300048926 Bacteria 17002
1050 Ga0496123_0013312 3300048926 Bacteria 6922
1051 Ga0496123_0017058 3300048926 Bacteria 5862
1052 Ga0496123_0024630 3300048926 Bacteria 4567
1053 Ga0496124_0000035 3300048927 Bacteria 318099
1054 Ga0496124_0000580 3300048927 Bacteria 61729
1055 Ga0496124_0001300 3300048927 Bacteria 37788
1056 Ga0496124_0001404 3300048927 Bacteria 35955
1057 Ga0496124_0002380 3300048927 Bacteria 24767
1058 Ga0496124_0012335 3300048927 Bacteria 8439
1059 Ga0496124_0013458 3300048927 Bacteria 7985
1060 Ga0496124_0014681 3300048927 Bacteria 7562
1061 Ga0496124_0022527 3300048927 Bacteria 5770
1062 Ga0496124_0032175 3300048927 Bacteria 4636
1063 Ga0496124_0054355 3300048927 Bacteria 3390
1064 Ga0496124_0073995 3300048927 Bacteria 2817
1065 Ga0496125_0000196 3300048928 Bacteria 129294
1066 Ga0496125_0004719 3300048928 Bacteria 15540
1067 Ga0496125_0005204 3300048928 Bacteria 14596
1068 Ga0496125_0011827 3300048928 Bacteria 8698
1069 Ga0496125_0020403 3300048928 Bacteria 6219
1070 Ga0496125_0022209 3300048928 Bacteria 5897
1071 Ga0496125_0022410 3300048928 Bacteria 5867
1072 Ga0496125_0042488 3300048928 Bacteria 3870
1073 Ga0496126_0000105 3300048929 Bacteria 198893
1074 Ga0496126_0002998 3300048929 Bacteria 21927
1075 Ga0496126_0005096 3300048929 Bacteria 15231
1076 Ga0496126_0008363 3300048929 Bacteria 11166
1077 Ga0496126_0033548 3300048929 Bacteria 4828
1078 Ga0496126_0035937 3300048929 Bacteria 4637
1079 Ga0496126_0088632 3300048929 Bacteria 2725
1080 Ga0495678_001085 3300049459 Bacteria 22975
1081 Ga0495678_002002 3300049459 Bacteria 14634
1082 Ga0495678_003062 3300049459 Bacteria 10614
1083 Ga0495678_003176 3300049459 Bacteria 10355
1084 Ga0495678_004295 3300049459 Bacteria 8309
1085 Ga0495678_004428 3300049459 Bacteria 8122
1086 Ga0495678_005242 3300049459 Bacteria 7224
1087 Ga0495678_024370 3300049459 Bacteria 2613
1088 Ga0495678_033623 3300049459 Bacteria 2115
1089 Ga0495682_0000113 3300049460 Bacteria 69969
1090 Ga0495682_0000118 3300049460 Bacteria 69167
1091 Ga0495682_0004503 3300049460 Bacteria 5944
1092 Ga0501034_0000248 3300049571 Bacteria 99691
1093 Ga0501039_0017022 3300049575 Bacteria 5572
1094 Ga0501073_0006663 3300049589 Bacteria 8602
1095 Ga0501083_0002432 3300049744 Bacteria 12739
1096 nmdc:mga06z11_11725_c1 3300050494 Bacteria 3789
1097 nmdc:mga05p37_2582_c1 3300050507 Bacteria 21054
1098 nmdc:mga09592_747_c1 3300050508 Bacteria 25046
1099 nmdc:mga0qj67_34105_c1 3300050509 Bacteria 3975
1100 nmdc:mga06r32_811_c1 3300050510 Bacteria 27762
1101 nmdc:mga08y16_34317_c1 3300050511 Bacteria 5331
1102 nmdc:mga0n895_29461_c1 3300050512 Bacteria 5237
1103 nmdc:mga08x19_16934_c1 3300050514 Bacteria 4453
1104 nmdc:mga0a205_2891_c1 3300050515 Bacteria 15195
1105 Ga0495601_0000008 3300053077 Bacteria 362152
1106 Ga0495612_0000026 3300053078 Bacteria 111627
1107 Ga0495612_0024122 3300053078 Bacteria 2442
1108 Ga0495595_0000024 3300053084 Bacteria 108008
1109 Ga0495619_0000002 3300053085 Bacteria 530226
1110 Ga0500572_002276 3300053111 Bacteria 4669
1111 Ga0500618_002165 3300053125 Bacteria 7712
1112 Ga0500659_0001817 3300053135 Bacteria 13338
1113 Ga0500559_0005743 3300053136 Bacteria 5667
1114 Ga0500604_0005290 3300053151 Bacteria 3411
1115 Ga0587090_000459 3300059510 Bacteria 3400
1116 Ga0587072_000018 3300059643 Bacteria 10605
1117 Ga0466962_0006789 3300061719 Bacteria 5491
1118 Ga0466962_0008470 3300061719 Bacteria 4928
1119 2506578563 2506520007 Bacteria 5442880
1120 2506583702 2506520008 Bacteria 5443009
1121 2510284240 2510065053 Bacteria 5005518
1122 2510293076 2510065055 Bacteria 5037935
1123 2510312577 2510065058 Bacteria 5005894
1124 2511252944 2511231004 Bacteria 6669789
1125 2511267140 2511231006 Bacteria 6794709
1126 2511271378 2511231007 Bacteria 6306603
1127 2511278513 2511231008 Bacteria 6624100
1128 2511292311 2511231010 Bacteria 6373152
1129 2511295260 2511231011 Bacteria 6149768
1130 2511302551 2511231012 Bacteria 6738011
1131 2511316087 2511231014 Bacteria 6462302
1132 2511323199 2511231015 Bacteria 6598026
1133 2511328088 2511231016 Bacteria 6704427
1134 2511335043 2511231017 Bacteria 6503007
1135 2511338341 2511231018 Bacteria 6436256
1136 2511344529 2511231019 Bacteria 6520662
1137 2511350915 2511231020 Bacteria 6115223
1138 2511359891 2511231021 Bacteria 7302637
1139 2511362073 2511231022 Bacteria 6719296
1140 2511370615 2511231023 Bacteria 6808468
1141 2511374932 2511231024 Bacteria 5835885
1142 2511411427 2511231031 Bacteria 6558529
1143 2511827092 2511231156 Bacteria 6845832
1144 2512324702 2512047018 Bacteria 6663241
1145 2514054968 2513237166 Bacteria 10373764
1146 2519460470 2519103095 Bacteria 6629912
1147 2554812594 2554235132 Bacteria 6772433
1148 2555248339 2554235231 Bacteria 5215788
1149 2555257435 2554235234 Bacteria 5762085
1150 2555672301 2554235341 Bacteria 6867980
1151 2563062836 2562617112 Bacteria 10918404
1152 2583794739 2582580891 Bacteria 6800976
1153 2585292965 2582581311 Bacteria 6763856
1154 2585305990 2582581313 Bacteria 10042643
1155 2597031047 2596583598 Bacteria 5251611
1156 2597860373 2597489887 Bacteria 6666321
1157 2597866117 2597489888 Bacteria 6179543
1158 2597871943 2597489889 Bacteria 6297495
1159 2599326775 2599185155 Bacteria 5827168
1160 2599358256 2599185160 Bacteria 6844013
1161 2599364611 2599185161 Bacteria 6960462
1162 2599370853 2599185162 Bacteria 6957254
1163 2599376875 2599185163 Bacteria 6995158
1164 2599383421 2599185164 Bacteria 6841688
1165 2599389868 2599185165 Bacteria 6843250
1166 2599396157 2599185166 Bacteria 6959206
1167 2599401423 2599185167 Bacteria 6353609
1168 2599407997 2599185168 Bacteria 6997636
1169 2599408936 2599185169 Bacteria 5441380
1170 2599448175 2599185178 Bacteria 5365746
1171 2599453108 2599185179 Bacteria 6611171
1172 2599465071 2599185181 Bacteria 6844519
1173 2599471388 2599185182 Bacteria 6883168
1174 2599486785 2599185185 Bacteria 6652270
1175 2599494014 2599185186 Bacteria 6831633
1176 2599505184 2599185188 Bacteria 6164180
1177 2599509863 2599185189 Bacteria 5862825
1178 2599515113 2599185190 Bacteria 6285678
1179 2599520277 2599185191 Bacteria 6297582
1180 2599616915 2599185212 Bacteria 6765997
1181 2599736060 2599185239 Bacteria 8686614
1182 2599747981 2599185240 Bacteria 7968121
1183 2599772884 2599185248 Bacteria 6696816
1184 2599807091 2599185257 Bacteria 6492581
1185 2599881714 2599185288 Bacteria 6666191
1186 2599888198 2599185289 Bacteria 6778765
1187 2599894493 2599185290 Bacteria 6289611
1188 2599901020 2599185291 Bacteria 6775623
1189 2599928603 2599185299 Bacteria 4854625
1190 2599934504 2599185300 Bacteria 6062622
1191 2599945083 2599185302 Bacteria 5954930
1192 2599949337 2599185303 Bacteria 6512725
1193 2599955188 2599185304 Bacteria 5951361
1194 2599962750 2599185305 Bacteria 6748700
1195 2599969299 2599185306 Bacteria 6637356
1196 2599980630 2599185308 Bacteria 6621546
1197 2599983921 2599185309 Bacteria 5969593
1198 2599990361 2599185310 Bacteria 6014457
1199 2599997403 2599185311 Bacteria 6354990
1200 2600001697 2599185312 Bacteria 5912071
1201 2600008439 2599185313 Bacteria 6658188
1202 2600014278 2599185314 Bacteria 6621749
1203 2600020856 2599185315 Bacteria 6771107
1204 2600026261 2599185316 Bacteria 6320029
1205 2600031811 2599185317 Bacteria 6435722
1206 2600038652 2599185318 Bacteria 6961590
1207 2600044102 2599185319 Bacteria 6637840
1208 2600048895 2599185320 Bacteria 5963263
1209 2600056078 2599185321 Bacteria 6764560
1210 2600062749 2599185322 Bacteria 6763055
1211 2600067744 2599185323 Bacteria 6688755
1212 2600073845 2599185324 Bacteria 6590677
1213 2600079531 2599185325 Bacteria 6324919
1214 2600210769 2599185355 Bacteria 7968906
1215 2600217804 2599185356 Bacteria 6843884
1216 2600360337 2600254930 Bacteria 6431253
1217 2600367113 2600254931 Bacteria 6734225
1218 2600445252 2600254954 Bacteria 5100516
1219 2601522547 2600255254 Bacteria 5281859
1220 2601527574 2600255255 Bacteria 5282785
1221 2601614405 2600255280 Bacteria 5292309
1222 2601619125 2600255281 Bacteria 5288753
1223 2601624441 2600255283 Bacteria 6061572
1224 2601642255 2600255287 Bacteria 5210468
1225 2601647117 2600255288 Bacteria 5282738
1226 2601652552 2600255289 Bacteria 5281907
1227 2601657878 2600255290 Bacteria 5282218
1228 2601662078 2600255291 Bacteria 5217298
1229 2601693953 2600255296 Bacteria 5784754
1230 2601695036 2600255298 Bacteria 5215185
1231 2601699708 2600255299 Bacteria 5218662
1232 2601706397 2600255300 Bacteria 5287774
1233 2601710703 2600255301 Bacteria 5280532
1234 2601715717 2600255302 Bacteria 5288235
1235 2601720059 2600255303 Bacteria 5219315
1236 2601726123 2600255304 Bacteria 5283973
1237 2601730664 2600255305 Bacteria 5282329
1238 2601735680 2600255306 Bacteria 5281613
1239 2601740948 2600255307 Bacteria 5439064
1240 2601750878 2600255309 Bacteria 5431045
1241 2601777971 2600255313 Bacteria 6842543
1242 2601800469 2600255318 Bacteria 6383414
1243 2602012363 2600255389 Bacteria 5275336
1244 2602018132 2600255392 Bacteria 5437392
1245 2603659440 2602042052 Bacteria 5215873
1246 2603664715 2602042053 Bacteria 5214361
1247 2603838056 2602042103 Bacteria 5284714
1248 2603843134 2602042104 Bacteria 5281639
1249 2603848207 2602042105 Bacteria 5282303
1250 2603853282 2602042106 Bacteria 5282744
1251 2603867226 2602042109 Bacteria 5152801
1252 2603871333 2602042110 Bacteria 5283285
1253 2603876264 2602042111 Bacteria 5212080
1254 2606048526 2603880178 Bacteria 5283018
1255 2606069142 2603880184 Bacteria 5217896
1256 2606078723 2603880185 Bacteria 6379190
1257 2606125617 2603880199 Bacteria 6377649
1258 2606144964 2603880202 Bacteria 5284684
1259 2606175927 2603880211 Bacteria 5284226
1260 2608384907 2606217733 Bacteria 6360972
1261 2621297358 2619619299 Bacteria 6649820
1262 2624482884 2623620443 Bacteria 6427864
1263 2624494426 2623620446 Bacteria 6500345
1264 2637224807 2636415599 Bacteria 5718434
1265 2643844805 2643221565 Bacteria 6216018
1266 2643869707 2643221571 Bacteria 6228673
1267 2643957571 2643221589 Bacteria 6250934
1268 2644025685 2643221602 Bacteria 6249926
1269 2644169092 2643221629 Bacteria 5850260
1270 2644189063 2643221633 Bacteria 6733554
1271 2644265148 2643221647 Bacteria 10741251
1272 2644285985 2643221650 Bacteria 7029547
1273 2644350504 2643221662 Bacteria 5851492
1274 2644438017 2643221678 Bacteria 9540101
1275 2644625334 2643221713 Bacteria 6554480
1276 2650898178 2648501693 Bacteria 5069560
1277 2652543963 2651869719 Bacteria 6047974
1278 2656279538 2654587920 Bacteria 5475511
1279 2671093914 2667528170 Bacteria 6786960
1280 2671100785 2667528171 Bacteria 6900659
1281 2671129995 2667528176 Bacteria 6724917
1282 2671773351 2671180172 Bacteria 6495783
1283 2676406076 2675903046 Bacteria 5451247
1284 2676746243 2675903129 Bacteria 7964495
1285 2677895821 2675903420 Bacteria 6247433
1286 2678265600 2675903515 Bacteria 6580491
1287 2686355178 2684622997 Bacteria 4624240
1288 2689445113 2687453601 Bacteria 5546041
1289 2713477031 2711768613 Bacteria 11048459
1290 2715752319 2713897148 Bacteria 5883533
1291 2715759059 2713897149 Bacteria 6506249
1292 2718636097 2718217725 Bacteria 5758958
1293 2723250848 2721755607 Bacteria 5841722
1294 2738672917 2738541265 Bacteria 6594665
1295 2738751310 2738541282 Bacteria 6593925
1296 2738810266 2738541294 Bacteria 6925949
1297 2738860351 2738541303 Bacteria 6591772
1298 2738897626 2738541309 Bacteria 6926455
1299 2739198177 2738543004 Bacteria 6381073
1300 2739260941 2738543015 Bacteria 6750701
1301 2739289590 2738543020 Bacteria 5718238
1302 2739294902 2738543021 Bacteria 5718241
1303 2739316579 2738543025 Bacteria 6600348
1304 2743739921 2740892503 Bacteria 6855563
1305 2745006837 2744054620 Bacteria 6551379
1306 2765584553 2765235841 Bacteria 6137024
1307 2774121797 2773857670 Bacteria 6407454
1308 2774131454 2773857672 Bacteria 4993178
1309 2774137038 2773857673 Bacteria 6513460
1310 2777022168 2775507074 Bacteria 5532402
1311 2784262338 2784132063 Bacteria 6262788
1312 2784314460 2784132072 Bacteria 6596533
1313 2786667215 2786546132 Bacteria 10419719
1314 2792836299 2791355137 Bacteria 9654227
1315 2794598452 2791355520 Bacteria 5948615
1316 2807408852 2806310737 Bacteria 5751088
1317 2807457183 2806310745 Bacteria 5742165
1318 2808858176 2808606361 Bacteria 6136259
1319 2808926754 2808606376 Bacteria 6248667
1320 2808930855 2808606377 Bacteria 6646337
1321 2808938347 2808606378 Bacteria 6177535
1322 2808948913 2808606380 Bacteria 6248705
1323 2808952977 2808606381 Bacteria 6646461
1324 2808959301 2808606382 Bacteria 6841132
1325 2808966661 2808606383 Bacteria 6138645
1326 2808974601 2808606384 Bacteria 8474373
1327 2808977626 2808606385 Bacteria 6711065
1328 2808992716 2808606388 Bacteria 6706662
1329 2809001491 2808606389 Bacteria 6138126
1330 2809009431 2808606390 Bacteria 8476311
1331 2809016569 2808606391 Bacteria 8308166
1332 2809127467 2808606414 Bacteria 4917181
1333 2809219288 2808606445 Bacteria 6057339
1334 2812366502 2811994881 Bacteria 6298475
1335 2817257740 2816332253 Bacteria 6764532
1336 2817281862 2816332256 Bacteria 6891714
1337 2817451677 2816332286 Bacteria 6853759
1338 2817493535 2816332298 Bacteria 6852809
1339 2819637481 2818991452 Bacteria 8442785
1340 2819659176 2818991456 Bacteria 6123676
1341 2819706453 2818991464 Bacteria 6907494
1342 2823422116 2823421272 Bacteria 5372474
1343 2825655641 2825651385 Bacteria 6715909
1344 2826583915 2826581358 Bacteria 5963467
1345 2834033255 2834028612 Bacteria 6354979
1346 2840881643 2840878972 Bacteria 5483153
1347 2842338098 2842333319 Bacteria 8899485
1348 2842775940 2842775625 Bacteria 5587290
1349 2842809789 2842805378 Bacteria 5385175
1350 2842820239 2842815866 Bacteria 5947510
1351 2842829153 2842826826 Bacteria 5974129
1352 2842836983 2842832357 Bacteria 5959113
1353 2842840414 2842837860 Bacteria 6066181
1354 2842847720 2842843487 Bacteria 6004777
1355 2842850832 2842849001 Bacteria 5924277
1356 2842859672 2842854478 Bacteria 6143501
1357 2844666469 2844665904 Bacteria 6817974
1358 2847798095 2847797336 Bacteria 5176640
1359 2852618163 2852612431 Bacteria 6885235
1360 2852661011 2852657418 Bacteria 6472974
1361 2852673221 2852667396 Bacteria 6885555
1362 2856291754 2856287931 Bacteria 7223934
1363 2857363919 2857357740 Bacteria 9937880
1364 2858696409 2858688981 Bacteria 8184122
1365 2860343873 2860339153 Bacteria 6846989
1366 2860872529 2860867994 Bacteria 5645326
1367 2862512189 2862507626 Bacteria 9425308
1368 2862576644 2862574272 Bacteria 10567477
1369 2863423701 2863421361 Bacteria 7300805
1370 2869554533 2869551831 Bacteria 5474685
1371 2870073750 2870068957 Bacteria 8925310
1372 2871501980 2871495908 Bacteria 6935695
1373 2878034819 2878029506 Bacteria 6418441
1374 2878765783 2878760144 Bacteria 6823465
1375 2878772457 2878767105 Bacteria 6898628
1376 2880235464 2880230671 Bacteria 6140320
1377 2884089075 2884086401 Bacteria 5005459
1378 2885268304 2885266251 Bacteria 4796748
1379 2891673486 2891670763 Bacteria 4967099
1380 2895434520 2895427314 Bacteria 13147766
1381 2900582438 2900577576 Bacteria 5438534
1382 2903546729 2903540706 Bacteria 7062119
1383 2904514305 2904513164 Bacteria 5476410
1384 2904522968 2904518522 Bacteria 6068986
1385 2904555867 2904550169 Bacteria 6221258
1386 2904568274 2904564687 Bacteria 7609577
1387 2904575317 2904571731 Bacteria 7608790
1388 2904621922 2904615490 Bacteria 10047340
1389 2908452053 2908446538 Bacteria 6829095
1390 2912964460 2912963787 Bacteria 5646108
1391 2913042011 2913036834 Bacteria 6704877
1392 2917076183 2917070673 Bacteria 6868303
1393 2917836294 2917832318 Bacteria 5346010
1394 2919067801 2919063839 Bacteria 6302690
1395 2919108631 2919108558 Bacteria 5897419
1396 2919127582 2919125081 Bacteria 5385106
1397 2919157038 2919155634 Bacteria 4860545
1398 2919390691 2919385768 Bacteria 5897293
1399 2919461760 2919456309 Bacteria 6586567
1400 2919471029 2919468124 Bacteria 9133025
1401 2919485852 2919481497 Bacteria 6907839
1402 2919490967 2919487758 Bacteria 5929766
1403 2919506367 2919501602 Bacteria 5286340
1404 2919701473 2919697872 Bacteria 6553725
1405 2923159012 2923153595 Bacteria 6870622
1406 2923520532 2923519811 Bacteria 6298479
1407 2923590972 2923586266 Bacteria 6565975
1408 2926067437 2926063275 Bacteria 5285848
1409 2928059024 2928058823 Bacteria 5520022
1410 2928160644 2928157003 Bacteria 7522202
1411 2928169846 2928163908 Bacteria 7561269
1412 2928171514 2928170801 Bacteria 8785406
1413 2928536140 2928536128 Bacteria 7657547
1414 2929149392 2929144301 Bacteria 6622272
1415 2929194635 2929189879 Bacteria 5930554
1416 2931373193 2931369376 Bacteria 6847892
1417 2931395919 2931390751 Bacteria 6273349
1418 2931397544 2931396565 Bacteria 7251677
1419 2935359607 2935353572 Unclassified 6955622
1420 2938000588 2937994558 Bacteria 7036190
1421 2939641808 2939636861 Bacteria 6297853
1422 2939651969 2939651529 Bacteria 5895393
1423 2945931413 2945928738 Bacteria 6053221
1424 2945966271 2945961074 Bacteria 7342064
1425 2946007465 2946006987 Bacteria 6705746
1426 2946033130 2946027586 Bacteria 6049274
1427 2947233902 2947233263 Bacteria 6439278
1428 2954389601 2954380949 Bacteria 10050426
1429 2954682303 2954673503 Bacteria 9685905
1430 2954690621 2954682443 Bacteria 9862841
1431 2954700445 2954691527 Bacteria 10720516
1432 2954701783 2954701450 Bacteria 10834262
1433 2954729091 2954721474 Bacteria 10456478
1434 2958170959 2958165035 Bacteria 6906348
1435 2961169403 2961163497 Bacteria 6901077
1436 2965023655 2965018300 Bacteria 6883036
1437 2968177793 2968171901 Bacteria 6894245
1438 2969081787 2969079654 Bacteria 5439582
1439 2969309637 2969304461 Bacteria 6601805
1440 2970560639 2970554993 Bacteria 6814252
1441 2971823199 2971820967 Bacteria 5823634
1442 2974294631 2974289157 Bacteria 6080362
1443 2974301656 2974298342 Bacteria 4840922
1444 2981991713 2981990288 Bacteria 7590678
1445 2984287157 2984286254 Bacteria 6702062
1446 2984495086 2984494565 Bacteria 5000175
1447 2984500770 2984499530 Bacteria 5020881
1448 2984507305 2984504281 Bacteria 5262371
1449 2984564212 2984559226 Bacteria 5683096
1450 2984596947 2984595703 Bacteria 5682994
1451 2987665619 2987659509 Bacteria 6966464
1452 2988730936 2988728565 Bacteria 6124362
1453 2990263167 2990261002 Bacteria 4919493
1454 2998144887 2998139840 Bacteria 6073514
1455 3000379131 3000376612 Bacteria 4705565
1456 3003666042 3003665799 Bacteria 7279786
1457 3004194591 3004188549 Bacteria 6952365
1458 3007318310 3007315729 Bacteria 5076637
1459 3007398633 3007395558 Bacteria 6755444
1460 3007420364 3007419365 Bacteria 7026924
1461 3007516671 3007511990 Bacteria 6481491
1462 3007619160 3007614139 Bacteria 6053559
1463 3007621097 3007619802 Bacteria 6411688
1464 3007722277 3007718800 Bacteria 5971527
1465 3007808873 3007803356 Bacteria 5931491
1466 3007860091 3007855910 Bacteria 5637581
1467 3007866342 3007861166 Bacteria 6045338
1468 3007870956 3007866637 Bacteria 5899198
1469 3007874287 3007872151 Bacteria 5268868
1470 637322720 637000220 Bacteria 7074893
1471 640486156 640427133 Bacteria 4567418
1472 642592860 642555112 Bacteria 8676562
1473 651174130 651053060 Bacteria 4689946
1474 8004596635 8004592986 Bacteria 5122074
1475 8011354165 8011350971 Bacteria 6158957
1476 8015693089 8015687852 Bacteria 6613826
1477 8016730588 8016728285 Bacteria 5263933
1478 8018853593 8018845410 Bacteria 8933938
1479 8019781910 8019775933 Bacteria 6858656
1480 8020808084 8020807995 Bacteria 6801506
1481 8020940871 8020938398 Bacteria 7472757
1482 8020947932 8020945358 Bacteria 8467355
1483 8020956582 8020953355 Bacteria 7439080
1484 8021123665 8021120328 Bacteria 8782274
1485 8029996011 8029995093 Bacteria 5990776
1486 8034966927 8034962539 Bacteria 4884839
1487 8039103455 8039098773 Bacteria 6602928
1488 8040168451 8040167225 Bacteria 6542727
1489 8040178108 8040173305 Bacteria 6827067
1490 8052496739 8052494512 Bacteria 5765634
1491 8054289290 8054285046 Bacteria 6919322
1492 8054353029 8054347763 Bacteria 5901107
1493 8054508423 8054503363 Bacteria 6101651
1494 8054931264 8054929484 Bacteria 5599761
1495 8055776338 8055770955 Bacteria 6827675
1496 8055823377 8055817908 Bacteria 6609162
1497 8055882021 8055878733 Bacteria 5907058
1498 8056118661 8056115690 Bacteria 5527654
1499 8056122989 8056120720 Bacteria 5758328
1500 8056131098 8056125926 Bacteria 6228218
1501 8056136773 8056131705 Bacteria 6107031
1502 8056140407 8056137416 Bacteria 6147080
1503 8056148217 8056143049 Bacteria 6307666
1504 8056150250 8056148874 Bacteria 6479865
1505 8056156298 8056155041 Bacteria 6486948
1506 8056163091 8056161164 Bacteria 6106669
1507 8056171680 8056166840 Bacteria 5820959
1508 8056172363 8056172158 Bacteria 6133900
1509 8056179161 8056177738 Bacteria 6748268
1510 8056571917 8056569372 Bacteria 5997322
1511 8057163465 8057160832 Bacteria 3268302
1512 8057309455 8057304971 Bacteria 4649742
1513 MRS2a_Contig_62
1514 JGI24741J21665_1001052
1515 JGI24740J21852_10000047
1516 JGI24740J21852_10000084
1517 JGI24739J22299_10000109
1518 JGI24735J21928_10000736
1519 JGI24735J21928_10001143
1520 JGI25156J39149_1001527
1521 JGI25156J39149_1007207
1522 JGI25162J39368_1000136
1523 JGI25162J39368_1000155
1524 JGI25154J39366_1000668
1525 JGI25163J39215_1001445
1526 JGI25163J39215_1001478
1527 JGI25164J39214_1000121
1528 JGI25164J39214_1000258
1529 JGI25406J46586_10003870
1530 JGI25406J46586_10005301
1531 JGI25406J46586_10011140
1532 JGI25165J46597_1000037
1533 JGI25165J46597_1000222
1534 JGI25165J46597_1000240
1535 JGI25160J50197_1000084
1536 Ga0007417J51691_1020671
1537 Ga0007416J51690_1015306
1538 Ga0055538_1000065
1539 Ga0055539_1000099
1540 Ga0055539_1000203
1541 Ga0055533_1000109
1542 Ga0055533_1000963
1543 Ga0055532_1000037
1544 Ga0055532_1000094
1545 Ga0055532_1001155
1546 Ga0055532_1001302
1547 Ga0055532_1001303
1548 Ga0055525_1000143
1549 Ga0055525_1000453
1550 Ga0055527_1000487
1551 Ga0055527_1000666
1552 Ga0055535_1000018
1553 Ga0055535_1002068
1554 Ga0055535_1002073
1555 Ga0055542_1000492
1556 Ga0055542_1001925
1557 Ga0055529_1000041
1558 Ga0055529_1000398
1559 Ga0055536_1000059
1560 Ga0055536_1000403
1561 Ga0055530_10000036
1562 Ga0055530_10000096
1563 Ga0055530_10000898
1564 Ga0055530_10010435
1565 Ga0055540_1000072
1566 Ga0055540_1000084
1567 Ga0055540_1000650
1568 Ga0055531_10000266
1569 Ga0055541_1000066
1570 Ga0055541_1000400
1571 Ga0058692_1003634
1572 Ga0065165_1000329
1573 Ga0065714_10004633
1574 Ga0065714_10065746
1575 Ga0065714_10066371
1576 Ga0065714_10073413
1577 Ga0065704_10000968
1578 Ga0065704_10002901
1579 Ga0070658_10005515
1580 Ga0070670_100001749
1581 Ga0070670_100002250
1582 Ga0068869_100039777
1583 Ga0070660_100000323
1584 Ga0070661_100000131
1585 Ga0070661_100000208
1586 Ga0070668_100006472
1587 Ga0070669_100000089
1588 Ga0070669_100003603
1589 Ga0070669_100059879
1590 Ga0070674_100086613
1591 Ga0070673_100024041
1592 Ga0070688_100054230
1593 Ga0070659_100000767
1594 Ga0070659_100011714
1595 Ga0070659_100034409
1596 Ga0070667_100019878
1597 Ga0070667_100069368
1598 Ga0070713_100101859
1599 Ga0070663_100000018
1600 Ga0070663_100000054
1601 Ga0070663_100005663
1602 Ga0070662_100011108
1603 Ga0070681_10030867
1604 Ga0068867_100091068
1605 Ga0070684_100019193
1606 Ga0068853_100002936
1607 Ga0068853_100009512
1608 Ga0070665_100004426
1609 Ga0070665_100025119
1610 Ga0070665_100042556
1611 Ga0070665_100073035
1612 Ga0068855_100002550
1613 Ga0068855_100058403
1614 Ga0070664_100000040
1615 Ga0070664_100000145
1616 Ga0070664_100055941
1617 Ga0068857_100049912
1618 Ga0068854_100000034
1619 Ga0068856_100000115
1620 Ga0068856_100026846
1621 Ga0068852_100028695
1622 Ga0068859_100189613
1623 Ga0068864_100032921
1624 Ga0068851_10000002
1625 Ga0081538_10002736
1626 Ga0081538_10014327
1627 Ga0081540_1007143
1628 Ga0081539_10000195
1629 Ga0081539_10000984
1630 Ga0081539_10001258
1631 Ga0075432_10000232
1632 Ga0075432_10001524
1633 Ga0075367_10019492
1634 Ga0075428_100018426
1635 Ga0075428_100054730
1636 Ga0075430_100002673
1637 Ga0075431_100002927
1638 Ga0075433_10001156
1639 Ga0075434_100001406
1640 Ga0075429_100002737
1641 Ga0075436_100001013
1642 Ga0097620_100189594
1643 Ga0099823_1000027
1644 Ga0079104_1000116
1645 Ga0079104_1000283
1646 Ga0079104_1001497
1647 Ga0099794_10028139
1648 Ga0105251_10000050
1649 Ga0105251_10000198
1650 Ga0105251_10000214
1651 Ga0105251_10000503
1652 Ga0105251_10000587
1653 Ga0105251_10000846
1654 Ga0105251_10000972
1655 Ga0105251_10001413
1656 Ga0105251_10001672
1657 Ga0105251_10015856
1658 Ga0105244_10000037
1659 Ga0105244_10000155
1660 Ga0105244_10000312
1661 Ga0105244_10000597
1662 Ga0105244_10000983
1663 Ga0105244_10001542
1664 Ga0105244_10002341
1665 Ga0105244_10002409
1666 Ga0105244_10002423
1667 Ga0105244_10003296
1668 Ga0105244_10005647
1669 Ga0105244_10006359
1670 Ga0105244_10009740
1671 Ga0105244_10017978
1672 Ga0105244_10027743
1673 Ga0105244_10046658
1674 Ga0105250_10000130
1675 Ga0105250_10000194
1676 Ga0105250_10001047
1677 Ga0105250_10001149
1678 Ga0105250_10002250
1679 Ga0105250_10006244
1680 Ga0105240_10006023
1681 Ga0105240_10031525
1682 Ga0105240_10035859
1683 Ga0105240_10040802
1684 Ga0105240_10041129
1685 Ga0105240_10129552
1686 Ga0111539_10008028
1687 Ga0105245_10012857
1688 Ga0105245_10026163
1689 Ga0105247_10000117
1690 Ga0105243_10000115
1691 Ga0105243_10001986
1692 Ga0105243_10006536
1693 Ga0105242_10008641
1694 Ga0105248_10053252
1695 Ga0105237_10002290
1696 Ga0105237_10009645
1697 Ga0105237_10018573
1698 Ga0105238_10014016
1699 Ga0105239_10004584
1700 Ga0105239_10019132
1701 Ga0105246_10000023
1702 Ga0157373_10002554
1703 Ga0157373_10007818
1704 Ga0157373_10033515
1705 Ga0157373_10045414
1706 Ga0157373_10063394
1707 Ga0157371_10000104
1708 Ga0157371_10000185
1709 Ga0157371_10000282
1710 Ga0157371_10000427
1711 Ga0157371_10028344
1712 Ga0157371_10059770
1713 Ga0157370_10000348
1714 Ga0157370_10000558
1715 Ga0157370_10001357
1716 Ga0157370_10004203
1717 Ga0157370_10010485
1718 Ga0157370_10031441
1719 Ga0157370_10039514
1720 Ga0157370_10061262
1721 Ga0157369_10005144
1722 Ga0157369_10007420
1723 Ga0157369_10014391
1724 Ga0157369_10024104
1725 Ga0157369_10033288
1726 Ga0157374_10000053
1727 Ga0163162_10000327
1728 Ga0163162_10001680
1729 Ga0163162_10002655
1730 Ga0163162_10003675
1731 Ga0157372_10000637
1732 Ga0157372_10000654
1733 Ga0157372_10003030
1734 Ga0157375_10004869
1735 Ga0157375_10023452
1736 Ga0157375_10025963
1737 Ga0163163_10059422
1738 Ga0182008_10000852
1739 Ga0182008_10004259
1740 Ga0182008_10006951
1741 Ga0182008_10008539
1742 Ga0182008_10008870
1743 Ga0182008_10012146
1744 Ga0182008_10024794
1745 Ga0182006_1000501
1746 Ga0182006_1000547
1747 Ga0182006_1001042
1748 Ga0182006_1003853
1749 Ga0182006_1004486
1750 Ga0182006_1014013
1751 Ga0182007_10000290
1752 Ga0182007_10006145
1753 Ga0182005_1000454
1754 Ga0182005_1000471
1755 Ga0182005_1016780
1756 Ga0183367_1001
1757 Ga0183361_10024
1758 Ga0163161_10000001
1759 Ga0163161_10001478
1760 Ga0163161_10006343
1761 Ga0163161_10016238
1762 Ga0163161_10024717
1763 Ga0163161_10039432
1764 Ga0163161_10052082
1765 Ga0163161_10060970
1766 Ga0154015_1222406
1767 Ga0213875_10000207
1768 Ga0213875_10000315
1769 Ga0213875_10037826
1770 Ga0209760_100102
1771 Ga0209760_100190
1772 Ga0209784_100101
1773 Ga0209784_100246
1774 Ga0209784_100301
1775 Ga0209784_101596
1776 Ga0209566_100123
1777 Ga0209566_100329
1778 Ga0209566_100341
1779 Ga0209566_100403
1780 Ga0209566_102957
1781 Ga0209674_100131
1782 Ga0209674_100145
1783 Ga0209674_100238
1784 Ga0209674_100814
1785 Ga0209672_100012
1786 Ga0209672_100057
1787 Ga0209672_100260
1788 Ga0209672_100429
1789 Ga0209147_100005
1790 Ga0209147_100007
1791 Ga0209147_100047
1792 Ga0209147_100151
1793 Ga0209147_100241
1794 Ga0209147_100747
1795 Ga0209563_100128
1796 Ga0209563_100170
1797 Ga0209563_100197
1798 Ga0207427_100056
1799 Ga0207427_100063
1800 Ga0209437_100065
1801 Ga0209437_100133
1802 Ga0209258_100007
1803 Ga0209258_100014
1804 Ga0209258_100065
1805 Ga0209258_100241
1806 Ga0209646_1000058
1807 Ga0209646_1000314
1808 Ga0209026_1002579
1809 Ga0209677_100094
1810 Ga0209677_100206
1811 Ga0209148_1000043
1812 Ga0209148_1001167
1813 Ga0209148_1001250
1814 Ga0209759_1002975
1815 Ga0209233_1000085
1816 Ga0209233_1000133
1817 Ga0209455_1000011
1818 Ga0209455_1000074
1819 Ga0209455_1002086
1820 Ga0209673_1000198
1821 Ga0209675_1001502
1822 Ga0209676_1000076
1823 Ga0209676_1000264
1824 Ga0209676_1000313
1825 Ga0209676_1000825
1826 Ga0209676_1003296
1827 Ga0209676_1003301
1828 Ga0209564_1010435
1829 Ga0209050_1000063
1830 Ga0209050_1000080
1831 Ga0209050_1000106
1832 Ga0209050_1001454
1833 Ga0207426_1000128
1834 Ga0207426_1007653
1835 Ga0209051_1000045
1836 Ga0209051_1000082
1837 Ga0209051_1000139
1838 Ga0209051_1009142
1839 Ga0209257_1000539
1840 Ga0207656_10000010
1841 Ga0207696_1000001
1842 Ga0207696_1000023
1843 Ga0207696_1000047
1844 Ga0207696_1000116
1845 Ga0207696_1000126
1846 Ga0207696_1000255
1847 Ga0207696_1001069
1848 Ga0207696_1002513
1849 Ga0207696_1006398
1850 Ga0207655_1000015
1851 Ga0207655_1000027
1852 Ga0207655_1000039
1853 Ga0207655_1000117
1854 Ga0207655_1000120
1855 Ga0207655_1000378
1856 Ga0207655_1000862
1857 Ga0207655_1001095
1858 Ga0207655_1004674
1859 Ga0207655_1008994
1860 Ga0207655_1010449
1861 Ga0207655_1012990
1862 Ga0207655_1012996
1863 Ga0207655_1016086
1864 Ga0207655_1020666
1865 Ga0207655_1021364
1866 Ga0207655_1030107
1867 Ga0207655_1032009
1868 Ga0207713_1000002
1869 Ga0207713_1000003
1870 Ga0207713_1000016
1871 Ga0207713_1000049
1872 Ga0207713_1000229
1873 Ga0207713_1000233
1874 Ga0207713_1000245
1875 Ga0207713_1000335
1876 Ga0207713_1002628
1877 Ga0207713_1003264
1878 Ga0207713_1004283
1879 Ga0207713_1005351
1880 Ga0207713_1009539
1881 Ga0207713_1012366
1882 Ga0207713_1017097
1883 Ga0207682_10000400
1884 Ga0207710_10000185
1885 Ga0207647_10004131
1886 Ga0207647_10007845
1887 Ga0207699_10028304
1888 Ga0207645_10053771
1889 Ga0207705_10016715
1890 Ga0207695_10003825
1891 Ga0207695_10005348
1892 Ga0207695_10011262
1893 Ga0207695_10098771
1894 Ga0207671_10000613
1895 Ga0207671_10033514
1896 Ga0207671_10070977
1897 Ga0207662_10011739
1898 Ga0207657_10000152
1899 Ga0207657_10013134
1900 Ga0207649_10000023
1901 Ga0207649_10000315
1902 Ga0207681_10000134
1903 Ga0207694_10023900
1904 Ga0207694_10076953
1905 Ga0207650_10000231
1906 Ga0207650_10001368
1907 Ga0207690_10000038
1908 Ga0207690_10007440
1909 Ga0207706_10000056
1910 Ga0207706_10008880
1911 Ga0207709_10000030
1912 Ga0207709_10000127
1913 Ga0207709_10017068
1914 Ga0207670_10034626
1915 Ga0207711_10090384
1916 Ga0207679_10000017
1917 Ga0207679_10000041
1918 Ga0207667_10001407
1919 Ga0207667_10062639
1920 Ga0207668_10062336
1921 Ga0207640_10000252
1922 Ga0207639_10000871
1923 Ga0207678_10000027
1924 Ga0207678_10000109
1925 Ga0207702_10000059
1926 Ga0207702_10037315
1927 Ga0207648_10087023
1928 Ga0207676_10020555
1929 Ga0207674_10042715
1930 Ga0207674_10042812
1931 Ga0207683_10007005
1932 Ga0207698_10036300
1933 Ga0209281_1000070
1934 Ga0209281_1000127
1935 Ga0209281_1001234
1936 Ga0209281_1005195
1937 Ga0209389_1000118
1938 Ga0209371_1000236
1939 Ga0209371_1000368
1940 Ga0209371_1000629
1941 Ga0209371_1002412
1942 Ga0209974_10012108
1943 Ga0207428_10000808
1944 Ga0207428_10003112
1945 Ga0207428_10015193
1946 Ga0207428_10026098
1947 Ga0207428_10048502
1948 Ga0207428_10062798
1949 Ga0268266_10032610
1950 Ga0307517_10001714
1951 Ga0307517_10027262
1952 Ga0307515_10011157
1953 Ga0307515_10014250
1954 Ga0307515_10056015
1955 Ga0268256_1000220
1956 Ga0268256_1000313
1957 Ga0268256_1000723
1958 Ga0268256_1002142
1959 Ga0307511_10002619
1960 Ga0307511_10026933
1961 Ga0307512_10002928
1962 Ga0307512_10009670
1963 Ga0314311_1018153
1964 Ga0316178_1041886
1965 Ga0265332_10001867
1966 Ga0265316_10073510
1967 Ga0307513_10004264
1968 Ga0307509_10022042
1969 Ga0307408_100000013
1970 Ga0307408_100008150
1971 Ga0307408_100009474
1972 Ga0307408_100041361
1973 Ga0307508_10001385
1974 Ga0307516_10000208
1975 Ga0307516_10021811
1976 Ga0307516_10128845
1977 Ga0307405_10000226
1978 Ga0307405_10006873
1979 Ga0307518_10023816
1980 Ga0307518_10039030
1981 Ga0307410_10012564
1982 Ga0307406_10015120
1983 Ga0307412_10000963
1984 Ga0307412_10004042
1985 Ga0307412_10008009
1986 Ga0307412_10058182
1987 Ga0307412_10069045
1988 Ga0307409_100020194
1989 Ga0307409_100022951
1990 Ga0307416_100030774
1991 Ga0307414_10003912
1992 Ga0307414_10090762
1993 Ga0307411_10081424
1994 Ga0307415_100000639
1995 Ga0307507_10014438
1996 Ga0307510_10010329
1997 Ga0373951_0000081
1998 Ga0373936_0000845
1999 Ga0373953_0003820
2000 Ga0373955_0000697
2001 Ga0373924_0000297
2002 Ga0373935_0000530
2003 Ga0373927_0004554
2004 Ga0373933_0002386
2005 Ga0373947_0001048
2006 Ga0373937_0000212
2007 Ga0373925_0000002
2008 Ga0395899_0000023
2009 Ga0395900_0000019
2010 Ga0395900_0011145
2011 Ga0395898_0000016
2012 Ga0395898_0029092
2013 Ga0395905_0000139
2014 Ga0436364_0796339
2015 Ga0436364_1383349
2016 Ga0436364_1481155
2017 Ga0436364_1483536
2018 Ga0395901_0000038
2019 Ga0237819_00203
2020 Ga0436365_0208634
2021 Ga0436365_0505152
2022 Ga0436365_0622916
2023 Ga0436365_1168445
2024 Ga0436365_1888304
2025 Ga0436361_1051656
2026 Ga0436361_1158602
2027 Ga0436361_1163181
2028 Ga0436363_0168519
2029 Ga0436362_0823318
2030 Ga0439436_0002355
2031 Ga0439438_001110
2032 Ga0439438_002344
2033 Ga0439438_002767
2034 Ga0439438_003268
2035 Ga0439438_004274
2036 Ga0439438_004325
2037 Ga0439438_007582
2038 Ga0439438_010915
2039 Ga0439438_014171
2040 Ga0439447_000104
2041 Ga0439447_000895
2042 Ga0439453_0000241
2043 Ga0439466_0000970
2044 Ga0439466_0009195
2045 Ga0439466_0011495
2046 Ga0439466_0020606
2047 Ga0439448_0000969
2048 Ga0439432_002681
2049 Ga0439432_003740
2050 Ga0439432_006543
2051 Ga0439432_021032
2052 Ga0439451_000619
2053 Ga0439452_000009
2054 Ga0439452_000085
2055 Ga0439452_000136
2056 Ga0439452_000149
2057 Ga0439452_008205
2058 Ga0439456_000013
2059 Ga0439456_005766
2060 Ga0439463_000698
2061 Ga0450911_001434
2062 Ga0450890_000250
2063 Ga0450904_002253
2064 Ga0450905_000018
2065 Ga0450906_006644
2066 Ga0450907_000025
2067 Ga0450907_002473
2068 Ga0450909_001728
2069 Ga0439434_0004591
2070 Ga0439460_0010550
2071 Ga0466986_0004181
2072 Ga0466969_0000375
2073 Ga0466969_0002196
2074 Ga0466969_0014453
2075 Ga0466972_0003056
2076 Ga0466973_0010320
2077 Ga0466978_0016238
2078 Ga0466982_0026631
2079 Ga0466966_0000020
2080 Ga0466966_0010767
2081 Ga0466961_0000024
2082 Ga0466961_0000043
2083 Ga0466961_0000622
2084 Ga0466961_0000999
2085 Ga0466961_0008631
2086 Ga0466961_0017210
2087 Ga0466963_0004216
2088 Ga0466963_0027977
2089 Ga0466964_0003088
2090 Ga0466964_0005300
2091 Ga0466971_0006666
2092 Ga0466970_0000611
2093 Ga0466970_0002332
2094 Ga0466970_0020134
2095 Ga0466957_0038248
2096 Ga0466960_0045580
2097 Ga0466959_0002813
2098 Ga0466959_0039214
2099 Ga0466958_0001628
2100 Ga0466967_0015670
2101 Ga0466967_0070991
2102 Ga0495617_000168
2103 Ga0495627_000020
2104 Ga0495627_000060
2105 Ga0495627_000154
2106 Ga0495627_000221
2107 Ga0495627_001421
2108 Ga0495627_004126
2109 Ga0495592_0000265
2110 Ga0495592_0006424
2111 Ga0495603_0001706
2112 Ga0495603_0003656
2113 Ga0495603_0005348
2114 Ga0495603_0005980
2115 Ga0495603_0011355
2116 Ga0495590_0000447
2117 Ga0495590_0001119
2118 Ga0495590_0009784
2119 Ga0495590_0018094
2120 Ga0495590_0018589
2121 Ga0495591_000058
2122 Ga0495591_000074
2123 Ga0495591_000165
2124 Ga0495591_000419
2125 Ga0495591_006472
2126 Ga0495591_007109
2127 Ga0495591_008093
2128 Ga0495591_011332
2129 Ga0495591_012070
2130 Ga0495629_0000238
2131 Ga0495629_0013407
2132 Ga0495629_0016863
2133 Ga0495638_0000428
2134 Ga0495638_0001172
2135 Ga0495638_0005050
2136 Ga0495638_0006257
2137 Ga0495638_0015145
2138 Ga0495638_0015253
2139 Ga0495638_0017295
2140 Ga0495638_0038299
2141 Ga0495651_0014887
2142 Ga0495653_0000006
2143 Ga0495653_0000332
2144 Ga0495653_0005802
2145 Ga0495653_0019424
2146 Ga0495653_0056660
2147 Ga0495650_0000765
2148 Ga0495650_0000966
2149 Ga0495650_0006120
2150 Ga0495650_0006565
2151 Ga0495580_0035115
2152 Ga0495605_0000048
2153 Ga0495605_0000091
2154 Ga0495605_0000953
2155 Ga0495605_0003434
2156 Ga0495605_0005869
2157 Ga0495605_0012168
2158 Ga0495605_0026464
2159 Ga0495605_0031113
2160 Ga0495639_0000041
2161 Ga0495662_0001839
2162 Ga0495664_0000002
2163 Ga0495664_0000843
2164 Ga0495584_0003348
2165 Ga0495584_0003833
2166 Ga0495584_0004401
2167 Ga0495584_0006209
2168 Ga0495584_0015515
2169 Ga0495585_0000937
2170 Ga0495585_0003124
2171 Ga0495585_0005080
2172 Ga0495585_0008082
2173 Ga0495585_0009962
2174 Ga0495585_0014914
2175 Ga0495594_0011179
2176 Ga0495596_0000109
2177 Ga0495607_0000139
2178 Ga0495607_0000190
2179 Ga0495607_0000330
2180 Ga0495607_0000395
2181 Ga0495607_0001876
2182 Ga0495607_0002335
2183 Ga0495607_0002507
2184 Ga0495607_0007196
2185 Ga0495607_0007963
2186 Ga0495607_0021823
2187 Ga0495607_0021851
2188 Ga0495607_0034982
2189 Ga0495607_0041655
2190 Ga0495607_0049523
2191 Ga0495583_0000187
2192 Ga0495583_0000206
2193 Ga0495583_0001258
2194 Ga0495583_0002463
2195 Ga0495583_0002998
2196 Ga0495583_0012055
2197 Ga0495583_0014705
2198 Ga0495583_0033154
2199 Ga0495606_0000177
2200 Ga0495606_0000287
2201 Ga0495606_0000324
2202 Ga0495606_0001537
2203 Ga0495606_0004243
2204 Ga0495606_0004992
2205 Ga0495606_0006124
2206 Ga0495606_0019151
2207 Ga0495606_0020543
2208 Ga0495606_0021126
2209 Ga0495606_0027210
2210 Ga0495608_0000006
2211 Ga0495610_0011194
2212 Ga0495616_0005222
2213 Ga0495616_0008607
2214 Ga0495616_0012882
2215 Ga0495616_0044536
2216 Ga0495618_0000282
2217 Ga0495620_0000012
2218 Ga0495620_0000742
2219 Ga0495620_0001923
2220 Ga0495620_0003045
2221 Ga0495620_0003619
2222 Ga0495620_0004446
2223 Ga0495620_0014976
2224 Ga0495620_0023845
2225 Ga0495628_0000002
2226 Ga0495628_0022270
2227 Ga0495628_0060872
2228 Ga0495630_0005689
2229 Ga0495631_0000423
2230 Ga0495631_0000472
2231 Ga0495631_0002057
2232 Ga0495631_0004989
2233 Ga0495632_0000803
2234 Ga0495632_0002609
2235 Ga0495632_0003915
2236 Ga0495632_0006163
2237 Ga0495632_0014674
2238 Ga0495632_0019983
2239 Ga0495632_0038915
2240 Ga0495637_0000016
2241 Ga0495637_0000409
2242 Ga0495637_0002003
2243 Ga0495637_0002806
2244 Ga0495637_0003940
2245 Ga0495637_0004776
2246 Ga0495637_0006218
2247 Ga0495637_0007095
2248 Ga0495637_0013562
2249 Ga0495643_0000593
2250 Ga0495643_0001236
2251 Ga0495643_0006380
2252 Ga0495643_0016201
2253 Ga0495643_0019417
2254 Ga0495643_0020324
2255 Ga0495643_0039549
2256 Ga0495644_0006100
2257 Ga0495644_0011746
2258 Ga0495648_0002180
2259 Ga0495648_0003559
2260 Ga0495648_0008219
2261 Ga0495648_0012385
2262 Ga0495648_0015509
2263 Ga0495648_0048448
2264 Ga0495648_0057452
2265 Ga0495666_0009349
2266 Ga0495642_0003556
2267 Ga0495642_0028116
2268 Ga0495652_0000004
2269 Ga0495652_0045709
2270 Ga0495654_0000341
2271 Ga0495654_0000771
2272 Ga0495654_0001231
2273 Ga0495654_0001742
2274 Ga0495654_0001915
2275 Ga0495654_0002274
2276 Ga0495654_0007083
2277 Ga0495654_0007255
2278 Ga0495654_0031333
2279 Ga0495654_0032387
2280 Ga0495654_0062948
2281 Ga0495640_0000007
2282 Ga0495586_0027131
2283 Ga0495587_0000031
2284 Ga0495587_0001669
2285 Ga0495587_0011584
2286 Ga0495609_0000231
2287 Ga0495609_0001798
2288 Ga0495609_0002652
2289 Ga0495609_0005747
2290 Ga0495609_0005771
2291 Ga0495597_0000175
2292 Ga0495597_0000837
2293 Ga0495597_0002042
2294 Ga0495597_0003647
2295 Ga0495597_0003687
2296 Ga0495597_0009080
2297 Ga0495597_0021139
2298 Ga0495597_0029025
2299 Ga0495645_0000003
2300 Ga0495645_0001142
2301 Ga0495622_0001392
2302 Ga0495622_0003639
2303 Ga0495622_0004703
2304 Ga0495622_0008750
2305 Ga0495633_0002225
2306 Ga0495633_0007192
2307 Ga0495633_0007220
2308 Ga0495667_0000002
2309 Ga0495668_0000469
2310 Ga0495668_0008984
2311 Ga0495668_0009110
2312 Ga0495668_0015020
2313 Ga0495634_0000110
2314 Ga0495634_0007128
2315 Ga0495634_0023082
2316 Ga0495634_0054992
2317 Ga0495611_0000122
2318 Ga0495611_0000663
2319 Ga0495611_0001621
2320 Ga0495611_0002019
2321 Ga0495611_0031117
2322 Ga0495625_0000015
2323 Ga0495625_0001457
2324 Ga0495625_0002724
2325 Ga0495625_0004443
2326 Ga0495625_0018911
2327 Ga0495625_0022007
2328 Ga0495625_0030056
2329 Ga0495625_0052325
2330 Ga0495635_0000022
2331 Ga0495635_0000520
2332 Ga0495635_0015127
2333 Ga0495659_0001226
2334 Ga0495661_0000001
2335 Ga0495661_0000075
2336 Ga0495661_0000491
2337 Ga0495661_0001678
2338 Ga0495661_0002674
2339 Ga0495661_0022703
2340 Ga0495661_0024597
2341 Ga0495657_0002481
2342 Ga0495599_0000001
2343 Ga0495623_0000898
2344 Ga0495646_0000007
2345 Ga0495646_0006657
2346 Ga0495646_0008412
2347 Ga0495613_0001531
2348 Ga0495613_0014177
2349 Ga0495613_0042616
2350 Ga0495624_0006117
2351 Ga0495670_0000195
2352 Ga0495670_0003338
2353 Ga0495670_0032037
2354 Ga0495671_0000011
2355 Ga0495671_0000348
2356 Ga0495671_0001149
2357 Ga0495671_0002810
2358 Ga0495671_0006736
2359 Ga0495671_0008036
2360 Ga0495671_0009197
2361 Ga0495671_0009230
2362 Ga0495671_0019129
2363 Ga0495671_0032706
2364 Ga0495671_0051075
2365 Ga0495649_0000272
2366 Ga0495649_0002881
2367 Ga0495649_0003495
2368 Ga0495649_0012114
2369 Ga0495649_0014303
2370 Ga0495649_0024100
2371 Ga0495649_0026241
2372 Ga0495649_0027247
2373 Ga0495649_0045078
2374 Ga0495649_0060125
2375 Ga0495589_0000576
2376 Ga0495589_0001356
2377 Ga0495589_0002374
2378 Ga0495589_0006384
2379 Ga0495589_0007131
2380 Ga0495589_0012439
2381 Ga0495660_0000829
2382 Ga0495660_0001599
2383 Ga0495660_0014955
2384 Ga0495660_0018964
2385 Ga0495660_0031227
2386 Ga0495660_0048045
2387 Ga0495660_0048956
2388 Ga0495581_0001847
2389 Ga0495581_0008885
2390 Ga0495581_0012229
2391 Ga0495604_0000005
2392 Ga0495604_0006222
2393 Ga0495604_0034073
2394 Ga0495636_0001195
2395 Ga0495674_0000003
2396 Ga0495674_0017007
2397 Ga0495672_0000059
2398 Ga0495672_0002933
2399 Ga0495672_0004094
2400 Ga0495672_0004404
2401 Ga0495672_0004737
2402 Ga0495672_0005320
2403 Ga0495672_0006304
2404 Ga0495672_0006980
2405 Ga0495672_0015319
2406 Ga0495672_0033075
2407 Ga0495672_0037276
2408 Ga0495672_0039134
2409 Ga0495672_0078362
2410 Ga0495676_0000001
2411 Ga0495676_0002451
2412 Ga0495676_0003597
2413 Ga0495676_0015876
2414 Ga0495680_0000091
2415 Ga0495680_0005855
2416 Ga0495683_0000043
2417 Ga0495683_0001732
2418 Ga0495683_0003532
2419 Ga0495683_0003604
2420 Ga0495683_0009926
2421 Ga0495683_0010099
2422 Ga0495683_0030225
2423 Ga0495687_000015
2424 Ga0495687_002768
2425 Ga0495687_005668
2426 Ga0495687_007146
2427 Ga0495687_014931
2428 Ga0495687_018435
2429 Ga0495675_0000133
2430 Ga0495679_000071
2431 Ga0495679_000081
2432 Ga0495679_002408
2433 Ga0495679_002727
2434 Ga0495679_021932
2435 Ga0495685_007417
2436 Ga0495673_0000013
2437 Ga0495673_0000924
2438 Ga0495673_0001422
2439 Ga0495673_0001817
2440 Ga0495673_0001954
2441 Ga0495673_0004535
2442 Ga0495673_0004601
2443 Ga0495673_0006740
2444 Ga0495681_0000483
2445 Ga0495681_0001489
2446 Ga0495681_0002540
2447 Ga0495681_0004310
2448 Ga0495681_0004383
2449 Ga0495681_0006550
2450 Ga0495681_0007466
2451 Ga0495681_0008329
2452 Ga0495681_0018160
2453 Ga0495681_0021832
2454 Ga0495681_0027722
2455 Ga0495684_0000035
2456 Ga0495686_0000042
2457 Ga0495686_0010349
2458 Ga0495686_0020449
2459 Ga0495686_0021463
2460 Ga0495686_0064621
2461 Ga0495593_0000746
2462 Ga0495593_0003672
2463 Ga0495602_0000029
2464 Ga0495602_0019220
2465 Ga0495614_0002106
2466 Ga0495626_0000008
2467 Ga0495626_0000364
2468 Ga0495626_0000705
2469 Ga0495626_0000767
2470 Ga0495626_0002131
2471 Ga0495626_0004194
2472 Ga0495626_0005203
2473 Ga0495626_0005475
2474 Ga0495626_0008184
2475 Ga0495626_0046058
2476 Ga0496100_0004321
2477 Ga0496100_0005571
2478 Ga0496100_0023145
2479 Ga0496100_0027976
2480 Ga0496101_0000269
2481 Ga0496101_0008618
2482 Ga0496101_0020118
2483 Ga0496102_0000138
2484 Ga0496103_0002580
2485 Ga0496104_0029919
2486 Ga0496105_0011836
2487 Ga0496105_0028840
2488 Ga0496106_0006861
2489 Ga0496106_0018839
2490 Ga0496106_0078080
2491 Ga0496108_0006388
2492 Ga0496109_0007921
2493 Ga0496110_0019961
2494 Ga0496111_0028924
2495 Ga0496112_0001121
2496 Ga0496112_0015288
2497 Ga0496112_0026647
2498 Ga0496113_0017878
2499 Ga0496113_0033341
2500 Ga0496114_0003352
2501 Ga0496114_0018376
2502 Ga0496115_0137830
2503 Ga0496116_0000001
2504 Ga0496116_0000065
2505 Ga0496116_0000267
2506 Ga0496116_0000605
2507 Ga0496116_0003570
2508 Ga0496116_0013688
2509 Ga0496116_0038985
2510 Ga0496116_0053700
2511 Ga0496117_0000245
2512 Ga0496117_0000345
2513 Ga0496117_0000866
2514 Ga0496117_0001344
2515 Ga0496117_0002196
2516 Ga0496117_0002910
2517 Ga0496117_0002920
2518 Ga0496117_0004635
2519 Ga0496117_0005308
2520 Ga0496117_0021683
2521 Ga0496117_0030146
2522 Ga0496117_0049549
2523 Ga0496117_0063403
2524 Ga0496118_0001300
2525 Ga0496118_0004485
2526 Ga0496118_0008231
2527 Ga0496118_0008529
2528 Ga0496118_0011583
2529 Ga0496118_0023500
2530 Ga0496118_0024914
2531 Ga0496118_0034968
2532 Ga0496118_0035394
2533 Ga0496118_0039498
2534 Ga0496118_0049144
2535 Ga0496118_0056964
2536 Ga0496119_0000011
2537 Ga0496119_0001557
2538 Ga0496119_0007379
2539 Ga0496120_0000306
2540 Ga0496120_0001332
2541 Ga0496120_0029590
2542 Ga0496121_0000366
2543 Ga0496121_0000487
2544 Ga0496121_0000670
2545 Ga0496121_0010504
2546 Ga0496121_0014728
2547 Ga0496121_0027246
2548 Ga0496121_0031160
2549 Ga0496121_0087404
2550 Ga0496122_0000221
2551 Ga0496122_0000292
2552 Ga0496122_0001617
2553 Ga0496122_0009392
2554 Ga0496122_0009594
2555 Ga0496122_0011780
2556 Ga0496122_0019468
2557 Ga0496122_0068190
2558 Ga0496123_0000037
2559 Ga0496123_0000989
2560 Ga0496123_0001885
2561 Ga0496123_0003653
2562 Ga0496123_0013312
2563 Ga0496123_0017058
2564 Ga0496123_0024630
2565 Ga0496124_0000035
2566 Ga0496124_0000580
2567 Ga0496124_0001300
2568 Ga0496124_0001404
2569 Ga0496124_0002380
2570 Ga0496124_0012335
2571 Ga0496124_0013458
2572 Ga0496124_0014681
2573 Ga0496124_0022527
2574 Ga0496124_0032175
2575 Ga0496124_0054355
2576 Ga0496124_0073995
2577 Ga0496125_0000196
2578 Ga0496125_0004719
2579 Ga0496125_0005204
2580 Ga0496125_0011827
2581 Ga0496125_0020403
2582 Ga0496125_0022209
2583 Ga0496125_0022410
2584 Ga0496125_0042488
2585 Ga0496126_0000105
2586 Ga0496126_0002998
2587 Ga0496126_0005096
2588 Ga0496126_0008363
2589 Ga0496126_0033548
2590 Ga0496126_0035937
2591 Ga0496126_0088632
2592 Ga0495678_001085
2593 Ga0495678_002002
2594 Ga0495678_003062
2595 Ga0495678_003176
2596 Ga0495678_004295
2597 Ga0495678_004428
2598 Ga0495678_005242
2599 Ga0495678_024370
2600 Ga0495678_033623
2601 Ga0495682_0000113
2602 Ga0495682_0000118
2603 Ga0495682_0004503
2604 Ga0501034_0000248
2605 Ga0501039_0017022
2606 Ga0501073_0006663
2607 Ga0501083_0002432
2608 nmdc:mga06z11_11725_c1
2609 nmdc:mga05p37_2582_c1
2610 nmdc:mga09592_747_c1
2611 nmdc:mga0qj67_34105_c1
2612 nmdc:mga06r32_811_c1
2613 nmdc:mga08y16_34317_c1
2614 nmdc:mga0n895_29461_c1
2615 nmdc:mga08x19_16934_c1
2616 nmdc:mga0a205_2891_c1
2617 Ga0495601_0000008
2618 Ga0495612_0000026
2619 Ga0495612_0024122
2620 Ga0495595_0000024
2621 Ga0495619_0000002
2622 Ga0500572_002276
2623 Ga0500618_002165
2624 Ga0500659_0001817
2625 Ga0500559_0005743
2626 Ga0500604_0005290
2627 Ga0587090_000459
2628 Ga0587072_000018
2629 Ga0466962_0006789
2630 Ga0466962_0008470
2631 2506578563
2632 2506583702
2633 2510284240
2634 2510293076
2635 2510312577
2636 2511252944
2637 2511267140
2638 2511271378
2639 2511278513
2640 2511292311
2641 2511295260
2642 2511302551
2643 2511316087
2644 2511323199
2645 2511328088
2646 2511335043
2647 2511338341
2648 2511344529
2649 2511350915
2650 2511359891
2651 2511362073
2652 2511370615
2653 2511374932
2654 2511411427
2655 2511827092
2656 2512324702
2657 2514054968
2658 2519460470
2659 2554812594
2660 2555248339
2661 2555257435
2662 2555672301
2663 2563062836
2664 2583794739
2665 2585292965
2666 2585305990
2667 2597031047
2668 2597860373
2669 2597866117
2670 2597871943
2671 2599326775
2672 2599358256
2673 2599364611
2674 2599370853
2675 2599376875
2676 2599383421
2677 2599389868
2678 2599396157
2679 2599401423
2680 2599407997
2681 2599408936
2682 2599448175
2683 2599453108
2684 2599465071
2685 2599471388
2686 2599486785
2687 2599494014
2688 2599505184
2689 2599509863
2690 2599515113
2691 2599520277
2692 2599616915
2693 2599736060
2694 2599747981
2695 2599772884
2696 2599807091
2697 2599881714
2698 2599888198
2699 2599894493
2700 2599901020
2701 2599928603
2702 2599934504
2703 2599945083
2704 2599949337
2705 2599955188
2706 2599962750
2707 2599969299
2708 2599980630
2709 2599983921
2710 2599990361
2711 2599997403
2712 2600001697
2713 2600008439
2714 2600014278
2715 2600020856
2716 2600026261
2717 2600031811
2718 2600038652
2719 2600044102
2720 2600048895
2721 2600056078
2722 2600062749
2723 2600067744
2724 2600073845
2725 2600079531
2726 2600210769
2727 2600217804
2728 2600360337
2729 2600367113
2730 2600445252
2731 2601522547
2732 2601527574
2733 2601614405
2734 2601619125
2735 2601624441
2736 2601642255
2737 2601647117
2738 2601652552
2739 2601657878
2740 2601662078
2741 2601693953
2742 2601695036
2743 2601699708
2744 2601706397
2745 2601710703
2746 2601715717
2747 2601720059
2748 2601726123
2749 2601730664
2750 2601735680
2751 2601740948
2752 2601750878
2753 2601777971
2754 2601800469
2755 2602012363
2756 2602018132
2757 2603659440
2758 2603664715
2759 2603838056
2760 2603843134
2761 2603848207
2762 2603853282
2763 2603867226
2764 2603871333
2765 2603876264
2766 2606048526
2767 2606069142
2768 2606078723
2769 2606125617
2770 2606144964
2771 2606175927
2772 2608384907
2773 2621297358
2774 2624482884
2775 2624494426
2776 2637224807
2777 2643844805
2778 2643869707
2779 2643957571
2780 2644025685
2781 2644169092
2782 2644189063
2783 2644265148
2784 2644285985
2785 2644350504
2786 2644438017
2787 2644625334
2788 2650898178
2789 2652543963
2790 2656279538
2791 2671093914
2792 2671100785
2793 2671129995
2794 2671773351
2795 2676406076
2796 2676746243
2797 2677895821
2798 2678265600
2799 2686355178
2800 2689445113
2801 2713477031
2802 2715752319
2803 2715759059
2804 2718636097
2805 2723250848
2806 2738672917
2807 2738751310
2808 2738810266
2809 2738860351
2810 2738897626
2811 2739198177
2812 2739260941
2813 2739289590
2814 2739294902
2815 2739316579
2816 2743739921
2817 2745006837
2818 2765584553
2819 2774121797
2820 2774131454
2821 2774137038
2822 2777022168
2823 2784262338
2824 2784314460
2825 2786667215
2826 2792836299
2827 2794598452
2828 2807408852
2829 2807457183
2830 2808858176
2831 2808926754
2832 2808930855
2833 2808938347
2834 2808948913
2835 2808952977
2836 2808959301
2837 2808966661
2838 2808974601
2839 2808977626
2840 2808992716
2841 2809001491
2842 2809009431
2843 2809016569
2844 2809127467
2845 2809219288
2846 2812366502
2847 2817257740
2848 2817281862
2849 2817451677
2850 2817493535
2851 2819637481
2852 2819659176
2853 2819706453
2854 2823422116
2855 2825655641
2856 2826583915
2857 2834033255
2858 2840881643
2859 2842338098
2860 2842775940
2861 2842809789
2862 2842820239
2863 2842829153
2864 2842836983
2865 2842840414
2866 2842847720
2867 2842850832
2868 2842859672
2869 2844666469
2870 2847798095
2871 2852618163
2872 2852661011
2873 2852673221
2874 2856291754
2875 2857363919
2876 2858696409
2877 2860343873
2878 2860872529
2879 2862512189
2880 2862576644
2881 2863423701
2882 2869554533
2883 2870073750
2884 2871501980
2885 2878034819
2886 2878765783
2887 2878772457
2888 2880235464
2889 2884089075
2890 2885268304
2891 2891673486
2892 2895434520
2893 2900582438
2894 2903546729
2895 2904514305
2896 2904522968
2897 2904555867
2898 2904568274
2899 2904575317
2900 2904621922
2901 2908452053
2902 2912964460
2903 2913042011
2904 2917076183
2905 2917836294
2906 2919067801
2907 2919108631
2908 2919127582
2909 2919157038
2910 2919390691
2911 2919461760
2912 2919471029
2913 2919485852
2914 2919490967
2915 2919506367
2916 2919701473
2917 2923159012
2918 2923520532
2919 2923590972
2920 2926067437
2921 2928059024
2922 2928160644
2923 2928169846
2924 2928171514
2925 2928536140
2926 2929149392
2927 2929194635
2928 2931373193
2929 2931395919
2930 2931397544
2931 2935359607
2932 2938000588
2933 2939641808
2934 2939651969
2935 2945931413
2936 2945966271
2937 2946007465
2938 2946033130
2939 2947233902
2940 2954389601
2941 2954682303
2942 2954690621
2943 2954700445
2944 2954701783
2945 2954729091
2946 2958170959
2947 2961169403
2948 2965023655
2949 2968177793
2950 2969081787
2951 2969309637
2952 2970560639
2953 2971823199
2954 2974294631
2955 2974301656
2956 2981991713
2957 2984287157
2958 2984495086
2959 2984500770
2960 2984507305
2961 2984564212
2962 2984596947
2963 2987665619
2964 2988730936
2965 2990263167
2966 2998144887
2967 3000379131
2968 3003666042
2969 3004194591
2970 3007318310
2971 3007398633
2972 3007420364
2973 3007516671
2974 3007619160
2975 3007621097
2976 3007722277
2977 3007808873
2978 3007860091
2979 3007866342
2980 3007870956
2981 3007874287
2982 637322720
2983 640486156
2984 642592860
2985 651174130
2986 8004596635
2987 8011354165
2988 8015693089
2989 8016730588
2990 8018853593
2991 8019781910
2992 8020808084
2993 8020940871
2994 8020947932
2995 8020956582
2996 8021123665
2997 8029996011
2998 8034966927
2999 8039103455
3000 8040168451
3001 8040178108
3002 8052496739
3003 8054289290
3004 8054353029
3005 8054508423
3006 8054931264
3007 8055776338
3008 8055823377
3009 8055882021
3010 8056118661
3011 8056122989
3012 8056131098
3013 8056136773
3014 8056140407
3015 8056148217
3016 8056150250
3017 8056156298
3018 8056163091
3019 8056171680
3020 8056172363
3021 8056179161
3022 8056571917
3023 8057163465
3024 8057309455

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14696

Glyoxalase_5

Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal

343

482

0.94

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

495

622

0.92

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

75

321

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hmq-assembly1.cif.gz_C xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.9432 57 673
5hmq-assembly3.cif.gz_D xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.9431 57 675
5hmq-assembly2.cif.gz_B xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.9415 57 675
5hmq-assembly3.cif.gz_E xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.9385 57 678
5hmq-assembly2.cif.gz_B xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.9373 57 675
ID Description Score Start End Superfamily
1cjxC02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9082 490 676 3.10.180.10
af_A0A1D8PHL9_249_477_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.907 492 676 3.10.180.10
1i60A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9063 60 325 3.20.20.150
3zgjA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8977 495 675 3.10.180.10
1i60A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8841 60 325 3.20.20.150
ID Description Score Start End GO Terms
AF-F3FH49-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 1.003 58 174 GO:0051213
AF-F3CDB3-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 1.002 58 298 GO:0051213
AF-A0A7Y4J7N4-F1-model_v4 deleted 1.001 78 210
AF-F3CDB3-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9975 58 298 GO:0051213
AF-S6T923-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9942 375 671 GO:0003868
GO:0006572
GO:0046872

Map