F494477
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1512 | 795 | 3024 | 628 |
Family's Representative Sequence
| Representative Sequence | 2124908027|MRS2a_Contig_62|MRS2a_00485700 |
| Length | 690 |
| Sequence | LLCRFDRPIIHPKLNAIPVGARLAGDGVLEIAIAGKPCSYSKRAIDNKIVSTTGSRNMQRSIATVSLSGTLPEKLEAIAAAGFDGVEIFENDLLYYDGSPREIKQMCADLGIAITLFQPFRDFEGCRRDRLPRNLERAERKFDLMQELGTDLVLVCSNASADAIGDEQILIDDLRLLAEHAGARGLRIGYEALAWGRHVNTYQQVWNIVRQADHPNLGVLLDSFHTLSLKGDPSAIAEIPGDKIFFVQMADAPILAMDVLEWSRHFRCFPGQGEFDLPGFLAPIIKSGYTGPLSLEIFNDGFRAAPPRANAADGLRSLLYLEEKTRERLAQEAMPPATVDILFETPQASEYNGIEFLEFAVDESLGAKLSHWLERLGFVKAGQHRSKSVSLLRQGDINLILNSEPYSFAHSFFEAHGPSLXATAVRVKDSASALARAVAYKGQPYRGLVGPNELELAAVRAPDGSLIYLVDQDADVYGTDFNLQPSAVASGGLKRIDHMAMALPADSLDSWVLFYKSLLDFEADDEVVLPDPYGLVKSRALRSRDSSIRLPLNISENRNTAISHALSSYRGSGVHHIAFDCDDIFAEVSRAKEAGVPLLDIPLNYYDDLAARFDFDDEFLXELAYYNVLXDRDAXGGELFHVYTXPFEGRFFFXIIQRKNGYAGYGAANVAVRLAAMAKSRSGXVRQAKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 77 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 78 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 79 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 107 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 111 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 172 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 173 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 178 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 179 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 181 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 182 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 183 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 184 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 187 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 190 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 191 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 193 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 194 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 195 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 199 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 200 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 201 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 202 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 203 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 210 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 211 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 212 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 223 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 224 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 225 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 226 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 227 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 228 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 229 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 230 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 231 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 232 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 233 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 234 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 235 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 236 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 237 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 238 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 239 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 240 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 241 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 242 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 243 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 244 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 245 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 246 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 247 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 248 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 249 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 250 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 251 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 252 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 253 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 254 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 255 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 256 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 257 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 258 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 259 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 260 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 261 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 262 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 352 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 353 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 354 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 355 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 356 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 359 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 360 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 361 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 362 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 363 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 364 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 365 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 366 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 367 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 368 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 369 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 370 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 371 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 372 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 373 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 374 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 375 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 382 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 395 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 397 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 398 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 399 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 402 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 403 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 404 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 405 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 406 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 407 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 408 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 409 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 410 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 411 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 412 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 413 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 414 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 415 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 416 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 417 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 418 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 419 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 420 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 421 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 422 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 423 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 424 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 425 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 426 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 427 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 428 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 429 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 430 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 431 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 432 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 433 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 434 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 435 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 436 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 437 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 438 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 439 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 440 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 441 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 442 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 443 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 444 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 445 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 446 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 447 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 448 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 449 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 450 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 451 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 452 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 453 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 454 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 455 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 456 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 457 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 458 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 459 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 460 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 461 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 462 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 463 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 464 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 465 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 466 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 467 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 468 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 469 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 470 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 471 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 472 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 473 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 474 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 475 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 476 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 477 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 478 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 479 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 480 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 481 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 482 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 483 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 484 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 485 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 486 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 487 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 488 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 489 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 490 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 491 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 492 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 493 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 494 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 495 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 496 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 497 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 498 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 499 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 500 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 501 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 502 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 503 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 504 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 505 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 506 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 507 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 508 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 509 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 510 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 511 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 512 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 513 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 514 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 515 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 516 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 517 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 518 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 519 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 520 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 521 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 522 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 523 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 524 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 525 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 526 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 527 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 528 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 529 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 530 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 531 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 532 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 533 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 534 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 535 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 536 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 537 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 538 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 539 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 540 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 541 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 542 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 543 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 544 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 545 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 546 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 547 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 548 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 549 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 550 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 551 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 552 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 553 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 554 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 555 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 556 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 557 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 558 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 559 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 560 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 561 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 562 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 563 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 564 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 565 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 566 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 567 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 568 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 569 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 570 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 571 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 572 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 573 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 574 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 575 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 576 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 577 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 578 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 579 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 580 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 581 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 582 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 583 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 584 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 585 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 586 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 587 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 588 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 589 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 590 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 591 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 592 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 593 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 594 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 595 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 596 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 597 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 598 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 599 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 600 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 601 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 602 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 603 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 604 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 605 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 606 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 607 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 608 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 609 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 610 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 611 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 612 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 613 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 614 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 615 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 616 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 617 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 618 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 619 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 620 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 621 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 622 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 623 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 624 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 625 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 626 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 627 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 628 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 629 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 630 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 631 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 632 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 633 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 634 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 635 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 636 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 637 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 638 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 639 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 640 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 641 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 642 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 643 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 644 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 645 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 646 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 647 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 648 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 649 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 650 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 651 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 652 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 653 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 654 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 655 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 656 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 657 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 658 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 659 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 660 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 661 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 662 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 663 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 664 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 665 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 666 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 667 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 668 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 669 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 670 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 671 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 672 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 673 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 674 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 675 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 676 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 677 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 678 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 679 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 680 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 681 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 682 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 683 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 684 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 685 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 686 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 687 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 688 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 689 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 690 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 691 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 692 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 693 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 694 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 695 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 696 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 697 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 698 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 699 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 700 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 701 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 702 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 703 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 704 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 705 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 706 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 707 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 708 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 709 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 710 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 711 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 712 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 713 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 714 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 715 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 716 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 717 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 718 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 719 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 720 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 721 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 722 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 723 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 724 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 725 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 726 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 727 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 728 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 729 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 730 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 731 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 732 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 733 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 734 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 735 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 736 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 737 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 738 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 739 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 740 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 741 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 742 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 743 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 744 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 745 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 746 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 747 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 748 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 749 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 750 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 751 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 752 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 753 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 754 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 755 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 756 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 757 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 758 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 759 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 760 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 761 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 762 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 763 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 764 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 765 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 766 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 767 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 768 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 769 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 770 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 771 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 772 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 773 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 774 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 775 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 776 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 777 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 778 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 779 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 780 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 781 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 782 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 783 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 784 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 785 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 786 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 787 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 788 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 789 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 790 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 791 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 792 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 793 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 794 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
| 795 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.61 |
| Metatranscriptomes | 0.33 |
| Isolates | 26.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.4 |
| Bulb | 0 |
| Endosphere | 7.74 |
| Nodule | 3.11 |
| Rhizoplane | 9.13 |
| Rhizosphere | 63.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_62 | 2124908027 | Bacteria | 15782 |
| 2 | JGI24741J21665_1001052 | 3300001915 | Bacteria | 8268 |
| 3 | JGI24740J21852_10000047 | 3300001979 | Bacteria | 39298 |
| 4 | JGI24740J21852_10000084 | 3300001979 | Bacteria | 32275 |
| 5 | JGI24739J22299_10000109 | 3300001989 | Bacteria | 25306 |
| 6 | JGI24735J21928_10000736 | 3300002067 | Bacteria | 11637 |
| 7 | JGI24735J21928_10001143 | 3300002067 | Bacteria | 9475 |
| 8 | JGI25156J39149_1001527 | 3300002705 | Bacteria | 9611 |
| 9 | JGI25156J39149_1007207 | 3300002705 | Bacteria | 2950 |
| 10 | JGI25162J39368_1000136 | 3300002737 | Bacteria | 79587 |
| 11 | JGI25162J39368_1000155 | 3300002737 | Bacteria | 75225 |
| 12 | JGI25154J39366_1000668 | 3300002738 | Bacteria | 16003 |
| 13 | JGI25163J39215_1001445 | 3300002771 | Bacteria | 3900 |
| 14 | JGI25163J39215_1001478 | 3300002771 | Bacteria | 3794 |
| 15 | JGI25164J39214_1000121 | 3300002772 | Bacteria | 75225 |
| 16 | JGI25164J39214_1000258 | 3300002772 | Bacteria | 39842 |
| 17 | JGI25406J46586_10003870 | 3300003203 | Bacteria | 6995 |
| 18 | JGI25406J46586_10005301 | 3300003203 | Bacteria | 5981 |
| 19 | JGI25406J46586_10011140 | 3300003203 | Bacteria | 3954 |
| 20 | JGI25165J46597_1000037 | 3300003214 | Bacteria | 285722 |
| 21 | JGI25165J46597_1000222 | 3300003214 | Bacteria | 79609 |
| 22 | JGI25165J46597_1000240 | 3300003214 | Bacteria | 75225 |
| 23 | JGI25160J50197_1000084 | 3300003354 | Bacteria | 97413 |
| 24 | Ga0007417J51691_1020671 | 3300003544 | Bacteria | 3947 |
| 25 | Ga0007416J51690_1015306 | 3300003577 | Bacteria | 3064 |
| 26 | Ga0055538_1000065 | 3300003751 | Bacteria | 100831 |
| 27 | Ga0055539_1000099 | 3300003752 | Bacteria | 100831 |
| 28 | Ga0055539_1000203 | 3300003752 | Bacteria | 46893 |
| 29 | Ga0055533_1000109 | 3300003756 | Bacteria | 100831 |
| 30 | Ga0055533_1000963 | 3300003756 | Bacteria | 8469 |
| 31 | Ga0055532_1000037 | 3300003758 | Bacteria | 205054 |
| 32 | Ga0055532_1000094 | 3300003758 | Bacteria | 100832 |
| 33 | Ga0055532_1001155 | 3300003758 | Bacteria | 8029 |
| 34 | Ga0055532_1001302 | 3300003758 | Bacteria | 7244 |
| 35 | Ga0055532_1001303 | 3300003758 | Bacteria | 7236 |
| 36 | Ga0055525_1000143 | 3300003759 | Bacteria | 100831 |
| 37 | Ga0055525_1000453 | 3300003759 | Bacteria | 23530 |
| 38 | Ga0055527_1000487 | 3300003760 | Bacteria | 14308 |
| 39 | Ga0055527_1000666 | 3300003760 | Bacteria | 10298 |
| 40 | Ga0055535_1000018 | 3300003761 | Bacteria | 243804 |
| 41 | Ga0055535_1002068 | 3300003761 | Bacteria | 8029 |
| 42 | Ga0055535_1002073 | 3300003761 | Bacteria | 8011 |
| 43 | Ga0055542_1000492 | 3300003762 | Bacteria | 36378 |
| 44 | Ga0055542_1001925 | 3300003762 | Bacteria | 8160 |
| 45 | Ga0055529_1000041 | 3300003763 | Bacteria | 226495 |
| 46 | Ga0055529_1000398 | 3300003763 | Bacteria | 46298 |
| 47 | Ga0055536_1000059 | 3300003781 | Bacteria | 103307 |
| 48 | Ga0055536_1000403 | 3300003781 | Bacteria | 31444 |
| 49 | Ga0055530_10000036 | 3300003791 | Bacteria | 117493 |
| 50 | Ga0055530_10000096 | 3300003791 | Bacteria | 73950 |
| 51 | Ga0055530_10000898 | 3300003791 | Bacteria | 24479 |
| 52 | Ga0055530_10010435 | 3300003791 | Bacteria | 3434 |
| 53 | Ga0055540_1000072 | 3300003792 | Bacteria | 117493 |
| 54 | Ga0055540_1000084 | 3300003792 | Bacteria | 107482 |
| 55 | Ga0055540_1000650 | 3300003792 | Bacteria | 24393 |
| 56 | Ga0055531_10000266 | 3300003794 | Bacteria | 54559 |
| 57 | Ga0055541_1000066 | 3300003841 | Bacteria | 100831 |
| 58 | Ga0055541_1000400 | 3300003841 | Bacteria | 13001 |
| 59 | Ga0058692_1003634 | 3300003856 | Bacteria | 4717 |
| 60 | Ga0065165_1000329 | 3300005262 | Bacteria | 77564 |
| 61 | Ga0065714_10004633 | 3300005288 | Bacteria | 5807 |
| 62 | Ga0065714_10065746 | 3300005288 | Bacteria | 8656 |
| 63 | Ga0065714_10066371 | 3300005288 | Bacteria | 6989 |
| 64 | Ga0065714_10073413 | 3300005288 | Bacteria | 3191 |
| 65 | Ga0065704_10000968 | 3300005289 | Bacteria | 13061 |
| 66 | Ga0065704_10002901 | 3300005289 | Bacteria | 4740 |
| 67 | Ga0070658_10005515 | 3300005327 | Bacteria | 10275 |
| 68 | Ga0070670_100001749 | 3300005331 | Bacteria | 17689 |
| 69 | Ga0070670_100002250 | 3300005331 | Bacteria | 15868 |
| 70 | Ga0068869_100039777 | 3300005334 | Bacteria | 3359 |
| 71 | Ga0070660_100000323 | 3300005339 | Bacteria | 31631 |
| 72 | Ga0070661_100000131 | 3300005344 | Bacteria | 62870 |
| 73 | Ga0070661_100000208 | 3300005344 | Bacteria | 48588 |
| 74 | Ga0070668_100006472 | 3300005347 | Bacteria | 8685 |
| 75 | Ga0070669_100000089 | 3300005353 | Bacteria | 88172 |
| 76 | Ga0070669_100003603 | 3300005353 | Bacteria | 11183 |
| 77 | Ga0070669_100059879 | 3300005353 | Bacteria | 2796 |
| 78 | Ga0070674_100086613 | 3300005356 | Bacteria | 2250 |
| 79 | Ga0070673_100024041 | 3300005364 | Bacteria | 4460 |
| 80 | Ga0070688_100054230 | 3300005365 | Bacteria | 2510 |
| 81 | Ga0070659_100000767 | 3300005366 | Bacteria | 23341 |
| 82 | Ga0070659_100011714 | 3300005366 | Bacteria | 6492 |
| 83 | Ga0070659_100034409 | 3300005366 | Bacteria | 3941 |
| 84 | Ga0070667_100019878 | 3300005367 | Bacteria | 5573 |
| 85 | Ga0070667_100069368 | 3300005367 | Bacteria | 3000 |
| 86 | Ga0070713_100101859 | 3300005436 | Bacteria | 2488 |
| 87 | Ga0070663_100000018 | 3300005455 | Bacteria | 115228 |
| 88 | Ga0070663_100000054 | 3300005455 | Bacteria | 51309 |
| 89 | Ga0070663_100005663 | 3300005455 | Bacteria | 7443 |
| 90 | Ga0070662_100011108 | 3300005457 | Bacteria | 5929 |
| 91 | Ga0070681_10030867 | 3300005458 | Bacteria | 5379 |
| 92 | Ga0068867_100091068 | 3300005459 | Bacteria | 2314 |
| 93 | Ga0070684_100019193 | 3300005535 | Bacteria | 5653 |
| 94 | Ga0068853_100002936 | 3300005539 | Bacteria | 12967 |
| 95 | Ga0068853_100009512 | 3300005539 | Bacteria | 7833 |
| 96 | Ga0070665_100004426 | 3300005548 | Bacteria | 14759 |
| 97 | Ga0070665_100025119 | 3300005548 | Bacteria | 6003 |
| 98 | Ga0070665_100042556 | 3300005548 | Bacteria | 4566 |
| 99 | Ga0070665_100073035 | 3300005548 | Bacteria | 3437 |
| 100 | Ga0068855_100002550 | 3300005563 | Bacteria | 22446 |
| 101 | Ga0068855_100058403 | 3300005563 | Bacteria | 4518 |
| 102 | Ga0070664_100000040 | 3300005564 | Bacteria | 78303 |
| 103 | Ga0070664_100000145 | 3300005564 | Bacteria | 48588 |
| 104 | Ga0070664_100055941 | 3300005564 | Bacteria | 3352 |
| 105 | Ga0068857_100049912 | 3300005577 | Bacteria | 3712 |
| 106 | Ga0068854_100000034 | 3300005578 | Bacteria | 102389 |
| 107 | Ga0068856_100000115 | 3300005614 | Bacteria | 79608 |
| 108 | Ga0068856_100026846 | 3300005614 | Bacteria | 5616 |
| 109 | Ga0068852_100028695 | 3300005616 | Bacteria | 4560 |
| 110 | Ga0068859_100189613 | 3300005617 | Bacteria | 2140 |
| 111 | Ga0068864_100032921 | 3300005618 | Bacteria | 4406 |
| 112 | Ga0068851_10000002 | 3300005834 | Bacteria | 302756 |
| 113 | Ga0081538_10002736 | 3300005981 | Bacteria | 16933 |
| 114 | Ga0081538_10014327 | 3300005981 | Bacteria | 6213 |
| 115 | Ga0081540_1007143 | 3300005983 | Bacteria | 8011 |
| 116 | Ga0081539_10000195 | 3300005985 | Bacteria | 141188 |
| 117 | Ga0081539_10000984 | 3300005985 | Bacteria | 53064 |
| 118 | Ga0081539_10001258 | 3300005985 | Bacteria | 44901 |
| 119 | Ga0075432_10000232 | 3300006058 | Bacteria | 14893 |
| 120 | Ga0075432_10001524 | 3300006058 | Bacteria | 7586 |
| 121 | Ga0075367_10019492 | 3300006178 | Bacteria | 3763 |
| 122 | Ga0075428_100018426 | 3300006844 | Bacteria | 7720 |
| 123 | Ga0075428_100054730 | 3300006844 | Bacteria | 4372 |
| 124 | Ga0075430_100002673 | 3300006846 | Bacteria | 14878 |
| 125 | Ga0075431_100002927 | 3300006847 | Bacteria | 16535 |
| 126 | Ga0075433_10001156 | 3300006852 | Bacteria | 19171 |
| 127 | Ga0075434_100001406 | 3300006871 | Bacteria | 20224 |
| 128 | Ga0075429_100002737 | 3300006880 | Bacteria | 14885 |
| 129 | Ga0075436_100001013 | 3300006914 | Bacteria | 18916 |
| 130 | Ga0097620_100189594 | 3300006931 | Bacteria | 2140 |
| 131 | Ga0099823_1000027 | 3300006944 | Bacteria | 69973 |
| 132 | Ga0079104_1000116 | 3300006946 | Bacteria | 114868 |
| 133 | Ga0079104_1000283 | 3300006946 | Bacteria | 65007 |
| 134 | Ga0079104_1001497 | 3300006946 | Bacteria | 15530 |
| 135 | Ga0099794_10028139 | 3300007265 | Bacteria | 2612 |
| 136 | Ga0105251_10000050 | 3300009011 | Bacteria | 108597 |
| 137 | Ga0105251_10000198 | 3300009011 | Bacteria | 60848 |
| 138 | Ga0105251_10000214 | 3300009011 | Bacteria | 58941 |
| 139 | Ga0105251_10000503 | 3300009011 | Bacteria | 37047 |
| 140 | Ga0105251_10000587 | 3300009011 | Bacteria | 33436 |
| 141 | Ga0105251_10000846 | 3300009011 | Bacteria | 27447 |
| 142 | Ga0105251_10000972 | 3300009011 | Bacteria | 25444 |
| 143 | Ga0105251_10001413 | 3300009011 | Bacteria | 20688 |
| 144 | Ga0105251_10001672 | 3300009011 | Bacteria | 18688 |
| 145 | Ga0105251_10015856 | 3300009011 | Bacteria | 4099 |
| 146 | Ga0105244_10000037 | 3300009036 | Bacteria | 161621 |
| 147 | Ga0105244_10000155 | 3300009036 | Bacteria | 71793 |
| 148 | Ga0105244_10000312 | 3300009036 | Bacteria | 47271 |
| 149 | Ga0105244_10000597 | 3300009036 | Bacteria | 32202 |
| 150 | Ga0105244_10000983 | 3300009036 | Bacteria | 23917 |
| 151 | Ga0105244_10001542 | 3300009036 | Bacteria | 18346 |
| 152 | Ga0105244_10002341 | 3300009036 | Bacteria | 14395 |
| 153 | Ga0105244_10002409 | 3300009036 | Bacteria | 14127 |
| 154 | Ga0105244_10002423 | 3300009036 | Bacteria | 14083 |
| 155 | Ga0105244_10003296 | 3300009036 | Bacteria | 11627 |
| 156 | Ga0105244_10005647 | 3300009036 | Bacteria | 8263 |
| 157 | Ga0105244_10006359 | 3300009036 | Bacteria | 7668 |
| 158 | Ga0105244_10009740 | 3300009036 | Bacteria | 5875 |
| 159 | Ga0105244_10017978 | 3300009036 | Bacteria | 3979 |
| 160 | Ga0105244_10027743 | 3300009036 | Bacteria | 3048 |
| 161 | Ga0105244_10046658 | 3300009036 | Bacteria | 2225 |
| 162 | Ga0105250_10000130 | 3300009092 | Bacteria | 65133 |
| 163 | Ga0105250_10000194 | 3300009092 | Bacteria | 51648 |
| 164 | Ga0105250_10001047 | 3300009092 | Bacteria | 15843 |
| 165 | Ga0105250_10001149 | 3300009092 | Bacteria | 14874 |
| 166 | Ga0105250_10002250 | 3300009092 | Bacteria | 9803 |
| 167 | Ga0105250_10006244 | 3300009092 | Bacteria | 5228 |
| 168 | Ga0105240_10006023 | 3300009093 | Bacteria | 17927 |
| 169 | Ga0105240_10031525 | 3300009093 | Bacteria | 6874 |
| 170 | Ga0105240_10035859 | 3300009093 | Bacteria | 6387 |
| 171 | Ga0105240_10040802 | 3300009093 | Bacteria | 5931 |
| 172 | Ga0105240_10041129 | 3300009093 | Bacteria | 5903 |
| 173 | Ga0105240_10129552 | 3300009093 | Bacteria | 3028 |
| 174 | Ga0111539_10008028 | 3300009094 | Bacteria | 13461 |
| 175 | Ga0105245_10012857 | 3300009098 | Bacteria | 7293 |
| 176 | Ga0105245_10026163 | 3300009098 | Bacteria | 5135 |
| 177 | Ga0105247_10000117 | 3300009101 | Bacteria | 77478 |
| 178 | Ga0105243_10000115 | 3300009148 | Bacteria | 92572 |
| 179 | Ga0105243_10001986 | 3300009148 | Bacteria | 17410 |
| 180 | Ga0105243_10006536 | 3300009148 | Bacteria | 9003 |
| 181 | Ga0105242_10008641 | 3300009176 | Bacteria | 7818 |
| 182 | Ga0105248_10053252 | 3300009177 | Bacteria | 4541 |
| 183 | Ga0105237_10002290 | 3300009545 | Bacteria | 23792 |
| 184 | Ga0105237_10009645 | 3300009545 | Bacteria | 10333 |
| 185 | Ga0105237_10018573 | 3300009545 | Bacteria | 7194 |
| 186 | Ga0105238_10014016 | 3300009551 | Bacteria | 8108 |
| 187 | Ga0105239_10004584 | 3300010375 | Bacteria | 16469 |
| 188 | Ga0105239_10019132 | 3300010375 | Bacteria | 7568 |
| 189 | Ga0105246_10000023 | 3300011119 | Bacteria | 56447 |
| 190 | Ga0157373_10002554 | 3300013100 | Bacteria | 13841 |
| 191 | Ga0157373_10007818 | 3300013100 | Bacteria | 7951 |
| 192 | Ga0157373_10033515 | 3300013100 | Bacteria | 3695 |
| 193 | Ga0157373_10045414 | 3300013100 | Bacteria | 3135 |
| 194 | Ga0157373_10063394 | 3300013100 | Bacteria | 2617 |
| 195 | Ga0157371_10000104 | 3300013102 | Bacteria | 128065 |
| 196 | Ga0157371_10000185 | 3300013102 | Bacteria | 91305 |
| 197 | Ga0157371_10000282 | 3300013102 | Bacteria | 68612 |
| 198 | Ga0157371_10000427 | 3300013102 | Bacteria | 51636 |
| 199 | Ga0157371_10028344 | 3300013102 | Bacteria | 4056 |
| 200 | Ga0157371_10059770 | 3300013102 | Bacteria | 2702 |
| 201 | Ga0157370_10000348 | 3300013104 | Bacteria | 58654 |
| 202 | Ga0157370_10000558 | 3300013104 | Bacteria | 46503 |
| 203 | Ga0157370_10001357 | 3300013104 | Bacteria | 30329 |
| 204 | Ga0157370_10004203 | 3300013104 | Bacteria | 16650 |
| 205 | Ga0157370_10010485 | 3300013104 | Bacteria | 9761 |
| 206 | Ga0157370_10031441 | 3300013104 | Bacteria | 5191 |
| 207 | Ga0157370_10039514 | 3300013104 | Bacteria | 4560 |
| 208 | Ga0157370_10061262 | 3300013104 | Bacteria | 3571 |
| 209 | Ga0157369_10005144 | 3300013105 | Bacteria | 15311 |
| 210 | Ga0157369_10007420 | 3300013105 | Bacteria | 12626 |
| 211 | Ga0157369_10014391 | 3300013105 | Bacteria | 8935 |
| 212 | Ga0157369_10024104 | 3300013105 | Bacteria | 6772 |
| 213 | Ga0157369_10033288 | 3300013105 | Bacteria | 5664 |
| 214 | Ga0157374_10000053 | 3300013296 | Bacteria | 123609 |
| 215 | Ga0163162_10000327 | 3300013306 | Bacteria | 43838 |
| 216 | Ga0163162_10001680 | 3300013306 | Bacteria | 20756 |
| 217 | Ga0163162_10002655 | 3300013306 | Bacteria | 16953 |
| 218 | Ga0163162_10003675 | 3300013306 | Bacteria | 14709 |
| 219 | Ga0157372_10000637 | 3300013307 | Bacteria | 38480 |
| 220 | Ga0157372_10000654 | 3300013307 | Bacteria | 38081 |
| 221 | Ga0157372_10003030 | 3300013307 | Bacteria | 18101 |
| 222 | Ga0157375_10004869 | 3300013308 | Bacteria | 11667 |
| 223 | Ga0157375_10023452 | 3300013308 | Bacteria | 5694 |
| 224 | Ga0157375_10025963 | 3300013308 | Bacteria | 5453 |
| 225 | Ga0163163_10059422 | 3300014325 | Bacteria | 3782 |
| 226 | Ga0182008_10000852 | 3300014497 | Bacteria | 21165 |
| 227 | Ga0182008_10004259 | 3300014497 | Bacteria | 8388 |
| 228 | Ga0182008_10006951 | 3300014497 | Bacteria | 6281 |
| 229 | Ga0182008_10008539 | 3300014497 | Bacteria | 5591 |
| 230 | Ga0182008_10008870 | 3300014497 | Bacteria | 5457 |
| 231 | Ga0182008_10012146 | 3300014497 | Bacteria | 4554 |
| 232 | Ga0182008_10024794 | 3300014497 | Bacteria | 3050 |
| 233 | Ga0182006_1000501 | 3300015261 | Bacteria | 30034 |
| 234 | Ga0182006_1000547 | 3300015261 | Bacteria | 28375 |
| 235 | Ga0182006_1001042 | 3300015261 | Bacteria | 18011 |
| 236 | Ga0182006_1003853 | 3300015261 | Bacteria | 7530 |
| 237 | Ga0182006_1004486 | 3300015261 | Bacteria | 6872 |
| 238 | Ga0182006_1014013 | 3300015261 | Bacteria | 3462 |
| 239 | Ga0182007_10000290 | 3300015262 | Bacteria | 32620 |
| 240 | Ga0182007_10006145 | 3300015262 | Bacteria | 5186 |
| 241 | Ga0182005_1000454 | 3300015265 | Bacteria | 21690 |
| 242 | Ga0182005_1000471 | 3300015265 | Bacteria | 20927 |
| 243 | Ga0182005_1016780 | 3300015265 | Bacteria | 2032 |
| 244 | Ga0183367_1001 | 3300015688 | Bacteria | 1225545 |
| 245 | Ga0183361_10024 | 3300016635 | Bacteria | 83513 |
| 246 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 247 | Ga0163161_10001478 | 3300017792 | Bacteria | 17345 |
| 248 | Ga0163161_10006343 | 3300017792 | Bacteria | 8182 |
| 249 | Ga0163161_10016238 | 3300017792 | Bacteria | 5196 |
| 250 | Ga0163161_10024717 | 3300017792 | Bacteria | 4247 |
| 251 | Ga0163161_10039432 | 3300017792 | Bacteria | 3391 |
| 252 | Ga0163161_10052082 | 3300017792 | Bacteria | 2967 |
| 253 | Ga0163161_10060970 | 3300017792 | Bacteria | 2746 |
| 254 | Ga0154015_1222406 | 3300020610 | Bacteria | 18981 |
| 255 | Ga0213875_10000207 | 3300021388 | Bacteria | 60208 |
| 256 | Ga0213875_10000315 | 3300021388 | Bacteria | 46146 |
| 257 | Ga0213875_10037826 | 3300021388 | Bacteria | 2273 |
| 258 | Ga0209760_100102 | 3300025207 | Bacteria | 65474 |
| 259 | Ga0209760_100190 | 3300025207 | Bacteria | 30518 |
| 260 | Ga0209784_100101 | 3300025224 | Bacteria | 100885 |
| 261 | Ga0209784_100246 | 3300025224 | Bacteria | 34625 |
| 262 | Ga0209784_100301 | 3300025224 | Bacteria | 26577 |
| 263 | Ga0209784_101596 | 3300025224 | Bacteria | 2832 |
| 264 | Ga0209566_100123 | 3300025225 | Bacteria | 100885 |
| 265 | Ga0209566_100329 | 3300025225 | Bacteria | 42615 |
| 266 | Ga0209566_100341 | 3300025225 | Bacteria | 40811 |
| 267 | Ga0209566_100403 | 3300025225 | Bacteria | 34323 |
| 268 | Ga0209566_102957 | 3300025225 | Bacteria | 2832 |
| 269 | Ga0209674_100131 | 3300025226 | Bacteria | 118079 |
| 270 | Ga0209674_100145 | 3300025226 | Bacteria | 100885 |
| 271 | Ga0209674_100238 | 3300025226 | Bacteria | 46947 |
| 272 | Ga0209674_100814 | 3300025226 | Bacteria | 10406 |
| 273 | Ga0209672_100012 | 3300025228 | Bacteria | 795742 |
| 274 | Ga0209672_100057 | 3300025228 | Bacteria | 215485 |
| 275 | Ga0209672_100260 | 3300025228 | Bacteria | 39122 |
| 276 | Ga0209672_100429 | 3300025228 | Bacteria | 24360 |
| 277 | Ga0209147_100005 | 3300025229 | Bacteria | 1036530 |
| 278 | Ga0209147_100007 | 3300025229 | Bacteria | 795684 |
| 279 | Ga0209147_100047 | 3300025229 | Bacteria | 288873 |
| 280 | Ga0209147_100151 | 3300025229 | Bacteria | 100885 |
| 281 | Ga0209147_100241 | 3300025229 | Bacteria | 53164 |
| 282 | Ga0209147_100747 | 3300025229 | Bacteria | 16061 |
| 283 | Ga0209563_100128 | 3300025230 | Bacteria | 100885 |
| 284 | Ga0209563_100170 | 3300025230 | Bacteria | 46947 |
| 285 | Ga0209563_100197 | 3300025230 | Bacteria | 33048 |
| 286 | Ga0207427_100056 | 3300025231 | Bacteria | 204343 |
| 287 | Ga0207427_100063 | 3300025231 | Bacteria | 177711 |
| 288 | Ga0209437_100065 | 3300025233 | Bacteria | 332417 |
| 289 | Ga0209437_100133 | 3300025233 | Bacteria | 178493 |
| 290 | Ga0209258_100007 | 3300025242 | Bacteria | 1036530 |
| 291 | Ga0209258_100014 | 3300025242 | Bacteria | 720132 |
| 292 | Ga0209258_100065 | 3300025242 | Bacteria | 288500 |
| 293 | Ga0209258_100241 | 3300025242 | Bacteria | 100872 |
| 294 | Ga0209646_1000058 | 3300025246 | Bacteria | 259999 |
| 295 | Ga0209646_1000314 | 3300025246 | Bacteria | 38078 |
| 296 | Ga0209026_1002579 | 3300025250 | Bacteria | 6668 |
| 297 | Ga0209677_100094 | 3300025253 | Bacteria | 100885 |
| 298 | Ga0209677_100206 | 3300025253 | Bacteria | 46947 |
| 299 | Ga0209148_1000043 | 3300025254 | Bacteria | 461531 |
| 300 | Ga0209148_1001167 | 3300025254 | Bacteria | 15255 |
| 301 | Ga0209148_1001250 | 3300025254 | Bacteria | 14157 |
| 302 | Ga0209759_1002975 | 3300025256 | Bacteria | 7043 |
| 303 | Ga0209233_1000085 | 3300025261 | Bacteria | 333078 |
| 304 | Ga0209233_1000133 | 3300025261 | Bacteria | 202716 |
| 305 | Ga0209455_1000011 | 3300025272 | Bacteria | 947242 |
| 306 | Ga0209455_1000074 | 3300025272 | Bacteria | 289143 |
| 307 | Ga0209455_1002086 | 3300025272 | Bacteria | 7995 |
| 308 | Ga0209673_1000198 | 3300025273 | Bacteria | 121230 |
| 309 | Ga0209675_1001502 | 3300025291 | Bacteria | 13383 |
| 310 | Ga0209676_1000076 | 3300025292 | Bacteria | 301393 |
| 311 | Ga0209676_1000264 | 3300025292 | Bacteria | 110593 |
| 312 | Ga0209676_1000313 | 3300025292 | Bacteria | 94925 |
| 313 | Ga0209676_1000825 | 3300025292 | Bacteria | 40324 |
| 314 | Ga0209676_1003296 | 3300025292 | Bacteria | 10116 |
| 315 | Ga0209676_1003301 | 3300025292 | Bacteria | 10105 |
| 316 | Ga0209564_1010435 | 3300025295 | Bacteria | 4281 |
| 317 | Ga0209050_1000063 | 3300025298 | Bacteria | 314955 |
| 318 | Ga0209050_1000080 | 3300025298 | Bacteria | 275154 |
| 319 | Ga0209050_1000106 | 3300025298 | Bacteria | 224396 |
| 320 | Ga0209050_1001454 | 3300025298 | Bacteria | 25396 |
| 321 | Ga0207426_1000128 | 3300025302 | Bacteria | 211383 |
| 322 | Ga0207426_1007653 | 3300025302 | Bacteria | 4490 |
| 323 | Ga0209051_1000045 | 3300025303 | Bacteria | 297882 |
| 324 | Ga0209051_1000082 | 3300025303 | Bacteria | 193133 |
| 325 | Ga0209051_1000139 | 3300025303 | Bacteria | 136281 |
| 326 | Ga0209051_1009142 | 3300025303 | Bacteria | 5143 |
| 327 | Ga0209257_1000539 | 3300025304 | Bacteria | 64964 |
| 328 | Ga0207656_10000010 | 3300025321 | Bacteria | 192224 |
| 329 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 330 | Ga0207696_1000023 | 3300025711 | Bacteria | 422195 |
| 331 | Ga0207696_1000047 | 3300025711 | Bacteria | 285005 |
| 332 | Ga0207696_1000116 | 3300025711 | Bacteria | 148125 |
| 333 | Ga0207696_1000126 | 3300025711 | Bacteria | 136197 |
| 334 | Ga0207696_1000255 | 3300025711 | Bacteria | 69740 |
| 335 | Ga0207696_1001069 | 3300025711 | Bacteria | 16167 |
| 336 | Ga0207696_1002513 | 3300025711 | Bacteria | 8954 |
| 337 | Ga0207696_1006398 | 3300025711 | Bacteria | 4752 |
| 338 | Ga0207655_1000015 | 3300025728 | Bacteria | 600662 |
| 339 | Ga0207655_1000027 | 3300025728 | Bacteria | 444552 |
| 340 | Ga0207655_1000039 | 3300025728 | Bacteria | 341249 |
| 341 | Ga0207655_1000117 | 3300025728 | Bacteria | 161655 |
| 342 | Ga0207655_1000120 | 3300025728 | Bacteria | 157018 |
| 343 | Ga0207655_1000378 | 3300025728 | Bacteria | 62082 |
| 344 | Ga0207655_1000862 | 3300025728 | Bacteria | 32286 |
| 345 | Ga0207655_1001095 | 3300025728 | Bacteria | 26574 |
| 346 | Ga0207655_1004674 | 3300025728 | Bacteria | 9601 |
| 347 | Ga0207655_1008994 | 3300025728 | Bacteria | 6260 |
| 348 | Ga0207655_1010449 | 3300025728 | Bacteria | 5627 |
| 349 | Ga0207655_1012990 | 3300025728 | Bacteria | 4814 |
| 350 | Ga0207655_1012996 | 3300025728 | Bacteria | 4813 |
| 351 | Ga0207655_1016086 | 3300025728 | Bacteria | 4116 |
| 352 | Ga0207655_1020666 | 3300025728 | Bacteria | 3372 |
| 353 | Ga0207655_1021364 | 3300025728 | Bacteria | 3287 |
| 354 | Ga0207655_1030107 | 3300025728 | Bacteria | 2530 |
| 355 | Ga0207655_1032009 | 3300025728 | Bacteria | 2411 |
| 356 | Ga0207713_1000002 | 3300025735 | Bacteria | 1061749 |
| 357 | Ga0207713_1000003 | 3300025735 | Bacteria | 860698 |
| 358 | Ga0207713_1000016 | 3300025735 | Bacteria | 421689 |
| 359 | Ga0207713_1000049 | 3300025735 | Bacteria | 227882 |
| 360 | Ga0207713_1000229 | 3300025735 | Bacteria | 75343 |
| 361 | Ga0207713_1000233 | 3300025735 | Bacteria | 74522 |
| 362 | Ga0207713_1000245 | 3300025735 | Bacteria | 69586 |
| 363 | Ga0207713_1000335 | 3300025735 | Bacteria | 52501 |
| 364 | Ga0207713_1002628 | 3300025735 | Bacteria | 12923 |
| 365 | Ga0207713_1003264 | 3300025735 | Bacteria | 11173 |
| 366 | Ga0207713_1004283 | 3300025735 | Bacteria | 9308 |
| 367 | Ga0207713_1005351 | 3300025735 | Bacteria | 8059 |
| 368 | Ga0207713_1009539 | 3300025735 | Bacteria | 5459 |
| 369 | Ga0207713_1012366 | 3300025735 | Bacteria | 4570 |
| 370 | Ga0207713_1017097 | 3300025735 | Bacteria | 3652 |
| 371 | Ga0207682_10000400 | 3300025893 | Bacteria | 19971 |
| 372 | Ga0207710_10000185 | 3300025900 | Bacteria | 61135 |
| 373 | Ga0207647_10004131 | 3300025904 | Bacteria | 10778 |
| 374 | Ga0207647_10007845 | 3300025904 | Bacteria | 7680 |
| 375 | Ga0207699_10028304 | 3300025906 | Bacteria | 3113 |
| 376 | Ga0207645_10053771 | 3300025907 | Bacteria | 2572 |
| 377 | Ga0207705_10016715 | 3300025909 | Bacteria | 5254 |
| 378 | Ga0207695_10003825 | 3300025913 | Bacteria | 20862 |
| 379 | Ga0207695_10005348 | 3300025913 | Bacteria | 17077 |
| 380 | Ga0207695_10011262 | 3300025913 | Bacteria | 10845 |
| 381 | Ga0207695_10098771 | 3300025913 | Bacteria | 2918 |
| 382 | Ga0207671_10000613 | 3300025914 | Bacteria | 47054 |
| 383 | Ga0207671_10033514 | 3300025914 | Bacteria | 3820 |
| 384 | Ga0207671_10070977 | 3300025914 | Bacteria | 2597 |
| 385 | Ga0207662_10011739 | 3300025918 | Bacteria | 4867 |
| 386 | Ga0207657_10000152 | 3300025919 | Bacteria | 70647 |
| 387 | Ga0207657_10013134 | 3300025919 | Bacteria | 8132 |
| 388 | Ga0207649_10000023 | 3300025920 | Bacteria | 188467 |
| 389 | Ga0207649_10000315 | 3300025920 | Bacteria | 36740 |
| 390 | Ga0207681_10000134 | 3300025923 | Bacteria | 60646 |
| 391 | Ga0207694_10023900 | 3300025924 | Bacteria | 4641 |
| 392 | Ga0207694_10076953 | 3300025924 | Bacteria | 2614 |
| 393 | Ga0207650_10000231 | 3300025925 | Bacteria | 62555 |
| 394 | Ga0207650_10001368 | 3300025925 | Bacteria | 17607 |
| 395 | Ga0207690_10000038 | 3300025932 | Bacteria | 136549 |
| 396 | Ga0207690_10007440 | 3300025932 | Bacteria | 6499 |
| 397 | Ga0207706_10000056 | 3300025933 | Bacteria | 113022 |
| 398 | Ga0207706_10008880 | 3300025933 | Bacteria | 9252 |
| 399 | Ga0207709_10000030 | 3300025935 | Bacteria | 331710 |
| 400 | Ga0207709_10000127 | 3300025935 | Bacteria | 112650 |
| 401 | Ga0207709_10017068 | 3300025935 | Bacteria | 4046 |
| 402 | Ga0207670_10034626 | 3300025936 | Bacteria | 3266 |
| 403 | Ga0207711_10090384 | 3300025941 | Bacteria | 2692 |
| 404 | Ga0207679_10000017 | 3300025945 | Bacteria | 253004 |
| 405 | Ga0207679_10000041 | 3300025945 | Bacteria | 127201 |
| 406 | Ga0207667_10001407 | 3300025949 | Bacteria | 30184 |
| 407 | Ga0207667_10062639 | 3300025949 | Bacteria | 3888 |
| 408 | Ga0207668_10062336 | 3300025972 | Bacteria | 2625 |
| 409 | Ga0207640_10000252 | 3300025981 | Bacteria | 36460 |
| 410 | Ga0207639_10000871 | 3300026041 | Bacteria | 20523 |
| 411 | Ga0207678_10000027 | 3300026067 | Bacteria | 115784 |
| 412 | Ga0207678_10000109 | 3300026067 | Bacteria | 67556 |
| 413 | Ga0207702_10000059 | 3300026078 | Bacteria | 127076 |
| 414 | Ga0207702_10037315 | 3300026078 | Bacteria | 4067 |
| 415 | Ga0207648_10087023 | 3300026089 | Bacteria | 2726 |
| 416 | Ga0207676_10020555 | 3300026095 | Bacteria | 4832 |
| 417 | Ga0207674_10042715 | 3300026116 | Bacteria | 4679 |
| 418 | Ga0207674_10042812 | 3300026116 | Bacteria | 4673 |
| 419 | Ga0207683_10007005 | 3300026121 | Bacteria | 9666 |
| 420 | Ga0207698_10036300 | 3300026142 | Bacteria | 3616 |
| 421 | Ga0209281_1000070 | 3300027111 | Bacteria | 277098 |
| 422 | Ga0209281_1000127 | 3300027111 | Bacteria | 200036 |
| 423 | Ga0209281_1001234 | 3300027111 | Bacteria | 16952 |
| 424 | Ga0209281_1005195 | 3300027111 | Bacteria | 3674 |
| 425 | Ga0209389_1000118 | 3300027296 | Bacteria | 70923 |
| 426 | Ga0209371_1000236 | 3300027312 | Bacteria | 69437 |
| 427 | Ga0209371_1000368 | 3300027312 | Bacteria | 48559 |
| 428 | Ga0209371_1000629 | 3300027312 | Bacteria | 31275 |
| 429 | Ga0209371_1002412 | 3300027312 | Bacteria | 10500 |
| 430 | Ga0209974_10012108 | 3300027876 | Bacteria | 2888 |
| 431 | Ga0207428_10000808 | 3300027907 | Bacteria | 35392 |
| 432 | Ga0207428_10003112 | 3300027907 | Bacteria | 16302 |
| 433 | Ga0207428_10015193 | 3300027907 | Bacteria | 6663 |
| 434 | Ga0207428_10026098 | 3300027907 | Bacteria | 4881 |
| 435 | Ga0207428_10048502 | 3300027907 | Bacteria | 3407 |
| 436 | Ga0207428_10062798 | 3300027907 | Bacteria | 2936 |
| 437 | Ga0268266_10032610 | 3300028379 | Bacteria | 4425 |
| 438 | Ga0307517_10001714 | 3300028786 | Bacteria | 36146 |
| 439 | Ga0307517_10027262 | 3300028786 | Bacteria | 6869 |
| 440 | Ga0307515_10011157 | 3300028794 | Bacteria | 17083 |
| 441 | Ga0307515_10014250 | 3300028794 | Bacteria | 14769 |
| 442 | Ga0307515_10056015 | 3300028794 | Bacteria | 5742 |
| 443 | Ga0268256_1000220 | 3300030500 | Bacteria | 63155 |
| 444 | Ga0268256_1000313 | 3300030500 | Bacteria | 48562 |
| 445 | Ga0268256_1000723 | 3300030500 | Bacteria | 24334 |
| 446 | Ga0268256_1002142 | 3300030500 | Bacteria | 10500 |
| 447 | Ga0307511_10002619 | 3300030521 | Bacteria | 18768 |
| 448 | Ga0307511_10026933 | 3300030521 | Bacteria | 5261 |
| 449 | Ga0307512_10002928 | 3300030522 | Bacteria | 20643 |
| 450 | Ga0307512_10009670 | 3300030522 | Bacteria | 9266 |
| 451 | Ga0314311_1018153 | 3300030733 | Bacteria | 6021 |
| 452 | Ga0316178_1041886 | 3300030735 | Bacteria | 28881 |
| 453 | Ga0265332_10001867 | 3300031238 | Bacteria | 11197 |
| 454 | Ga0265316_10073510 | 3300031344 | Bacteria | 2633 |
| 455 | Ga0307513_10004264 | 3300031456 | Bacteria | 19132 |
| 456 | Ga0307509_10022042 | 3300031507 | Bacteria | 7191 |
| 457 | Ga0307408_100000013 | 3300031548 | Bacteria | 386212 |
| 458 | Ga0307408_100008150 | 3300031548 | Bacteria | 6919 |
| 459 | Ga0307408_100009474 | 3300031548 | Bacteria | 6424 |
| 460 | Ga0307408_100041361 | 3300031548 | Bacteria | 3267 |
| 461 | Ga0307508_10001385 | 3300031616 | Bacteria | 27340 |
| 462 | Ga0307516_10000208 | 3300031730 | Bacteria | 75300 |
| 463 | Ga0307516_10021811 | 3300031730 | Bacteria | 6583 |
| 464 | Ga0307516_10128845 | 3300031730 | Bacteria | 2312 |
| 465 | Ga0307405_10000226 | 3300031731 | Bacteria | 20355 |
| 466 | Ga0307405_10006873 | 3300031731 | Bacteria | 5641 |
| 467 | Ga0307518_10023816 | 3300031838 | Bacteria | 4413 |
| 468 | Ga0307518_10039030 | 3300031838 | Bacteria | 3452 |
| 469 | Ga0307410_10012564 | 3300031852 | Bacteria | 4904 |
| 470 | Ga0307406_10015120 | 3300031901 | Bacteria | 4459 |
| 471 | Ga0307412_10000963 | 3300031911 | Bacteria | 16440 |
| 472 | Ga0307412_10004042 | 3300031911 | Bacteria | 8175 |
| 473 | Ga0307412_10008009 | 3300031911 | Bacteria | 6026 |
| 474 | Ga0307412_10058182 | 3300031911 | Bacteria | 2584 |
| 475 | Ga0307412_10069045 | 3300031911 | Bacteria | 2404 |
| 476 | Ga0307409_100020194 | 3300031995 | Bacteria | 4534 |
| 477 | Ga0307409_100022951 | 3300031995 | Bacteria | 4312 |
| 478 | Ga0307416_100030774 | 3300032002 | Bacteria | 4031 |
| 479 | Ga0307414_10003912 | 3300032004 | Bacteria | 8029 |
| 480 | Ga0307414_10090762 | 3300032004 | Bacteria | 2268 |
| 481 | Ga0307411_10081424 | 3300032005 | Bacteria | 2229 |
| 482 | Ga0307415_100000639 | 3300032126 | Bacteria | 15379 |
| 483 | Ga0307507_10014438 | 3300033179 | Bacteria | 9417 |
| 484 | Ga0307510_10010329 | 3300033180 | Bacteria | 11085 |
| 485 | Ga0373951_0000081 | 3300035091 | Bacteria | 37714 |
| 486 | Ga0373936_0000845 | 3300035113 | Bacteria | 10905 |
| 487 | Ga0373953_0003820 | 3300035117 | Bacteria | 4740 |
| 488 | Ga0373955_0000697 | 3300035172 | Bacteria | 14439 |
| 489 | Ga0373924_0000297 | 3300035410 | Bacteria | 15359 |
| 490 | Ga0373935_0000530 | 3300035692 | Bacteria | 19893 |
| 491 | Ga0373927_0004554 | 3300035695 | Bacteria | 9687 |
| 492 | Ga0373933_0002386 | 3300035724 | Bacteria | 10610 |
| 493 | Ga0373947_0001048 | 3300035725 | Bacteria | 16869 |
| 494 | Ga0373937_0000212 | 3300036401 | Bacteria | 55966 |
| 495 | Ga0373925_0000002 | 3300037068 | Bacteria | 368879 |
| 496 | Ga0395899_0000023 | 3300037312 | Bacteria | 367159 |
| 497 | Ga0395900_0000019 | 3300037418 | Bacteria | 357240 |
| 498 | Ga0395900_0011145 | 3300037418 | Bacteria | 9189 |
| 499 | Ga0395898_0000016 | 3300037466 | Bacteria | 435585 |
| 500 | Ga0395898_0029092 | 3300037466 | Bacteria | 5535 |
| 501 | Ga0395905_0000139 | 3300037471 | Bacteria | 120342 |
| 502 | Ga0436364_0796339 | 3300037853 | Bacteria | 8115 |
| 503 | Ga0436364_1383349 | 3300037853 | Bacteria | 102720 |
| 504 | Ga0436364_1481155 | 3300037853 | Bacteria | 87951 |
| 505 | Ga0436364_1483536 | 3300037853 | Bacteria | 14223 |
| 506 | Ga0395901_0000038 | 3300038443 | Bacteria | 210534 |
| 507 | Ga0237819_00203 | 3300038705 | Bacteria | 21713 |
| 508 | Ga0436365_0208634 | 3300039437 | Unclassified | 2144 |
| 509 | Ga0436365_0505152 | 3300039437 | Bacteria | 3986 |
| 510 | Ga0436365_0622916 | 3300039437 | Bacteria | 21905 |
| 511 | Ga0436365_1168445 | 3300039437 | Bacteria | 4026 |
| 512 | Ga0436365_1888304 | 3300039437 | Bacteria | 4920 |
| 513 | Ga0436361_1051656 | 3300039447 | Bacteria | 5711 |
| 514 | Ga0436361_1158602 | 3300039447 | Bacteria | 3243 |
| 515 | Ga0436361_1163181 | 3300039447 | Bacteria | 14246 |
| 516 | Ga0436363_0168519 | 3300039450 | Bacteria | 7820 |
| 517 | Ga0436362_0823318 | 3300039453 | Bacteria | 5819 |
| 518 | Ga0439436_0002355 | 3300041404 | Bacteria | 5658 |
| 519 | Ga0439438_001110 | 3300041405 | Bacteria | 11990 |
| 520 | Ga0439438_002344 | 3300041405 | Bacteria | 8075 |
| 521 | Ga0439438_002767 | 3300041405 | Bacteria | 7342 |
| 522 | Ga0439438_003268 | 3300041405 | Bacteria | 6625 |
| 523 | Ga0439438_004274 | 3300041405 | Bacteria | 5539 |
| 524 | Ga0439438_004325 | 3300041405 | Bacteria | 5484 |
| 525 | Ga0439438_007582 | 3300041405 | Bacteria | 3694 |
| 526 | Ga0439438_010915 | 3300041405 | Bacteria | 2852 |
| 527 | Ga0439438_014171 | 3300041405 | Bacteria | 2379 |
| 528 | Ga0439447_000104 | 3300041407 | Bacteria | 29012 |
| 529 | Ga0439447_000895 | 3300041407 | Bacteria | 10892 |
| 530 | Ga0439453_0000241 | 3300041408 | Bacteria | 5506 |
| 531 | Ga0439466_0000970 | 3300041411 | Bacteria | 11035 |
| 532 | Ga0439466_0009195 | 3300041411 | Bacteria | 3700 |
| 533 | Ga0439466_0011495 | 3300041411 | Bacteria | 3275 |
| 534 | Ga0439466_0020606 | 3300041411 | Bacteria | 2348 |
| 535 | Ga0439448_0000969 | 3300042005 | Bacteria | 7107 |
| 536 | Ga0439432_002681 | 3300042006 | Bacteria | 6662 |
| 537 | Ga0439432_003740 | 3300042006 | Bacteria | 5622 |
| 538 | Ga0439432_006543 | 3300042006 | Bacteria | 4157 |
| 539 | Ga0439432_021032 | 3300042006 | Bacteria | 2165 |
| 540 | Ga0439451_000619 | 3300042009 | Bacteria | 6753 |
| 541 | Ga0439452_000009 | 3300042010 | Bacteria | 569493 |
| 542 | Ga0439452_000085 | 3300042010 | Bacteria | 79496 |
| 543 | Ga0439452_000136 | 3300042010 | Bacteria | 55807 |
| 544 | Ga0439452_000149 | 3300042010 | Bacteria | 51740 |
| 545 | Ga0439452_008205 | 3300042010 | Bacteria | 3156 |
| 546 | Ga0439456_000013 | 3300042013 | Bacteria | 72544 |
| 547 | Ga0439456_005766 | 3300042013 | Bacteria | 2518 |
| 548 | Ga0439463_000698 | 3300042016 | Bacteria | 9297 |
| 549 | Ga0450911_001434 | 3300042115 | Bacteria | 5492 |
| 550 | Ga0450890_000250 | 3300042127 | Bacteria | 8037 |
| 551 | Ga0450904_002253 | 3300042139 | Bacteria | 2347 |
| 552 | Ga0450905_000018 | 3300042142 | Bacteria | 15231 |
| 553 | Ga0450906_006644 | 3300042145 | Bacteria | 2320 |
| 554 | Ga0450907_000025 | 3300042146 | Bacteria | 72853 |
| 555 | Ga0450907_002473 | 3300042146 | Bacteria | 3517 |
| 556 | Ga0450909_001728 | 3300042185 | Bacteria | 3065 |
| 557 | Ga0439434_0004591 | 3300042435 | Bacteria | 4043 |
| 558 | Ga0439460_0010550 | 3300042461 | Bacteria | 2368 |
| 559 | Ga0466986_0004181 | 3300044650 | Bacteria | 7699 |
| 560 | Ga0466969_0000375 | 3300044656 | Bacteria | 24528 |
| 561 | Ga0466969_0002196 | 3300044656 | Bacteria | 10427 |
| 562 | Ga0466969_0014453 | 3300044656 | Bacteria | 4151 |
| 563 | Ga0466972_0003056 | 3300044658 | Bacteria | 8303 |
| 564 | Ga0466973_0010320 | 3300044659 | Bacteria | 8611 |
| 565 | Ga0466978_0016238 | 3300044671 | Bacteria | 4293 |
| 566 | Ga0466982_0026631 | 3300044672 | Bacteria | 3378 |
| 567 | Ga0466966_0000020 | 3300044684 | Bacteria | 119360 |
| 568 | Ga0466966_0010767 | 3300044684 | Bacteria | 6079 |
| 569 | Ga0466961_0000024 | 3300044693 | Bacteria | 96595 |
| 570 | Ga0466961_0000043 | 3300044693 | Bacteria | 76269 |
| 571 | Ga0466961_0000622 | 3300044693 | Bacteria | 22250 |
| 572 | Ga0466961_0000999 | 3300044693 | Bacteria | 17449 |
| 573 | Ga0466961_0008631 | 3300044693 | Bacteria | 6494 |
| 574 | Ga0466961_0017210 | 3300044693 | Bacteria | 4643 |
| 575 | Ga0466963_0004216 | 3300044694 | Bacteria | 8337 |
| 576 | Ga0466963_0027977 | 3300044694 | Bacteria | 3615 |
| 577 | Ga0466964_0003088 | 3300044706 | Bacteria | 6056 |
| 578 | Ga0466964_0005300 | 3300044706 | Bacteria | 4785 |
| 579 | Ga0466971_0006666 | 3300044719 | Bacteria | 5024 |
| 580 | Ga0466970_0000611 | 3300044765 | Bacteria | 17530 |
| 581 | Ga0466970_0002332 | 3300044765 | Bacteria | 9177 |
| 582 | Ga0466970_0020134 | 3300044765 | Bacteria | 3463 |
| 583 | Ga0466957_0038248 | 3300044842 | Bacteria | 2890 |
| 584 | Ga0466960_0045580 | 3300044901 | Bacteria | 2095 |
| 585 | Ga0466959_0002813 | 3300045049 | Bacteria | 11205 |
| 586 | Ga0466959_0039214 | 3300045049 | Bacteria | 3500 |
| 587 | Ga0466958_0001628 | 3300045836 | Bacteria | 10806 |
| 588 | Ga0466967_0015670 | 3300045976 | Bacteria | 5951 |
| 589 | Ga0466967_0070991 | 3300045976 | Bacteria | 3117 |
| 590 | Ga0495617_000168 | 3300046452 | Bacteria | 41777 |
| 591 | Ga0495627_000020 | 3300046453 | Bacteria | 291866 |
| 592 | Ga0495627_000060 | 3300046453 | Bacteria | 140874 |
| 593 | Ga0495627_000154 | 3300046453 | Bacteria | 80512 |
| 594 | Ga0495627_000221 | 3300046453 | Bacteria | 61299 |
| 595 | Ga0495627_001421 | 3300046453 | Bacteria | 14086 |
| 596 | Ga0495627_004126 | 3300046453 | Bacteria | 6168 |
| 597 | Ga0495592_0000265 | 3300046454 | Bacteria | 44816 |
| 598 | Ga0495592_0006424 | 3300046454 | Bacteria | 8750 |
| 599 | Ga0495603_0001706 | 3300046455 | Bacteria | 12940 |
| 600 | Ga0495603_0003656 | 3300046455 | Bacteria | 9147 |
| 601 | Ga0495603_0005348 | 3300046455 | Bacteria | 7660 |
| 602 | Ga0495603_0005980 | 3300046455 | Bacteria | 7274 |
| 603 | Ga0495603_0011355 | 3300046455 | Bacteria | 5393 |
| 604 | Ga0495590_0000447 | 3300046457 | Bacteria | 20404 |
| 605 | Ga0495590_0001119 | 3300046457 | Bacteria | 11744 |
| 606 | Ga0495590_0009784 | 3300046457 | Bacteria | 3630 |
| 607 | Ga0495590_0018094 | 3300046457 | Bacteria | 2525 |
| 608 | Ga0495590_0018589 | 3300046457 | Bacteria | 2487 |
| 609 | Ga0495591_000058 | 3300046458 | Bacteria | 130659 |
| 610 | Ga0495591_000074 | 3300046458 | Bacteria | 114062 |
| 611 | Ga0495591_000165 | 3300046458 | Bacteria | 70496 |
| 612 | Ga0495591_000419 | 3300046458 | Bacteria | 35268 |
| 613 | Ga0495591_006472 | 3300046458 | Bacteria | 5176 |
| 614 | Ga0495591_007109 | 3300046458 | Bacteria | 4817 |
| 615 | Ga0495591_008093 | 3300046458 | Bacteria | 4348 |
| 616 | Ga0495591_011332 | 3300046458 | Bacteria | 3383 |
| 617 | Ga0495591_012070 | 3300046458 | Bacteria | 3236 |
| 618 | Ga0495629_0000238 | 3300046459 | Bacteria | 48096 |
| 619 | Ga0495629_0013407 | 3300046459 | Bacteria | 5914 |
| 620 | Ga0495629_0016863 | 3300046459 | Bacteria | 5242 |
| 621 | Ga0495638_0000428 | 3300046460 | Bacteria | 50789 |
| 622 | Ga0495638_0001172 | 3300046460 | Bacteria | 25142 |
| 623 | Ga0495638_0005050 | 3300046460 | Bacteria | 9895 |
| 624 | Ga0495638_0006257 | 3300046460 | Bacteria | 8689 |
| 625 | Ga0495638_0015145 | 3300046460 | Bacteria | 5186 |
| 626 | Ga0495638_0015253 | 3300046460 | Bacteria | 5164 |
| 627 | Ga0495638_0017295 | 3300046460 | Bacteria | 4813 |
| 628 | Ga0495638_0038299 | 3300046460 | Bacteria | 3048 |
| 629 | Ga0495651_0014887 | 3300046462 | Bacteria | 6013 |
| 630 | Ga0495653_0000006 | 3300046463 | Bacteria | 363285 |
| 631 | Ga0495653_0000332 | 3300046463 | Bacteria | 38593 |
| 632 | Ga0495653_0005802 | 3300046463 | Bacteria | 10101 |
| 633 | Ga0495653_0019424 | 3300046463 | Bacteria | 5512 |
| 634 | Ga0495653_0056660 | 3300046463 | Bacteria | 2986 |
| 635 | Ga0495650_0000765 | 3300046471 | Bacteria | 39770 |
| 636 | Ga0495650_0000966 | 3300046471 | Bacteria | 32946 |
| 637 | Ga0495650_0006120 | 3300046471 | Bacteria | 7573 |
| 638 | Ga0495650_0006565 | 3300046471 | Bacteria | 7230 |
| 639 | Ga0495580_0035115 | 3300046472 | Bacteria | 3605 |
| 640 | Ga0495605_0000048 | 3300046474 | Bacteria | 170182 |
| 641 | Ga0495605_0000091 | 3300046474 | Bacteria | 115482 |
| 642 | Ga0495605_0000953 | 3300046474 | Bacteria | 19725 |
| 643 | Ga0495605_0003434 | 3300046474 | Bacteria | 9418 |
| 644 | Ga0495605_0005869 | 3300046474 | Bacteria | 7095 |
| 645 | Ga0495605_0012168 | 3300046474 | Bacteria | 4780 |
| 646 | Ga0495605_0026464 | 3300046474 | Bacteria | 3015 |
| 647 | Ga0495605_0031113 | 3300046474 | Bacteria | 2728 |
| 648 | Ga0495639_0000041 | 3300046475 | Bacteria | 55786 |
| 649 | Ga0495662_0001839 | 3300046476 | Bacteria | 10633 |
| 650 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 651 | Ga0495664_0000843 | 3300046477 | Bacteria | 15738 |
| 652 | Ga0495584_0003348 | 3300046491 | Bacteria | 8853 |
| 653 | Ga0495584_0003833 | 3300046491 | Bacteria | 8175 |
| 654 | Ga0495584_0004401 | 3300046491 | Bacteria | 7586 |
| 655 | Ga0495584_0006209 | 3300046491 | Bacteria | 6269 |
| 656 | Ga0495584_0015515 | 3300046491 | Bacteria | 3881 |
| 657 | Ga0495585_0000937 | 3300046492 | Bacteria | 24621 |
| 658 | Ga0495585_0003124 | 3300046492 | Bacteria | 11357 |
| 659 | Ga0495585_0005080 | 3300046492 | Bacteria | 8387 |
| 660 | Ga0495585_0008082 | 3300046492 | Bacteria | 6393 |
| 661 | Ga0495585_0009962 | 3300046492 | Bacteria | 5679 |
| 662 | Ga0495585_0014914 | 3300046492 | Bacteria | 4519 |
| 663 | Ga0495594_0011179 | 3300046499 | Bacteria | 4661 |
| 664 | Ga0495596_0000109 | 3300046500 | Bacteria | 57203 |
| 665 | Ga0495607_0000139 | 3300046501 | Bacteria | 76715 |
| 666 | Ga0495607_0000190 | 3300046501 | Bacteria | 65339 |
| 667 | Ga0495607_0000330 | 3300046501 | Bacteria | 49138 |
| 668 | Ga0495607_0000395 | 3300046501 | Bacteria | 44371 |
| 669 | Ga0495607_0001876 | 3300046501 | Bacteria | 17826 |
| 670 | Ga0495607_0002335 | 3300046501 | Bacteria | 15526 |
| 671 | Ga0495607_0002507 | 3300046501 | Bacteria | 14881 |
| 672 | Ga0495607_0007196 | 3300046501 | Bacteria | 7729 |
| 673 | Ga0495607_0007963 | 3300046501 | Bacteria | 7284 |
| 674 | Ga0495607_0021823 | 3300046501 | Bacteria | 4026 |
| 675 | Ga0495607_0021851 | 3300046501 | Bacteria | 4023 |
| 676 | Ga0495607_0034982 | 3300046501 | Bacteria | 3043 |
| 677 | Ga0495607_0041655 | 3300046501 | Bacteria | 2726 |
| 678 | Ga0495607_0049523 | 3300046501 | Bacteria | 2449 |
| 679 | Ga0495583_0000187 | 3300046506 | Bacteria | 104971 |
| 680 | Ga0495583_0000206 | 3300046506 | Bacteria | 99380 |
| 681 | Ga0495583_0001258 | 3300046506 | Bacteria | 26665 |
| 682 | Ga0495583_0002463 | 3300046506 | Bacteria | 15807 |
| 683 | Ga0495583_0002998 | 3300046506 | Bacteria | 13523 |
| 684 | Ga0495583_0012055 | 3300046506 | Bacteria | 4922 |
| 685 | Ga0495583_0014705 | 3300046506 | Bacteria | 4300 |
| 686 | Ga0495583_0033154 | 3300046506 | Bacteria | 2485 |
| 687 | Ga0495606_0000177 | 3300046507 | Bacteria | 112843 |
| 688 | Ga0495606_0000287 | 3300046507 | Bacteria | 87639 |
| 689 | Ga0495606_0000324 | 3300046507 | Bacteria | 82321 |
| 690 | Ga0495606_0001537 | 3300046507 | Bacteria | 30458 |
| 691 | Ga0495606_0004243 | 3300046507 | Bacteria | 14498 |
| 692 | Ga0495606_0004992 | 3300046507 | Bacteria | 12939 |
| 693 | Ga0495606_0006124 | 3300046507 | Bacteria | 11229 |
| 694 | Ga0495606_0019151 | 3300046507 | Bacteria | 5103 |
| 695 | Ga0495606_0020543 | 3300046507 | Bacteria | 4864 |
| 696 | Ga0495606_0021126 | 3300046507 | Bacteria | 4773 |
| 697 | Ga0495606_0027210 | 3300046507 | Bacteria | 4060 |
| 698 | Ga0495608_0000006 | 3300046511 | Bacteria | 324334 |
| 699 | Ga0495610_0011194 | 3300046512 | Bacteria | 5501 |
| 700 | Ga0495616_0005222 | 3300046513 | Bacteria | 8027 |
| 701 | Ga0495616_0008607 | 3300046513 | Bacteria | 6026 |
| 702 | Ga0495616_0012882 | 3300046513 | Bacteria | 4730 |
| 703 | Ga0495616_0044536 | 3300046513 | Bacteria | 2250 |
| 704 | Ga0495618_0000282 | 3300046514 | Bacteria | 36848 |
| 705 | Ga0495620_0000012 | 3300046515 | Bacteria | 166395 |
| 706 | Ga0495620_0000742 | 3300046515 | Bacteria | 20067 |
| 707 | Ga0495620_0001923 | 3300046515 | Bacteria | 12178 |
| 708 | Ga0495620_0003045 | 3300046515 | Bacteria | 9633 |
| 709 | Ga0495620_0003619 | 3300046515 | Bacteria | 8820 |
| 710 | Ga0495620_0004446 | 3300046515 | Bacteria | 7901 |
| 711 | Ga0495620_0014976 | 3300046515 | Bacteria | 3925 |
| 712 | Ga0495620_0023845 | 3300046515 | Bacteria | 2917 |
| 713 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 714 | Ga0495628_0022270 | 3300046516 | Bacteria | 5206 |
| 715 | Ga0495628_0060872 | 3300046516 | Bacteria | 2962 |
| 716 | Ga0495630_0005689 | 3300046517 | Bacteria | 8812 |
| 717 | Ga0495631_0000423 | 3300046518 | Bacteria | 29200 |
| 718 | Ga0495631_0000472 | 3300046518 | Bacteria | 27165 |
| 719 | Ga0495631_0002057 | 3300046518 | Bacteria | 11723 |
| 720 | Ga0495631_0004989 | 3300046518 | Bacteria | 6997 |
| 721 | Ga0495632_0000803 | 3300046519 | Bacteria | 27828 |
| 722 | Ga0495632_0002609 | 3300046519 | Bacteria | 13579 |
| 723 | Ga0495632_0003915 | 3300046519 | Bacteria | 10341 |
| 724 | Ga0495632_0006163 | 3300046519 | Bacteria | 7767 |
| 725 | Ga0495632_0014674 | 3300046519 | Bacteria | 4423 |
| 726 | Ga0495632_0019983 | 3300046519 | Bacteria | 3637 |
| 727 | Ga0495632_0038915 | 3300046519 | Bacteria | 2404 |
| 728 | Ga0495637_0000016 | 3300046520 | Bacteria | 226914 |
| 729 | Ga0495637_0000409 | 3300046520 | Bacteria | 31750 |
| 730 | Ga0495637_0002003 | 3300046520 | Bacteria | 11491 |
| 731 | Ga0495637_0002806 | 3300046520 | Bacteria | 9442 |
| 732 | Ga0495637_0003940 | 3300046520 | Bacteria | 7774 |
| 733 | Ga0495637_0004776 | 3300046520 | Bacteria | 6991 |
| 734 | Ga0495637_0006218 | 3300046520 | Bacteria | 6004 |
| 735 | Ga0495637_0007095 | 3300046520 | Bacteria | 5579 |
| 736 | Ga0495637_0013562 | 3300046520 | Bacteria | 3864 |
| 737 | Ga0495643_0000593 | 3300046522 | Bacteria | 43905 |
| 738 | Ga0495643_0001236 | 3300046522 | Bacteria | 24581 |
| 739 | Ga0495643_0006380 | 3300046522 | Bacteria | 7786 |
| 740 | Ga0495643_0016201 | 3300046522 | Bacteria | 4383 |
| 741 | Ga0495643_0019417 | 3300046522 | Bacteria | 3932 |
| 742 | Ga0495643_0020324 | 3300046522 | Bacteria | 3829 |
| 743 | Ga0495643_0039549 | 3300046522 | Bacteria | 2578 |
| 744 | Ga0495644_0006100 | 3300046523 | Bacteria | 4685 |
| 745 | Ga0495644_0011746 | 3300046523 | Bacteria | 3371 |
| 746 | Ga0495648_0002180 | 3300046524 | Bacteria | 18392 |
| 747 | Ga0495648_0003559 | 3300046524 | Bacteria | 13634 |
| 748 | Ga0495648_0008219 | 3300046524 | Bacteria | 8229 |
| 749 | Ga0495648_0012385 | 3300046524 | Bacteria | 6368 |
| 750 | Ga0495648_0015509 | 3300046524 | Bacteria | 5530 |
| 751 | Ga0495648_0048448 | 3300046524 | Bacteria | 2615 |
| 752 | Ga0495648_0057452 | 3300046524 | Bacteria | 2333 |
| 753 | Ga0495666_0009349 | 3300046526 | Bacteria | 4903 |
| 754 | Ga0495642_0003556 | 3300046528 | Bacteria | 6135 |
| 755 | Ga0495642_0028116 | 3300046528 | Bacteria | 2239 |
| 756 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 757 | Ga0495652_0045709 | 3300046529 | Bacteria | 3762 |
| 758 | Ga0495654_0000341 | 3300046530 | Bacteria | 40691 |
| 759 | Ga0495654_0000771 | 3300046530 | Bacteria | 24701 |
| 760 | Ga0495654_0001231 | 3300046530 | Bacteria | 18082 |
| 761 | Ga0495654_0001742 | 3300046530 | Bacteria | 14591 |
| 762 | Ga0495654_0001915 | 3300046530 | Bacteria | 13817 |
| 763 | Ga0495654_0002274 | 3300046530 | Bacteria | 12427 |
| 764 | Ga0495654_0007083 | 3300046530 | Bacteria | 6307 |
| 765 | Ga0495654_0007255 | 3300046530 | Bacteria | 6212 |
| 766 | Ga0495654_0031333 | 3300046530 | Bacteria | 2699 |
| 767 | Ga0495654_0032387 | 3300046530 | Bacteria | 2650 |
| 768 | Ga0495654_0062948 | 3300046530 | Bacteria | 1777 |
| 769 | Ga0495640_0000007 | 3300046533 | Bacteria | 265481 |
| 770 | Ga0495586_0027131 | 3300046535 | Bacteria | 3065 |
| 771 | Ga0495587_0000031 | 3300046536 | Bacteria | 126721 |
| 772 | Ga0495587_0001669 | 3300046536 | Bacteria | 14811 |
| 773 | Ga0495587_0011584 | 3300046536 | Bacteria | 5583 |
| 774 | Ga0495609_0000231 | 3300046538 | Bacteria | 53219 |
| 775 | Ga0495609_0001798 | 3300046538 | Bacteria | 13765 |
| 776 | Ga0495609_0002652 | 3300046538 | Bacteria | 10843 |
| 777 | Ga0495609_0005747 | 3300046538 | Bacteria | 6448 |
| 778 | Ga0495609_0005771 | 3300046538 | Bacteria | 6434 |
| 779 | Ga0495597_0000175 | 3300046542 | Bacteria | 56934 |
| 780 | Ga0495597_0000837 | 3300046542 | Bacteria | 24200 |
| 781 | Ga0495597_0002042 | 3300046542 | Bacteria | 13491 |
| 782 | Ga0495597_0003647 | 3300046542 | Bacteria | 8845 |
| 783 | Ga0495597_0003687 | 3300046542 | Bacteria | 8784 |
| 784 | Ga0495597_0009080 | 3300046542 | Bacteria | 4937 |
| 785 | Ga0495597_0021139 | 3300046542 | Bacteria | 3026 |
| 786 | Ga0495597_0029025 | 3300046542 | Bacteria | 2527 |
| 787 | Ga0495645_0000003 | 3300046543 | Bacteria | 570133 |
| 788 | Ga0495645_0001142 | 3300046543 | Bacteria | 18002 |
| 789 | Ga0495622_0001392 | 3300046557 | Bacteria | 12300 |
| 790 | Ga0495622_0003639 | 3300046557 | Bacteria | 7231 |
| 791 | Ga0495622_0004703 | 3300046557 | Bacteria | 6328 |
| 792 | Ga0495622_0008750 | 3300046557 | Bacteria | 4690 |
| 793 | Ga0495633_0002225 | 3300046558 | Bacteria | 13863 |
| 794 | Ga0495633_0007192 | 3300046558 | Bacteria | 6449 |
| 795 | Ga0495633_0007220 | 3300046558 | Bacteria | 6431 |
| 796 | Ga0495667_0000002 | 3300046559 | Bacteria | 437535 |
| 797 | Ga0495668_0000469 | 3300046616 | Bacteria | 51055 |
| 798 | Ga0495668_0008984 | 3300046616 | Bacteria | 6171 |
| 799 | Ga0495668_0009110 | 3300046616 | Bacteria | 6122 |
| 800 | Ga0495668_0015020 | 3300046616 | Bacteria | 4530 |
| 801 | Ga0495634_0000110 | 3300046642 | Bacteria | 68101 |
| 802 | Ga0495634_0007128 | 3300046642 | Bacteria | 8430 |
| 803 | Ga0495634_0023082 | 3300046642 | Bacteria | 4378 |
| 804 | Ga0495634_0054992 | 3300046642 | Bacteria | 2663 |
| 805 | Ga0495611_0000122 | 3300046648 | Bacteria | 55685 |
| 806 | Ga0495611_0000663 | 3300046648 | Bacteria | 19615 |
| 807 | Ga0495611_0001621 | 3300046648 | Bacteria | 10945 |
| 808 | Ga0495611_0002019 | 3300046648 | Bacteria | 9593 |
| 809 | Ga0495611_0031117 | 3300046648 | Bacteria | 2348 |
| 810 | Ga0495625_0000015 | 3300046660 | Bacteria | 317237 |
| 811 | Ga0495625_0001457 | 3300046660 | Bacteria | 28713 |
| 812 | Ga0495625_0002724 | 3300046660 | Bacteria | 18731 |
| 813 | Ga0495625_0004443 | 3300046660 | Bacteria | 13258 |
| 814 | Ga0495625_0018911 | 3300046660 | Bacteria | 5362 |
| 815 | Ga0495625_0022007 | 3300046660 | Bacteria | 4895 |
| 816 | Ga0495625_0030056 | 3300046660 | Bacteria | 4056 |
| 817 | Ga0495625_0052325 | 3300046660 | Bacteria | 2925 |
| 818 | Ga0495635_0000022 | 3300046663 | Bacteria | 160907 |
| 819 | Ga0495635_0000520 | 3300046663 | Bacteria | 24388 |
| 820 | Ga0495635_0015127 | 3300046663 | Bacteria | 5396 |
| 821 | Ga0495659_0001226 | 3300046664 | Bacteria | 8873 |
| 822 | Ga0495661_0000001 | 3300046665 | Bacteria | 898372 |
| 823 | Ga0495661_0000075 | 3300046665 | Bacteria | 119777 |
| 824 | Ga0495661_0000491 | 3300046665 | Bacteria | 41378 |
| 825 | Ga0495661_0001678 | 3300046665 | Bacteria | 18051 |
| 826 | Ga0495661_0002674 | 3300046665 | Bacteria | 13637 |
| 827 | Ga0495661_0022703 | 3300046665 | Bacteria | 4080 |
| 828 | Ga0495661_0024597 | 3300046665 | Bacteria | 3899 |
| 829 | Ga0495657_0002481 | 3300046675 | Bacteria | 15518 |
| 830 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 831 | Ga0495623_0000898 | 3300046679 | Bacteria | 20166 |
| 832 | Ga0495646_0000007 | 3300046680 | Bacteria | 236764 |
| 833 | Ga0495646_0006657 | 3300046680 | Bacteria | 7326 |
| 834 | Ga0495646_0008412 | 3300046680 | Bacteria | 6552 |
| 835 | Ga0495613_0001531 | 3300046689 | Bacteria | 17600 |
| 836 | Ga0495613_0014177 | 3300046689 | Bacteria | 5913 |
| 837 | Ga0495613_0042616 | 3300046689 | Bacteria | 3358 |
| 838 | Ga0495624_0006117 | 3300046690 | Bacteria | 8573 |
| 839 | Ga0495670_0000195 | 3300046691 | Bacteria | 27168 |
| 840 | Ga0495670_0003338 | 3300046691 | Bacteria | 7902 |
| 841 | Ga0495670_0032037 | 3300046691 | Bacteria | 2613 |
| 842 | Ga0495671_0000011 | 3300046692 | Bacteria | 365582 |
| 843 | Ga0495671_0000348 | 3300046692 | Bacteria | 38480 |
| 844 | Ga0495671_0001149 | 3300046692 | Bacteria | 18190 |
| 845 | Ga0495671_0002810 | 3300046692 | Bacteria | 10894 |
| 846 | Ga0495671_0006736 | 3300046692 | Bacteria | 6612 |
| 847 | Ga0495671_0008036 | 3300046692 | Bacteria | 5962 |
| 848 | Ga0495671_0009197 | 3300046692 | Bacteria | 5522 |
| 849 | Ga0495671_0009230 | 3300046692 | Bacteria | 5513 |
| 850 | Ga0495671_0019129 | 3300046692 | Bacteria | 3624 |
| 851 | Ga0495671_0032706 | 3300046692 | Bacteria | 2654 |
| 852 | Ga0495671_0051075 | 3300046692 | Bacteria | 2057 |
| 853 | Ga0495649_0000272 | 3300046694 | Bacteria | 46077 |
| 854 | Ga0495649_0002881 | 3300046694 | Bacteria | 11921 |
| 855 | Ga0495649_0003495 | 3300046694 | Bacteria | 10581 |
| 856 | Ga0495649_0012114 | 3300046694 | Bacteria | 5032 |
| 857 | Ga0495649_0014303 | 3300046694 | Bacteria | 4552 |
| 858 | Ga0495649_0024100 | 3300046694 | Bacteria | 3396 |
| 859 | Ga0495649_0026241 | 3300046694 | Bacteria | 3242 |
| 860 | Ga0495649_0027247 | 3300046694 | Bacteria | 3171 |
| 861 | Ga0495649_0045078 | 3300046694 | Bacteria | 2405 |
| 862 | Ga0495649_0060125 | 3300046694 | Bacteria | 2044 |
| 863 | Ga0495589_0000576 | 3300046794 | Bacteria | 25355 |
| 864 | Ga0495589_0001356 | 3300046794 | Bacteria | 14319 |
| 865 | Ga0495589_0002374 | 3300046794 | Bacteria | 10574 |
| 866 | Ga0495589_0006384 | 3300046794 | Bacteria | 6227 |
| 867 | Ga0495589_0007131 | 3300046794 | Bacteria | 5856 |
| 868 | Ga0495589_0012439 | 3300046794 | Bacteria | 4407 |
| 869 | Ga0495660_0000829 | 3300046810 | Bacteria | 22990 |
| 870 | Ga0495660_0001599 | 3300046810 | Bacteria | 15207 |
| 871 | Ga0495660_0014955 | 3300046810 | Bacteria | 4488 |
| 872 | Ga0495660_0018964 | 3300046810 | Bacteria | 3949 |
| 873 | Ga0495660_0031227 | 3300046810 | Bacteria | 2995 |
| 874 | Ga0495660_0048045 | 3300046810 | Bacteria | 2334 |
| 875 | Ga0495660_0048956 | 3300046810 | Bacteria | 2309 |
| 876 | Ga0495581_0001847 | 3300047315 | Bacteria | 11846 |
| 877 | Ga0495581_0008885 | 3300047315 | Bacteria | 5817 |
| 878 | Ga0495581_0012229 | 3300047315 | Bacteria | 4970 |
| 879 | Ga0495604_0000005 | 3300047317 | Bacteria | 424516 |
| 880 | Ga0495604_0006222 | 3300047317 | Bacteria | 9473 |
| 881 | Ga0495604_0034073 | 3300047317 | Bacteria | 4029 |
| 882 | Ga0495636_0001195 | 3300047318 | Bacteria | 9808 |
| 883 | Ga0495674_0000003 | 3300047319 | Bacteria | 562126 |
| 884 | Ga0495674_0017007 | 3300047319 | Bacteria | 6778 |
| 885 | Ga0495672_0000059 | 3300047320 | Bacteria | 217302 |
| 886 | Ga0495672_0002933 | 3300047320 | Bacteria | 15047 |
| 887 | Ga0495672_0004094 | 3300047320 | Bacteria | 12161 |
| 888 | Ga0495672_0004404 | 3300047320 | Bacteria | 11546 |
| 889 | Ga0495672_0004737 | 3300047320 | Bacteria | 10986 |
| 890 | Ga0495672_0005320 | 3300047320 | Bacteria | 10242 |
| 891 | Ga0495672_0006304 | 3300047320 | Bacteria | 9224 |
| 892 | Ga0495672_0006980 | 3300047320 | Bacteria | 8583 |
| 893 | Ga0495672_0015319 | 3300047320 | Bacteria | 5211 |
| 894 | Ga0495672_0033075 | 3300047320 | Bacteria | 3207 |
| 895 | Ga0495672_0037276 | 3300047320 | Bacteria | 2976 |
| 896 | Ga0495672_0039134 | 3300047320 | Bacteria | 2885 |
| 897 | Ga0495672_0078362 | 3300047320 | Bacteria | 1848 |
| 898 | Ga0495676_0000001 | 3300047321 | Bacteria | 624167 |
| 899 | Ga0495676_0002451 | 3300047321 | Bacteria | 16487 |
| 900 | Ga0495676_0003597 | 3300047321 | Bacteria | 14067 |
| 901 | Ga0495676_0015876 | 3300047321 | Bacteria | 6693 |
| 902 | Ga0495680_0000091 | 3300047322 | Bacteria | 81622 |
| 903 | Ga0495680_0005855 | 3300047322 | Bacteria | 11506 |
| 904 | Ga0495683_0000043 | 3300047323 | Bacteria | 136876 |
| 905 | Ga0495683_0001732 | 3300047323 | Bacteria | 13792 |
| 906 | Ga0495683_0003532 | 3300047323 | Bacteria | 9097 |
| 907 | Ga0495683_0003604 | 3300047323 | Bacteria | 8984 |
| 908 | Ga0495683_0009926 | 3300047323 | Bacteria | 5056 |
| 909 | Ga0495683_0010099 | 3300047323 | Bacteria | 5003 |
| 910 | Ga0495683_0030225 | 3300047323 | Bacteria | 2765 |
| 911 | Ga0495687_000015 | 3300047443 | Bacteria | 365627 |
| 912 | Ga0495687_002768 | 3300047443 | Bacteria | 13581 |
| 913 | Ga0495687_005668 | 3300047443 | Bacteria | 7885 |
| 914 | Ga0495687_007146 | 3300047443 | Bacteria | 6651 |
| 915 | Ga0495687_014931 | 3300047443 | Bacteria | 3969 |
| 916 | Ga0495687_018435 | 3300047443 | Bacteria | 3450 |
| 917 | Ga0495675_0000133 | 3300047444 | Bacteria | 52544 |
| 918 | Ga0495679_000071 | 3300047446 | Bacteria | 97677 |
| 919 | Ga0495679_000081 | 3300047446 | Bacteria | 88918 |
| 920 | Ga0495679_002408 | 3300047446 | Bacteria | 9549 |
| 921 | Ga0495679_002727 | 3300047446 | Bacteria | 8793 |
| 922 | Ga0495679_021932 | 3300047446 | Bacteria | 2195 |
| 923 | Ga0495685_007417 | 3300047447 | Bacteria | 3621 |
| 924 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 925 | Ga0495673_0000924 | 3300047469 | Bacteria | 26657 |
| 926 | Ga0495673_0001422 | 3300047469 | Bacteria | 19169 |
| 927 | Ga0495673_0001817 | 3300047469 | Bacteria | 16119 |
| 928 | Ga0495673_0001954 | 3300047469 | Bacteria | 15301 |
| 929 | Ga0495673_0004535 | 3300047469 | Bacteria | 8672 |
| 930 | Ga0495673_0004601 | 3300047469 | Bacteria | 8591 |
| 931 | Ga0495673_0006740 | 3300047469 | Bacteria | 6713 |
| 932 | Ga0495681_0000483 | 3300047470 | Bacteria | 30581 |
| 933 | Ga0495681_0001489 | 3300047470 | Bacteria | 17496 |
| 934 | Ga0495681_0002540 | 3300047470 | Bacteria | 12998 |
| 935 | Ga0495681_0004310 | 3300047470 | Bacteria | 9736 |
| 936 | Ga0495681_0004383 | 3300047470 | Bacteria | 9641 |
| 937 | Ga0495681_0006550 | 3300047470 | Bacteria | 7630 |
| 938 | Ga0495681_0007466 | 3300047470 | Bacteria | 6978 |
| 939 | Ga0495681_0008329 | 3300047470 | Bacteria | 6510 |
| 940 | Ga0495681_0018160 | 3300047470 | Bacteria | 3882 |
| 941 | Ga0495681_0021832 | 3300047470 | Bacteria | 3439 |
| 942 | Ga0495681_0027722 | 3300047470 | Bacteria | 2925 |
| 943 | Ga0495684_0000035 | 3300047471 | Bacteria | 107768 |
| 944 | Ga0495686_0000042 | 3300047472 | Bacteria | 293968 |
| 945 | Ga0495686_0010349 | 3300047472 | Bacteria | 6639 |
| 946 | Ga0495686_0020449 | 3300047472 | Bacteria | 4413 |
| 947 | Ga0495686_0021463 | 3300047472 | Bacteria | 4288 |
| 948 | Ga0495686_0064621 | 3300047472 | Bacteria | 2264 |
| 949 | Ga0495593_0000746 | 3300047673 | Bacteria | 18929 |
| 950 | Ga0495593_0003672 | 3300047673 | Bacteria | 9162 |
| 951 | Ga0495602_0000029 | 3300048088 | Bacteria | 142344 |
| 952 | Ga0495602_0019220 | 3300048088 | Bacteria | 6792 |
| 953 | Ga0495614_0002106 | 3300048089 | Bacteria | 8792 |
| 954 | Ga0495626_0000008 | 3300048091 | Bacteria | 271853 |
| 955 | Ga0495626_0000364 | 3300048091 | Bacteria | 47517 |
| 956 | Ga0495626_0000705 | 3300048091 | Bacteria | 31675 |
| 957 | Ga0495626_0000767 | 3300048091 | Bacteria | 29487 |
| 958 | Ga0495626_0002131 | 3300048091 | Bacteria | 14326 |
| 959 | Ga0495626_0004194 | 3300048091 | Bacteria | 8931 |
| 960 | Ga0495626_0005203 | 3300048091 | Bacteria | 7701 |
| 961 | Ga0495626_0005475 | 3300048091 | Bacteria | 7410 |
| 962 | Ga0495626_0008184 | 3300048091 | Bacteria | 5760 |
| 963 | Ga0495626_0046058 | 3300048091 | Bacteria | 2033 |
| 964 | Ga0496100_0004321 | 3300048903 | Bacteria | 7525 |
| 965 | Ga0496100_0005571 | 3300048903 | Bacteria | 6797 |
| 966 | Ga0496100_0023145 | 3300048903 | Bacteria | 3769 |
| 967 | Ga0496100_0027976 | 3300048903 | Bacteria | 3473 |
| 968 | Ga0496101_0000269 | 3300048904 | Bacteria | 36730 |
| 969 | Ga0496101_0008618 | 3300048904 | Bacteria | 6667 |
| 970 | Ga0496101_0020118 | 3300048904 | Bacteria | 4565 |
| 971 | Ga0496102_0000138 | 3300048905 | Bacteria | 98703 |
| 972 | Ga0496103_0002580 | 3300048906 | Bacteria | 11345 |
| 973 | Ga0496104_0029919 | 3300048907 | Bacteria | 5057 |
| 974 | Ga0496105_0011836 | 3300048908 | Bacteria | 6910 |
| 975 | Ga0496105_0028840 | 3300048908 | Bacteria | 4541 |
| 976 | Ga0496106_0006861 | 3300048909 | Bacteria | 8427 |
| 977 | Ga0496106_0018839 | 3300048909 | Bacteria | 5114 |
| 978 | Ga0496106_0078080 | 3300048909 | Bacteria | 2540 |
| 979 | Ga0496108_0006388 | 3300048911 | Bacteria | 9554 |
| 980 | Ga0496109_0007921 | 3300048912 | Bacteria | 9005 |
| 981 | Ga0496110_0019961 | 3300048913 | Bacteria | 5649 |
| 982 | Ga0496111_0028924 | 3300048914 | Bacteria | 3930 |
| 983 | Ga0496112_0001121 | 3300048915 | Bacteria | 19909 |
| 984 | Ga0496112_0015288 | 3300048915 | Bacteria | 7156 |
| 985 | Ga0496112_0026647 | 3300048915 | Bacteria | 5567 |
| 986 | Ga0496113_0017878 | 3300048916 | Bacteria | 4928 |
| 987 | Ga0496113_0033341 | 3300048916 | Bacteria | 3748 |
| 988 | Ga0496114_0003352 | 3300048917 | Bacteria | 12312 |
| 989 | Ga0496114_0018376 | 3300048917 | Bacteria | 5653 |
| 990 | Ga0496115_0137830 | 3300048918 | Bacteria | 2012 |
| 991 | Ga0496116_0000001 | 3300048919 | Bacteria | 1501681 |
| 992 | Ga0496116_0000065 | 3300048919 | Bacteria | 265193 |
| 993 | Ga0496116_0000267 | 3300048919 | Bacteria | 91320 |
| 994 | Ga0496116_0000605 | 3300048919 | Bacteria | 47467 |
| 995 | Ga0496116_0003570 | 3300048919 | Bacteria | 15289 |
| 996 | Ga0496116_0013688 | 3300048919 | Bacteria | 6522 |
| 997 | Ga0496116_0038985 | 3300048919 | Bacteria | 3290 |
| 998 | Ga0496116_0053700 | 3300048919 | Bacteria | 2659 |
| 999 | Ga0496117_0000245 | 3300048920 | Bacteria | 102799 |
| 1000 | Ga0496117_0000345 | 3300048920 | Bacteria | 82051 |
| 1001 | Ga0496117_0000866 | 3300048920 | Bacteria | 46705 |
| 1002 | Ga0496117_0001344 | 3300048920 | Bacteria | 36059 |
| 1003 | Ga0496117_0002196 | 3300048920 | Bacteria | 25381 |
| 1004 | Ga0496117_0002910 | 3300048920 | Bacteria | 20715 |
| 1005 | Ga0496117_0002920 | 3300048920 | Bacteria | 20685 |
| 1006 | Ga0496117_0004635 | 3300048920 | Bacteria | 14976 |
| 1007 | Ga0496117_0005308 | 3300048920 | Bacteria | 13623 |
| 1008 | Ga0496117_0021683 | 3300048920 | Bacteria | 5184 |
| 1009 | Ga0496117_0030146 | 3300048920 | Bacteria | 4168 |
| 1010 | Ga0496117_0049549 | 3300048920 | Bacteria | 2986 |
| 1011 | Ga0496117_0063403 | 3300048920 | Bacteria | 2526 |
| 1012 | Ga0496118_0001300 | 3300048921 | Bacteria | 38048 |
| 1013 | Ga0496118_0004485 | 3300048921 | Bacteria | 16529 |
| 1014 | Ga0496118_0008231 | 3300048921 | Bacteria | 10819 |
| 1015 | Ga0496118_0008529 | 3300048921 | Bacteria | 10578 |
| 1016 | Ga0496118_0011583 | 3300048921 | Bacteria | 8588 |
| 1017 | Ga0496118_0023500 | 3300048921 | Bacteria | 5351 |
| 1018 | Ga0496118_0024914 | 3300048921 | Bacteria | 5149 |
| 1019 | Ga0496118_0034968 | 3300048921 | Bacteria | 4089 |
| 1020 | Ga0496118_0035394 | 3300048921 | Bacteria | 4054 |
| 1021 | Ga0496118_0039498 | 3300048921 | Bacteria | 3764 |
| 1022 | Ga0496118_0049144 | 3300048921 | Bacteria | 3250 |
| 1023 | Ga0496118_0056964 | 3300048921 | Bacteria | 2933 |
| 1024 | Ga0496119_0000011 | 3300048922 | Bacteria | 438315 |
| 1025 | Ga0496119_0001557 | 3300048922 | Bacteria | 27320 |
| 1026 | Ga0496119_0007379 | 3300048922 | Bacteria | 9926 |
| 1027 | Ga0496120_0000306 | 3300048923 | Bacteria | 81699 |
| 1028 | Ga0496120_0001332 | 3300048923 | Bacteria | 30475 |
| 1029 | Ga0496120_0029590 | 3300048923 | Bacteria | 3342 |
| 1030 | Ga0496121_0000366 | 3300048924 | Bacteria | 92773 |
| 1031 | Ga0496121_0000487 | 3300048924 | Bacteria | 76772 |
| 1032 | Ga0496121_0000670 | 3300048924 | Bacteria | 63957 |
| 1033 | Ga0496121_0010504 | 3300048924 | Bacteria | 10430 |
| 1034 | Ga0496121_0014728 | 3300048924 | Bacteria | 8263 |
| 1035 | Ga0496121_0027246 | 3300048924 | Bacteria | 5352 |
| 1036 | Ga0496121_0031160 | 3300048924 | Bacteria | 4878 |
| 1037 | Ga0496121_0087404 | 3300048924 | Bacteria | 2447 |
| 1038 | Ga0496122_0000221 | 3300048925 | Bacteria | 127004 |
| 1039 | Ga0496122_0000292 | 3300048925 | Bacteria | 110793 |
| 1040 | Ga0496122_0001617 | 3300048925 | Bacteria | 35202 |
| 1041 | Ga0496122_0009392 | 3300048925 | Bacteria | 10317 |
| 1042 | Ga0496122_0009594 | 3300048925 | Bacteria | 10140 |
| 1043 | Ga0496122_0011780 | 3300048925 | Bacteria | 8804 |
| 1044 | Ga0496122_0019468 | 3300048925 | Bacteria | 6198 |
| 1045 | Ga0496122_0068190 | 3300048925 | Bacteria | 2556 |
| 1046 | Ga0496123_0000037 | 3300048926 | Bacteria | 262238 |
| 1047 | Ga0496123_0000989 | 3300048926 | Bacteria | 43699 |
| 1048 | Ga0496123_0001885 | 3300048926 | Bacteria | 27375 |
| 1049 | Ga0496123_0003653 | 3300048926 | Bacteria | 17002 |
| 1050 | Ga0496123_0013312 | 3300048926 | Bacteria | 6922 |
| 1051 | Ga0496123_0017058 | 3300048926 | Bacteria | 5862 |
| 1052 | Ga0496123_0024630 | 3300048926 | Bacteria | 4567 |
| 1053 | Ga0496124_0000035 | 3300048927 | Bacteria | 318099 |
| 1054 | Ga0496124_0000580 | 3300048927 | Bacteria | 61729 |
| 1055 | Ga0496124_0001300 | 3300048927 | Bacteria | 37788 |
| 1056 | Ga0496124_0001404 | 3300048927 | Bacteria | 35955 |
| 1057 | Ga0496124_0002380 | 3300048927 | Bacteria | 24767 |
| 1058 | Ga0496124_0012335 | 3300048927 | Bacteria | 8439 |
| 1059 | Ga0496124_0013458 | 3300048927 | Bacteria | 7985 |
| 1060 | Ga0496124_0014681 | 3300048927 | Bacteria | 7562 |
| 1061 | Ga0496124_0022527 | 3300048927 | Bacteria | 5770 |
| 1062 | Ga0496124_0032175 | 3300048927 | Bacteria | 4636 |
| 1063 | Ga0496124_0054355 | 3300048927 | Bacteria | 3390 |
| 1064 | Ga0496124_0073995 | 3300048927 | Bacteria | 2817 |
| 1065 | Ga0496125_0000196 | 3300048928 | Bacteria | 129294 |
| 1066 | Ga0496125_0004719 | 3300048928 | Bacteria | 15540 |
| 1067 | Ga0496125_0005204 | 3300048928 | Bacteria | 14596 |
| 1068 | Ga0496125_0011827 | 3300048928 | Bacteria | 8698 |
| 1069 | Ga0496125_0020403 | 3300048928 | Bacteria | 6219 |
| 1070 | Ga0496125_0022209 | 3300048928 | Bacteria | 5897 |
| 1071 | Ga0496125_0022410 | 3300048928 | Bacteria | 5867 |
| 1072 | Ga0496125_0042488 | 3300048928 | Bacteria | 3870 |
| 1073 | Ga0496126_0000105 | 3300048929 | Bacteria | 198893 |
| 1074 | Ga0496126_0002998 | 3300048929 | Bacteria | 21927 |
| 1075 | Ga0496126_0005096 | 3300048929 | Bacteria | 15231 |
| 1076 | Ga0496126_0008363 | 3300048929 | Bacteria | 11166 |
| 1077 | Ga0496126_0033548 | 3300048929 | Bacteria | 4828 |
| 1078 | Ga0496126_0035937 | 3300048929 | Bacteria | 4637 |
| 1079 | Ga0496126_0088632 | 3300048929 | Bacteria | 2725 |
| 1080 | Ga0495678_001085 | 3300049459 | Bacteria | 22975 |
| 1081 | Ga0495678_002002 | 3300049459 | Bacteria | 14634 |
| 1082 | Ga0495678_003062 | 3300049459 | Bacteria | 10614 |
| 1083 | Ga0495678_003176 | 3300049459 | Bacteria | 10355 |
| 1084 | Ga0495678_004295 | 3300049459 | Bacteria | 8309 |
| 1085 | Ga0495678_004428 | 3300049459 | Bacteria | 8122 |
| 1086 | Ga0495678_005242 | 3300049459 | Bacteria | 7224 |
| 1087 | Ga0495678_024370 | 3300049459 | Bacteria | 2613 |
| 1088 | Ga0495678_033623 | 3300049459 | Bacteria | 2115 |
| 1089 | Ga0495682_0000113 | 3300049460 | Bacteria | 69969 |
| 1090 | Ga0495682_0000118 | 3300049460 | Bacteria | 69167 |
| 1091 | Ga0495682_0004503 | 3300049460 | Bacteria | 5944 |
| 1092 | Ga0501034_0000248 | 3300049571 | Bacteria | 99691 |
| 1093 | Ga0501039_0017022 | 3300049575 | Bacteria | 5572 |
| 1094 | Ga0501073_0006663 | 3300049589 | Bacteria | 8602 |
| 1095 | Ga0501083_0002432 | 3300049744 | Bacteria | 12739 |
| 1096 | nmdc:mga06z11_11725_c1 | 3300050494 | Bacteria | 3789 |
| 1097 | nmdc:mga05p37_2582_c1 | 3300050507 | Bacteria | 21054 |
| 1098 | nmdc:mga09592_747_c1 | 3300050508 | Bacteria | 25046 |
| 1099 | nmdc:mga0qj67_34105_c1 | 3300050509 | Bacteria | 3975 |
| 1100 | nmdc:mga06r32_811_c1 | 3300050510 | Bacteria | 27762 |
| 1101 | nmdc:mga08y16_34317_c1 | 3300050511 | Bacteria | 5331 |
| 1102 | nmdc:mga0n895_29461_c1 | 3300050512 | Bacteria | 5237 |
| 1103 | nmdc:mga08x19_16934_c1 | 3300050514 | Bacteria | 4453 |
| 1104 | nmdc:mga0a205_2891_c1 | 3300050515 | Bacteria | 15195 |
| 1105 | Ga0495601_0000008 | 3300053077 | Bacteria | 362152 |
| 1106 | Ga0495612_0000026 | 3300053078 | Bacteria | 111627 |
| 1107 | Ga0495612_0024122 | 3300053078 | Bacteria | 2442 |
| 1108 | Ga0495595_0000024 | 3300053084 | Bacteria | 108008 |
| 1109 | Ga0495619_0000002 | 3300053085 | Bacteria | 530226 |
| 1110 | Ga0500572_002276 | 3300053111 | Bacteria | 4669 |
| 1111 | Ga0500618_002165 | 3300053125 | Bacteria | 7712 |
| 1112 | Ga0500659_0001817 | 3300053135 | Bacteria | 13338 |
| 1113 | Ga0500559_0005743 | 3300053136 | Bacteria | 5667 |
| 1114 | Ga0500604_0005290 | 3300053151 | Bacteria | 3411 |
| 1115 | Ga0587090_000459 | 3300059510 | Bacteria | 3400 |
| 1116 | Ga0587072_000018 | 3300059643 | Bacteria | 10605 |
| 1117 | Ga0466962_0006789 | 3300061719 | Bacteria | 5491 |
| 1118 | Ga0466962_0008470 | 3300061719 | Bacteria | 4928 |
| 1119 | 2506578563 | 2506520007 | Bacteria | 5442880 |
| 1120 | 2506583702 | 2506520008 | Bacteria | 5443009 |
| 1121 | 2510284240 | 2510065053 | Bacteria | 5005518 |
| 1122 | 2510293076 | 2510065055 | Bacteria | 5037935 |
| 1123 | 2510312577 | 2510065058 | Bacteria | 5005894 |
| 1124 | 2511252944 | 2511231004 | Bacteria | 6669789 |
| 1125 | 2511267140 | 2511231006 | Bacteria | 6794709 |
| 1126 | 2511271378 | 2511231007 | Bacteria | 6306603 |
| 1127 | 2511278513 | 2511231008 | Bacteria | 6624100 |
| 1128 | 2511292311 | 2511231010 | Bacteria | 6373152 |
| 1129 | 2511295260 | 2511231011 | Bacteria | 6149768 |
| 1130 | 2511302551 | 2511231012 | Bacteria | 6738011 |
| 1131 | 2511316087 | 2511231014 | Bacteria | 6462302 |
| 1132 | 2511323199 | 2511231015 | Bacteria | 6598026 |
| 1133 | 2511328088 | 2511231016 | Bacteria | 6704427 |
| 1134 | 2511335043 | 2511231017 | Bacteria | 6503007 |
| 1135 | 2511338341 | 2511231018 | Bacteria | 6436256 |
| 1136 | 2511344529 | 2511231019 | Bacteria | 6520662 |
| 1137 | 2511350915 | 2511231020 | Bacteria | 6115223 |
| 1138 | 2511359891 | 2511231021 | Bacteria | 7302637 |
| 1139 | 2511362073 | 2511231022 | Bacteria | 6719296 |
| 1140 | 2511370615 | 2511231023 | Bacteria | 6808468 |
| 1141 | 2511374932 | 2511231024 | Bacteria | 5835885 |
| 1142 | 2511411427 | 2511231031 | Bacteria | 6558529 |
| 1143 | 2511827092 | 2511231156 | Bacteria | 6845832 |
| 1144 | 2512324702 | 2512047018 | Bacteria | 6663241 |
| 1145 | 2514054968 | 2513237166 | Bacteria | 10373764 |
| 1146 | 2519460470 | 2519103095 | Bacteria | 6629912 |
| 1147 | 2554812594 | 2554235132 | Bacteria | 6772433 |
| 1148 | 2555248339 | 2554235231 | Bacteria | 5215788 |
| 1149 | 2555257435 | 2554235234 | Bacteria | 5762085 |
| 1150 | 2555672301 | 2554235341 | Bacteria | 6867980 |
| 1151 | 2563062836 | 2562617112 | Bacteria | 10918404 |
| 1152 | 2583794739 | 2582580891 | Bacteria | 6800976 |
| 1153 | 2585292965 | 2582581311 | Bacteria | 6763856 |
| 1154 | 2585305990 | 2582581313 | Bacteria | 10042643 |
| 1155 | 2597031047 | 2596583598 | Bacteria | 5251611 |
| 1156 | 2597860373 | 2597489887 | Bacteria | 6666321 |
| 1157 | 2597866117 | 2597489888 | Bacteria | 6179543 |
| 1158 | 2597871943 | 2597489889 | Bacteria | 6297495 |
| 1159 | 2599326775 | 2599185155 | Bacteria | 5827168 |
| 1160 | 2599358256 | 2599185160 | Bacteria | 6844013 |
| 1161 | 2599364611 | 2599185161 | Bacteria | 6960462 |
| 1162 | 2599370853 | 2599185162 | Bacteria | 6957254 |
| 1163 | 2599376875 | 2599185163 | Bacteria | 6995158 |
| 1164 | 2599383421 | 2599185164 | Bacteria | 6841688 |
| 1165 | 2599389868 | 2599185165 | Bacteria | 6843250 |
| 1166 | 2599396157 | 2599185166 | Bacteria | 6959206 |
| 1167 | 2599401423 | 2599185167 | Bacteria | 6353609 |
| 1168 | 2599407997 | 2599185168 | Bacteria | 6997636 |
| 1169 | 2599408936 | 2599185169 | Bacteria | 5441380 |
| 1170 | 2599448175 | 2599185178 | Bacteria | 5365746 |
| 1171 | 2599453108 | 2599185179 | Bacteria | 6611171 |
| 1172 | 2599465071 | 2599185181 | Bacteria | 6844519 |
| 1173 | 2599471388 | 2599185182 | Bacteria | 6883168 |
| 1174 | 2599486785 | 2599185185 | Bacteria | 6652270 |
| 1175 | 2599494014 | 2599185186 | Bacteria | 6831633 |
| 1176 | 2599505184 | 2599185188 | Bacteria | 6164180 |
| 1177 | 2599509863 | 2599185189 | Bacteria | 5862825 |
| 1178 | 2599515113 | 2599185190 | Bacteria | 6285678 |
| 1179 | 2599520277 | 2599185191 | Bacteria | 6297582 |
| 1180 | 2599616915 | 2599185212 | Bacteria | 6765997 |
| 1181 | 2599736060 | 2599185239 | Bacteria | 8686614 |
| 1182 | 2599747981 | 2599185240 | Bacteria | 7968121 |
| 1183 | 2599772884 | 2599185248 | Bacteria | 6696816 |
| 1184 | 2599807091 | 2599185257 | Bacteria | 6492581 |
| 1185 | 2599881714 | 2599185288 | Bacteria | 6666191 |
| 1186 | 2599888198 | 2599185289 | Bacteria | 6778765 |
| 1187 | 2599894493 | 2599185290 | Bacteria | 6289611 |
| 1188 | 2599901020 | 2599185291 | Bacteria | 6775623 |
| 1189 | 2599928603 | 2599185299 | Bacteria | 4854625 |
| 1190 | 2599934504 | 2599185300 | Bacteria | 6062622 |
| 1191 | 2599945083 | 2599185302 | Bacteria | 5954930 |
| 1192 | 2599949337 | 2599185303 | Bacteria | 6512725 |
| 1193 | 2599955188 | 2599185304 | Bacteria | 5951361 |
| 1194 | 2599962750 | 2599185305 | Bacteria | 6748700 |
| 1195 | 2599969299 | 2599185306 | Bacteria | 6637356 |
| 1196 | 2599980630 | 2599185308 | Bacteria | 6621546 |
| 1197 | 2599983921 | 2599185309 | Bacteria | 5969593 |
| 1198 | 2599990361 | 2599185310 | Bacteria | 6014457 |
| 1199 | 2599997403 | 2599185311 | Bacteria | 6354990 |
| 1200 | 2600001697 | 2599185312 | Bacteria | 5912071 |
| 1201 | 2600008439 | 2599185313 | Bacteria | 6658188 |
| 1202 | 2600014278 | 2599185314 | Bacteria | 6621749 |
| 1203 | 2600020856 | 2599185315 | Bacteria | 6771107 |
| 1204 | 2600026261 | 2599185316 | Bacteria | 6320029 |
| 1205 | 2600031811 | 2599185317 | Bacteria | 6435722 |
| 1206 | 2600038652 | 2599185318 | Bacteria | 6961590 |
| 1207 | 2600044102 | 2599185319 | Bacteria | 6637840 |
| 1208 | 2600048895 | 2599185320 | Bacteria | 5963263 |
| 1209 | 2600056078 | 2599185321 | Bacteria | 6764560 |
| 1210 | 2600062749 | 2599185322 | Bacteria | 6763055 |
| 1211 | 2600067744 | 2599185323 | Bacteria | 6688755 |
| 1212 | 2600073845 | 2599185324 | Bacteria | 6590677 |
| 1213 | 2600079531 | 2599185325 | Bacteria | 6324919 |
| 1214 | 2600210769 | 2599185355 | Bacteria | 7968906 |
| 1215 | 2600217804 | 2599185356 | Bacteria | 6843884 |
| 1216 | 2600360337 | 2600254930 | Bacteria | 6431253 |
| 1217 | 2600367113 | 2600254931 | Bacteria | 6734225 |
| 1218 | 2600445252 | 2600254954 | Bacteria | 5100516 |
| 1219 | 2601522547 | 2600255254 | Bacteria | 5281859 |
| 1220 | 2601527574 | 2600255255 | Bacteria | 5282785 |
| 1221 | 2601614405 | 2600255280 | Bacteria | 5292309 |
| 1222 | 2601619125 | 2600255281 | Bacteria | 5288753 |
| 1223 | 2601624441 | 2600255283 | Bacteria | 6061572 |
| 1224 | 2601642255 | 2600255287 | Bacteria | 5210468 |
| 1225 | 2601647117 | 2600255288 | Bacteria | 5282738 |
| 1226 | 2601652552 | 2600255289 | Bacteria | 5281907 |
| 1227 | 2601657878 | 2600255290 | Bacteria | 5282218 |
| 1228 | 2601662078 | 2600255291 | Bacteria | 5217298 |
| 1229 | 2601693953 | 2600255296 | Bacteria | 5784754 |
| 1230 | 2601695036 | 2600255298 | Bacteria | 5215185 |
| 1231 | 2601699708 | 2600255299 | Bacteria | 5218662 |
| 1232 | 2601706397 | 2600255300 | Bacteria | 5287774 |
| 1233 | 2601710703 | 2600255301 | Bacteria | 5280532 |
| 1234 | 2601715717 | 2600255302 | Bacteria | 5288235 |
| 1235 | 2601720059 | 2600255303 | Bacteria | 5219315 |
| 1236 | 2601726123 | 2600255304 | Bacteria | 5283973 |
| 1237 | 2601730664 | 2600255305 | Bacteria | 5282329 |
| 1238 | 2601735680 | 2600255306 | Bacteria | 5281613 |
| 1239 | 2601740948 | 2600255307 | Bacteria | 5439064 |
| 1240 | 2601750878 | 2600255309 | Bacteria | 5431045 |
| 1241 | 2601777971 | 2600255313 | Bacteria | 6842543 |
| 1242 | 2601800469 | 2600255318 | Bacteria | 6383414 |
| 1243 | 2602012363 | 2600255389 | Bacteria | 5275336 |
| 1244 | 2602018132 | 2600255392 | Bacteria | 5437392 |
| 1245 | 2603659440 | 2602042052 | Bacteria | 5215873 |
| 1246 | 2603664715 | 2602042053 | Bacteria | 5214361 |
| 1247 | 2603838056 | 2602042103 | Bacteria | 5284714 |
| 1248 | 2603843134 | 2602042104 | Bacteria | 5281639 |
| 1249 | 2603848207 | 2602042105 | Bacteria | 5282303 |
| 1250 | 2603853282 | 2602042106 | Bacteria | 5282744 |
| 1251 | 2603867226 | 2602042109 | Bacteria | 5152801 |
| 1252 | 2603871333 | 2602042110 | Bacteria | 5283285 |
| 1253 | 2603876264 | 2602042111 | Bacteria | 5212080 |
| 1254 | 2606048526 | 2603880178 | Bacteria | 5283018 |
| 1255 | 2606069142 | 2603880184 | Bacteria | 5217896 |
| 1256 | 2606078723 | 2603880185 | Bacteria | 6379190 |
| 1257 | 2606125617 | 2603880199 | Bacteria | 6377649 |
| 1258 | 2606144964 | 2603880202 | Bacteria | 5284684 |
| 1259 | 2606175927 | 2603880211 | Bacteria | 5284226 |
| 1260 | 2608384907 | 2606217733 | Bacteria | 6360972 |
| 1261 | 2621297358 | 2619619299 | Bacteria | 6649820 |
| 1262 | 2624482884 | 2623620443 | Bacteria | 6427864 |
| 1263 | 2624494426 | 2623620446 | Bacteria | 6500345 |
| 1264 | 2637224807 | 2636415599 | Bacteria | 5718434 |
| 1265 | 2643844805 | 2643221565 | Bacteria | 6216018 |
| 1266 | 2643869707 | 2643221571 | Bacteria | 6228673 |
| 1267 | 2643957571 | 2643221589 | Bacteria | 6250934 |
| 1268 | 2644025685 | 2643221602 | Bacteria | 6249926 |
| 1269 | 2644169092 | 2643221629 | Bacteria | 5850260 |
| 1270 | 2644189063 | 2643221633 | Bacteria | 6733554 |
| 1271 | 2644265148 | 2643221647 | Bacteria | 10741251 |
| 1272 | 2644285985 | 2643221650 | Bacteria | 7029547 |
| 1273 | 2644350504 | 2643221662 | Bacteria | 5851492 |
| 1274 | 2644438017 | 2643221678 | Bacteria | 9540101 |
| 1275 | 2644625334 | 2643221713 | Bacteria | 6554480 |
| 1276 | 2650898178 | 2648501693 | Bacteria | 5069560 |
| 1277 | 2652543963 | 2651869719 | Bacteria | 6047974 |
| 1278 | 2656279538 | 2654587920 | Bacteria | 5475511 |
| 1279 | 2671093914 | 2667528170 | Bacteria | 6786960 |
| 1280 | 2671100785 | 2667528171 | Bacteria | 6900659 |
| 1281 | 2671129995 | 2667528176 | Bacteria | 6724917 |
| 1282 | 2671773351 | 2671180172 | Bacteria | 6495783 |
| 1283 | 2676406076 | 2675903046 | Bacteria | 5451247 |
| 1284 | 2676746243 | 2675903129 | Bacteria | 7964495 |
| 1285 | 2677895821 | 2675903420 | Bacteria | 6247433 |
| 1286 | 2678265600 | 2675903515 | Bacteria | 6580491 |
| 1287 | 2686355178 | 2684622997 | Bacteria | 4624240 |
| 1288 | 2689445113 | 2687453601 | Bacteria | 5546041 |
| 1289 | 2713477031 | 2711768613 | Bacteria | 11048459 |
| 1290 | 2715752319 | 2713897148 | Bacteria | 5883533 |
| 1291 | 2715759059 | 2713897149 | Bacteria | 6506249 |
| 1292 | 2718636097 | 2718217725 | Bacteria | 5758958 |
| 1293 | 2723250848 | 2721755607 | Bacteria | 5841722 |
| 1294 | 2738672917 | 2738541265 | Bacteria | 6594665 |
| 1295 | 2738751310 | 2738541282 | Bacteria | 6593925 |
| 1296 | 2738810266 | 2738541294 | Bacteria | 6925949 |
| 1297 | 2738860351 | 2738541303 | Bacteria | 6591772 |
| 1298 | 2738897626 | 2738541309 | Bacteria | 6926455 |
| 1299 | 2739198177 | 2738543004 | Bacteria | 6381073 |
| 1300 | 2739260941 | 2738543015 | Bacteria | 6750701 |
| 1301 | 2739289590 | 2738543020 | Bacteria | 5718238 |
| 1302 | 2739294902 | 2738543021 | Bacteria | 5718241 |
| 1303 | 2739316579 | 2738543025 | Bacteria | 6600348 |
| 1304 | 2743739921 | 2740892503 | Bacteria | 6855563 |
| 1305 | 2745006837 | 2744054620 | Bacteria | 6551379 |
| 1306 | 2765584553 | 2765235841 | Bacteria | 6137024 |
| 1307 | 2774121797 | 2773857670 | Bacteria | 6407454 |
| 1308 | 2774131454 | 2773857672 | Bacteria | 4993178 |
| 1309 | 2774137038 | 2773857673 | Bacteria | 6513460 |
| 1310 | 2777022168 | 2775507074 | Bacteria | 5532402 |
| 1311 | 2784262338 | 2784132063 | Bacteria | 6262788 |
| 1312 | 2784314460 | 2784132072 | Bacteria | 6596533 |
| 1313 | 2786667215 | 2786546132 | Bacteria | 10419719 |
| 1314 | 2792836299 | 2791355137 | Bacteria | 9654227 |
| 1315 | 2794598452 | 2791355520 | Bacteria | 5948615 |
| 1316 | 2807408852 | 2806310737 | Bacteria | 5751088 |
| 1317 | 2807457183 | 2806310745 | Bacteria | 5742165 |
| 1318 | 2808858176 | 2808606361 | Bacteria | 6136259 |
| 1319 | 2808926754 | 2808606376 | Bacteria | 6248667 |
| 1320 | 2808930855 | 2808606377 | Bacteria | 6646337 |
| 1321 | 2808938347 | 2808606378 | Bacteria | 6177535 |
| 1322 | 2808948913 | 2808606380 | Bacteria | 6248705 |
| 1323 | 2808952977 | 2808606381 | Bacteria | 6646461 |
| 1324 | 2808959301 | 2808606382 | Bacteria | 6841132 |
| 1325 | 2808966661 | 2808606383 | Bacteria | 6138645 |
| 1326 | 2808974601 | 2808606384 | Bacteria | 8474373 |
| 1327 | 2808977626 | 2808606385 | Bacteria | 6711065 |
| 1328 | 2808992716 | 2808606388 | Bacteria | 6706662 |
| 1329 | 2809001491 | 2808606389 | Bacteria | 6138126 |
| 1330 | 2809009431 | 2808606390 | Bacteria | 8476311 |
| 1331 | 2809016569 | 2808606391 | Bacteria | 8308166 |
| 1332 | 2809127467 | 2808606414 | Bacteria | 4917181 |
| 1333 | 2809219288 | 2808606445 | Bacteria | 6057339 |
| 1334 | 2812366502 | 2811994881 | Bacteria | 6298475 |
| 1335 | 2817257740 | 2816332253 | Bacteria | 6764532 |
| 1336 | 2817281862 | 2816332256 | Bacteria | 6891714 |
| 1337 | 2817451677 | 2816332286 | Bacteria | 6853759 |
| 1338 | 2817493535 | 2816332298 | Bacteria | 6852809 |
| 1339 | 2819637481 | 2818991452 | Bacteria | 8442785 |
| 1340 | 2819659176 | 2818991456 | Bacteria | 6123676 |
| 1341 | 2819706453 | 2818991464 | Bacteria | 6907494 |
| 1342 | 2823422116 | 2823421272 | Bacteria | 5372474 |
| 1343 | 2825655641 | 2825651385 | Bacteria | 6715909 |
| 1344 | 2826583915 | 2826581358 | Bacteria | 5963467 |
| 1345 | 2834033255 | 2834028612 | Bacteria | 6354979 |
| 1346 | 2840881643 | 2840878972 | Bacteria | 5483153 |
| 1347 | 2842338098 | 2842333319 | Bacteria | 8899485 |
| 1348 | 2842775940 | 2842775625 | Bacteria | 5587290 |
| 1349 | 2842809789 | 2842805378 | Bacteria | 5385175 |
| 1350 | 2842820239 | 2842815866 | Bacteria | 5947510 |
| 1351 | 2842829153 | 2842826826 | Bacteria | 5974129 |
| 1352 | 2842836983 | 2842832357 | Bacteria | 5959113 |
| 1353 | 2842840414 | 2842837860 | Bacteria | 6066181 |
| 1354 | 2842847720 | 2842843487 | Bacteria | 6004777 |
| 1355 | 2842850832 | 2842849001 | Bacteria | 5924277 |
| 1356 | 2842859672 | 2842854478 | Bacteria | 6143501 |
| 1357 | 2844666469 | 2844665904 | Bacteria | 6817974 |
| 1358 | 2847798095 | 2847797336 | Bacteria | 5176640 |
| 1359 | 2852618163 | 2852612431 | Bacteria | 6885235 |
| 1360 | 2852661011 | 2852657418 | Bacteria | 6472974 |
| 1361 | 2852673221 | 2852667396 | Bacteria | 6885555 |
| 1362 | 2856291754 | 2856287931 | Bacteria | 7223934 |
| 1363 | 2857363919 | 2857357740 | Bacteria | 9937880 |
| 1364 | 2858696409 | 2858688981 | Bacteria | 8184122 |
| 1365 | 2860343873 | 2860339153 | Bacteria | 6846989 |
| 1366 | 2860872529 | 2860867994 | Bacteria | 5645326 |
| 1367 | 2862512189 | 2862507626 | Bacteria | 9425308 |
| 1368 | 2862576644 | 2862574272 | Bacteria | 10567477 |
| 1369 | 2863423701 | 2863421361 | Bacteria | 7300805 |
| 1370 | 2869554533 | 2869551831 | Bacteria | 5474685 |
| 1371 | 2870073750 | 2870068957 | Bacteria | 8925310 |
| 1372 | 2871501980 | 2871495908 | Bacteria | 6935695 |
| 1373 | 2878034819 | 2878029506 | Bacteria | 6418441 |
| 1374 | 2878765783 | 2878760144 | Bacteria | 6823465 |
| 1375 | 2878772457 | 2878767105 | Bacteria | 6898628 |
| 1376 | 2880235464 | 2880230671 | Bacteria | 6140320 |
| 1377 | 2884089075 | 2884086401 | Bacteria | 5005459 |
| 1378 | 2885268304 | 2885266251 | Bacteria | 4796748 |
| 1379 | 2891673486 | 2891670763 | Bacteria | 4967099 |
| 1380 | 2895434520 | 2895427314 | Bacteria | 13147766 |
| 1381 | 2900582438 | 2900577576 | Bacteria | 5438534 |
| 1382 | 2903546729 | 2903540706 | Bacteria | 7062119 |
| 1383 | 2904514305 | 2904513164 | Bacteria | 5476410 |
| 1384 | 2904522968 | 2904518522 | Bacteria | 6068986 |
| 1385 | 2904555867 | 2904550169 | Bacteria | 6221258 |
| 1386 | 2904568274 | 2904564687 | Bacteria | 7609577 |
| 1387 | 2904575317 | 2904571731 | Bacteria | 7608790 |
| 1388 | 2904621922 | 2904615490 | Bacteria | 10047340 |
| 1389 | 2908452053 | 2908446538 | Bacteria | 6829095 |
| 1390 | 2912964460 | 2912963787 | Bacteria | 5646108 |
| 1391 | 2913042011 | 2913036834 | Bacteria | 6704877 |
| 1392 | 2917076183 | 2917070673 | Bacteria | 6868303 |
| 1393 | 2917836294 | 2917832318 | Bacteria | 5346010 |
| 1394 | 2919067801 | 2919063839 | Bacteria | 6302690 |
| 1395 | 2919108631 | 2919108558 | Bacteria | 5897419 |
| 1396 | 2919127582 | 2919125081 | Bacteria | 5385106 |
| 1397 | 2919157038 | 2919155634 | Bacteria | 4860545 |
| 1398 | 2919390691 | 2919385768 | Bacteria | 5897293 |
| 1399 | 2919461760 | 2919456309 | Bacteria | 6586567 |
| 1400 | 2919471029 | 2919468124 | Bacteria | 9133025 |
| 1401 | 2919485852 | 2919481497 | Bacteria | 6907839 |
| 1402 | 2919490967 | 2919487758 | Bacteria | 5929766 |
| 1403 | 2919506367 | 2919501602 | Bacteria | 5286340 |
| 1404 | 2919701473 | 2919697872 | Bacteria | 6553725 |
| 1405 | 2923159012 | 2923153595 | Bacteria | 6870622 |
| 1406 | 2923520532 | 2923519811 | Bacteria | 6298479 |
| 1407 | 2923590972 | 2923586266 | Bacteria | 6565975 |
| 1408 | 2926067437 | 2926063275 | Bacteria | 5285848 |
| 1409 | 2928059024 | 2928058823 | Bacteria | 5520022 |
| 1410 | 2928160644 | 2928157003 | Bacteria | 7522202 |
| 1411 | 2928169846 | 2928163908 | Bacteria | 7561269 |
| 1412 | 2928171514 | 2928170801 | Bacteria | 8785406 |
| 1413 | 2928536140 | 2928536128 | Bacteria | 7657547 |
| 1414 | 2929149392 | 2929144301 | Bacteria | 6622272 |
| 1415 | 2929194635 | 2929189879 | Bacteria | 5930554 |
| 1416 | 2931373193 | 2931369376 | Bacteria | 6847892 |
| 1417 | 2931395919 | 2931390751 | Bacteria | 6273349 |
| 1418 | 2931397544 | 2931396565 | Bacteria | 7251677 |
| 1419 | 2935359607 | 2935353572 | Unclassified | 6955622 |
| 1420 | 2938000588 | 2937994558 | Bacteria | 7036190 |
| 1421 | 2939641808 | 2939636861 | Bacteria | 6297853 |
| 1422 | 2939651969 | 2939651529 | Bacteria | 5895393 |
| 1423 | 2945931413 | 2945928738 | Bacteria | 6053221 |
| 1424 | 2945966271 | 2945961074 | Bacteria | 7342064 |
| 1425 | 2946007465 | 2946006987 | Bacteria | 6705746 |
| 1426 | 2946033130 | 2946027586 | Bacteria | 6049274 |
| 1427 | 2947233902 | 2947233263 | Bacteria | 6439278 |
| 1428 | 2954389601 | 2954380949 | Bacteria | 10050426 |
| 1429 | 2954682303 | 2954673503 | Bacteria | 9685905 |
| 1430 | 2954690621 | 2954682443 | Bacteria | 9862841 |
| 1431 | 2954700445 | 2954691527 | Bacteria | 10720516 |
| 1432 | 2954701783 | 2954701450 | Bacteria | 10834262 |
| 1433 | 2954729091 | 2954721474 | Bacteria | 10456478 |
| 1434 | 2958170959 | 2958165035 | Bacteria | 6906348 |
| 1435 | 2961169403 | 2961163497 | Bacteria | 6901077 |
| 1436 | 2965023655 | 2965018300 | Bacteria | 6883036 |
| 1437 | 2968177793 | 2968171901 | Bacteria | 6894245 |
| 1438 | 2969081787 | 2969079654 | Bacteria | 5439582 |
| 1439 | 2969309637 | 2969304461 | Bacteria | 6601805 |
| 1440 | 2970560639 | 2970554993 | Bacteria | 6814252 |
| 1441 | 2971823199 | 2971820967 | Bacteria | 5823634 |
| 1442 | 2974294631 | 2974289157 | Bacteria | 6080362 |
| 1443 | 2974301656 | 2974298342 | Bacteria | 4840922 |
| 1444 | 2981991713 | 2981990288 | Bacteria | 7590678 |
| 1445 | 2984287157 | 2984286254 | Bacteria | 6702062 |
| 1446 | 2984495086 | 2984494565 | Bacteria | 5000175 |
| 1447 | 2984500770 | 2984499530 | Bacteria | 5020881 |
| 1448 | 2984507305 | 2984504281 | Bacteria | 5262371 |
| 1449 | 2984564212 | 2984559226 | Bacteria | 5683096 |
| 1450 | 2984596947 | 2984595703 | Bacteria | 5682994 |
| 1451 | 2987665619 | 2987659509 | Bacteria | 6966464 |
| 1452 | 2988730936 | 2988728565 | Bacteria | 6124362 |
| 1453 | 2990263167 | 2990261002 | Bacteria | 4919493 |
| 1454 | 2998144887 | 2998139840 | Bacteria | 6073514 |
| 1455 | 3000379131 | 3000376612 | Bacteria | 4705565 |
| 1456 | 3003666042 | 3003665799 | Bacteria | 7279786 |
| 1457 | 3004194591 | 3004188549 | Bacteria | 6952365 |
| 1458 | 3007318310 | 3007315729 | Bacteria | 5076637 |
| 1459 | 3007398633 | 3007395558 | Bacteria | 6755444 |
| 1460 | 3007420364 | 3007419365 | Bacteria | 7026924 |
| 1461 | 3007516671 | 3007511990 | Bacteria | 6481491 |
| 1462 | 3007619160 | 3007614139 | Bacteria | 6053559 |
| 1463 | 3007621097 | 3007619802 | Bacteria | 6411688 |
| 1464 | 3007722277 | 3007718800 | Bacteria | 5971527 |
| 1465 | 3007808873 | 3007803356 | Bacteria | 5931491 |
| 1466 | 3007860091 | 3007855910 | Bacteria | 5637581 |
| 1467 | 3007866342 | 3007861166 | Bacteria | 6045338 |
| 1468 | 3007870956 | 3007866637 | Bacteria | 5899198 |
| 1469 | 3007874287 | 3007872151 | Bacteria | 5268868 |
| 1470 | 637322720 | 637000220 | Bacteria | 7074893 |
| 1471 | 640486156 | 640427133 | Bacteria | 4567418 |
| 1472 | 642592860 | 642555112 | Bacteria | 8676562 |
| 1473 | 651174130 | 651053060 | Bacteria | 4689946 |
| 1474 | 8004596635 | 8004592986 | Bacteria | 5122074 |
| 1475 | 8011354165 | 8011350971 | Bacteria | 6158957 |
| 1476 | 8015693089 | 8015687852 | Bacteria | 6613826 |
| 1477 | 8016730588 | 8016728285 | Bacteria | 5263933 |
| 1478 | 8018853593 | 8018845410 | Bacteria | 8933938 |
| 1479 | 8019781910 | 8019775933 | Bacteria | 6858656 |
| 1480 | 8020808084 | 8020807995 | Bacteria | 6801506 |
| 1481 | 8020940871 | 8020938398 | Bacteria | 7472757 |
| 1482 | 8020947932 | 8020945358 | Bacteria | 8467355 |
| 1483 | 8020956582 | 8020953355 | Bacteria | 7439080 |
| 1484 | 8021123665 | 8021120328 | Bacteria | 8782274 |
| 1485 | 8029996011 | 8029995093 | Bacteria | 5990776 |
| 1486 | 8034966927 | 8034962539 | Bacteria | 4884839 |
| 1487 | 8039103455 | 8039098773 | Bacteria | 6602928 |
| 1488 | 8040168451 | 8040167225 | Bacteria | 6542727 |
| 1489 | 8040178108 | 8040173305 | Bacteria | 6827067 |
| 1490 | 8052496739 | 8052494512 | Bacteria | 5765634 |
| 1491 | 8054289290 | 8054285046 | Bacteria | 6919322 |
| 1492 | 8054353029 | 8054347763 | Bacteria | 5901107 |
| 1493 | 8054508423 | 8054503363 | Bacteria | 6101651 |
| 1494 | 8054931264 | 8054929484 | Bacteria | 5599761 |
| 1495 | 8055776338 | 8055770955 | Bacteria | 6827675 |
| 1496 | 8055823377 | 8055817908 | Bacteria | 6609162 |
| 1497 | 8055882021 | 8055878733 | Bacteria | 5907058 |
| 1498 | 8056118661 | 8056115690 | Bacteria | 5527654 |
| 1499 | 8056122989 | 8056120720 | Bacteria | 5758328 |
| 1500 | 8056131098 | 8056125926 | Bacteria | 6228218 |
| 1501 | 8056136773 | 8056131705 | Bacteria | 6107031 |
| 1502 | 8056140407 | 8056137416 | Bacteria | 6147080 |
| 1503 | 8056148217 | 8056143049 | Bacteria | 6307666 |
| 1504 | 8056150250 | 8056148874 | Bacteria | 6479865 |
| 1505 | 8056156298 | 8056155041 | Bacteria | 6486948 |
| 1506 | 8056163091 | 8056161164 | Bacteria | 6106669 |
| 1507 | 8056171680 | 8056166840 | Bacteria | 5820959 |
| 1508 | 8056172363 | 8056172158 | Bacteria | 6133900 |
| 1509 | 8056179161 | 8056177738 | Bacteria | 6748268 |
| 1510 | 8056571917 | 8056569372 | Bacteria | 5997322 |
| 1511 | 8057163465 | 8057160832 | Bacteria | 3268302 |
| 1512 | 8057309455 | 8057304971 | Bacteria | 4649742 |
| 1513 | MRS2a_Contig_62 | |||
| 1514 | JGI24741J21665_1001052 | |||
| 1515 | JGI24740J21852_10000047 | |||
| 1516 | JGI24740J21852_10000084 | |||
| 1517 | JGI24739J22299_10000109 | |||
| 1518 | JGI24735J21928_10000736 | |||
| 1519 | JGI24735J21928_10001143 | |||
| 1520 | JGI25156J39149_1001527 | |||
| 1521 | JGI25156J39149_1007207 | |||
| 1522 | JGI25162J39368_1000136 | |||
| 1523 | JGI25162J39368_1000155 | |||
| 1524 | JGI25154J39366_1000668 | |||
| 1525 | JGI25163J39215_1001445 | |||
| 1526 | JGI25163J39215_1001478 | |||
| 1527 | JGI25164J39214_1000121 | |||
| 1528 | JGI25164J39214_1000258 | |||
| 1529 | JGI25406J46586_10003870 | |||
| 1530 | JGI25406J46586_10005301 | |||
| 1531 | JGI25406J46586_10011140 | |||
| 1532 | JGI25165J46597_1000037 | |||
| 1533 | JGI25165J46597_1000222 | |||
| 1534 | JGI25165J46597_1000240 | |||
| 1535 | JGI25160J50197_1000084 | |||
| 1536 | Ga0007417J51691_1020671 | |||
| 1537 | Ga0007416J51690_1015306 | |||
| 1538 | Ga0055538_1000065 | |||
| 1539 | Ga0055539_1000099 | |||
| 1540 | Ga0055539_1000203 | |||
| 1541 | Ga0055533_1000109 | |||
| 1542 | Ga0055533_1000963 | |||
| 1543 | Ga0055532_1000037 | |||
| 1544 | Ga0055532_1000094 | |||
| 1545 | Ga0055532_1001155 | |||
| 1546 | Ga0055532_1001302 | |||
| 1547 | Ga0055532_1001303 | |||
| 1548 | Ga0055525_1000143 | |||
| 1549 | Ga0055525_1000453 | |||
| 1550 | Ga0055527_1000487 | |||
| 1551 | Ga0055527_1000666 | |||
| 1552 | Ga0055535_1000018 | |||
| 1553 | Ga0055535_1002068 | |||
| 1554 | Ga0055535_1002073 | |||
| 1555 | Ga0055542_1000492 | |||
| 1556 | Ga0055542_1001925 | |||
| 1557 | Ga0055529_1000041 | |||
| 1558 | Ga0055529_1000398 | |||
| 1559 | Ga0055536_1000059 | |||
| 1560 | Ga0055536_1000403 | |||
| 1561 | Ga0055530_10000036 | |||
| 1562 | Ga0055530_10000096 | |||
| 1563 | Ga0055530_10000898 | |||
| 1564 | Ga0055530_10010435 | |||
| 1565 | Ga0055540_1000072 | |||
| 1566 | Ga0055540_1000084 | |||
| 1567 | Ga0055540_1000650 | |||
| 1568 | Ga0055531_10000266 | |||
| 1569 | Ga0055541_1000066 | |||
| 1570 | Ga0055541_1000400 | |||
| 1571 | Ga0058692_1003634 | |||
| 1572 | Ga0065165_1000329 | |||
| 1573 | Ga0065714_10004633 | |||
| 1574 | Ga0065714_10065746 | |||
| 1575 | Ga0065714_10066371 | |||
| 1576 | Ga0065714_10073413 | |||
| 1577 | Ga0065704_10000968 | |||
| 1578 | Ga0065704_10002901 | |||
| 1579 | Ga0070658_10005515 | |||
| 1580 | Ga0070670_100001749 | |||
| 1581 | Ga0070670_100002250 | |||
| 1582 | Ga0068869_100039777 | |||
| 1583 | Ga0070660_100000323 | |||
| 1584 | Ga0070661_100000131 | |||
| 1585 | Ga0070661_100000208 | |||
| 1586 | Ga0070668_100006472 | |||
| 1587 | Ga0070669_100000089 | |||
| 1588 | Ga0070669_100003603 | |||
| 1589 | Ga0070669_100059879 | |||
| 1590 | Ga0070674_100086613 | |||
| 1591 | Ga0070673_100024041 | |||
| 1592 | Ga0070688_100054230 | |||
| 1593 | Ga0070659_100000767 | |||
| 1594 | Ga0070659_100011714 | |||
| 1595 | Ga0070659_100034409 | |||
| 1596 | Ga0070667_100019878 | |||
| 1597 | Ga0070667_100069368 | |||
| 1598 | Ga0070713_100101859 | |||
| 1599 | Ga0070663_100000018 | |||
| 1600 | Ga0070663_100000054 | |||
| 1601 | Ga0070663_100005663 | |||
| 1602 | Ga0070662_100011108 | |||
| 1603 | Ga0070681_10030867 | |||
| 1604 | Ga0068867_100091068 | |||
| 1605 | Ga0070684_100019193 | |||
| 1606 | Ga0068853_100002936 | |||
| 1607 | Ga0068853_100009512 | |||
| 1608 | Ga0070665_100004426 | |||
| 1609 | Ga0070665_100025119 | |||
| 1610 | Ga0070665_100042556 | |||
| 1611 | Ga0070665_100073035 | |||
| 1612 | Ga0068855_100002550 | |||
| 1613 | Ga0068855_100058403 | |||
| 1614 | Ga0070664_100000040 | |||
| 1615 | Ga0070664_100000145 | |||
| 1616 | Ga0070664_100055941 | |||
| 1617 | Ga0068857_100049912 | |||
| 1618 | Ga0068854_100000034 | |||
| 1619 | Ga0068856_100000115 | |||
| 1620 | Ga0068856_100026846 | |||
| 1621 | Ga0068852_100028695 | |||
| 1622 | Ga0068859_100189613 | |||
| 1623 | Ga0068864_100032921 | |||
| 1624 | Ga0068851_10000002 | |||
| 1625 | Ga0081538_10002736 | |||
| 1626 | Ga0081538_10014327 | |||
| 1627 | Ga0081540_1007143 | |||
| 1628 | Ga0081539_10000195 | |||
| 1629 | Ga0081539_10000984 | |||
| 1630 | Ga0081539_10001258 | |||
| 1631 | Ga0075432_10000232 | |||
| 1632 | Ga0075432_10001524 | |||
| 1633 | Ga0075367_10019492 | |||
| 1634 | Ga0075428_100018426 | |||
| 1635 | Ga0075428_100054730 | |||
| 1636 | Ga0075430_100002673 | |||
| 1637 | Ga0075431_100002927 | |||
| 1638 | Ga0075433_10001156 | |||
| 1639 | Ga0075434_100001406 | |||
| 1640 | Ga0075429_100002737 | |||
| 1641 | Ga0075436_100001013 | |||
| 1642 | Ga0097620_100189594 | |||
| 1643 | Ga0099823_1000027 | |||
| 1644 | Ga0079104_1000116 | |||
| 1645 | Ga0079104_1000283 | |||
| 1646 | Ga0079104_1001497 | |||
| 1647 | Ga0099794_10028139 | |||
| 1648 | Ga0105251_10000050 | |||
| 1649 | Ga0105251_10000198 | |||
| 1650 | Ga0105251_10000214 | |||
| 1651 | Ga0105251_10000503 | |||
| 1652 | Ga0105251_10000587 | |||
| 1653 | Ga0105251_10000846 | |||
| 1654 | Ga0105251_10000972 | |||
| 1655 | Ga0105251_10001413 | |||
| 1656 | Ga0105251_10001672 | |||
| 1657 | Ga0105251_10015856 | |||
| 1658 | Ga0105244_10000037 | |||
| 1659 | Ga0105244_10000155 | |||
| 1660 | Ga0105244_10000312 | |||
| 1661 | Ga0105244_10000597 | |||
| 1662 | Ga0105244_10000983 | |||
| 1663 | Ga0105244_10001542 | |||
| 1664 | Ga0105244_10002341 | |||
| 1665 | Ga0105244_10002409 | |||
| 1666 | Ga0105244_10002423 | |||
| 1667 | Ga0105244_10003296 | |||
| 1668 | Ga0105244_10005647 | |||
| 1669 | Ga0105244_10006359 | |||
| 1670 | Ga0105244_10009740 | |||
| 1671 | Ga0105244_10017978 | |||
| 1672 | Ga0105244_10027743 | |||
| 1673 | Ga0105244_10046658 | |||
| 1674 | Ga0105250_10000130 | |||
| 1675 | Ga0105250_10000194 | |||
| 1676 | Ga0105250_10001047 | |||
| 1677 | Ga0105250_10001149 | |||
| 1678 | Ga0105250_10002250 | |||
| 1679 | Ga0105250_10006244 | |||
| 1680 | Ga0105240_10006023 | |||
| 1681 | Ga0105240_10031525 | |||
| 1682 | Ga0105240_10035859 | |||
| 1683 | Ga0105240_10040802 | |||
| 1684 | Ga0105240_10041129 | |||
| 1685 | Ga0105240_10129552 | |||
| 1686 | Ga0111539_10008028 | |||
| 1687 | Ga0105245_10012857 | |||
| 1688 | Ga0105245_10026163 | |||
| 1689 | Ga0105247_10000117 | |||
| 1690 | Ga0105243_10000115 | |||
| 1691 | Ga0105243_10001986 | |||
| 1692 | Ga0105243_10006536 | |||
| 1693 | Ga0105242_10008641 | |||
| 1694 | Ga0105248_10053252 | |||
| 1695 | Ga0105237_10002290 | |||
| 1696 | Ga0105237_10009645 | |||
| 1697 | Ga0105237_10018573 | |||
| 1698 | Ga0105238_10014016 | |||
| 1699 | Ga0105239_10004584 | |||
| 1700 | Ga0105239_10019132 | |||
| 1701 | Ga0105246_10000023 | |||
| 1702 | Ga0157373_10002554 | |||
| 1703 | Ga0157373_10007818 | |||
| 1704 | Ga0157373_10033515 | |||
| 1705 | Ga0157373_10045414 | |||
| 1706 | Ga0157373_10063394 | |||
| 1707 | Ga0157371_10000104 | |||
| 1708 | Ga0157371_10000185 | |||
| 1709 | Ga0157371_10000282 | |||
| 1710 | Ga0157371_10000427 | |||
| 1711 | Ga0157371_10028344 | |||
| 1712 | Ga0157371_10059770 | |||
| 1713 | Ga0157370_10000348 | |||
| 1714 | Ga0157370_10000558 | |||
| 1715 | Ga0157370_10001357 | |||
| 1716 | Ga0157370_10004203 | |||
| 1717 | Ga0157370_10010485 | |||
| 1718 | Ga0157370_10031441 | |||
| 1719 | Ga0157370_10039514 | |||
| 1720 | Ga0157370_10061262 | |||
| 1721 | Ga0157369_10005144 | |||
| 1722 | Ga0157369_10007420 | |||
| 1723 | Ga0157369_10014391 | |||
| 1724 | Ga0157369_10024104 | |||
| 1725 | Ga0157369_10033288 | |||
| 1726 | Ga0157374_10000053 | |||
| 1727 | Ga0163162_10000327 | |||
| 1728 | Ga0163162_10001680 | |||
| 1729 | Ga0163162_10002655 | |||
| 1730 | Ga0163162_10003675 | |||
| 1731 | Ga0157372_10000637 | |||
| 1732 | Ga0157372_10000654 | |||
| 1733 | Ga0157372_10003030 | |||
| 1734 | Ga0157375_10004869 | |||
| 1735 | Ga0157375_10023452 | |||
| 1736 | Ga0157375_10025963 | |||
| 1737 | Ga0163163_10059422 | |||
| 1738 | Ga0182008_10000852 | |||
| 1739 | Ga0182008_10004259 | |||
| 1740 | Ga0182008_10006951 | |||
| 1741 | Ga0182008_10008539 | |||
| 1742 | Ga0182008_10008870 | |||
| 1743 | Ga0182008_10012146 | |||
| 1744 | Ga0182008_10024794 | |||
| 1745 | Ga0182006_1000501 | |||
| 1746 | Ga0182006_1000547 | |||
| 1747 | Ga0182006_1001042 | |||
| 1748 | Ga0182006_1003853 | |||
| 1749 | Ga0182006_1004486 | |||
| 1750 | Ga0182006_1014013 | |||
| 1751 | Ga0182007_10000290 | |||
| 1752 | Ga0182007_10006145 | |||
| 1753 | Ga0182005_1000454 | |||
| 1754 | Ga0182005_1000471 | |||
| 1755 | Ga0182005_1016780 | |||
| 1756 | Ga0183367_1001 | |||
| 1757 | Ga0183361_10024 | |||
| 1758 | Ga0163161_10000001 | |||
| 1759 | Ga0163161_10001478 | |||
| 1760 | Ga0163161_10006343 | |||
| 1761 | Ga0163161_10016238 | |||
| 1762 | Ga0163161_10024717 | |||
| 1763 | Ga0163161_10039432 | |||
| 1764 | Ga0163161_10052082 | |||
| 1765 | Ga0163161_10060970 | |||
| 1766 | Ga0154015_1222406 | |||
| 1767 | Ga0213875_10000207 | |||
| 1768 | Ga0213875_10000315 | |||
| 1769 | Ga0213875_10037826 | |||
| 1770 | Ga0209760_100102 | |||
| 1771 | Ga0209760_100190 | |||
| 1772 | Ga0209784_100101 | |||
| 1773 | Ga0209784_100246 | |||
| 1774 | Ga0209784_100301 | |||
| 1775 | Ga0209784_101596 | |||
| 1776 | Ga0209566_100123 | |||
| 1777 | Ga0209566_100329 | |||
| 1778 | Ga0209566_100341 | |||
| 1779 | Ga0209566_100403 | |||
| 1780 | Ga0209566_102957 | |||
| 1781 | Ga0209674_100131 | |||
| 1782 | Ga0209674_100145 | |||
| 1783 | Ga0209674_100238 | |||
| 1784 | Ga0209674_100814 | |||
| 1785 | Ga0209672_100012 | |||
| 1786 | Ga0209672_100057 | |||
| 1787 | Ga0209672_100260 | |||
| 1788 | Ga0209672_100429 | |||
| 1789 | Ga0209147_100005 | |||
| 1790 | Ga0209147_100007 | |||
| 1791 | Ga0209147_100047 | |||
| 1792 | Ga0209147_100151 | |||
| 1793 | Ga0209147_100241 | |||
| 1794 | Ga0209147_100747 | |||
| 1795 | Ga0209563_100128 | |||
| 1796 | Ga0209563_100170 | |||
| 1797 | Ga0209563_100197 | |||
| 1798 | Ga0207427_100056 | |||
| 1799 | Ga0207427_100063 | |||
| 1800 | Ga0209437_100065 | |||
| 1801 | Ga0209437_100133 | |||
| 1802 | Ga0209258_100007 | |||
| 1803 | Ga0209258_100014 | |||
| 1804 | Ga0209258_100065 | |||
| 1805 | Ga0209258_100241 | |||
| 1806 | Ga0209646_1000058 | |||
| 1807 | Ga0209646_1000314 | |||
| 1808 | Ga0209026_1002579 | |||
| 1809 | Ga0209677_100094 | |||
| 1810 | Ga0209677_100206 | |||
| 1811 | Ga0209148_1000043 | |||
| 1812 | Ga0209148_1001167 | |||
| 1813 | Ga0209148_1001250 | |||
| 1814 | Ga0209759_1002975 | |||
| 1815 | Ga0209233_1000085 | |||
| 1816 | Ga0209233_1000133 | |||
| 1817 | Ga0209455_1000011 | |||
| 1818 | Ga0209455_1000074 | |||
| 1819 | Ga0209455_1002086 | |||
| 1820 | Ga0209673_1000198 | |||
| 1821 | Ga0209675_1001502 | |||
| 1822 | Ga0209676_1000076 | |||
| 1823 | Ga0209676_1000264 | |||
| 1824 | Ga0209676_1000313 | |||
| 1825 | Ga0209676_1000825 | |||
| 1826 | Ga0209676_1003296 | |||
| 1827 | Ga0209676_1003301 | |||
| 1828 | Ga0209564_1010435 | |||
| 1829 | Ga0209050_1000063 | |||
| 1830 | Ga0209050_1000080 | |||
| 1831 | Ga0209050_1000106 | |||
| 1832 | Ga0209050_1001454 | |||
| 1833 | Ga0207426_1000128 | |||
| 1834 | Ga0207426_1007653 | |||
| 1835 | Ga0209051_1000045 | |||
| 1836 | Ga0209051_1000082 | |||
| 1837 | Ga0209051_1000139 | |||
| 1838 | Ga0209051_1009142 | |||
| 1839 | Ga0209257_1000539 | |||
| 1840 | Ga0207656_10000010 | |||
| 1841 | Ga0207696_1000001 | |||
| 1842 | Ga0207696_1000023 | |||
| 1843 | Ga0207696_1000047 | |||
| 1844 | Ga0207696_1000116 | |||
| 1845 | Ga0207696_1000126 | |||
| 1846 | Ga0207696_1000255 | |||
| 1847 | Ga0207696_1001069 | |||
| 1848 | Ga0207696_1002513 | |||
| 1849 | Ga0207696_1006398 | |||
| 1850 | Ga0207655_1000015 | |||
| 1851 | Ga0207655_1000027 | |||
| 1852 | Ga0207655_1000039 | |||
| 1853 | Ga0207655_1000117 | |||
| 1854 | Ga0207655_1000120 | |||
| 1855 | Ga0207655_1000378 | |||
| 1856 | Ga0207655_1000862 | |||
| 1857 | Ga0207655_1001095 | |||
| 1858 | Ga0207655_1004674 | |||
| 1859 | Ga0207655_1008994 | |||
| 1860 | Ga0207655_1010449 | |||
| 1861 | Ga0207655_1012990 | |||
| 1862 | Ga0207655_1012996 | |||
| 1863 | Ga0207655_1016086 | |||
| 1864 | Ga0207655_1020666 | |||
| 1865 | Ga0207655_1021364 | |||
| 1866 | Ga0207655_1030107 | |||
| 1867 | Ga0207655_1032009 | |||
| 1868 | Ga0207713_1000002 | |||
| 1869 | Ga0207713_1000003 | |||
| 1870 | Ga0207713_1000016 | |||
| 1871 | Ga0207713_1000049 | |||
| 1872 | Ga0207713_1000229 | |||
| 1873 | Ga0207713_1000233 | |||
| 1874 | Ga0207713_1000245 | |||
| 1875 | Ga0207713_1000335 | |||
| 1876 | Ga0207713_1002628 | |||
| 1877 | Ga0207713_1003264 | |||
| 1878 | Ga0207713_1004283 | |||
| 1879 | Ga0207713_1005351 | |||
| 1880 | Ga0207713_1009539 | |||
| 1881 | Ga0207713_1012366 | |||
| 1882 | Ga0207713_1017097 | |||
| 1883 | Ga0207682_10000400 | |||
| 1884 | Ga0207710_10000185 | |||
| 1885 | Ga0207647_10004131 | |||
| 1886 | Ga0207647_10007845 | |||
| 1887 | Ga0207699_10028304 | |||
| 1888 | Ga0207645_10053771 | |||
| 1889 | Ga0207705_10016715 | |||
| 1890 | Ga0207695_10003825 | |||
| 1891 | Ga0207695_10005348 | |||
| 1892 | Ga0207695_10011262 | |||
| 1893 | Ga0207695_10098771 | |||
| 1894 | Ga0207671_10000613 | |||
| 1895 | Ga0207671_10033514 | |||
| 1896 | Ga0207671_10070977 | |||
| 1897 | Ga0207662_10011739 | |||
| 1898 | Ga0207657_10000152 | |||
| 1899 | Ga0207657_10013134 | |||
| 1900 | Ga0207649_10000023 | |||
| 1901 | Ga0207649_10000315 | |||
| 1902 | Ga0207681_10000134 | |||
| 1903 | Ga0207694_10023900 | |||
| 1904 | Ga0207694_10076953 | |||
| 1905 | Ga0207650_10000231 | |||
| 1906 | Ga0207650_10001368 | |||
| 1907 | Ga0207690_10000038 | |||
| 1908 | Ga0207690_10007440 | |||
| 1909 | Ga0207706_10000056 | |||
| 1910 | Ga0207706_10008880 | |||
| 1911 | Ga0207709_10000030 | |||
| 1912 | Ga0207709_10000127 | |||
| 1913 | Ga0207709_10017068 | |||
| 1914 | Ga0207670_10034626 | |||
| 1915 | Ga0207711_10090384 | |||
| 1916 | Ga0207679_10000017 | |||
| 1917 | Ga0207679_10000041 | |||
| 1918 | Ga0207667_10001407 | |||
| 1919 | Ga0207667_10062639 | |||
| 1920 | Ga0207668_10062336 | |||
| 1921 | Ga0207640_10000252 | |||
| 1922 | Ga0207639_10000871 | |||
| 1923 | Ga0207678_10000027 | |||
| 1924 | Ga0207678_10000109 | |||
| 1925 | Ga0207702_10000059 | |||
| 1926 | Ga0207702_10037315 | |||
| 1927 | Ga0207648_10087023 | |||
| 1928 | Ga0207676_10020555 | |||
| 1929 | Ga0207674_10042715 | |||
| 1930 | Ga0207674_10042812 | |||
| 1931 | Ga0207683_10007005 | |||
| 1932 | Ga0207698_10036300 | |||
| 1933 | Ga0209281_1000070 | |||
| 1934 | Ga0209281_1000127 | |||
| 1935 | Ga0209281_1001234 | |||
| 1936 | Ga0209281_1005195 | |||
| 1937 | Ga0209389_1000118 | |||
| 1938 | Ga0209371_1000236 | |||
| 1939 | Ga0209371_1000368 | |||
| 1940 | Ga0209371_1000629 | |||
| 1941 | Ga0209371_1002412 | |||
| 1942 | Ga0209974_10012108 | |||
| 1943 | Ga0207428_10000808 | |||
| 1944 | Ga0207428_10003112 | |||
| 1945 | Ga0207428_10015193 | |||
| 1946 | Ga0207428_10026098 | |||
| 1947 | Ga0207428_10048502 | |||
| 1948 | Ga0207428_10062798 | |||
| 1949 | Ga0268266_10032610 | |||
| 1950 | Ga0307517_10001714 | |||
| 1951 | Ga0307517_10027262 | |||
| 1952 | Ga0307515_10011157 | |||
| 1953 | Ga0307515_10014250 | |||
| 1954 | Ga0307515_10056015 | |||
| 1955 | Ga0268256_1000220 | |||
| 1956 | Ga0268256_1000313 | |||
| 1957 | Ga0268256_1000723 | |||
| 1958 | Ga0268256_1002142 | |||
| 1959 | Ga0307511_10002619 | |||
| 1960 | Ga0307511_10026933 | |||
| 1961 | Ga0307512_10002928 | |||
| 1962 | Ga0307512_10009670 | |||
| 1963 | Ga0314311_1018153 | |||
| 1964 | Ga0316178_1041886 | |||
| 1965 | Ga0265332_10001867 | |||
| 1966 | Ga0265316_10073510 | |||
| 1967 | Ga0307513_10004264 | |||
| 1968 | Ga0307509_10022042 | |||
| 1969 | Ga0307408_100000013 | |||
| 1970 | Ga0307408_100008150 | |||
| 1971 | Ga0307408_100009474 | |||
| 1972 | Ga0307408_100041361 | |||
| 1973 | Ga0307508_10001385 | |||
| 1974 | Ga0307516_10000208 | |||
| 1975 | Ga0307516_10021811 | |||
| 1976 | Ga0307516_10128845 | |||
| 1977 | Ga0307405_10000226 | |||
| 1978 | Ga0307405_10006873 | |||
| 1979 | Ga0307518_10023816 | |||
| 1980 | Ga0307518_10039030 | |||
| 1981 | Ga0307410_10012564 | |||
| 1982 | Ga0307406_10015120 | |||
| 1983 | Ga0307412_10000963 | |||
| 1984 | Ga0307412_10004042 | |||
| 1985 | Ga0307412_10008009 | |||
| 1986 | Ga0307412_10058182 | |||
| 1987 | Ga0307412_10069045 | |||
| 1988 | Ga0307409_100020194 | |||
| 1989 | Ga0307409_100022951 | |||
| 1990 | Ga0307416_100030774 | |||
| 1991 | Ga0307414_10003912 | |||
| 1992 | Ga0307414_10090762 | |||
| 1993 | Ga0307411_10081424 | |||
| 1994 | Ga0307415_100000639 | |||
| 1995 | Ga0307507_10014438 | |||
| 1996 | Ga0307510_10010329 | |||
| 1997 | Ga0373951_0000081 | |||
| 1998 | Ga0373936_0000845 | |||
| 1999 | Ga0373953_0003820 | |||
| 2000 | Ga0373955_0000697 | |||
| 2001 | Ga0373924_0000297 | |||
| 2002 | Ga0373935_0000530 | |||
| 2003 | Ga0373927_0004554 | |||
| 2004 | Ga0373933_0002386 | |||
| 2005 | Ga0373947_0001048 | |||
| 2006 | Ga0373937_0000212 | |||
| 2007 | Ga0373925_0000002 | |||
| 2008 | Ga0395899_0000023 | |||
| 2009 | Ga0395900_0000019 | |||
| 2010 | Ga0395900_0011145 | |||
| 2011 | Ga0395898_0000016 | |||
| 2012 | Ga0395898_0029092 | |||
| 2013 | Ga0395905_0000139 | |||
| 2014 | Ga0436364_0796339 | |||
| 2015 | Ga0436364_1383349 | |||
| 2016 | Ga0436364_1481155 | |||
| 2017 | Ga0436364_1483536 | |||
| 2018 | Ga0395901_0000038 | |||
| 2019 | Ga0237819_00203 | |||
| 2020 | Ga0436365_0208634 | |||
| 2021 | Ga0436365_0505152 | |||
| 2022 | Ga0436365_0622916 | |||
| 2023 | Ga0436365_1168445 | |||
| 2024 | Ga0436365_1888304 | |||
| 2025 | Ga0436361_1051656 | |||
| 2026 | Ga0436361_1158602 | |||
| 2027 | Ga0436361_1163181 | |||
| 2028 | Ga0436363_0168519 | |||
| 2029 | Ga0436362_0823318 | |||
| 2030 | Ga0439436_0002355 | |||
| 2031 | Ga0439438_001110 | |||
| 2032 | Ga0439438_002344 | |||
| 2033 | Ga0439438_002767 | |||
| 2034 | Ga0439438_003268 | |||
| 2035 | Ga0439438_004274 | |||
| 2036 | Ga0439438_004325 | |||
| 2037 | Ga0439438_007582 | |||
| 2038 | Ga0439438_010915 | |||
| 2039 | Ga0439438_014171 | |||
| 2040 | Ga0439447_000104 | |||
| 2041 | Ga0439447_000895 | |||
| 2042 | Ga0439453_0000241 | |||
| 2043 | Ga0439466_0000970 | |||
| 2044 | Ga0439466_0009195 | |||
| 2045 | Ga0439466_0011495 | |||
| 2046 | Ga0439466_0020606 | |||
| 2047 | Ga0439448_0000969 | |||
| 2048 | Ga0439432_002681 | |||
| 2049 | Ga0439432_003740 | |||
| 2050 | Ga0439432_006543 | |||
| 2051 | Ga0439432_021032 | |||
| 2052 | Ga0439451_000619 | |||
| 2053 | Ga0439452_000009 | |||
| 2054 | Ga0439452_000085 | |||
| 2055 | Ga0439452_000136 | |||
| 2056 | Ga0439452_000149 | |||
| 2057 | Ga0439452_008205 | |||
| 2058 | Ga0439456_000013 | |||
| 2059 | Ga0439456_005766 | |||
| 2060 | Ga0439463_000698 | |||
| 2061 | Ga0450911_001434 | |||
| 2062 | Ga0450890_000250 | |||
| 2063 | Ga0450904_002253 | |||
| 2064 | Ga0450905_000018 | |||
| 2065 | Ga0450906_006644 | |||
| 2066 | Ga0450907_000025 | |||
| 2067 | Ga0450907_002473 | |||
| 2068 | Ga0450909_001728 | |||
| 2069 | Ga0439434_0004591 | |||
| 2070 | Ga0439460_0010550 | |||
| 2071 | Ga0466986_0004181 | |||
| 2072 | Ga0466969_0000375 | |||
| 2073 | Ga0466969_0002196 | |||
| 2074 | Ga0466969_0014453 | |||
| 2075 | Ga0466972_0003056 | |||
| 2076 | Ga0466973_0010320 | |||
| 2077 | Ga0466978_0016238 | |||
| 2078 | Ga0466982_0026631 | |||
| 2079 | Ga0466966_0000020 | |||
| 2080 | Ga0466966_0010767 | |||
| 2081 | Ga0466961_0000024 | |||
| 2082 | Ga0466961_0000043 | |||
| 2083 | Ga0466961_0000622 | |||
| 2084 | Ga0466961_0000999 | |||
| 2085 | Ga0466961_0008631 | |||
| 2086 | Ga0466961_0017210 | |||
| 2087 | Ga0466963_0004216 | |||
| 2088 | Ga0466963_0027977 | |||
| 2089 | Ga0466964_0003088 | |||
| 2090 | Ga0466964_0005300 | |||
| 2091 | Ga0466971_0006666 | |||
| 2092 | Ga0466970_0000611 | |||
| 2093 | Ga0466970_0002332 | |||
| 2094 | Ga0466970_0020134 | |||
| 2095 | Ga0466957_0038248 | |||
| 2096 | Ga0466960_0045580 | |||
| 2097 | Ga0466959_0002813 | |||
| 2098 | Ga0466959_0039214 | |||
| 2099 | Ga0466958_0001628 | |||
| 2100 | Ga0466967_0015670 | |||
| 2101 | Ga0466967_0070991 | |||
| 2102 | Ga0495617_000168 | |||
| 2103 | Ga0495627_000020 | |||
| 2104 | Ga0495627_000060 | |||
| 2105 | Ga0495627_000154 | |||
| 2106 | Ga0495627_000221 | |||
| 2107 | Ga0495627_001421 | |||
| 2108 | Ga0495627_004126 | |||
| 2109 | Ga0495592_0000265 | |||
| 2110 | Ga0495592_0006424 | |||
| 2111 | Ga0495603_0001706 | |||
| 2112 | Ga0495603_0003656 | |||
| 2113 | Ga0495603_0005348 | |||
| 2114 | Ga0495603_0005980 | |||
| 2115 | Ga0495603_0011355 | |||
| 2116 | Ga0495590_0000447 | |||
| 2117 | Ga0495590_0001119 | |||
| 2118 | Ga0495590_0009784 | |||
| 2119 | Ga0495590_0018094 | |||
| 2120 | Ga0495590_0018589 | |||
| 2121 | Ga0495591_000058 | |||
| 2122 | Ga0495591_000074 | |||
| 2123 | Ga0495591_000165 | |||
| 2124 | Ga0495591_000419 | |||
| 2125 | Ga0495591_006472 | |||
| 2126 | Ga0495591_007109 | |||
| 2127 | Ga0495591_008093 | |||
| 2128 | Ga0495591_011332 | |||
| 2129 | Ga0495591_012070 | |||
| 2130 | Ga0495629_0000238 | |||
| 2131 | Ga0495629_0013407 | |||
| 2132 | Ga0495629_0016863 | |||
| 2133 | Ga0495638_0000428 | |||
| 2134 | Ga0495638_0001172 | |||
| 2135 | Ga0495638_0005050 | |||
| 2136 | Ga0495638_0006257 | |||
| 2137 | Ga0495638_0015145 | |||
| 2138 | Ga0495638_0015253 | |||
| 2139 | Ga0495638_0017295 | |||
| 2140 | Ga0495638_0038299 | |||
| 2141 | Ga0495651_0014887 | |||
| 2142 | Ga0495653_0000006 | |||
| 2143 | Ga0495653_0000332 | |||
| 2144 | Ga0495653_0005802 | |||
| 2145 | Ga0495653_0019424 | |||
| 2146 | Ga0495653_0056660 | |||
| 2147 | Ga0495650_0000765 | |||
| 2148 | Ga0495650_0000966 | |||
| 2149 | Ga0495650_0006120 | |||
| 2150 | Ga0495650_0006565 | |||
| 2151 | Ga0495580_0035115 | |||
| 2152 | Ga0495605_0000048 | |||
| 2153 | Ga0495605_0000091 | |||
| 2154 | Ga0495605_0000953 | |||
| 2155 | Ga0495605_0003434 | |||
| 2156 | Ga0495605_0005869 | |||
| 2157 | Ga0495605_0012168 | |||
| 2158 | Ga0495605_0026464 | |||
| 2159 | Ga0495605_0031113 | |||
| 2160 | Ga0495639_0000041 | |||
| 2161 | Ga0495662_0001839 | |||
| 2162 | Ga0495664_0000002 | |||
| 2163 | Ga0495664_0000843 | |||
| 2164 | Ga0495584_0003348 | |||
| 2165 | Ga0495584_0003833 | |||
| 2166 | Ga0495584_0004401 | |||
| 2167 | Ga0495584_0006209 | |||
| 2168 | Ga0495584_0015515 | |||
| 2169 | Ga0495585_0000937 | |||
| 2170 | Ga0495585_0003124 | |||
| 2171 | Ga0495585_0005080 | |||
| 2172 | Ga0495585_0008082 | |||
| 2173 | Ga0495585_0009962 | |||
| 2174 | Ga0495585_0014914 | |||
| 2175 | Ga0495594_0011179 | |||
| 2176 | Ga0495596_0000109 | |||
| 2177 | Ga0495607_0000139 | |||
| 2178 | Ga0495607_0000190 | |||
| 2179 | Ga0495607_0000330 | |||
| 2180 | Ga0495607_0000395 | |||
| 2181 | Ga0495607_0001876 | |||
| 2182 | Ga0495607_0002335 | |||
| 2183 | Ga0495607_0002507 | |||
| 2184 | Ga0495607_0007196 | |||
| 2185 | Ga0495607_0007963 | |||
| 2186 | Ga0495607_0021823 | |||
| 2187 | Ga0495607_0021851 | |||
| 2188 | Ga0495607_0034982 | |||
| 2189 | Ga0495607_0041655 | |||
| 2190 | Ga0495607_0049523 | |||
| 2191 | Ga0495583_0000187 | |||
| 2192 | Ga0495583_0000206 | |||
| 2193 | Ga0495583_0001258 | |||
| 2194 | Ga0495583_0002463 | |||
| 2195 | Ga0495583_0002998 | |||
| 2196 | Ga0495583_0012055 | |||
| 2197 | Ga0495583_0014705 | |||
| 2198 | Ga0495583_0033154 | |||
| 2199 | Ga0495606_0000177 | |||
| 2200 | Ga0495606_0000287 | |||
| 2201 | Ga0495606_0000324 | |||
| 2202 | Ga0495606_0001537 | |||
| 2203 | Ga0495606_0004243 | |||
| 2204 | Ga0495606_0004992 | |||
| 2205 | Ga0495606_0006124 | |||
| 2206 | Ga0495606_0019151 | |||
| 2207 | Ga0495606_0020543 | |||
| 2208 | Ga0495606_0021126 | |||
| 2209 | Ga0495606_0027210 | |||
| 2210 | Ga0495608_0000006 | |||
| 2211 | Ga0495610_0011194 | |||
| 2212 | Ga0495616_0005222 | |||
| 2213 | Ga0495616_0008607 | |||
| 2214 | Ga0495616_0012882 | |||
| 2215 | Ga0495616_0044536 | |||
| 2216 | Ga0495618_0000282 | |||
| 2217 | Ga0495620_0000012 | |||
| 2218 | Ga0495620_0000742 | |||
| 2219 | Ga0495620_0001923 | |||
| 2220 | Ga0495620_0003045 | |||
| 2221 | Ga0495620_0003619 | |||
| 2222 | Ga0495620_0004446 | |||
| 2223 | Ga0495620_0014976 | |||
| 2224 | Ga0495620_0023845 | |||
| 2225 | Ga0495628_0000002 | |||
| 2226 | Ga0495628_0022270 | |||
| 2227 | Ga0495628_0060872 | |||
| 2228 | Ga0495630_0005689 | |||
| 2229 | Ga0495631_0000423 | |||
| 2230 | Ga0495631_0000472 | |||
| 2231 | Ga0495631_0002057 | |||
| 2232 | Ga0495631_0004989 | |||
| 2233 | Ga0495632_0000803 | |||
| 2234 | Ga0495632_0002609 | |||
| 2235 | Ga0495632_0003915 | |||
| 2236 | Ga0495632_0006163 | |||
| 2237 | Ga0495632_0014674 | |||
| 2238 | Ga0495632_0019983 | |||
| 2239 | Ga0495632_0038915 | |||
| 2240 | Ga0495637_0000016 | |||
| 2241 | Ga0495637_0000409 | |||
| 2242 | Ga0495637_0002003 | |||
| 2243 | Ga0495637_0002806 | |||
| 2244 | Ga0495637_0003940 | |||
| 2245 | Ga0495637_0004776 | |||
| 2246 | Ga0495637_0006218 | |||
| 2247 | Ga0495637_0007095 | |||
| 2248 | Ga0495637_0013562 | |||
| 2249 | Ga0495643_0000593 | |||
| 2250 | Ga0495643_0001236 | |||
| 2251 | Ga0495643_0006380 | |||
| 2252 | Ga0495643_0016201 | |||
| 2253 | Ga0495643_0019417 | |||
| 2254 | Ga0495643_0020324 | |||
| 2255 | Ga0495643_0039549 | |||
| 2256 | Ga0495644_0006100 | |||
| 2257 | Ga0495644_0011746 | |||
| 2258 | Ga0495648_0002180 | |||
| 2259 | Ga0495648_0003559 | |||
| 2260 | Ga0495648_0008219 | |||
| 2261 | Ga0495648_0012385 | |||
| 2262 | Ga0495648_0015509 | |||
| 2263 | Ga0495648_0048448 | |||
| 2264 | Ga0495648_0057452 | |||
| 2265 | Ga0495666_0009349 | |||
| 2266 | Ga0495642_0003556 | |||
| 2267 | Ga0495642_0028116 | |||
| 2268 | Ga0495652_0000004 | |||
| 2269 | Ga0495652_0045709 | |||
| 2270 | Ga0495654_0000341 | |||
| 2271 | Ga0495654_0000771 | |||
| 2272 | Ga0495654_0001231 | |||
| 2273 | Ga0495654_0001742 | |||
| 2274 | Ga0495654_0001915 | |||
| 2275 | Ga0495654_0002274 | |||
| 2276 | Ga0495654_0007083 | |||
| 2277 | Ga0495654_0007255 | |||
| 2278 | Ga0495654_0031333 | |||
| 2279 | Ga0495654_0032387 | |||
| 2280 | Ga0495654_0062948 | |||
| 2281 | Ga0495640_0000007 | |||
| 2282 | Ga0495586_0027131 | |||
| 2283 | Ga0495587_0000031 | |||
| 2284 | Ga0495587_0001669 | |||
| 2285 | Ga0495587_0011584 | |||
| 2286 | Ga0495609_0000231 | |||
| 2287 | Ga0495609_0001798 | |||
| 2288 | Ga0495609_0002652 | |||
| 2289 | Ga0495609_0005747 | |||
| 2290 | Ga0495609_0005771 | |||
| 2291 | Ga0495597_0000175 | |||
| 2292 | Ga0495597_0000837 | |||
| 2293 | Ga0495597_0002042 | |||
| 2294 | Ga0495597_0003647 | |||
| 2295 | Ga0495597_0003687 | |||
| 2296 | Ga0495597_0009080 | |||
| 2297 | Ga0495597_0021139 | |||
| 2298 | Ga0495597_0029025 | |||
| 2299 | Ga0495645_0000003 | |||
| 2300 | Ga0495645_0001142 | |||
| 2301 | Ga0495622_0001392 | |||
| 2302 | Ga0495622_0003639 | |||
| 2303 | Ga0495622_0004703 | |||
| 2304 | Ga0495622_0008750 | |||
| 2305 | Ga0495633_0002225 | |||
| 2306 | Ga0495633_0007192 | |||
| 2307 | Ga0495633_0007220 | |||
| 2308 | Ga0495667_0000002 | |||
| 2309 | Ga0495668_0000469 | |||
| 2310 | Ga0495668_0008984 | |||
| 2311 | Ga0495668_0009110 | |||
| 2312 | Ga0495668_0015020 | |||
| 2313 | Ga0495634_0000110 | |||
| 2314 | Ga0495634_0007128 | |||
| 2315 | Ga0495634_0023082 | |||
| 2316 | Ga0495634_0054992 | |||
| 2317 | Ga0495611_0000122 | |||
| 2318 | Ga0495611_0000663 | |||
| 2319 | Ga0495611_0001621 | |||
| 2320 | Ga0495611_0002019 | |||
| 2321 | Ga0495611_0031117 | |||
| 2322 | Ga0495625_0000015 | |||
| 2323 | Ga0495625_0001457 | |||
| 2324 | Ga0495625_0002724 | |||
| 2325 | Ga0495625_0004443 | |||
| 2326 | Ga0495625_0018911 | |||
| 2327 | Ga0495625_0022007 | |||
| 2328 | Ga0495625_0030056 | |||
| 2329 | Ga0495625_0052325 | |||
| 2330 | Ga0495635_0000022 | |||
| 2331 | Ga0495635_0000520 | |||
| 2332 | Ga0495635_0015127 | |||
| 2333 | Ga0495659_0001226 | |||
| 2334 | Ga0495661_0000001 | |||
| 2335 | Ga0495661_0000075 | |||
| 2336 | Ga0495661_0000491 | |||
| 2337 | Ga0495661_0001678 | |||
| 2338 | Ga0495661_0002674 | |||
| 2339 | Ga0495661_0022703 | |||
| 2340 | Ga0495661_0024597 | |||
| 2341 | Ga0495657_0002481 | |||
| 2342 | Ga0495599_0000001 | |||
| 2343 | Ga0495623_0000898 | |||
| 2344 | Ga0495646_0000007 | |||
| 2345 | Ga0495646_0006657 | |||
| 2346 | Ga0495646_0008412 | |||
| 2347 | Ga0495613_0001531 | |||
| 2348 | Ga0495613_0014177 | |||
| 2349 | Ga0495613_0042616 | |||
| 2350 | Ga0495624_0006117 | |||
| 2351 | Ga0495670_0000195 | |||
| 2352 | Ga0495670_0003338 | |||
| 2353 | Ga0495670_0032037 | |||
| 2354 | Ga0495671_0000011 | |||
| 2355 | Ga0495671_0000348 | |||
| 2356 | Ga0495671_0001149 | |||
| 2357 | Ga0495671_0002810 | |||
| 2358 | Ga0495671_0006736 | |||
| 2359 | Ga0495671_0008036 | |||
| 2360 | Ga0495671_0009197 | |||
| 2361 | Ga0495671_0009230 | |||
| 2362 | Ga0495671_0019129 | |||
| 2363 | Ga0495671_0032706 | |||
| 2364 | Ga0495671_0051075 | |||
| 2365 | Ga0495649_0000272 | |||
| 2366 | Ga0495649_0002881 | |||
| 2367 | Ga0495649_0003495 | |||
| 2368 | Ga0495649_0012114 | |||
| 2369 | Ga0495649_0014303 | |||
| 2370 | Ga0495649_0024100 | |||
| 2371 | Ga0495649_0026241 | |||
| 2372 | Ga0495649_0027247 | |||
| 2373 | Ga0495649_0045078 | |||
| 2374 | Ga0495649_0060125 | |||
| 2375 | Ga0495589_0000576 | |||
| 2376 | Ga0495589_0001356 | |||
| 2377 | Ga0495589_0002374 | |||
| 2378 | Ga0495589_0006384 | |||
| 2379 | Ga0495589_0007131 | |||
| 2380 | Ga0495589_0012439 | |||
| 2381 | Ga0495660_0000829 | |||
| 2382 | Ga0495660_0001599 | |||
| 2383 | Ga0495660_0014955 | |||
| 2384 | Ga0495660_0018964 | |||
| 2385 | Ga0495660_0031227 | |||
| 2386 | Ga0495660_0048045 | |||
| 2387 | Ga0495660_0048956 | |||
| 2388 | Ga0495581_0001847 | |||
| 2389 | Ga0495581_0008885 | |||
| 2390 | Ga0495581_0012229 | |||
| 2391 | Ga0495604_0000005 | |||
| 2392 | Ga0495604_0006222 | |||
| 2393 | Ga0495604_0034073 | |||
| 2394 | Ga0495636_0001195 | |||
| 2395 | Ga0495674_0000003 | |||
| 2396 | Ga0495674_0017007 | |||
| 2397 | Ga0495672_0000059 | |||
| 2398 | Ga0495672_0002933 | |||
| 2399 | Ga0495672_0004094 | |||
| 2400 | Ga0495672_0004404 | |||
| 2401 | Ga0495672_0004737 | |||
| 2402 | Ga0495672_0005320 | |||
| 2403 | Ga0495672_0006304 | |||
| 2404 | Ga0495672_0006980 | |||
| 2405 | Ga0495672_0015319 | |||
| 2406 | Ga0495672_0033075 | |||
| 2407 | Ga0495672_0037276 | |||
| 2408 | Ga0495672_0039134 | |||
| 2409 | Ga0495672_0078362 | |||
| 2410 | Ga0495676_0000001 | |||
| 2411 | Ga0495676_0002451 | |||
| 2412 | Ga0495676_0003597 | |||
| 2413 | Ga0495676_0015876 | |||
| 2414 | Ga0495680_0000091 | |||
| 2415 | Ga0495680_0005855 | |||
| 2416 | Ga0495683_0000043 | |||
| 2417 | Ga0495683_0001732 | |||
| 2418 | Ga0495683_0003532 | |||
| 2419 | Ga0495683_0003604 | |||
| 2420 | Ga0495683_0009926 | |||
| 2421 | Ga0495683_0010099 | |||
| 2422 | Ga0495683_0030225 | |||
| 2423 | Ga0495687_000015 | |||
| 2424 | Ga0495687_002768 | |||
| 2425 | Ga0495687_005668 | |||
| 2426 | Ga0495687_007146 | |||
| 2427 | Ga0495687_014931 | |||
| 2428 | Ga0495687_018435 | |||
| 2429 | Ga0495675_0000133 | |||
| 2430 | Ga0495679_000071 | |||
| 2431 | Ga0495679_000081 | |||
| 2432 | Ga0495679_002408 | |||
| 2433 | Ga0495679_002727 | |||
| 2434 | Ga0495679_021932 | |||
| 2435 | Ga0495685_007417 | |||
| 2436 | Ga0495673_0000013 | |||
| 2437 | Ga0495673_0000924 | |||
| 2438 | Ga0495673_0001422 | |||
| 2439 | Ga0495673_0001817 | |||
| 2440 | Ga0495673_0001954 | |||
| 2441 | Ga0495673_0004535 | |||
| 2442 | Ga0495673_0004601 | |||
| 2443 | Ga0495673_0006740 | |||
| 2444 | Ga0495681_0000483 | |||
| 2445 | Ga0495681_0001489 | |||
| 2446 | Ga0495681_0002540 | |||
| 2447 | Ga0495681_0004310 | |||
| 2448 | Ga0495681_0004383 | |||
| 2449 | Ga0495681_0006550 | |||
| 2450 | Ga0495681_0007466 | |||
| 2451 | Ga0495681_0008329 | |||
| 2452 | Ga0495681_0018160 | |||
| 2453 | Ga0495681_0021832 | |||
| 2454 | Ga0495681_0027722 | |||
| 2455 | Ga0495684_0000035 | |||
| 2456 | Ga0495686_0000042 | |||
| 2457 | Ga0495686_0010349 | |||
| 2458 | Ga0495686_0020449 | |||
| 2459 | Ga0495686_0021463 | |||
| 2460 | Ga0495686_0064621 | |||
| 2461 | Ga0495593_0000746 | |||
| 2462 | Ga0495593_0003672 | |||
| 2463 | Ga0495602_0000029 | |||
| 2464 | Ga0495602_0019220 | |||
| 2465 | Ga0495614_0002106 | |||
| 2466 | Ga0495626_0000008 | |||
| 2467 | Ga0495626_0000364 | |||
| 2468 | Ga0495626_0000705 | |||
| 2469 | Ga0495626_0000767 | |||
| 2470 | Ga0495626_0002131 | |||
| 2471 | Ga0495626_0004194 | |||
| 2472 | Ga0495626_0005203 | |||
| 2473 | Ga0495626_0005475 | |||
| 2474 | Ga0495626_0008184 | |||
| 2475 | Ga0495626_0046058 | |||
| 2476 | Ga0496100_0004321 | |||
| 2477 | Ga0496100_0005571 | |||
| 2478 | Ga0496100_0023145 | |||
| 2479 | Ga0496100_0027976 | |||
| 2480 | Ga0496101_0000269 | |||
| 2481 | Ga0496101_0008618 | |||
| 2482 | Ga0496101_0020118 | |||
| 2483 | Ga0496102_0000138 | |||
| 2484 | Ga0496103_0002580 | |||
| 2485 | Ga0496104_0029919 | |||
| 2486 | Ga0496105_0011836 | |||
| 2487 | Ga0496105_0028840 | |||
| 2488 | Ga0496106_0006861 | |||
| 2489 | Ga0496106_0018839 | |||
| 2490 | Ga0496106_0078080 | |||
| 2491 | Ga0496108_0006388 | |||
| 2492 | Ga0496109_0007921 | |||
| 2493 | Ga0496110_0019961 | |||
| 2494 | Ga0496111_0028924 | |||
| 2495 | Ga0496112_0001121 | |||
| 2496 | Ga0496112_0015288 | |||
| 2497 | Ga0496112_0026647 | |||
| 2498 | Ga0496113_0017878 | |||
| 2499 | Ga0496113_0033341 | |||
| 2500 | Ga0496114_0003352 | |||
| 2501 | Ga0496114_0018376 | |||
| 2502 | Ga0496115_0137830 | |||
| 2503 | Ga0496116_0000001 | |||
| 2504 | Ga0496116_0000065 | |||
| 2505 | Ga0496116_0000267 | |||
| 2506 | Ga0496116_0000605 | |||
| 2507 | Ga0496116_0003570 | |||
| 2508 | Ga0496116_0013688 | |||
| 2509 | Ga0496116_0038985 | |||
| 2510 | Ga0496116_0053700 | |||
| 2511 | Ga0496117_0000245 | |||
| 2512 | Ga0496117_0000345 | |||
| 2513 | Ga0496117_0000866 | |||
| 2514 | Ga0496117_0001344 | |||
| 2515 | Ga0496117_0002196 | |||
| 2516 | Ga0496117_0002910 | |||
| 2517 | Ga0496117_0002920 | |||
| 2518 | Ga0496117_0004635 | |||
| 2519 | Ga0496117_0005308 | |||
| 2520 | Ga0496117_0021683 | |||
| 2521 | Ga0496117_0030146 | |||
| 2522 | Ga0496117_0049549 | |||
| 2523 | Ga0496117_0063403 | |||
| 2524 | Ga0496118_0001300 | |||
| 2525 | Ga0496118_0004485 | |||
| 2526 | Ga0496118_0008231 | |||
| 2527 | Ga0496118_0008529 | |||
| 2528 | Ga0496118_0011583 | |||
| 2529 | Ga0496118_0023500 | |||
| 2530 | Ga0496118_0024914 | |||
| 2531 | Ga0496118_0034968 | |||
| 2532 | Ga0496118_0035394 | |||
| 2533 | Ga0496118_0039498 | |||
| 2534 | Ga0496118_0049144 | |||
| 2535 | Ga0496118_0056964 | |||
| 2536 | Ga0496119_0000011 | |||
| 2537 | Ga0496119_0001557 | |||
| 2538 | Ga0496119_0007379 | |||
| 2539 | Ga0496120_0000306 | |||
| 2540 | Ga0496120_0001332 | |||
| 2541 | Ga0496120_0029590 | |||
| 2542 | Ga0496121_0000366 | |||
| 2543 | Ga0496121_0000487 | |||
| 2544 | Ga0496121_0000670 | |||
| 2545 | Ga0496121_0010504 | |||
| 2546 | Ga0496121_0014728 | |||
| 2547 | Ga0496121_0027246 | |||
| 2548 | Ga0496121_0031160 | |||
| 2549 | Ga0496121_0087404 | |||
| 2550 | Ga0496122_0000221 | |||
| 2551 | Ga0496122_0000292 | |||
| 2552 | Ga0496122_0001617 | |||
| 2553 | Ga0496122_0009392 | |||
| 2554 | Ga0496122_0009594 | |||
| 2555 | Ga0496122_0011780 | |||
| 2556 | Ga0496122_0019468 | |||
| 2557 | Ga0496122_0068190 | |||
| 2558 | Ga0496123_0000037 | |||
| 2559 | Ga0496123_0000989 | |||
| 2560 | Ga0496123_0001885 | |||
| 2561 | Ga0496123_0003653 | |||
| 2562 | Ga0496123_0013312 | |||
| 2563 | Ga0496123_0017058 | |||
| 2564 | Ga0496123_0024630 | |||
| 2565 | Ga0496124_0000035 | |||
| 2566 | Ga0496124_0000580 | |||
| 2567 | Ga0496124_0001300 | |||
| 2568 | Ga0496124_0001404 | |||
| 2569 | Ga0496124_0002380 | |||
| 2570 | Ga0496124_0012335 | |||
| 2571 | Ga0496124_0013458 | |||
| 2572 | Ga0496124_0014681 | |||
| 2573 | Ga0496124_0022527 | |||
| 2574 | Ga0496124_0032175 | |||
| 2575 | Ga0496124_0054355 | |||
| 2576 | Ga0496124_0073995 | |||
| 2577 | Ga0496125_0000196 | |||
| 2578 | Ga0496125_0004719 | |||
| 2579 | Ga0496125_0005204 | |||
| 2580 | Ga0496125_0011827 | |||
| 2581 | Ga0496125_0020403 | |||
| 2582 | Ga0496125_0022209 | |||
| 2583 | Ga0496125_0022410 | |||
| 2584 | Ga0496125_0042488 | |||
| 2585 | Ga0496126_0000105 | |||
| 2586 | Ga0496126_0002998 | |||
| 2587 | Ga0496126_0005096 | |||
| 2588 | Ga0496126_0008363 | |||
| 2589 | Ga0496126_0033548 | |||
| 2590 | Ga0496126_0035937 | |||
| 2591 | Ga0496126_0088632 | |||
| 2592 | Ga0495678_001085 | |||
| 2593 | Ga0495678_002002 | |||
| 2594 | Ga0495678_003062 | |||
| 2595 | Ga0495678_003176 | |||
| 2596 | Ga0495678_004295 | |||
| 2597 | Ga0495678_004428 | |||
| 2598 | Ga0495678_005242 | |||
| 2599 | Ga0495678_024370 | |||
| 2600 | Ga0495678_033623 | |||
| 2601 | Ga0495682_0000113 | |||
| 2602 | Ga0495682_0000118 | |||
| 2603 | Ga0495682_0004503 | |||
| 2604 | Ga0501034_0000248 | |||
| 2605 | Ga0501039_0017022 | |||
| 2606 | Ga0501073_0006663 | |||
| 2607 | Ga0501083_0002432 | |||
| 2608 | nmdc:mga06z11_11725_c1 | |||
| 2609 | nmdc:mga05p37_2582_c1 | |||
| 2610 | nmdc:mga09592_747_c1 | |||
| 2611 | nmdc:mga0qj67_34105_c1 | |||
| 2612 | nmdc:mga06r32_811_c1 | |||
| 2613 | nmdc:mga08y16_34317_c1 | |||
| 2614 | nmdc:mga0n895_29461_c1 | |||
| 2615 | nmdc:mga08x19_16934_c1 | |||
| 2616 | nmdc:mga0a205_2891_c1 | |||
| 2617 | Ga0495601_0000008 | |||
| 2618 | Ga0495612_0000026 | |||
| 2619 | Ga0495612_0024122 | |||
| 2620 | Ga0495595_0000024 | |||
| 2621 | Ga0495619_0000002 | |||
| 2622 | Ga0500572_002276 | |||
| 2623 | Ga0500618_002165 | |||
| 2624 | Ga0500659_0001817 | |||
| 2625 | Ga0500559_0005743 | |||
| 2626 | Ga0500604_0005290 | |||
| 2627 | Ga0587090_000459 | |||
| 2628 | Ga0587072_000018 | |||
| 2629 | Ga0466962_0006789 | |||
| 2630 | Ga0466962_0008470 | |||
| 2631 | 2506578563 | |||
| 2632 | 2506583702 | |||
| 2633 | 2510284240 | |||
| 2634 | 2510293076 | |||
| 2635 | 2510312577 | |||
| 2636 | 2511252944 | |||
| 2637 | 2511267140 | |||
| 2638 | 2511271378 | |||
| 2639 | 2511278513 | |||
| 2640 | 2511292311 | |||
| 2641 | 2511295260 | |||
| 2642 | 2511302551 | |||
| 2643 | 2511316087 | |||
| 2644 | 2511323199 | |||
| 2645 | 2511328088 | |||
| 2646 | 2511335043 | |||
| 2647 | 2511338341 | |||
| 2648 | 2511344529 | |||
| 2649 | 2511350915 | |||
| 2650 | 2511359891 | |||
| 2651 | 2511362073 | |||
| 2652 | 2511370615 | |||
| 2653 | 2511374932 | |||
| 2654 | 2511411427 | |||
| 2655 | 2511827092 | |||
| 2656 | 2512324702 | |||
| 2657 | 2514054968 | |||
| 2658 | 2519460470 | |||
| 2659 | 2554812594 | |||
| 2660 | 2555248339 | |||
| 2661 | 2555257435 | |||
| 2662 | 2555672301 | |||
| 2663 | 2563062836 | |||
| 2664 | 2583794739 | |||
| 2665 | 2585292965 | |||
| 2666 | 2585305990 | |||
| 2667 | 2597031047 | |||
| 2668 | 2597860373 | |||
| 2669 | 2597866117 | |||
| 2670 | 2597871943 | |||
| 2671 | 2599326775 | |||
| 2672 | 2599358256 | |||
| 2673 | 2599364611 | |||
| 2674 | 2599370853 | |||
| 2675 | 2599376875 | |||
| 2676 | 2599383421 | |||
| 2677 | 2599389868 | |||
| 2678 | 2599396157 | |||
| 2679 | 2599401423 | |||
| 2680 | 2599407997 | |||
| 2681 | 2599408936 | |||
| 2682 | 2599448175 | |||
| 2683 | 2599453108 | |||
| 2684 | 2599465071 | |||
| 2685 | 2599471388 | |||
| 2686 | 2599486785 | |||
| 2687 | 2599494014 | |||
| 2688 | 2599505184 | |||
| 2689 | 2599509863 | |||
| 2690 | 2599515113 | |||
| 2691 | 2599520277 | |||
| 2692 | 2599616915 | |||
| 2693 | 2599736060 | |||
| 2694 | 2599747981 | |||
| 2695 | 2599772884 | |||
| 2696 | 2599807091 | |||
| 2697 | 2599881714 | |||
| 2698 | 2599888198 | |||
| 2699 | 2599894493 | |||
| 2700 | 2599901020 | |||
| 2701 | 2599928603 | |||
| 2702 | 2599934504 | |||
| 2703 | 2599945083 | |||
| 2704 | 2599949337 | |||
| 2705 | 2599955188 | |||
| 2706 | 2599962750 | |||
| 2707 | 2599969299 | |||
| 2708 | 2599980630 | |||
| 2709 | 2599983921 | |||
| 2710 | 2599990361 | |||
| 2711 | 2599997403 | |||
| 2712 | 2600001697 | |||
| 2713 | 2600008439 | |||
| 2714 | 2600014278 | |||
| 2715 | 2600020856 | |||
| 2716 | 2600026261 | |||
| 2717 | 2600031811 | |||
| 2718 | 2600038652 | |||
| 2719 | 2600044102 | |||
| 2720 | 2600048895 | |||
| 2721 | 2600056078 | |||
| 2722 | 2600062749 | |||
| 2723 | 2600067744 | |||
| 2724 | 2600073845 | |||
| 2725 | 2600079531 | |||
| 2726 | 2600210769 | |||
| 2727 | 2600217804 | |||
| 2728 | 2600360337 | |||
| 2729 | 2600367113 | |||
| 2730 | 2600445252 | |||
| 2731 | 2601522547 | |||
| 2732 | 2601527574 | |||
| 2733 | 2601614405 | |||
| 2734 | 2601619125 | |||
| 2735 | 2601624441 | |||
| 2736 | 2601642255 | |||
| 2737 | 2601647117 | |||
| 2738 | 2601652552 | |||
| 2739 | 2601657878 | |||
| 2740 | 2601662078 | |||
| 2741 | 2601693953 | |||
| 2742 | 2601695036 | |||
| 2743 | 2601699708 | |||
| 2744 | 2601706397 | |||
| 2745 | 2601710703 | |||
| 2746 | 2601715717 | |||
| 2747 | 2601720059 | |||
| 2748 | 2601726123 | |||
| 2749 | 2601730664 | |||
| 2750 | 2601735680 | |||
| 2751 | 2601740948 | |||
| 2752 | 2601750878 | |||
| 2753 | 2601777971 | |||
| 2754 | 2601800469 | |||
| 2755 | 2602012363 | |||
| 2756 | 2602018132 | |||
| 2757 | 2603659440 | |||
| 2758 | 2603664715 | |||
| 2759 | 2603838056 | |||
| 2760 | 2603843134 | |||
| 2761 | 2603848207 | |||
| 2762 | 2603853282 | |||
| 2763 | 2603867226 | |||
| 2764 | 2603871333 | |||
| 2765 | 2603876264 | |||
| 2766 | 2606048526 | |||
| 2767 | 2606069142 | |||
| 2768 | 2606078723 | |||
| 2769 | 2606125617 | |||
| 2770 | 2606144964 | |||
| 2771 | 2606175927 | |||
| 2772 | 2608384907 | |||
| 2773 | 2621297358 | |||
| 2774 | 2624482884 | |||
| 2775 | 2624494426 | |||
| 2776 | 2637224807 | |||
| 2777 | 2643844805 | |||
| 2778 | 2643869707 | |||
| 2779 | 2643957571 | |||
| 2780 | 2644025685 | |||
| 2781 | 2644169092 | |||
| 2782 | 2644189063 | |||
| 2783 | 2644265148 | |||
| 2784 | 2644285985 | |||
| 2785 | 2644350504 | |||
| 2786 | 2644438017 | |||
| 2787 | 2644625334 | |||
| 2788 | 2650898178 | |||
| 2789 | 2652543963 | |||
| 2790 | 2656279538 | |||
| 2791 | 2671093914 | |||
| 2792 | 2671100785 | |||
| 2793 | 2671129995 | |||
| 2794 | 2671773351 | |||
| 2795 | 2676406076 | |||
| 2796 | 2676746243 | |||
| 2797 | 2677895821 | |||
| 2798 | 2678265600 | |||
| 2799 | 2686355178 | |||
| 2800 | 2689445113 | |||
| 2801 | 2713477031 | |||
| 2802 | 2715752319 | |||
| 2803 | 2715759059 | |||
| 2804 | 2718636097 | |||
| 2805 | 2723250848 | |||
| 2806 | 2738672917 | |||
| 2807 | 2738751310 | |||
| 2808 | 2738810266 | |||
| 2809 | 2738860351 | |||
| 2810 | 2738897626 | |||
| 2811 | 2739198177 | |||
| 2812 | 2739260941 | |||
| 2813 | 2739289590 | |||
| 2814 | 2739294902 | |||
| 2815 | 2739316579 | |||
| 2816 | 2743739921 | |||
| 2817 | 2745006837 | |||
| 2818 | 2765584553 | |||
| 2819 | 2774121797 | |||
| 2820 | 2774131454 | |||
| 2821 | 2774137038 | |||
| 2822 | 2777022168 | |||
| 2823 | 2784262338 | |||
| 2824 | 2784314460 | |||
| 2825 | 2786667215 | |||
| 2826 | 2792836299 | |||
| 2827 | 2794598452 | |||
| 2828 | 2807408852 | |||
| 2829 | 2807457183 | |||
| 2830 | 2808858176 | |||
| 2831 | 2808926754 | |||
| 2832 | 2808930855 | |||
| 2833 | 2808938347 | |||
| 2834 | 2808948913 | |||
| 2835 | 2808952977 | |||
| 2836 | 2808959301 | |||
| 2837 | 2808966661 | |||
| 2838 | 2808974601 | |||
| 2839 | 2808977626 | |||
| 2840 | 2808992716 | |||
| 2841 | 2809001491 | |||
| 2842 | 2809009431 | |||
| 2843 | 2809016569 | |||
| 2844 | 2809127467 | |||
| 2845 | 2809219288 | |||
| 2846 | 2812366502 | |||
| 2847 | 2817257740 | |||
| 2848 | 2817281862 | |||
| 2849 | 2817451677 | |||
| 2850 | 2817493535 | |||
| 2851 | 2819637481 | |||
| 2852 | 2819659176 | |||
| 2853 | 2819706453 | |||
| 2854 | 2823422116 | |||
| 2855 | 2825655641 | |||
| 2856 | 2826583915 | |||
| 2857 | 2834033255 | |||
| 2858 | 2840881643 | |||
| 2859 | 2842338098 | |||
| 2860 | 2842775940 | |||
| 2861 | 2842809789 | |||
| 2862 | 2842820239 | |||
| 2863 | 2842829153 | |||
| 2864 | 2842836983 | |||
| 2865 | 2842840414 | |||
| 2866 | 2842847720 | |||
| 2867 | 2842850832 | |||
| 2868 | 2842859672 | |||
| 2869 | 2844666469 | |||
| 2870 | 2847798095 | |||
| 2871 | 2852618163 | |||
| 2872 | 2852661011 | |||
| 2873 | 2852673221 | |||
| 2874 | 2856291754 | |||
| 2875 | 2857363919 | |||
| 2876 | 2858696409 | |||
| 2877 | 2860343873 | |||
| 2878 | 2860872529 | |||
| 2879 | 2862512189 | |||
| 2880 | 2862576644 | |||
| 2881 | 2863423701 | |||
| 2882 | 2869554533 | |||
| 2883 | 2870073750 | |||
| 2884 | 2871501980 | |||
| 2885 | 2878034819 | |||
| 2886 | 2878765783 | |||
| 2887 | 2878772457 | |||
| 2888 | 2880235464 | |||
| 2889 | 2884089075 | |||
| 2890 | 2885268304 | |||
| 2891 | 2891673486 | |||
| 2892 | 2895434520 | |||
| 2893 | 2900582438 | |||
| 2894 | 2903546729 | |||
| 2895 | 2904514305 | |||
| 2896 | 2904522968 | |||
| 2897 | 2904555867 | |||
| 2898 | 2904568274 | |||
| 2899 | 2904575317 | |||
| 2900 | 2904621922 | |||
| 2901 | 2908452053 | |||
| 2902 | 2912964460 | |||
| 2903 | 2913042011 | |||
| 2904 | 2917076183 | |||
| 2905 | 2917836294 | |||
| 2906 | 2919067801 | |||
| 2907 | 2919108631 | |||
| 2908 | 2919127582 | |||
| 2909 | 2919157038 | |||
| 2910 | 2919390691 | |||
| 2911 | 2919461760 | |||
| 2912 | 2919471029 | |||
| 2913 | 2919485852 | |||
| 2914 | 2919490967 | |||
| 2915 | 2919506367 | |||
| 2916 | 2919701473 | |||
| 2917 | 2923159012 | |||
| 2918 | 2923520532 | |||
| 2919 | 2923590972 | |||
| 2920 | 2926067437 | |||
| 2921 | 2928059024 | |||
| 2922 | 2928160644 | |||
| 2923 | 2928169846 | |||
| 2924 | 2928171514 | |||
| 2925 | 2928536140 | |||
| 2926 | 2929149392 | |||
| 2927 | 2929194635 | |||
| 2928 | 2931373193 | |||
| 2929 | 2931395919 | |||
| 2930 | 2931397544 | |||
| 2931 | 2935359607 | |||
| 2932 | 2938000588 | |||
| 2933 | 2939641808 | |||
| 2934 | 2939651969 | |||
| 2935 | 2945931413 | |||
| 2936 | 2945966271 | |||
| 2937 | 2946007465 | |||
| 2938 | 2946033130 | |||
| 2939 | 2947233902 | |||
| 2940 | 2954389601 | |||
| 2941 | 2954682303 | |||
| 2942 | 2954690621 | |||
| 2943 | 2954700445 | |||
| 2944 | 2954701783 | |||
| 2945 | 2954729091 | |||
| 2946 | 2958170959 | |||
| 2947 | 2961169403 | |||
| 2948 | 2965023655 | |||
| 2949 | 2968177793 | |||
| 2950 | 2969081787 | |||
| 2951 | 2969309637 | |||
| 2952 | 2970560639 | |||
| 2953 | 2971823199 | |||
| 2954 | 2974294631 | |||
| 2955 | 2974301656 | |||
| 2956 | 2981991713 | |||
| 2957 | 2984287157 | |||
| 2958 | 2984495086 | |||
| 2959 | 2984500770 | |||
| 2960 | 2984507305 | |||
| 2961 | 2984564212 | |||
| 2962 | 2984596947 | |||
| 2963 | 2987665619 | |||
| 2964 | 2988730936 | |||
| 2965 | 2990263167 | |||
| 2966 | 2998144887 | |||
| 2967 | 3000379131 | |||
| 2968 | 3003666042 | |||
| 2969 | 3004194591 | |||
| 2970 | 3007318310 | |||
| 2971 | 3007398633 | |||
| 2972 | 3007420364 | |||
| 2973 | 3007516671 | |||
| 2974 | 3007619160 | |||
| 2975 | 3007621097 | |||
| 2976 | 3007722277 | |||
| 2977 | 3007808873 | |||
| 2978 | 3007860091 | |||
| 2979 | 3007866342 | |||
| 2980 | 3007870956 | |||
| 2981 | 3007874287 | |||
| 2982 | 637322720 | |||
| 2983 | 640486156 | |||
| 2984 | 642592860 | |||
| 2985 | 651174130 | |||
| 2986 | 8004596635 | |||
| 2987 | 8011354165 | |||
| 2988 | 8015693089 | |||
| 2989 | 8016730588 | |||
| 2990 | 8018853593 | |||
| 2991 | 8019781910 | |||
| 2992 | 8020808084 | |||
| 2993 | 8020940871 | |||
| 2994 | 8020947932 | |||
| 2995 | 8020956582 | |||
| 2996 | 8021123665 | |||
| 2997 | 8029996011 | |||
| 2998 | 8034966927 | |||
| 2999 | 8039103455 | |||
| 3000 | 8040168451 | |||
| 3001 | 8040178108 | |||
| 3002 | 8052496739 | |||
| 3003 | 8054289290 | |||
| 3004 | 8054353029 | |||
| 3005 | 8054508423 | |||
| 3006 | 8054931264 | |||
| 3007 | 8055776338 | |||
| 3008 | 8055823377 | |||
| 3009 | 8055882021 | |||
| 3010 | 8056118661 | |||
| 3011 | 8056122989 | |||
| 3012 | 8056131098 | |||
| 3013 | 8056136773 | |||
| 3014 | 8056140407 | |||
| 3015 | 8056148217 | |||
| 3016 | 8056150250 | |||
| 3017 | 8056156298 | |||
| 3018 | 8056163091 | |||
| 3019 | 8056171680 | |||
| 3020 | 8056172363 | |||
| 3021 | 8056179161 | |||
| 3022 | 8056571917 | |||
| 3023 | 8057163465 | |||
| 3024 | 8057309455 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hmq-assembly1.cif.gz_C | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.9432 | 57 | 673 |
| 5hmq-assembly3.cif.gz_D | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.9431 | 57 | 675 |
| 5hmq-assembly2.cif.gz_B | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.9415 | 57 | 675 |
| 5hmq-assembly3.cif.gz_E | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.9385 | 57 | 678 |
| 5hmq-assembly2.cif.gz_B | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.9373 | 57 | 675 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1cjxC02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9082 | 490 | 676 | 3.10.180.10 |
| af_A0A1D8PHL9_249_477_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.907 | 492 | 676 | 3.10.180.10 |
| 1i60A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9063 | 60 | 325 | 3.20.20.150 |
| 3zgjA02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8977 | 495 | 675 | 3.10.180.10 |
| 1i60A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8841 | 60 | 325 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F3FH49-F1-model_v4 | 4-hydroxyphenylpyruvate dioxygenase | 1.003 | 58 | 174 |
GO:0051213
|
| AF-F3CDB3-F1-model_v4 | 4-hydroxyphenylpyruvate dioxygenase | 1.002 | 58 | 298 |
GO:0051213
|
| AF-A0A7Y4J7N4-F1-model_v4 | deleted | 1.001 | 78 | 210 |
|
| AF-F3CDB3-F1-model_v4 | 4-hydroxyphenylpyruvate dioxygenase | 0.9975 | 58 | 298 |
GO:0051213
|
| AF-S6T923-F1-model_v4 | 4-hydroxyphenylpyruvate dioxygenase | 0.9942 | 375 | 671 |
GO:0003868
GO:0006572 GO:0046872 |