F494480

General Info

Members Datasets Scaffolds Average Seq Length
1512 670 2760 473

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2888337043|2888340291
Length 530
Sequence PETGTPTPLFLFSNRLLTRIKAVSPVFLSIASHQSLQIGESIMTTADFNIPVPKVTTAAPTKLRLGSLTALVIGSMVGSGVFSLPQNMAAGAGPLAILIGWAITAVGMLALVFVYQSLATRKPELDAGPYAYAKAGFGPFIGFTSAWGYWISAWVGNVSYAVIVFSALSYFFPSFGDGNTWQAVLGASILLWLIHVLVLAGIRQAAIVNLIVTVAKIAPIVLFVGVVAVAFKLQVWSLDFTGLGNASLGSITAQVKSTMLVTLWVFIGIEGASVFSGRAERRKDIAMATVLGFVTCLALYALVSLLSLGILSQPELAALKNPSMAGVLEAVVGPWGAILINVALVVSVVGAFLSWTLLAAEIPHVAAKDGTMPKFFGHESSRGVPSTSLLITNLLVQAFLVITLFAQSTYQALFYIASAAILVPYIFSGAYAAKLALTGESYASGEQRAGPLFAGLLATVYGLWLVYAAGPAYLFMCAILYAPGIIFYIWARRETDQRVFHTAEAALAGTLIAVAILAVYEMWTGAISPL

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
95 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
152 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
153 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
154 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
178 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
179 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
180 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
181 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
182 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
183 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
184 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
185 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
186 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
187 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
188 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
189 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
190 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
191 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
192 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
193 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
194 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
195 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
196 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
197 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
198 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
199 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
200 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
201 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
202 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
206 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
220 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
221 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
227 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
230 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
231 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
234 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
235 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
236 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
239 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
247 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
254 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
255 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
260 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
263 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
270 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
271 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
272 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
273 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
274 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
275 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
278 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
279 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
280 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
283 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
284 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
285 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
286 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
287 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
301 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
302 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
303 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
304 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
307 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
308 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
309 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
312 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
313 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
327 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
328 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
330 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
331 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
332 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
335 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
336 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
337 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
338 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
339 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
340 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
341 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
342 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
343 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
344 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
345 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
346 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
347 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
348 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
349 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
350 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
351 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
352 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
353 2511231004 Pseudomonas sp. GM102 Isolate Nodule
354 2511231006 Pseudomonas sp. GM17 Isolate Nodule
355 2511231008 Pseudomonas sp. GM21 Isolate Nodule
356 2511231010 Pseudomonas sp. GM25 Isolate Nodule
357 2511231011 Pseudomonas sp. GM30 Isolate Nodule
358 2511231012 Pseudomonas sp. GM33 Isolate Nodule
359 2511231014 Pseudomonas sp. GM48 Isolate Nodule
360 2511231015 Pseudomonas sp. GM49 Isolate Nodule
361 2511231016 Pseudomonas sp. GM50 Isolate Nodule
362 2511231017 Pseudomonas sp. GM55 Isolate Nodule
363 2511231018 Pseudomonas sp. GM60 Isolate Nodule
364 2511231019 Pseudomonas sp. GM67 Isolate Nodule
365 2511231020 Pseudomonas sp. GM74 Isolate Nodule
366 2511231021 Pseudomonas sp. GM78 Isolate Nodule
367 2511231022 Pseudomonas sp. GM79 Isolate Nodule
368 2511231023 Pseudomonas sp. GM80 Isolate Nodule
369 2511231024 Pseudomonas sp. GM84 Isolate Nodule
370 2511231031 Pseudomonas sp. GM16 Isolate Nodule
371 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
372 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
373 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
374 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
375 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
376 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
377 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
378 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
379 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
380 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
381 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
382 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
383 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
384 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
385 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
386 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
387 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
388 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
389 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
390 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
391 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
392 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
393 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
394 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
395 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
396 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
397 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
398 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
399 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
400 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
401 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
402 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
403 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
404 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
405 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
406 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
407 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
408 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
409 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
410 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
411 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
412 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
413 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
414 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
415 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
416 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
417 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
418 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
419 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
420 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
421 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
422 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
423 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
424 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
425 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
426 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
427 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
428 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
429 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
430 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
431 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
432 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
433 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
434 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
435 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
436 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
437 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
438 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
439 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
440 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
441 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
442 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
443 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
444 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
445 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
446 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
447 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
448 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
449 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
450 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
451 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
452 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
453 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
454 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
455 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
456 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
457 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
458 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
459 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
460 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
461 2643221718 Rhizobium sp. Root268 Isolate Unclassified
462 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
463 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
464 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
465 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
466 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
467 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
468 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
469 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
470 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
471 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
472 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
473 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
474 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
475 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
476 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
477 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
478 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
479 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
480 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
481 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
482 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
483 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
484 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
485 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
486 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
487 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
488 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
489 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
490 2773857673 Pseudomonas sp. 443 Isolate Unclassified
491 2784132063 Pseudomonas sp. 424 Isolate Unclassified
492 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
493 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
494 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
495 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
496 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
497 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
498 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
499 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
500 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
501 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
502 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
503 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
504 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
505 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
506 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
507 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
508 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
509 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
510 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
511 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
512 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
513 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
514 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
515 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
516 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
517 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
518 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
519 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
520 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
521 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
522 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
523 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
524 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
525 2854911287 Brucella lupini LUP21 Isolate Unclassified
526 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
527 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
528 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
529 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
530 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
531 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
532 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
533 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
534 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
535 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
536 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
537 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
538 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
539 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
540 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
541 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
542 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
543 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
544 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
545 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
546 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
547 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
548 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
549 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
550 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
551 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
552 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
553 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
554 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
555 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
556 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
557 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
558 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
559 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
560 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
561 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
562 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
563 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
564 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
565 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
566 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
567 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
568 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
569 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
570 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
571 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
572 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
573 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
574 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
575 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
576 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
577 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
578 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
579 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
580 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
581 2928163908 Burkholderia sp. 567 Isolate Unclassified
582 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
583 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
584 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
585 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
586 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
587 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
588 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
589 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
590 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
591 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
592 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
593 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
594 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
595 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
596 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
597 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
598 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
599 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
600 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
601 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
602 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
603 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
604 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
605 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
606 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
607 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
608 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
609 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
610 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
611 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
612 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
613 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
614 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
615 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
616 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
617 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
618 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
619 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
620 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
621 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
622 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
623 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
624 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
625 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
626 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
627 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
628 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
629 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
630 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
631 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
632 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
633 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
634 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
635 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
636 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
637 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
638 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
639 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
640 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
641 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
642 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
643 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
644 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
645 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
646 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
647 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
648 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
649 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
650 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
651 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
652 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
653 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
654 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
655 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
656 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
657 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
658 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
659 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
660 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
661 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
662 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
663 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
664 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
665 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
666 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
667 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
668 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
669 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
670 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 68.92
Metatranscriptomes 0
Isolates 31.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.47
Nodule 7.34
Rhizoplane 7.47
Rhizosphere 62.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001861 3300001979 Bacteria 9657
2 JGI24735J21928_10022245 3300002067 Bacteria 1932
3 JGI25155J39150_1000017 3300002704 Bacteria 159274
4 JGI25155J39150_1001097 3300002704 Bacteria 2694
5 JGI25156J39149_1000034 3300002705 Bacteria 114036
6 JGI25162J39368_1000073 3300002737 Bacteria 121835
7 JGI25162J39368_1000262 3300002737 Bacteria 50465
8 JGI25154J39366_1000034 3300002738 Bacteria 176764
9 JGI25154J39366_1005657 3300002738 Bacteria 1954
10 JGI25154J39366_1005760 3300002738 Bacteria 1919
11 JGI25157J39369_1000137 3300002741 Bacteria 61333
12 JGI25163J39215_1000380 3300002771 Bacteria 14288
13 JGI25164J39214_1000052 3300002772 Bacteria 121835
14 JGI25164J39214_1000239 3300002772 Bacteria 41919
15 JGI25165J46597_1000137 3300003214 Bacteria 121835
16 JGI25165J46597_1000351 3300003214 Bacteria 52020
17 JGI25165J46597_1000366 3300003214 Bacteria 50465
18 JGI25165J46597_1003810 3300003214 Bacteria 3530
19 rootH1_10103289 3300003316 Bacteria 5411
20 rootH2_10027258 3300003320 Bacteria 13268
21 rootL2_10008082 3300003322 Bacteria 60006
22 rootL2_10008608 3300003322 Bacteria 32925
23 rootH1_10107069 3300003323 Bacteria 7677
24 rootH1_10143638 3300003323 Bacteria 3965
25 Ga0055538_1000047 3300003751 Bacteria 135637
26 Ga0055539_1000067 3300003752 Bacteria 135637
27 Ga0055533_1000077 3300003756 Bacteria 135637
28 Ga0055532_1000093 3300003758 Bacteria 103005
29 Ga0055525_1000101 3300003759 Bacteria 135637
30 Ga0055525_1002127 3300003759 Bacteria 2290
31 Ga0055542_1003791 3300003762 Bacteria 3930
32 Ga0055536_1000048 3300003781 Bacteria 115094
33 Ga0055536_1000745 3300003781 Bacteria 21784
34 Ga0055536_1000776 3300003781 Bacteria 21283
35 Ga0055530_10000401 3300003791 Bacteria 38836
36 Ga0055530_10001462 3300003791 Bacteria 17200
37 Ga0055530_10008782 3300003791 Bacteria 3990
38 Ga0055540_1000564 3300003792 Bacteria 27281
39 Ga0055540_1011205 3300003792 Bacteria 2912
40 Ga0055531_10000825 3300003794 Bacteria 25638
41 Ga0055531_10009814 3300003794 Bacteria 4851
42 Ga0055541_1000048 3300003841 Bacteria 135637
43 Ga0065714_10002647 3300005288 Bacteria 26348
44 Ga0065714_10006480 3300005288 Bacteria 7273
45 Ga0065714_10007683 3300005288 Bacteria 4453
46 Ga0065714_10016281 3300005288 Bacteria 2873
47 Ga0065714_10075338 3300005288 Bacteria 2915
48 Ga0065714_10078317 3300005288 Bacteria 2603
49 Ga0065714_10084681 3300005288 Bacteria 2185
50 Ga0065714_10087836 3300005288 Bacteria 2010
51 Ga0065704_10000713 3300005289 Bacteria 18379
52 Ga0065704_10005784 3300005289 Bacteria 3890
53 Ga0065704_10110960 3300005289 Bacteria 1969
54 Ga0065712_10070331 3300005290 Bacteria 6105
55 Ga0070658_10004683 3300005327 Bacteria 11124
56 Ga0070690_100046770 3300005330 Bacteria 2752
57 Ga0070670_100000394 3300005331 Bacteria 36051
58 Ga0070670_100009769 3300005331 Bacteria 8193
59 Ga0070660_100000171 3300005339 Bacteria 42584
60 Ga0070661_100000106 3300005344 Bacteria 69221
61 Ga0070668_100076309 3300005347 Bacteria 2617
62 Ga0070669_100001587 3300005353 Bacteria 16435
63 Ga0070688_100032569 3300005365 Bacteria 3144
64 Ga0070659_100000028 3300005366 Bacteria 140665
65 Ga0070663_100001621 3300005455 Bacteria 12413
66 Ga0070662_100000532 3300005457 Bacteria 23041
67 Ga0070662_100094407 3300005457 Bacteria 2252
68 Ga0070706_100098055 3300005467 Bacteria 2723
69 Ga0070684_100066657 3300005535 Bacteria 3160
70 Ga0070697_100097542 3300005536 Bacteria 2439
71 Ga0068853_100014884 3300005539 Bacteria 6388
72 Ga0070665_100019171 3300005548 Bacteria 6864
73 Ga0070665_100045847 3300005548 Bacteria 4391
74 Ga0070665_100285732 3300005548 Bacteria 1652
75 Ga0068855_100010177 3300005563 Bacteria 11335
76 Ga0070664_100006695 3300005564 Bacteria 9290
77 Ga0070664_100039956 3300005564 Bacteria 3955
78 Ga0068854_100008963 3300005578 Bacteria 6445
79 Ga0068852_100015244 3300005616 Bacteria 5952
80 Ga0068851_10000036 3300005834 Bacteria 105179
81 Ga0068858_100012442 3300005842 Bacteria 8023
82 Ga0068862_100025868 3300005844 Bacteria 4930
83 Ga0075365_10015334 3300006038 Bacteria 4634
84 Ga0075365_10047671 3300006038 Bacteria 2817
85 Ga0075368_10028187 3300006042 Bacteria 2169
86 Ga0075363_100020181 3300006048 Bacteria 3340
87 Ga0075364_10004890 3300006051 Bacteria 7764
88 Ga0075364_10045657 3300006051 Bacteria 2851
89 Ga0075364_10055063 3300006051 Bacteria 2603
90 Ga0075432_10014775 3300006058 Bacteria 2659
91 Ga0075432_10015068 3300006058 Bacteria 2634
92 Ga0075432_10019567 3300006058 Bacteria 2314
93 Ga0075367_10006333 3300006178 Bacteria 5969
94 Ga0075367_10063209 3300006178 Bacteria 2212
95 Ga0075369_10003995 3300006186 Bacteria 5414
96 Ga0075370_10011113 3300006353 Bacteria 4721
97 Ga0075431_100046346 3300006847 Bacteria 4483
98 Ga0068865_100016055 3300006881 Bacteria 4784
99 Ga0099823_1012610 3300006944 Bacteria 8539
100 Ga0079104_1000244 3300006946 Bacteria 72608
101 Ga0079104_1000432 3300006946 Bacteria 47752
102 Ga0079104_1017120 3300006946 Bacteria 2093
103 Ga0105251_10002904 3300009011 Bacteria 12876
104 Ga0105251_10003926 3300009011 Bacteria 10556
105 Ga0105251_10008444 3300009011 Bacteria 6198
106 Ga0105251_10011323 3300009011 Bacteria 5103
107 Ga0105244_10004755 3300009036 Bacteria 9243
108 Ga0105244_10006270 3300009036 Bacteria 7742
109 Ga0105244_10016889 3300009036 Bacteria 4144
110 Ga0105244_10024105 3300009036 Bacteria 3325
111 Ga0105244_10049022 3300009036 Bacteria 2160
112 Ga0105250_10000459 3300009092 Bacteria 29275
113 Ga0105250_10003197 3300009092 Bacteria 7833
114 Ga0105250_10004391 3300009092 Bacteria 6499
115 Ga0105250_10005134 3300009092 Bacteria 5916
116 Ga0105250_10015148 3300009092 Bacteria 3158
117 Ga0105250_10029162 3300009092 Bacteria 2221
118 Ga0105240_10000255 3300009093 Bacteria 105565
119 Ga0105240_10000256 3300009093 Bacteria 105227
120 Ga0105240_10011407 3300009093 Bacteria 12377
121 Ga0105240_10011525 3300009093 Bacteria 12305
122 Ga0105240_10044459 3300009093 Bacteria 5643
123 Ga0105245_10087058 3300009098 Bacteria 2867
124 Ga0105247_10006364 3300009101 Bacteria 7313
125 Ga0114129_10085223 3300009147 Bacteria 4383
126 Ga0105243_10000808 3300009148 Bacteria 29810
127 Ga0105243_10000910 3300009148 Bacteria 27751
128 Ga0105243_10097046 3300009148 Bacteria 2439
129 Ga0105243_10123575 3300009148 Bacteria 2186
130 Ga0105241_10028129 3300009174 Bacteria 4187
131 Ga0105242_10000547 3300009176 Bacteria 29760
132 Ga0105248_10012821 3300009177 Bacteria 9246
133 Ga0105237_10006662 3300009545 Bacteria 12766
134 Ga0105237_10013057 3300009545 Bacteria 8722
135 Ga0105237_10029717 3300009545 Bacteria 5553
136 Ga0105237_10039300 3300009545 Bacteria 4777
137 Ga0105238_10017098 3300009551 Bacteria 7361
138 Ga0105238_10205138 3300009551 Bacteria 1947
139 Ga0105239_10000932 3300010375 Bacteria 41400
140 Ga0105239_10003360 3300010375 Bacteria 19656
141 Ga0105239_10014404 3300010375 Bacteria 8775
142 Ga0105239_10016000 3300010375 Bacteria 8302
143 Ga0105239_10043155 3300010375 Bacteria 4941
144 Ga0105239_10069581 3300010375 Bacteria 3867
145 Ga0105246_10002160 3300011119 Bacteria 11868
146 Ga0105246_10061350 3300011119 Bacteria 2616
147 Ga0157345_1000109 3300012498 Bacteria 15915
148 Ga0157373_10001399 3300013100 Bacteria 18484
149 Ga0157373_10002268 3300013100 Bacteria 14575
150 Ga0157373_10005118 3300013100 Bacteria 9855
151 Ga0157373_10015951 3300013100 Bacteria 5485
152 Ga0157373_10022663 3300013100 Bacteria 4555
153 Ga0157373_10045315 3300013100 Bacteria 3139
154 Ga0157373_10156982 3300013100 Bacteria 1600
155 Ga0157371_10001380 3300013102 Bacteria 25456
156 Ga0157371_10003050 3300013102 Bacteria 15547
157 Ga0157371_10020875 3300013102 Bacteria 4817
158 Ga0157371_10058276 3300013102 Bacteria 2740
159 Ga0157371_10089665 3300013102 Bacteria 2178
160 Ga0157370_10000070 3300013104 Bacteria 112014
161 Ga0157370_10007058 3300013104 Bacteria 12264
162 Ga0157370_10016668 3300013104 Bacteria 7436
163 Ga0157370_10064065 3300013104 Bacteria 3481
164 Ga0157370_10109795 3300013104 Bacteria 2578
165 Ga0157369_10013332 3300013105 Bacteria 9296
166 Ga0157369_10027737 3300013105 Bacteria 6273
167 Ga0157369_10028371 3300013105 Bacteria 6195
168 Ga0157369_10047573 3300013105 Bacteria 4656
169 Ga0157369_10051527 3300013105 Bacteria 4454
170 Ga0157369_10053069 3300013105 Bacteria 4382
171 Ga0157369_10056516 3300013105 Bacteria 4235
172 Ga0157378_10011013 3300013297 Bacteria 7915
173 Ga0163162_10003189 3300013306 Bacteria 15681
174 Ga0163162_10075602 3300013306 Bacteria 3429
175 Ga0163162_10114468 3300013306 Bacteria 2796
176 Ga0163162_10137467 3300013306 Bacteria 2555
177 Ga0163162_10302758 3300013306 Bacteria 1731
178 Ga0157372_10021418 3300013307 Bacteria 6984
179 Ga0157375_10006419 3300013308 Bacteria 10249
180 Ga0157375_10012360 3300013308 Bacteria 7570
181 Ga0157375_10016590 3300013308 Bacteria 6622
182 Ga0157375_10138927 3300013308 Bacteria 2555
183 Ga0182008_10000593 3300014497 Bacteria 26632
184 Ga0182008_10001437 3300014497 Bacteria 15932
185 Ga0182008_10001850 3300014497 Bacteria 13773
186 Ga0182008_10004969 3300014497 Bacteria 7655
187 Ga0182008_10010920 3300014497 Bacteria 4844
188 Ga0182008_10010972 3300014497 Bacteria 4831
189 Ga0182008_10017510 3300014497 Bacteria 3716
190 Ga0182008_10017710 3300014497 Bacteria 3693
191 Ga0182008_10020679 3300014497 Bacteria 3385
192 Ga0157379_10011341 3300014968 Bacteria 7771
193 Ga0157376_10003637 3300014969 Bacteria 10640
194 Ga0157376_10066194 3300014969 Bacteria 3054
195 Ga0182006_1003011 3300015261 Bacteria 8863
196 Ga0182006_1006211 3300015261 Bacteria 5577
197 Ga0182006_1008002 3300015261 Bacteria 4804
198 Ga0182006_1024370 3300015261 Bacteria 2495
199 Ga0182007_10006882 3300015262 Bacteria 4833
200 Ga0182007_10016001 3300015262 Bacteria 2779
201 Ga0163161_10016315 3300017792 Bacteria 5185
202 Ga0163161_10017758 3300017792 Bacteria 4985
203 Ga0163161_10018742 3300017792 Bacteria 4850
204 Ga0163161_10020038 3300017792 Bacteria 4692
205 Ga0163161_10050869 3300017792 Bacteria 3000
206 Ga0163161_10101208 3300017792 Bacteria 2145
207 Ga0163161_10143095 3300017792 Bacteria 1812
208 Ga0209435_100023 3300025206 Bacteria 201972
209 Ga0209435_100671 3300025206 Bacteria 6028
210 Ga0209760_100090 3300025207 Bacteria 72214
211 Ga0209760_100106 3300025207 Bacteria 63287
212 Ga0209784_100080 3300025224 Bacteria 135689
213 Ga0209566_100096 3300025225 Bacteria 135689
214 Ga0209674_100117 3300025226 Bacteria 135689
215 Ga0209147_100123 3300025229 Bacteria 135689
216 Ga0209563_100114 3300025230 Bacteria 135689
217 Ga0209563_100947 3300025230 Bacteria 8559
218 Ga0207427_100004 3300025231 Bacteria 939600
219 Ga0207427_100007 3300025231 Bacteria 746220
220 Ga0209437_100006 3300025233 Bacteria 1042724
221 Ga0209437_100028 3300025233 Bacteria 540136
222 Ga0209437_102874 3300025233 Bacteria 3231
223 Ga0209258_100174 3300025242 Bacteria 143702
224 Ga0209646_1000080 3300025246 Bacteria 201975
225 Ga0209646_1000422 3300025246 Bacteria 23757
226 Ga0209026_1000076 3300025250 Bacteria 201975
227 Ga0209677_100073 3300025253 Bacteria 135689
228 Ga0209677_100272 3300025253 Bacteria 34642
229 Ga0209148_1000921 3300025254 Bacteria 19607
230 Ga0209759_1000059 3300025256 Bacteria 201975
231 Ga0209759_1004309 3300025256 Bacteria 5352
232 Ga0209759_1007300 3300025256 Bacteria 3575
233 Ga0209233_1000008 3300025261 Bacteria 1356712
234 Ga0209233_1000086 3300025261 Bacteria 331687
235 Ga0209233_1000282 3300025261 Bacteria 70340
236 Ga0209233_1000310 3300025261 Bacteria 56582
237 Ga0209455_1000150 3300025272 Bacteria 130892
238 Ga0209676_1000006 3300025292 Bacteria 1039588
239 Ga0209676_1000010 3300025292 Bacteria 954025
240 Ga0209676_1001133 3300025292 Bacteria 29195
241 Ga0209676_1007590 3300025292 Bacteria 5043
242 Ga0209564_1025789 3300025295 Bacteria 1965
243 Ga0209758_1006795 3300025297 Bacteria 8026
244 Ga0209050_1000019 3300025298 Bacteria 608757
245 Ga0209050_1000070 3300025298 Bacteria 296366
246 Ga0209050_1001703 3300025298 Bacteria 21969
247 Ga0209050_1005922 3300025298 Bacteria 7452
248 Ga0209051_1000093 3300025303 Bacteria 169092
249 Ga0209051_1000146 3300025303 Bacteria 134294
250 Ga0209051_1011790 3300025303 Bacteria 4283
251 Ga0209257_1000040 3300025304 Bacteria 538759
252 Ga0209257_1000303 3300025304 Bacteria 107862
253 Ga0207656_10000021 3300025321 Bacteria 113329
254 Ga0207696_1000073 3300025711 Bacteria 215388
255 Ga0207696_1000246 3300025711 Bacteria 73989
256 Ga0207696_1001465 3300025711 Bacteria 12773
257 Ga0207696_1005199 3300025711 Bacteria 5446
258 Ga0207655_1000005 3300025728 Bacteria 917277
259 Ga0207655_1000015 3300025728 Bacteria 600662
260 Ga0207655_1000701 3300025728 Bacteria 38852
261 Ga0207655_1001021 3300025728 Bacteria 28295
262 Ga0207655_1002919 3300025728 Bacteria 13148
263 Ga0207655_1006300 3300025728 Bacteria 7889
264 Ga0207655_1010879 3300025728 Bacteria 5474
265 Ga0207655_1011785 3300025728 Bacteria 5168
266 Ga0207655_1011887 3300025728 Bacteria 5137
267 Ga0207655_1016207 3300025728 Bacteria 4090
268 Ga0207713_1000426 3300025735 Bacteria 44662
269 Ga0207713_1000543 3300025735 Bacteria 37728
270 Ga0207713_1000600 3300025735 Bacteria 35518
271 Ga0207713_1001527 3300025735 Bacteria 18229
272 Ga0207713_1005163 3300025735 Bacteria 8252
273 Ga0207713_1008166 3300025735 Bacteria 6059
274 Ga0207713_1015009 3300025735 Bacteria 3994
275 Ga0207713_1018361 3300025735 Bacteria 3466
276 Ga0207710_10005346 3300025900 Bacteria 5540
277 Ga0207647_10003622 3300025904 Bacteria 11566
278 Ga0207647_10004058 3300025904 Bacteria 10904
279 Ga0207654_10016121 3300025911 Bacteria 3887
280 Ga0207695_10000352 3300025913 Bacteria 105524
281 Ga0207695_10001755 3300025913 Bacteria 34425
282 Ga0207695_10054008 3300025913 Bacteria 4199
283 Ga0207671_10000534 3300025914 Bacteria 51293
284 Ga0207671_10000766 3300025914 Bacteria 40806
285 Ga0207671_10018516 3300025914 Bacteria 5340
286 Ga0207671_10063802 3300025914 Bacteria 2738
287 Ga0207657_10000111 3300025919 Bacteria 79991
288 Ga0207649_10000006 3300025920 Bacteria 349180
289 Ga0207681_10001988 3300025923 Bacteria 13129
290 Ga0207681_10003269 3300025923 Bacteria 10149
291 Ga0207650_10000188 3300025925 Bacteria 72046
292 Ga0207650_10000561 3300025925 Bacteria 30124
293 Ga0207687_10059204 3300025927 Bacteria 2697
294 Ga0207690_10000009 3300025932 Bacteria 366044
295 Ga0207706_10000205 3300025933 Bacteria 65450
296 Ga0207706_10008376 3300025933 Bacteria 9539
297 Ga0207706_10051537 3300025933 Bacteria 3634
298 Ga0207686_10003836 3300025934 Bacteria 8063
299 Ga0207709_10000013 3300025935 Bacteria 531977
300 Ga0207709_10000586 3300025935 Bacteria 30449
301 Ga0207709_10054723 3300025935 Bacteria 2461
302 Ga0207711_10101031 3300025941 Bacteria 2552
303 Ga0207661_10157182 3300025944 Bacteria 1970
304 Ga0207679_10000010 3300025945 Bacteria 349180
305 Ga0207667_10003058 3300025949 Bacteria 20744
306 Ga0207640_10018604 3300025981 Bacteria 4085
307 Ga0207658_10129106 3300025986 Bacteria 2028
308 Ga0207703_10014678 3300026035 Bacteria 6113
309 Ga0207639_10001976 3300026041 Bacteria 13792
310 Ga0207639_10023522 3300026041 Bacteria 4450
311 Ga0207639_10134362 3300026041 Bacteria 2052
312 Ga0207678_10000347 3300026067 Bacteria 41971
313 Ga0207698_10073392 3300026142 Bacteria 2725
314 Ga0209281_1000049 3300027111 Bacteria 322274
315 Ga0209281_1000202 3300027111 Bacteria 135240
316 Ga0209281_1003441 3300027111 Bacteria 5235
317 Ga0207428_10016226 3300027907 Bacteria 6414
318 Ga0207428_10136292 3300027907 Bacteria 1876
319 Ga0268266_10116692 3300028379 Bacteria 2371
320 Ga0268265_10116215 3300028380 Bacteria 2195
321 Ga0265326_10007166 3300028558 Bacteria 3428
322 Ga0265338_10008078 3300028800 Bacteria 12864
323 Ga0265338_10034157 3300028800 Bacteria 4920
324 Ga0265338_10089674 3300028800 Bacteria 2547
325 Ga0307511_10041818 3300030521 Bacteria 3862
326 Ga0307511_10044765 3300030521 Bacteria 3670
327 Ga0316179_1007569 3300030734 Bacteria 2335
328 Ga0316178_1085488 3300030735 Bacteria 13716
329 Ga0265330_10009700 3300031235 Bacteria 4564
330 Ga0265325_10001901 3300031241 Bacteria 14416
331 Ga0265339_10014882 3300031249 Bacteria 4677
332 Ga0265331_10011374 3300031250 Bacteria 4877
333 Ga0265327_10045761 3300031251 Bacteria 2323
334 Ga0307513_10117147 3300031456 Bacteria 2641
335 Ga0307509_10088442 3300031507 Bacteria 3180
336 Ga0307408_100004523 3300031548 Bacteria 9427
337 Ga0307408_100022392 3300031548 Bacteria 4292
338 Ga0307408_100027290 3300031548 Bacteria 3932
339 Ga0265313_10004543 3300031595 Bacteria 10583
340 Ga0307514_10001067 3300031649 Bacteria 38961
341 Ga0265314_10005751 3300031711 Bacteria 11124
342 Ga0307405_10004895 3300031731 Bacteria 6393
343 Ga0307405_10008531 3300031731 Bacteria 5203
344 Ga0307405_10036019 3300031731 Bacteria 2961
345 Ga0307413_10063951 3300031824 Bacteria 2283
346 Ga0307406_10011704 3300031901 Bacteria 4981
347 Ga0307412_10002215 3300031911 Bacteria 10786
348 Ga0307412_10030858 3300031911 Bacteria 3379
349 Ga0307409_100078077 3300031995 Bacteria 2662
350 Ga0307409_100081478 3300031995 Bacteria 2616
351 Ga0307416_100135158 3300032002 Bacteria 2229
352 Ga0307414_10083713 3300032004 Bacteria 2344
353 Ga0307411_10029815 3300032005 Bacteria 3337
354 Ga0307411_10106522 3300032005 Bacteria 1995
355 Ga0307510_10016790 3300033180 Bacteria 8637
356 Ga0395900_0002853 3300037418 Bacteria 18860
357 Ga0395900_0247148 3300037418 Bacteria 1787
358 Ga0395905_0001778 3300037471 Bacteria 25004
359 Ga0395905_0014404 3300037471 Bacteria 7553
360 Ga0395905_0029858 3300037471 Bacteria 5138
361 Ga0395901_0004406 3300038443 Bacteria 14190
362 Ga0395901_0017627 3300038443 Bacteria 7292
363 Ga0439438_000532 3300041405 Bacteria 17336
364 Ga0439438_002698 3300041405 Bacteria 7471
365 Ga0439438_002764 3300041405 Bacteria 7349
366 Ga0439438_004435 3300041405 Bacteria 5386
367 Ga0439438_005714 3300041405 Bacteria 4526
368 Ga0439438_009523 3300041405 Bacteria 3139
369 Ga0439447_001577 3300041407 Bacteria 8344
370 Ga0439447_003653 3300041407 Bacteria 5428
371 Ga0439447_003866 3300041407 Bacteria 5253
372 Ga0439447_007780 3300041407 Bacteria 3367
373 Ga0439466_0002401 3300041411 Bacteria 7343
374 Ga0439466_0003005 3300041411 Bacteria 6580
375 Ga0439466_0009803 3300041411 Bacteria 3569
376 Ga0439466_0013997 3300041411 Bacteria 2928
377 Ga0439466_0018978 3300041411 Bacteria 2462
378 Ga0439432_001499 3300042006 Bacteria 8761
379 Ga0439432_001529 3300042006 Bacteria 8687
380 Ga0439432_007275 3300042006 Bacteria 3930
381 Ga0439451_000472 3300042009 Bacteria 7819
382 Ga0439451_001204 3300042009 Bacteria 5102
383 Ga0439452_000732 3300042010 Bacteria 15774
384 Ga0439452_000742 3300042010 Bacteria 15669
385 Ga0439452_001257 3300042010 Bacteria 10755
386 Ga0439452_011606 3300042010 Bacteria 2524
387 Ga0439456_000071 3300042013 Bacteria 36014
388 Ga0439456_003830 3300042013 Bacteria 3054
389 Ga0439463_003557 3300042016 Bacteria 3939
390 Ga0450911_000441 3300042115 Bacteria 13478
391 Ga0450911_001298 3300042115 Bacteria 5925
392 Ga0450911_002186 3300042115 Bacteria 3957
393 Ga0450920_000209 3300042122 Bacteria 8642
394 Ga0450922_001359 3300042124 Bacteria 2410
395 Ga0450890_000618 3300042127 Bacteria 5191
396 Ga0450899_001777 3300042135 Bacteria 2393
397 Ga0450902_003704 3300042137 Bacteria 2247
398 Ga0450904_000950 3300042139 Bacteria 4577
399 Ga0450906_001861 3300042145 Bacteria 4617
400 Ga0450906_009724 3300042145 Bacteria 1827
401 Ga0450907_000015 3300042146 Bacteria 85221
402 Ga0450907_000967 3300042146 Bacteria 6788
403 Ga0450910_004102 3300042147 Bacteria 1960
404 Ga0439446_0002404 3300042156 Bacteria 4486
405 Ga0450908_006563 3300042184 Bacteria 2206
406 Ga0439434_0000083 3300042435 Bacteria 23647
407 Ga0439464_0002942 3300042439 Bacteria 4247
408 Ga0439460_0001661 3300042461 Bacteria 5272
409 Ga0439460_0003001 3300042461 Bacteria 4072
410 Ga0439460_0003519 3300042461 Bacteria 3787
411 Ga0439460_0006771 3300042461 Bacteria 2851
412 Ga0439440_0004230 3300042993 Bacteria 2814
413 Ga0495617_000789 3300046452 Bacteria 15318
414 Ga0495617_002785 3300046452 Bacteria 6744
415 Ga0495617_007706 3300046452 Bacteria 3724
416 Ga0495617_013876 3300046452 Bacteria 2740
417 Ga0495617_030650 3300046452 Bacteria 1807
418 Ga0495627_002706 3300046453 Bacteria 8291
419 Ga0495627_002977 3300046453 Bacteria 7760
420 Ga0495627_003608 3300046453 Bacteria 6736
421 Ga0495627_007871 3300046453 Bacteria 4045
422 Ga0495627_008703 3300046453 Bacteria 3785
423 Ga0495592_0025312 3300046454 Bacteria 4505
424 Ga0495603_0082583 3300046455 Bacteria 1882
425 Ga0495590_0002105 3300046457 Bacteria 8339
426 Ga0495590_0002853 3300046457 Bacteria 7119
427 Ga0495590_0006100 3300046457 Bacteria 4725
428 Ga0495591_001192 3300046458 Bacteria 16980
429 Ga0495591_001612 3300046458 Bacteria 13633
430 Ga0495591_002052 3300046458 Bacteria 11682
431 Ga0495591_002960 3300046458 Bacteria 9068
432 Ga0495591_003835 3300046458 Bacteria 7603
433 Ga0495591_008863 3300046458 Bacteria 4063
434 Ga0495629_0000468 3300046459 Bacteria 33837
435 Ga0495638_0006469 3300046460 Bacteria 8521
436 Ga0495638_0008707 3300046460 Bacteria 7173
437 Ga0495638_0010243 3300046460 Bacteria 6523
438 Ga0495638_0015446 3300046460 Bacteria 5125
439 Ga0495638_0015799 3300046460 Bacteria 5057
440 Ga0495638_0015981 3300046460 Bacteria 5030
441 Ga0495638_0016917 3300046460 Bacteria 4875
442 Ga0495638_0017845 3300046460 Bacteria 4723
443 Ga0495638_0024983 3300046460 Bacteria 3888
444 Ga0495638_0040765 3300046460 Bacteria 2941
445 Ga0495651_0015068 3300046462 Bacteria 5975
446 Ga0495653_0038962 3300046463 Bacteria 3726
447 Ga0495653_0048939 3300046463 Bacteria 3259
448 Ga0495653_0080965 3300046463 Bacteria 2400
449 Ga0495653_0140349 3300046463 Bacteria 1700
450 Ga0495650_0003878 3300046471 Bacteria 10584
451 Ga0495650_0011538 3300046471 Bacteria 4830
452 Ga0495650_0012383 3300046471 Bacteria 4592
453 Ga0495650_0029051 3300046471 Bacteria 2526
454 Ga0495650_0029907 3300046471 Bacteria 2475
455 Ga0495580_0000104 3300046472 Bacteria 56812
456 Ga0495580_0009914 3300046472 Bacteria 7457
457 Ga0495580_0023254 3300046472 Bacteria 4553
458 Ga0495582_0009166 3300046473 Bacteria 5459
459 Ga0495605_0001604 3300046474 Bacteria 14652
460 Ga0495605_0004544 3300046474 Bacteria 8126
461 Ga0495605_0006744 3300046474 Bacteria 6564
462 Ga0495605_0011512 3300046474 Bacteria 4926
463 Ga0495605_0012216 3300046474 Bacteria 4769
464 Ga0495605_0032166 3300046474 Bacteria 2673
465 Ga0495605_0049993 3300046474 Bacteria 2040
466 Ga0495664_0029390 3300046477 Bacteria 3214
467 Ga0495584_0000014 3300046491 Bacteria 172880
468 Ga0495584_0001457 3300046491 Bacteria 14215
469 Ga0495584_0001756 3300046491 Bacteria 12646
470 Ga0495584_0003606 3300046491 Bacteria 8446
471 Ga0495584_0004147 3300046491 Bacteria 7824
472 Ga0495584_0009081 3300046491 Bacteria 5134
473 Ga0495584_0015268 3300046491 Bacteria 3913
474 Ga0495585_0000096 3300046492 Bacteria 93635
475 Ga0495585_0002384 3300046492 Bacteria 13478
476 Ga0495585_0004069 3300046492 Bacteria 9605
477 Ga0495585_0011835 3300046492 Bacteria 5153
478 Ga0495585_0013169 3300046492 Bacteria 4846
479 Ga0495585_0035921 3300046492 Bacteria 2798
480 Ga0495585_0040818 3300046492 Bacteria 2604
481 Ga0495585_0041493 3300046492 Bacteria 2580
482 Ga0495585_0075124 3300046492 Bacteria 1837
483 Ga0495594_0043205 3300046499 Bacteria 2470
484 Ga0495596_0000888 3300046500 Bacteria 18032
485 Ga0495596_0007790 3300046500 Bacteria 4805
486 Ga0495596_0017771 3300046500 Bacteria 2940
487 Ga0495607_0001972 3300046501 Bacteria 17295
488 Ga0495607_0005517 3300046501 Bacteria 9025
489 Ga0495607_0006291 3300046501 Bacteria 8371
490 Ga0495607_0013220 3300046501 Bacteria 5419
491 Ga0495607_0016236 3300046501 Bacteria 4808
492 Ga0495607_0042500 3300046501 Bacteria 2693
493 Ga0495607_0046195 3300046501 Bacteria 2558
494 Ga0495583_0002651 3300046506 Bacteria 14916
495 Ga0495583_0005025 3300046506 Bacteria 9154
496 Ga0495583_0005187 3300046506 Bacteria 8970
497 Ga0495583_0005623 3300046506 Bacteria 8448
498 Ga0495583_0012075 3300046506 Bacteria 4917
499 Ga0495583_0018753 3300046506 Bacteria 3632
500 Ga0495583_0028784 3300046506 Bacteria 2727
501 Ga0495583_0028862 3300046506 Bacteria 2722
502 Ga0495606_0000027 3300046507 Bacteria 253573
503 Ga0495606_0006755 3300046507 Bacteria 10498
504 Ga0495606_0007268 3300046507 Bacteria 9980
505 Ga0495606_0007963 3300046507 Bacteria 9326
506 Ga0495606_0010270 3300046507 Bacteria 7796
507 Ga0495606_0028117 3300046507 Bacteria 3971
508 Ga0495606_0035116 3300046507 Bacteria 3431
509 Ga0495608_0001808 3300046511 Bacteria 15286
510 Ga0495610_0006370 3300046512 Bacteria 8143
511 Ga0495610_0006603 3300046512 Bacteria 7926
512 Ga0495610_0007514 3300046512 Bacteria 7235
513 Ga0495610_0009350 3300046512 Bacteria 6206
514 Ga0495610_0013412 3300046512 Bacteria 4870
515 Ga0495610_0015529 3300046512 Bacteria 4420
516 Ga0495610_0016744 3300046512 Bacteria 4208
517 Ga0495610_0028596 3300046512 Bacteria 2945
518 Ga0495610_0029381 3300046512 Bacteria 2895
519 Ga0495610_0044416 3300046512 Bacteria 2205
520 Ga0495616_0005526 3300046513 Bacteria 7768
521 Ga0495616_0011272 3300046513 Bacteria 5131
522 Ga0495616_0011759 3300046513 Bacteria 4999
523 Ga0495616_0030044 3300046513 Bacteria 2860
524 Ga0495616_0038614 3300046513 Bacteria 2450
525 Ga0495618_0005058 3300046514 Bacteria 8054
526 Ga0495620_0001983 3300046515 Bacteria 11965
527 Ga0495620_0002880 3300046515 Bacteria 9888
528 Ga0495620_0010389 3300046515 Bacteria 4913
529 Ga0495630_0008000 3300046517 Bacteria 7594
530 Ga0495630_0011630 3300046517 Bacteria 6377
531 Ga0495630_0021381 3300046517 Bacteria 4778
532 Ga0495630_0025431 3300046517 Bacteria 4378
533 Ga0495630_0044799 3300046517 Bacteria 3306
534 Ga0495631_0000637 3300046518 Bacteria 22916
535 Ga0495631_0002437 3300046518 Bacteria 10490
536 Ga0495632_0002221 3300046519 Bacteria 14973
537 Ga0495632_0006267 3300046519 Bacteria 7687
538 Ga0495632_0021428 3300046519 Bacteria 3482
539 Ga0495632_0024850 3300046519 Bacteria 3176
540 Ga0495632_0037202 3300046519 Bacteria 2471
541 Ga0495632_0058981 3300046519 Bacteria 1868
542 Ga0495637_0000743 3300046520 Bacteria 22023
543 Ga0495637_0004004 3300046520 Bacteria 7687
544 Ga0495637_0004169 3300046520 Bacteria 7520
545 Ga0495637_0004212 3300046520 Bacteria 7473
546 Ga0495637_0010212 3300046520 Bacteria 4549
547 Ga0495637_0010627 3300046520 Bacteria 4445
548 Ga0495637_0020960 3300046520 Bacteria 2998
549 Ga0495637_0023808 3300046520 Bacteria 2776
550 Ga0495637_0049704 3300046520 Bacteria 1760
551 Ga0495643_0000049 3300046522 Bacteria 212242
552 Ga0495643_0005492 3300046522 Bacteria 8557
553 Ga0495643_0014948 3300046522 Bacteria 4602
554 Ga0495643_0021642 3300046522 Bacteria 3684
555 Ga0495644_0002471 3300046523 Bacteria 7375
556 Ga0495644_0003748 3300046523 Bacteria 5982
557 Ga0495644_0005046 3300046523 Bacteria 5162
558 Ga0495648_0006977 3300046524 Bacteria 9110
559 Ga0495648_0015406 3300046524 Bacteria 5553
560 Ga0495648_0019472 3300046524 Bacteria 4771
561 Ga0495648_0024656 3300046524 Bacteria 4089
562 Ga0495648_0036025 3300046524 Bacteria 3199
563 Ga0495648_0059998 3300046524 Bacteria 2265
564 Ga0495648_0062378 3300046524 Bacteria 2207
565 Ga0495666_0000354 3300046526 Bacteria 20158
566 Ga0495666_0002897 3300046526 Bacteria 8593
567 Ga0495642_0000042 3300046528 Bacteria 75891
568 Ga0495642_0001043 3300046528 Bacteria 12868
569 Ga0495652_0009144 3300046529 Bacteria 9006
570 Ga0495654_0001990 3300046530 Bacteria 13453
571 Ga0495654_0003418 3300046530 Bacteria 9744
572 Ga0495654_0003987 3300046530 Bacteria 8884
573 Ga0495654_0004439 3300046530 Bacteria 8322
574 Ga0495654_0009995 3300046530 Bacteria 5182
575 Ga0495654_0031671 3300046530 Bacteria 2684
576 Ga0495654_0044487 3300046530 Bacteria 2196
577 Ga0495654_0055840 3300046530 Bacteria 1910
578 Ga0495665_0001735 3300046531 Bacteria 11719
579 Ga0495665_0022196 3300046531 Bacteria 3413
580 Ga0495640_0029250 3300046533 Bacteria 3958
581 Ga0495587_0000917 3300046536 Bacteria 19460
582 Ga0495587_0018623 3300046536 Bacteria 4304
583 Ga0495609_0000928 3300046538 Bacteria 21198
584 Ga0495609_0002746 3300046538 Bacteria 10597
585 Ga0495609_0008048 3300046538 Bacteria 5197
586 Ga0495609_0014589 3300046538 Bacteria 3691
587 Ga0495609_0014637 3300046538 Bacteria 3684
588 Ga0495609_0027333 3300046538 Bacteria 2608
589 Ga0495609_0053390 3300046538 Bacteria 1797
590 Ga0495597_0003541 3300046542 Bacteria 9030
591 Ga0495597_0008048 3300046542 Bacteria 5305
592 Ga0495597_0012096 3300046542 Bacteria 4171
593 Ga0495597_0034930 3300046542 Bacteria 2270
594 Ga0495597_0037287 3300046542 Bacteria 2183
595 Ga0495645_0079895 3300046543 Bacteria 2348
596 Ga0495645_0118550 3300046543 Bacteria 1866
597 Ga0495622_0009838 3300046557 Bacteria 4422
598 Ga0495622_0010541 3300046557 Bacteria 4268
599 Ga0495622_0010724 3300046557 Bacteria 4228
600 Ga0495622_0025944 3300046557 Bacteria 2738
601 Ga0495633_0003512 3300046558 Bacteria 10400
602 Ga0495656_0002177 3300046615 Bacteria 6477
603 Ga0495656_0041654 3300046615 Bacteria 1920
604 Ga0495668_0003061 3300046616 Bacteria 12952
605 Ga0495668_0006817 3300046616 Bacteria 7414
606 Ga0495668_0010604 3300046616 Bacteria 5567
607 Ga0495668_0011931 3300046616 Bacteria 5174
608 Ga0495634_0028576 3300046642 Bacteria 3869
609 Ga0495611_0001015 3300046648 Bacteria 14886
610 Ga0495625_0004213 3300046660 Bacteria 13703
611 Ga0495625_0006199 3300046660 Bacteria 10713
612 Ga0495625_0010011 3300046660 Bacteria 7884
613 Ga0495625_0022102 3300046660 Bacteria 4882
614 Ga0495625_0023761 3300046660 Bacteria 4678
615 Ga0495625_0049227 3300046660 Bacteria 3030
616 Ga0495625_0060201 3300046660 Bacteria 2691
617 Ga0495635_0005729 3300046663 Bacteria 8653
618 Ga0495659_0006521 3300046664 Bacteria 3686
619 Ga0495661_0004628 3300046665 Bacteria 9899
620 Ga0495661_0007157 3300046665 Bacteria 7786
621 Ga0495661_0018363 3300046665 Bacteria 4602
622 Ga0495661_0032986 3300046665 Bacteria 3268
623 Ga0495661_0036199 3300046665 Bacteria 3092
624 Ga0495661_0039208 3300046665 Bacteria 2945
625 Ga0495588_0004345 3300046674 Bacteria 6256
626 Ga0495599_0013867 3300046678 Bacteria 4987
627 Ga0495623_0003020 3300046679 Bacteria 11074
628 Ga0495623_0003593 3300046679 Bacteria 10255
629 Ga0495623_0014480 3300046679 Bacteria 5104
630 Ga0495646_0023390 3300046680 Bacteria 3890
631 Ga0495669_0017315 3300046684 Bacteria 3091
632 Ga0495613_0002518 3300046689 Bacteria 13807
633 Ga0495613_0077847 3300046689 Bacteria 2412
634 Ga0495624_0001358 3300046690 Bacteria 19089
635 Ga0495624_0004594 3300046690 Bacteria 10075
636 Ga0495624_0014347 3300046690 Bacteria 5380
637 Ga0495670_0002154 3300046691 Bacteria 9733
638 Ga0495670_0003049 3300046691 Bacteria 8262
639 Ga0495670_0003797 3300046691 Bacteria 7423
640 Ga0495670_0018969 3300046691 Bacteria 3388
641 Ga0495671_0000674 3300046692 Bacteria 24630
642 Ga0495671_0001038 3300046692 Bacteria 19312
643 Ga0495671_0004372 3300046692 Bacteria 8466
644 Ga0495671_0008811 3300046692 Bacteria 5665
645 Ga0495671_0010676 3300046692 Bacteria 5081
646 Ga0495671_0011679 3300046692 Bacteria 4818
647 Ga0495671_0054340 3300046692 Bacteria 1985
648 Ga0495649_0000045 3300046694 Bacteria 120562
649 Ga0495649_0002119 3300046694 Bacteria 14235
650 Ga0495649_0006018 3300046694 Bacteria 7593
651 Ga0495649_0009383 3300046694 Bacteria 5821
652 Ga0495649_0015440 3300046694 Bacteria 4346
653 Ga0495649_0017519 3300046694 Bacteria 4040
654 Ga0495649_0017531 3300046694 Bacteria 4039
655 Ga0495649_0027591 3300046694 Bacteria 3149
656 Ga0495649_0032641 3300046694 Bacteria 2866
657 Ga0495649_0042760 3300046694 Bacteria 2474
658 Ga0495649_0063407 3300046694 Bacteria 1985
659 Ga0495589_0000710 3300046794 Bacteria 21647
660 Ga0495589_0001216 3300046794 Bacteria 15315
661 Ga0495589_0003242 3300046794 Bacteria 8871
662 Ga0495589_0004730 3300046794 Bacteria 7226
663 Ga0495589_0005288 3300046794 Bacteria 6821
664 Ga0495589_0008364 3300046794 Bacteria 5406
665 Ga0495589_0016286 3300046794 Bacteria 3821
666 Ga0495589_0023075 3300046794 Bacteria 3171
667 Ga0495589_0029829 3300046794 Bacteria 2749
668 Ga0495600_0000760 3300046809 Bacteria 16970
669 Ga0495600_0042489 3300046809 Bacteria 2963
670 Ga0495600_0103663 3300046809 Bacteria 1854
671 Ga0495660_0012476 3300046810 Bacteria 4933
672 Ga0495660_0032381 3300046810 Bacteria 2935
673 Ga0495660_0055094 3300046810 Bacteria 2153
674 Ga0495660_0060371 3300046810 Bacteria 2036
675 Ga0495660_0086910 3300046810 Bacteria 1631
676 Ga0495604_0055479 3300047317 Bacteria 3053
677 Ga0495636_0009555 3300047318 Bacteria 3819
678 Ga0495674_0007043 3300047319 Bacteria 10756
679 Ga0495674_0010312 3300047319 Bacteria 8847
680 Ga0495674_0022078 3300047319 Bacteria 5874
681 Ga0495674_0032782 3300047319 Bacteria 4708
682 Ga0495672_0000491 3300047320 Bacteria 46089
683 Ga0495672_0006898 3300047320 Bacteria 8659
684 Ga0495672_0010295 3300047320 Bacteria 6680
685 Ga0495672_0010675 3300047320 Bacteria 6522
686 Ga0495672_0012049 3300047320 Bacteria 6056
687 Ga0495672_0012889 3300047320 Bacteria 5797
688 Ga0495672_0014480 3300047320 Bacteria 5399
689 Ga0495672_0014869 3300047320 Bacteria 5307
690 Ga0495672_0040857 3300047320 Bacteria 2809
691 Ga0495672_0042516 3300047320 Bacteria 2739
692 Ga0495676_0021737 3300047321 Bacteria 5594
693 Ga0495676_0047502 3300047321 Bacteria 3470
694 Ga0495680_0022594 3300047322 Bacteria 5239
695 Ga0495680_0024779 3300047322 Bacteria 4971
696 Ga0495680_0045732 3300047322 Bacteria 3455
697 Ga0495680_0088625 3300047322 Bacteria 2324
698 Ga0495680_0113934 3300047322 Bacteria 2001
699 Ga0495683_0001300 3300047323 Bacteria 16871
700 Ga0495683_0001396 3300047323 Bacteria 15956
701 Ga0495683_0004230 3300047323 Bacteria 8198
702 Ga0495683_0005000 3300047323 Bacteria 7425
703 Ga0495683_0010755 3300047323 Bacteria 4825
704 Ga0495683_0016072 3300047323 Bacteria 3886
705 Ga0495683_0070842 3300047323 Bacteria 1711
706 Ga0495687_000391 3300047443 Bacteria 54354
707 Ga0495687_002043 3300047443 Bacteria 17006
708 Ga0495687_005506 3300047443 Bacteria 8041
709 Ga0495687_005781 3300047443 Bacteria 7764
710 Ga0495675_0001615 3300047444 Bacteria 13542
711 Ga0495677_0015881 3300047445 Bacteria 2734
712 Ga0495679_000099 3300047446 Bacteria 79098
713 Ga0495679_004021 3300047446 Bacteria 6911
714 Ga0495679_007433 3300047446 Bacteria 4568
715 Ga0495679_007460 3300047446 Bacteria 4557
716 Ga0495679_025500 3300047446 Bacteria 1975
717 Ga0495673_0000138 3300047469 Bacteria 130703
718 Ga0495673_0001881 3300047469 Bacteria 15755
719 Ga0495673_0003310 3300047469 Bacteria 10683
720 Ga0495673_0005487 3300047469 Bacteria 7660
721 Ga0495673_0011480 3300047469 Bacteria 4760
722 Ga0495673_0012351 3300047469 Bacteria 4538
723 Ga0495673_0012998 3300047469 Bacteria 4387
724 Ga0495673_0021585 3300047469 Bacteria 3176
725 Ga0495673_0022476 3300047469 Bacteria 3089
726 Ga0495673_0023859 3300047469 Bacteria 2966
727 Ga0495673_0046515 3300047469 Bacteria 1922
728 Ga0495673_0082830 3300047469 Bacteria 1325
729 Ga0495681_0001868 3300047470 Bacteria 15463
730 Ga0495681_0002951 3300047470 Bacteria 12000
731 Ga0495681_0003683 3300047470 Bacteria 10641
732 Ga0495681_0004182 3300047470 Bacteria 9909
733 Ga0495681_0008619 3300047470 Bacteria 6368
734 Ga0495681_0009879 3300047470 Bacteria 5833
735 Ga0495681_0011262 3300047470 Bacteria 5341
736 Ga0495681_0011768 3300047470 Bacteria 5181
737 Ga0495681_0013301 3300047470 Bacteria 4784
738 Ga0495681_0016467 3300047470 Bacteria 4141
739 Ga0495681_0019611 3300047470 Bacteria 3687
740 Ga0495681_0028480 3300047470 Bacteria 2873
741 Ga0495681_0028807 3300047470 Bacteria 2851
742 Ga0495684_0027096 3300047471 Bacteria 4400
743 Ga0495686_0003876 3300047472 Bacteria 12625
744 Ga0495686_0005847 3300047472 Bacteria 9590
745 Ga0495686_0035291 3300047472 Bacteria 3215
746 Ga0495593_0000669 3300047673 Bacteria 19745
747 Ga0495593_0061855 3300047673 Bacteria 1957
748 Ga0495602_0003358 3300048088 Bacteria 16530
749 Ga0495602_0016506 3300048088 Bacteria 7424
750 Ga0495602_0024407 3300048088 Bacteria 5866
751 Ga0495614_0000359 3300048089 Bacteria 18242
752 Ga0495626_0001033 3300048091 Bacteria 23809
753 Ga0495626_0001736 3300048091 Bacteria 16616
754 Ga0495626_0006717 3300048091 Bacteria 6514
755 Ga0495626_0008794 3300048091 Bacteria 5495
756 Ga0495626_0009686 3300048091 Bacteria 5194
757 Ga0496100_0000804 3300048903 Bacteria 15016
758 Ga0496100_0004424 3300048903 Bacteria 7447
759 Ga0496100_0136633 3300048903 Bacteria 1733
760 Ga0496101_0007867 3300048904 Bacteria 6936
761 Ga0496102_0001622 3300048905 Bacteria 19810
762 Ga0496103_0010728 3300048906 Bacteria 5421
763 Ga0496103_0106475 3300048906 Bacteria 1778
764 Ga0496104_0005909 3300048907 Bacteria 10716
765 Ga0496104_0227007 3300048907 Bacteria 1779
766 Ga0496105_0019530 3300048908 Bacteria 5467
767 Ga0496106_0000114 3300048909 Bacteria 61763
768 Ga0496106_0008022 3300048909 Bacteria 7798
769 Ga0496107_0001207 3300048910 Bacteria 15753
770 Ga0496108_0042541 3300048911 Bacteria 3793
771 Ga0496112_0131925 3300048915 Bacteria 2469
772 Ga0496113_0133324 3300048916 Bacteria 1951
773 Ga0496114_0004038 3300048917 Bacteria 11337
774 Ga0496115_0026149 3300048918 Bacteria 4552
775 Ga0496115_0080871 3300048918 Bacteria 2646
776 Ga0496116_0000399 3300048919 Bacteria 63018
777 Ga0496116_0000810 3300048919 Bacteria 39564
778 Ga0496116_0004905 3300048919 Bacteria 12609
779 Ga0496116_0007180 3300048919 Bacteria 9951
780 Ga0496116_0042753 3300048919 Bacteria 3094
781 Ga0496117_0002593 3300048920 Bacteria 22486
782 Ga0496117_0003951 3300048920 Bacteria 16773
783 Ga0496117_0008920 3300048920 Bacteria 9444
784 Ga0496117_0010763 3300048920 Bacteria 8265
785 Ga0496117_0018404 3300048920 Bacteria 5785
786 Ga0496118_0006873 3300048921 Bacteria 12324
787 Ga0496118_0009751 3300048921 Bacteria 9632
788 Ga0496118_0018912 3300048921 Bacteria 6180
789 Ga0496118_0019180 3300048921 Bacteria 6123
790 Ga0496118_0021107 3300048921 Bacteria 5746
791 Ga0496118_0054205 3300048921 Bacteria 3039
792 Ga0496118_0105790 3300048921 Bacteria 1884
793 Ga0496118_0105878 3300048921 Bacteria 1883
794 Ga0496119_0007808 3300048922 Bacteria 9540
795 Ga0496119_0008144 3300048922 Bacteria 9278
796 Ga0496119_0009601 3300048922 Bacteria 8261
797 Ga0496119_0030671 3300048922 Bacteria 3620
798 Ga0496120_0000931 3300048923 Bacteria 40425
799 Ga0496120_0003224 3300048923 Bacteria 15142
800 Ga0496121_0000691 3300048924 Bacteria 62894
801 Ga0496121_0004080 3300048924 Bacteria 20059
802 Ga0496121_0014819 3300048924 Bacteria 8231
803 Ga0496121_0029335 3300048924 Bacteria 5091
804 Ga0496121_0035167 3300048924 Bacteria 4494
805 Ga0496121_0037360 3300048924 Bacteria 4314
806 Ga0496121_0056868 3300048924 Bacteria 3246
807 Ga0496121_0062868 3300048924 Bacteria 3037
808 Ga0496122_0000505 3300048925 Bacteria 80571
809 Ga0496122_0001469 3300048925 Bacteria 37960
810 Ga0496122_0003049 3300048925 Bacteria 22654
811 Ga0496122_0004296 3300048925 Bacteria 17856
812 Ga0496122_0024973 3300048925 Bacteria 5212
813 Ga0496122_0032638 3300048925 Bacteria 4301
814 Ga0496122_0044116 3300048925 Bacteria 3484
815 Ga0496122_0047433 3300048925 Bacteria 3316
816 Ga0496123_0000400 3300048926 Bacteria 80571
817 Ga0496123_0000971 3300048926 Bacteria 44294
818 Ga0496123_0002513 3300048926 Bacteria 22537
819 Ga0496123_0008313 3300048926 Bacteria 9555
820 Ga0496123_0009181 3300048926 Bacteria 8939
821 Ga0496124_0005167 3300048927 Bacteria 14849
822 Ga0496124_0009488 3300048927 Bacteria 10016
823 Ga0496124_0024513 3300048927 Bacteria 5482
824 Ga0496124_0033527 3300048927 Bacteria 4517
825 Ga0496124_0033716 3300048927 Bacteria 4502
826 Ga0496124_0092685 3300048927 Bacteria 2460
827 Ga0496124_0127912 3300048927 Bacteria 2022
828 Ga0496124_0153785 3300048927 Bacteria 1801
829 Ga0496125_0001896 3300048928 Bacteria 28683
830 Ga0496125_0005264 3300048928 Bacteria 14485
831 Ga0496125_0017090 3300048928 Bacteria 6931
832 Ga0496125_0027457 3300048928 Bacteria 5158
833 Ga0496125_0065760 3300048928 Bacteria 2869
834 Ga0496125_0124077 3300048928 Bacteria 1834
835 Ga0496125_0136853 3300048928 Bacteria 1711
836 Ga0496126_0033065 3300048929 Bacteria 4867
837 Ga0496126_0184061 3300048929 Bacteria 1772
838 Ga0496126_0218023 3300048929 Bacteria 1604
839 Ga0495678_004490 3300049459 Bacteria 8055
840 Ga0495678_006097 3300049459 Bacteria 6484
841 Ga0495678_009727 3300049459 Bacteria 4725
842 Ga0495678_012376 3300049459 Bacteria 4048
843 Ga0495678_012409 3300049459 Bacteria 4042
844 Ga0495678_013969 3300049459 Bacteria 3750
845 Ga0495682_0003906 3300049460 Bacteria 6508
846 Ga0495682_0004603 3300049460 Bacteria 5863
847 Ga0495682_0005731 3300049460 Bacteria 5124
848 Ga0495682_0014099 3300049460 Bacteria 3034
849 Ga0501031_0000010 3300049568 Bacteria 146435
850 Ga0501031_0006499 3300049568 Bacteria 7618
851 Ga0501031_0075269 3300049568 Bacteria 2198
852 Ga0501032_0000023 3300049569 Bacteria 146435
853 Ga0501032_0001104 3300049569 Bacteria 21587
854 Ga0501032_0057249 3300049569 Bacteria 2619
855 Ga0501033_0000104 3300049570 Bacteria 81029
856 Ga0501033_0001424 3300049570 Bacteria 21245
857 Ga0501033_0020261 3300049570 Bacteria 5025
858 Ga0501033_0077708 3300049570 Bacteria 2435
859 Ga0501033_0098443 3300049570 Bacteria 2136
860 Ga0501034_0000116 3300049571 Bacteria 146442
861 Ga0501034_0061943 3300049571 Bacteria 3756
862 Ga0501036_0000015 3300049572 Bacteria 146442
863 Ga0501036_0001104 3300049572 Bacteria 20497
864 Ga0501036_0025512 3300049572 Bacteria 4987
865 Ga0501036_0134265 3300049572 Bacteria 2088
866 Ga0501037_0000023 3300049573 Bacteria 146542
867 Ga0501037_0023642 3300049573 Bacteria 4543
868 Ga0501038_0000025 3300049574 Bacteria 146542
869 Ga0501038_0035235 3300049574 Bacteria 4395
870 Ga0501038_0055071 3300049574 Bacteria 3418
871 Ga0501038_0057467 3300049574 Bacteria 3340
872 Ga0501039_0000037 3300049575 Bacteria 122286
873 Ga0501039_0072647 3300049575 Bacteria 2673
874 Ga0501040_0005598 3300049576 Bacteria 8116
875 Ga0501043_0000070 3300049579 Bacteria 89839
876 Ga0501043_0006747 3300049579 Bacteria 9166
877 Ga0501047_0001244 3300049581 Bacteria 25242
878 Ga0501047_0002705 3300049581 Bacteria 16870
879 Ga0501067_0057993 3300049583 Bacteria 2144
880 Ga0501070_0067260 3300049586 Bacteria 2967
881 Ga0501076_0110937 3300049592 Bacteria 2217
882 Ga0501083_0011128 3300049744 Bacteria 6317
883 Ga0501035_0000074 3300049822 Bacteria 122269
884 Ga0501035_0003834 3300049822 Bacteria 14328
885 Ga0501035_0025760 3300049822 Bacteria 5390
886 Ga0501035_0028382 3300049822 Bacteria 5108
887 Ga0501044_0000069 3300049823 Bacteria 125974
888 Ga0501044_0002371 3300049823 Bacteria 21455
889 Ga0501044_0037706 3300049823 Bacteria 5051
890 nmdc:mga03n38_4231_c2 3300050490 Bacteria 2982
891 nmdc:mga00v17_99760_c1 3300050491 Bacteria 1832
892 nmdc:mga0yw44_85201_c1 3300050492 Bacteria 1988
893 nmdc:mga06z11_17879_c1 3300050494 Bacteria 3228
894 nmdc:mga07m45_2758_c1 3300050496 Bacteria 8286
895 nmdc:mga06r32_15033_c1 3300050510 Bacteria 7027
896 nmdc:mga0sz30_18129_c1 3300050516 Bacteria 2814
897 Ga0500647_0001267 3300053091 Bacteria 8446
898 Ga0500647_0002844 3300053091 Bacteria 6595
899 Ga0500608_006037 3300053122 Bacteria 4884
900 Ga0500618_000529 3300053125 Bacteria 23895
901 Ga0500618_000872 3300053125 Bacteria 16107
902 Ga0500642_0001809 3300053130 Bacteria 6172
903 Ga0500658_0019773 3300053134 Bacteria 2537
904 Ga0500564_002158 3300053138 Bacteria 7154
905 Ga0500634_0007749 3300053161 Bacteria 5325
906 Ga0500638_000044 3300053162 Bacteria 29743
907 Ga0500636_0000373 3300053177 Bacteria 24563
908 Ga0501082_0100338 3300060353 Bacteria 2504
909 Ga0501082_0118143 3300060353 Bacteria 2297
910 Ga0530510_0070798 3300061734 Bacteria 2531
911 2888340291 2888337043 Bacteria 6629336
912 2501075475 2501025501 Bacteria 7768574
913 2501410816 2501025504 Bacteria 8008976
914 2511096725 2510917014 Bacteria 8296963
915 2511102646 2510917015 Bacteria 7950052
916 2511256488 2511231004 Bacteria 6669789
917 2511256489 2511231004 Bacteria 6669789
918 2511265803 2511231006 Bacteria 6794709
919 2511265804 2511231006 Bacteria 6794709
920 2511280955 2511231008 Bacteria 6624100
921 2511280956 2511231008 Bacteria 6624100
922 2511287949 2511231010 Bacteria 6373152
923 2511287950 2511231010 Bacteria 6373152
924 2511298520 2511231011 Bacteria 6149768
925 2511298521 2511231011 Bacteria 6149768
926 2511301589 2511231012 Bacteria 6738011
927 2511301590 2511231012 Bacteria 6738011
928 2511314219 2511231014 Bacteria 6462302
929 2511314220 2511231014 Bacteria 6462302
930 2511319034 2511231015 Bacteria 6598026
931 2511319035 2511231015 Bacteria 6598026
932 2511323817 2511231016 Bacteria 6704427
933 2511323818 2511231016 Bacteria 6704427
934 2511332966 2511231017 Bacteria 6503007
935 2511332967 2511231017 Bacteria 6503007
936 2511337785 2511231018 Bacteria 6436256
937 2511337786 2511231018 Bacteria 6436256
938 2511343541 2511231019 Bacteria 6520662
939 2511343542 2511231019 Bacteria 6520662
940 2511348824 2511231020 Bacteria 6115223
941 2511348825 2511231020 Bacteria 6115223
942 2511355871 2511231021 Bacteria 7302637
943 2511363821 2511231022 Bacteria 6719296
944 2511363822 2511231022 Bacteria 6719296
945 2511371710 2511231023 Bacteria 6808468
946 2511371711 2511231023 Bacteria 6808468
947 2511375196 2511231024 Bacteria 5835885
948 2511410584 2511231031 Bacteria 6558529
949 2511410585 2511231031 Bacteria 6558529
950 2511823258 2511231156 Bacteria 6845832
951 2512327464 2512047018 Bacteria 6663241
952 2512327465 2512047018 Bacteria 6663241
953 2513613800 2513237090 Bacteria 7096802
954 2514052024 2513237166 Bacteria 10373764
955 2514417995 2513237305 Bacteria 7293571
956 2517566855 2517487022 Bacteria 7227575
957 2524454219 2524023207 Bacteria 6813453
958 2527076467 2526164713 Bacteria 6780608
959 2555246832 2554235231 Bacteria 5215788
960 2555246833 2554235231 Bacteria 5215788
961 2555671652 2554235341 Bacteria 6867980
962 2555671653 2554235341 Bacteria 6867980
963 2583794129 2582580891 Bacteria 6800976
964 2583794130 2582580891 Bacteria 6800976
965 2585276546 2582581307 Bacteria 6597605
966 2585283423 2582581308 Bacteria 7413247
967 2585329104 2582581315 Bacteria 7318924
968 2585333303 2582581316 Bacteria 7774528
969 2585537145 2585427527 Bacteria 7273426
970 2585557051 2585427530 Bacteria 7383882
971 2585900914 2585427608 Bacteria 6544331
972 2588518034 2588253730 Bacteria 6881675
973 2597859721 2597489887 Bacteria 6666321
974 2597859722 2597489887 Bacteria 6666321
975 2597865636 2597489888 Bacteria 6179543
976 2597865637 2597489888 Bacteria 6179543
977 2597871445 2597489889 Bacteria 6297495
978 2597871446 2597489889 Bacteria 6297495
979 2599354193 2599185160 Bacteria 6844013
980 2599354194 2599185160 Bacteria 6844013
981 2599360129 2599185161 Bacteria 6960462
982 2599360130 2599185161 Bacteria 6960462
983 2599366451 2599185162 Bacteria 6957254
984 2599366452 2599185162 Bacteria 6957254
985 2599373241 2599185163 Bacteria 6995158
986 2599373242 2599185163 Bacteria 6995158
987 2599379301 2599185164 Bacteria 6841688
988 2599379302 2599185164 Bacteria 6841688
989 2599385720 2599185165 Bacteria 6843250
990 2599385721 2599185165 Bacteria 6843250
991 2599392100 2599185166 Bacteria 6959206
992 2599392101 2599185166 Bacteria 6959206
993 2599399988 2599185167 Bacteria 6353609
994 2599399989 2599185167 Bacteria 6353609
995 2599403866 2599185168 Bacteria 6997636
996 2599403867 2599185168 Bacteria 6997636
997 2599452808 2599185179 Bacteria 6611171
998 2599452809 2599185179 Bacteria 6611171
999 2599461027 2599185181 Bacteria 6844519
1000 2599461028 2599185181 Bacteria 6844519
1001 2599469569 2599185182 Bacteria 6883168
1002 2599469570 2599185182 Bacteria 6883168
1003 2599482550 2599185185 Bacteria 6652270
1004 2599482551 2599185185 Bacteria 6652270
1005 2599490047 2599185186 Bacteria 6831633
1006 2599490048 2599185186 Bacteria 6831633
1007 2599510128 2599185189 Bacteria 5862825
1008 2599510129 2599185189 Bacteria 5862825
1009 2599514442 2599185190 Bacteria 6285678
1010 2599514443 2599185190 Bacteria 6285678
1011 2599520663 2599185191 Bacteria 6297582
1012 2599520664 2599185191 Bacteria 6297582
1013 2599614925 2599185212 Bacteria 6765997
1014 2599770547 2599185248 Bacteria 6696816
1015 2599803728 2599185257 Bacteria 6492581
1016 2599803729 2599185257 Bacteria 6492581
1017 2599882038 2599185288 Bacteria 6666191
1018 2599882039 2599185288 Bacteria 6666191
1019 2599886432 2599185289 Bacteria 6778765
1020 2599893818 2599185290 Bacteria 6289611
1021 2599893819 2599185290 Bacteria 6289611
1022 2599896797 2599185291 Bacteria 6775623
1023 2599944229 2599185302 Bacteria 5954930
1024 2599946209 2599185302 Bacteria 5954930
1025 2599950064 2599185303 Bacteria 6512725
1026 2599950065 2599185303 Bacteria 6512725
1027 2599954701 2599185304 Bacteria 5951361
1028 2599957198 2599185304 Bacteria 5951361
1029 2599959668 2599185305 Bacteria 6748700
1030 2599969763 2599185306 Bacteria 6637356
1031 2599981284 2599185308 Bacteria 6621546
1032 2599996455 2599185311 Bacteria 6354990
1033 2600006517 2599185313 Bacteria 6658188
1034 2600015091 2599185314 Bacteria 6621749
1035 2600016862 2599185315 Bacteria 6771107
1036 2600024103 2599185316 Bacteria 6320029
1037 2600031127 2599185317 Bacteria 6435722
1038 2600035286 2599185318 Bacteria 6961590
1039 2600042739 2599185319 Bacteria 6637840
1040 2600053757 2599185321 Bacteria 6764560
1041 2600058237 2599185322 Bacteria 6763055
1042 2600064086 2599185323 Bacteria 6688755
1043 2600072913 2599185324 Bacteria 6590677
1044 2600078533 2599185325 Bacteria 6324919
1045 2600213641 2599185356 Bacteria 6843884
1046 2600213642 2599185356 Bacteria 6843884
1047 2600360184 2600254930 Bacteria 6431253
1048 2600364623 2600254931 Bacteria 6734225
1049 2600364624 2600254931 Bacteria 6734225
1050 2600445693 2600254954 Bacteria 5100516
1051 2601692909 2600255296 Bacteria 5784754
1052 2601692910 2600255296 Bacteria 5784754
1053 2601773809 2600255313 Bacteria 6842543
1054 2601773810 2600255313 Bacteria 6842543
1055 2601796655 2600255318 Bacteria 6383414
1056 2601796656 2600255318 Bacteria 6383414
1057 2602012606 2600255389 Bacteria 5275336
1058 2606073805 2603880185 Bacteria 6379190
1059 2606073806 2603880185 Bacteria 6379190
1060 2606126549 2603880199 Bacteria 6377649
1061 2606126550 2603880199 Bacteria 6377649
1062 2616312559 2615840626 Bacteria 7921970
1063 2621297881 2619619299 Bacteria 6649820
1064 2621297882 2619619299 Bacteria 6649820
1065 2624482356 2623620443 Bacteria 6427864
1066 2624482357 2623620443 Bacteria 6427864
1067 2643772645 2643221550 Bacteria 4619371
1068 2643841370 2643221565 Bacteria 6216018
1069 2643873775 2643221571 Bacteria 6228673
1070 2643873776 2643221571 Bacteria 6228673
1071 2643955154 2643221589 Bacteria 6250934
1072 2643955155 2643221589 Bacteria 6250934
1073 2643988291 2643221595 Bacteria 6565519
1074 2644023509 2643221602 Bacteria 6249926
1075 2644023510 2643221602 Bacteria 6249926
1076 2644132282 2643221623 Bacteria 5239945
1077 2644156994 2643221627 Bacteria 6761570
1078 2644202713 2643221636 Bacteria 6583769
1079 2644207730 2643221637 Bacteria 5345260
1080 2644282339 2643221650 Bacteria 7029547
1081 2644624920 2643221713 Bacteria 6554480
1082 2644624921 2643221713 Bacteria 6554480
1083 2644651819 2643221718 Bacteria 5345506
1084 2652546850 2651869719 Bacteria 6047974
1085 2671092153 2667528170 Bacteria 6786960
1086 2671096773 2667528171 Bacteria 6900659
1087 2671096774 2667528171 Bacteria 6900659
1088 2671116279 2667528174 Bacteria 6435400
1089 2671127626 2667528176 Bacteria 6724917
1090 2671770703 2671180172 Bacteria 6495783
1091 2671770704 2671180172 Bacteria 6495783
1092 2677897816 2675903420 Bacteria 6247433
1093 2677897817 2675903420 Bacteria 6247433
1094 2678261804 2675903515 Bacteria 6580491
1095 2678261805 2675903515 Bacteria 6580491
1096 2694631731 2693429783 Bacteria 7019804
1097 2694638027 2693429784 Bacteria 7241525
1098 2715750355 2713897148 Bacteria 5883533
1099 2715750356 2713897148 Bacteria 5883533
1100 2715755253 2713897149 Bacteria 6506249
1101 2715755254 2713897149 Bacteria 6506249
1102 2718635535 2718217725 Bacteria 5758958
1103 2718635536 2718217725 Bacteria 5758958
1104 2723250360 2721755607 Bacteria 5841722
1105 2723250361 2721755607 Bacteria 5841722
1106 2723578411 2721755686 Bacteria 7343952
1107 2738670765 2738541265 Bacteria 6594665
1108 2738670766 2738541265 Bacteria 6594665
1109 2738749158 2738541282 Bacteria 6593925
1110 2738749159 2738541282 Bacteria 6593925
1111 2738811644 2738541294 Bacteria 6925949
1112 2738811645 2738541294 Bacteria 6925949
1113 2738858200 2738541303 Bacteria 6591772
1114 2738858201 2738541303 Bacteria 6591772
1115 2738899004 2738541309 Bacteria 6926455
1116 2738899005 2738541309 Bacteria 6926455
1117 2739196746 2738543004 Bacteria 6381073
1118 2739257722 2738543015 Bacteria 6750701
1119 2739257723 2738543015 Bacteria 6750701
1120 2739287604 2738543020 Bacteria 5718238
1121 2739292917 2738543021 Bacteria 5718241
1122 2739313413 2738543025 Bacteria 6600348
1123 2739313414 2738543025 Bacteria 6600348
1124 2743739271 2740892503 Bacteria 6855563
1125 2743739272 2740892503 Bacteria 6855563
1126 2745008153 2744054620 Bacteria 6551379
1127 2745008154 2744054620 Bacteria 6551379
1128 2756677897 2756170246 Bacteria 7451806
1129 2774133238 2773857673 Bacteria 6513460
1130 2774133239 2773857673 Bacteria 6513460
1131 2784262899 2784132063 Bacteria 6262788
1132 2784262900 2784132063 Bacteria 6262788
1133 2792629386 2791355092 Bacteria 6248105
1134 2794594618 2791355520 Bacteria 5948615
1135 2807409965 2806310737 Bacteria 5751088
1136 2807409966 2806310737 Bacteria 5751088
1137 2807458312 2806310745 Bacteria 5742165
1138 2807458313 2806310745 Bacteria 5742165
1139 2808856413 2808606361 Bacteria 6136259
1140 2808931371 2808606377 Bacteria 6646337
1141 2808936439 2808606378 Bacteria 6177535
1142 2808953493 2808606381 Bacteria 6646461
1143 2808958701 2808606382 Bacteria 6841132
1144 2808964860 2808606383 Bacteria 6138645
1145 2808979613 2808606385 Bacteria 6711065
1146 2808979614 2808606385 Bacteria 6711065
1147 2808995116 2808606388 Bacteria 6706662
1148 2808995117 2808606388 Bacteria 6706662
1149 2808999752 2808606389 Bacteria 6138126
1150 2809219426 2808606445 Bacteria 6057339
1151 2809219427 2808606445 Bacteria 6057339
1152 2817492983 2816332298 Bacteria 6852809
1153 2817492984 2816332298 Bacteria 6852809
1154 2819642438 2818991453 Bacteria 7181617
1155 2819656031 2818991456 Bacteria 6123676
1156 2819656032 2818991456 Bacteria 6123676
1157 2819701866 2818991464 Bacteria 6907494
1158 2819701867 2818991464 Bacteria 6907494
1159 2823424071 2823421272 Bacteria 5372474
1160 2825653471 2825651385 Bacteria 6715909
1161 2825653472 2825651385 Bacteria 6715909
1162 2834031410 2834028612 Bacteria 6354979
1163 2834031411 2834028612 Bacteria 6354979
1164 2842805875 2842805378 Bacteria 5385175
1165 2842832127 2842826826 Bacteria 5974129
1166 2842832128 2842826826 Bacteria 5974129
1167 2842837211 2842832357 Bacteria 5959113
1168 2842837212 2842832357 Bacteria 5959113
1169 2842840720 2842837860 Bacteria 6066181
1170 2842840721 2842837860 Bacteria 6066181
1171 2842845008 2842843487 Bacteria 6004777
1172 2842845009 2842843487 Bacteria 6004777
1173 2842857024 2842854478 Bacteria 6143501
1174 2844004905 2844002411 Bacteria 7168230
1175 2844672175 2844665904 Bacteria 6817974
1176 2844672176 2844665904 Bacteria 6817974
1177 2846958398 2846952575 Bacteria 6587527
1178 2852612625 2852612431 Bacteria 6885235
1179 2852612626 2852612431 Bacteria 6885235
1180 2852660902 2852657418 Bacteria 6472974
1181 2852660903 2852657418 Bacteria 6472974
1182 2852669638 2852667396 Bacteria 6885555
1183 2852669639 2852667396 Bacteria 6885555
1184 2854915469 2854911287 Bacteria 5582813
1185 2856343043 2856342000 Bacteria 7176905
1186 2856363564 2856356410 Bacteria 6297484
1187 2857354093 2857349434 Bacteria 7926032
1188 2857366033 2857357740 Bacteria 9937880
1189 2860341210 2860339153 Bacteria 6846989
1190 2860872069 2860867994 Bacteria 5645326
1191 2860872070 2860867994 Bacteria 5645326
1192 2869162967 2869162929 Bacteria 6399702
1193 2871471149 2871466892 Bacteria 6923287
1194 2871492319 2871488783 Bacteria 6929816
1195 2874128032 2874123672 Bacteria 7238285
1196 2878034280 2878029506 Bacteria 6418441
1197 2878034281 2878029506 Bacteria 6418441
1198 2878759667 2878753008 Bacteria 6922523
1199 2878785400 2878781027 Bacteria 6834456
1200 2880234908 2880230671 Bacteria 6140320
1201 2880234909 2880230671 Bacteria 6140320
1202 2881849472 2881845957 Bacteria 6611900
1203 2881865749 2881861095 Bacteria 7128710
1204 2882912578 2882912400 Bacteria 6801539
1205 2883091307 2883087390 Bacteria 9532701
1206 2883357702 2883354860 Bacteria 5865246
1207 2885308167 2885305155 Bacteria 7348390
1208 2885316169 2885312484 Bacteria 6415165
1209 2885322230 2885318864 Bacteria 6729568
1210 2885328914 2885326080 Bacteria 7134805
1211 2885334511 2885334103 Bacteria 7216818
1212 2888352029 2888350351 Bacteria 7372807
1213 2889014015 2889010040 Bacteria 6749192
1214 2889021278 2889016732 Bacteria 6700763
1215 2903496950 2903492973 Bacteria 13473544
1216 2904522239 2904518522 Bacteria 6068986
1217 2904522240 2904518522 Bacteria 6068986
1218 2904553764 2904550169 Bacteria 6221258
1219 2904553765 2904550169 Bacteria 6221258
1220 2906328780 2906328253 Bacteria 6585166
1221 2906360606 2906354277 Bacteria 6991324
1222 2906383954 2906378014 Bacteria 6911440
1223 2908451571 2908446538 Bacteria 6829095
1224 2908451572 2908446538 Bacteria 6829095
1225 2912964815 2912963787 Bacteria 5646108
1226 2912964816 2912963787 Bacteria 5646108
1227 2917075522 2917070673 Bacteria 6868303
1228 2917075523 2917070673 Bacteria 6868303
1229 2919066656 2919063839 Bacteria 6302690
1230 2919066657 2919063839 Bacteria 6302690
1231 2919388357 2919385768 Bacteria 5897293
1232 2919388358 2919385768 Bacteria 5897293
1233 2919459303 2919456309 Bacteria 6586567
1234 2919459304 2919456309 Bacteria 6586567
1235 2919483062 2919481497 Bacteria 6907839
1236 2919493150 2919487758 Bacteria 5929766
1237 2919493151 2919487758 Bacteria 5929766
1238 2919493277 2919493220 Bacteria 4598500
1239 2919503768 2919501602 Bacteria 5286340
1240 2919543103 2919543075 Bacteria 4728703
1241 2922136041 2922130491 Bacteria 7173936
1242 2922155266 2922151315 Bacteria 6902399
1243 2922190737 2922185730 Bacteria 7113964
1244 2923158354 2923153595 Bacteria 6870622
1245 2923158355 2923153595 Bacteria 6870622
1246 2923528333 2923525760 Bacteria 4472324
1247 2923590725 2923586266 Bacteria 6565975
1248 2924734129 2924733363 Bacteria 7574837
1249 2924785334 2924784321 Bacteria 7416538
1250 2926065660 2926063275 Bacteria 5285848
1251 2926760170 2926754445 Bacteria 5964435
1252 2928158953 2928157003 Bacteria 7522202
1253 2928167774 2928163908 Bacteria 7561269
1254 2928525649 2928521798 Bacteria 4960112
1255 2929145597 2929144301 Bacteria 6622272
1256 2929194145 2929189879 Bacteria 5930554
1257 2929194146 2929189879 Bacteria 5930554
1258 2931371071 2931369376 Bacteria 6847892
1259 2931395460 2931390751 Bacteria 6273349
1260 2931395461 2931390751 Bacteria 6273349
1261 2931396945 2931396565 Bacteria 7251677
1262 2935356508 2935353572 Unclassified 6955622
1263 2935356509 2935353572 Unclassified 6955622
1264 2937849078 2937848649 Bacteria 6983481
1265 2938019213 2938014810 Bacteria 6700592
1266 2939637209 2939636861 Bacteria 6297853
1267 2939637210 2939636861 Bacteria 6297853
1268 2939652316 2939651529 Bacteria 5895393
1269 2939652317 2939651529 Bacteria 5895393
1270 2945931868 2945928738 Bacteria 6053221
1271 2945931869 2945928738 Bacteria 6053221
1272 2945965557 2945961074 Bacteria 7342064
1273 2945965558 2945961074 Bacteria 7342064
1274 2946007964 2946006987 Bacteria 6705746
1275 2946007965 2946006987 Bacteria 6705746
1276 2946032658 2946027586 Bacteria 6049274
1277 2946032659 2946027586 Bacteria 6049274
1278 2947233421 2947233263 Bacteria 6439278
1279 2947233422 2947233263 Bacteria 6439278
1280 2958106355 2958100919 Bacteria 6800575
1281 2958176412 2958172287 Bacteria 6716688
1282 2961173607 2961170736 Bacteria 7072258
1283 2965116277 2965110997 Bacteria 6693150
1284 2965121266 2965119406 Bacteria 6956431
1285 2968005797 2968003550 Bacteria 6929263
1286 2968120368 2968117919 Bacteria 6536078
1287 2969309063 2969304461 Bacteria 6601805
1288 2969309064 2969304461 Bacteria 6601805
1289 2970495966 2970489779 Bacteria 6517260
1290 2970506199 2970503327 Bacteria 7099517
1291 2970543484 2970540015 Bacteria 6977556
1292 2974289568 2974289157 Bacteria 6080362
1293 2974289569 2974289157 Bacteria 6080362
1294 2977828189 2977821940 Bacteria 6906439
1295 2977834685 2977828996 Bacteria 7007971
1296 2977923144 2977922695 Bacteria 6956781
1297 2977949754 2977942078 Bacteria 7570577
1298 2977973135 2977971508 Bacteria 7472917
1299 2977992622 2977986579 Bacteria 6581278
1300 2979714350 2979710463 Bacteria 6785254
1301 2979745227 2979742915 Bacteria 7301278
1302 2979810921 2979808191 Bacteria 7179355
1303 2984287835 2984286254 Bacteria 6702062
1304 2984287836 2984286254 Bacteria 6702062
1305 2987642497 2987636660 Bacteria 8088555
1306 2987653946 2987652177 Bacteria 6969023
1307 2987680064 2987673487 Bacteria 6884027
1308 2989351348 2989349275 Bacteria 6349068
1309 2989774530 2989771324 Bacteria 5605128
1310 2990710567 2990703756 Bacteria 7715990
1311 2998144346 2998139840 Bacteria 6073514
1312 2998144347 2998139840 Bacteria 6073514
1313 3004210578 3004203850 Bacteria 7307914
1314 3004211626 3004211236 Bacteria 7417683
1315 3004218873 3004218560 Bacteria 7421728
1316 3004272269 3004268573 Bacteria 7043476
1317 3005419017 3005416602 Bacteria 7064308
1318 3007397644 3007395558 Bacteria 6755444
1319 3007397645 3007395558 Bacteria 6755444
1320 3007420854 3007419365 Bacteria 7026924
1321 3007516128 3007511990 Bacteria 6481491
1322 3007516129 3007511990 Bacteria 6481491
1323 3007615354 3007614139 Bacteria 6053559
1324 3007620381 3007619802 Bacteria 6411688
1325 3007620382 3007619802 Bacteria 6411688
1326 3007720065 3007718800 Bacteria 5971527
1327 3007720066 3007718800 Bacteria 5971527
1328 3007858670 3007855910 Bacteria 5637581
1329 3007858671 3007855910 Bacteria 5637581
1330 3007865801 3007861166 Bacteria 6045338
1331 3007865802 3007861166 Bacteria 6045338
1332 637321970 637000220 Bacteria 7074893
1333 637321971 637000220 Bacteria 7074893
1334 642425049 641736151 Bacteria 7477263
1335 642592868 642555112 Bacteria 8676562
1336 8004381169 8004374579 Bacteria 6898112
1337 8005320800 8005314921 Bacteria 7072929
1338 8005645550 8005645114 Bacteria 6950293
1339 8005685606 8005682033 Bacteria 6726518
1340 8015692430 8015687852 Bacteria 6613826
1341 8015692431 8015687852 Bacteria 6613826
1342 8019773895 8019769354 Bacteria 6924660
1343 8019773896 8019769354 Bacteria 6924660
1344 8029996532 8029995093 Bacteria 5990776
1345 8029996533 8029995093 Bacteria 5990776
1346 8034965942 8034962539 Bacteria 4884839
1347 8054285206 8054285046 Bacteria 6919322
1348 8054285207 8054285046 Bacteria 6919322
1349 8054351284 8054347763 Bacteria 5901107
1350 8054351285 8054347763 Bacteria 5901107
1351 8054507961 8054503363 Bacteria 6101651
1352 8054507962 8054503363 Bacteria 6101651
1353 8054934464 8054929484 Bacteria 5599761
1354 8055775650 8055770955 Bacteria 6827675
1355 8055775651 8055770955 Bacteria 6827675
1356 8055822930 8055817908 Bacteria 6609162
1357 8055822931 8055817908 Bacteria 6609162
1358 8055883333 8055878733 Bacteria 5907058
1359 8055883334 8055878733 Bacteria 5907058
1360 8056120324 8056115690 Bacteria 5527654
1361 8056121842 8056120720 Bacteria 5758328
1362 8056130637 8056125926 Bacteria 6228218
1363 8056130638 8056125926 Bacteria 6228218
1364 8056136330 8056131705 Bacteria 6107031
1365 8056136331 8056131705 Bacteria 6107031
1366 8056147676 8056143049 Bacteria 6307666
1367 8056153647 8056148874 Bacteria 6479865
1368 8056153648 8056148874 Bacteria 6479865
1369 8056155328 8056155041 Bacteria 6486948
1370 8056155329 8056155041 Bacteria 6486948
1371 8056162588 8056161164 Bacteria 6106669
1372 8056162589 8056161164 Bacteria 6106669
1373 8056166915 8056166840 Bacteria 5820959
1374 8056166916 8056166840 Bacteria 5820959
1375 8056172900 8056172158 Bacteria 6133900
1376 8056172901 8056172158 Bacteria 6133900
1377 8056183252 8056177738 Bacteria 6748268
1378 8056572420 8056569372 Bacteria 5997322
1379 8057804509 8057798959 Bacteria 6713499
1380 8057804510 8057798959 Bacteria 6713499
1381 JGI24740J21852_10001861
1382 JGI24735J21928_10022245
1383 JGI25155J39150_1000017
1384 JGI25155J39150_1001097
1385 JGI25156J39149_1000034
1386 JGI25162J39368_1000073
1387 JGI25162J39368_1000262
1388 JGI25154J39366_1000034
1389 JGI25154J39366_1005657
1390 JGI25154J39366_1005760
1391 JGI25157J39369_1000137
1392 JGI25163J39215_1000380
1393 JGI25164J39214_1000052
1394 JGI25164J39214_1000239
1395 JGI25165J46597_1000137
1396 JGI25165J46597_1000351
1397 JGI25165J46597_1000366
1398 JGI25165J46597_1003810
1399 rootH1_10103289
1400 rootH2_10027258
1401 rootL2_10008082
1402 rootL2_10008608
1403 rootH1_10107069
1404 rootH1_10143638
1405 Ga0055538_1000047
1406 Ga0055539_1000067
1407 Ga0055533_1000077
1408 Ga0055532_1000093
1409 Ga0055525_1000101
1410 Ga0055525_1002127
1411 Ga0055542_1003791
1412 Ga0055536_1000048
1413 Ga0055536_1000745
1414 Ga0055536_1000776
1415 Ga0055530_10000401
1416 Ga0055530_10001462
1417 Ga0055530_10008782
1418 Ga0055540_1000564
1419 Ga0055540_1011205
1420 Ga0055531_10000825
1421 Ga0055531_10009814
1422 Ga0055541_1000048
1423 Ga0065714_10002647
1424 Ga0065714_10006480
1425 Ga0065714_10007683
1426 Ga0065714_10016281
1427 Ga0065714_10075338
1428 Ga0065714_10078317
1429 Ga0065714_10084681
1430 Ga0065714_10087836
1431 Ga0065704_10000713
1432 Ga0065704_10005784
1433 Ga0065704_10110960
1434 Ga0065712_10070331
1435 Ga0070658_10004683
1436 Ga0070690_100046770
1437 Ga0070670_100000394
1438 Ga0070670_100009769
1439 Ga0070660_100000171
1440 Ga0070661_100000106
1441 Ga0070668_100076309
1442 Ga0070669_100001587
1443 Ga0070688_100032569
1444 Ga0070659_100000028
1445 Ga0070663_100001621
1446 Ga0070662_100000532
1447 Ga0070662_100094407
1448 Ga0070706_100098055
1449 Ga0070684_100066657
1450 Ga0070697_100097542
1451 Ga0068853_100014884
1452 Ga0070665_100019171
1453 Ga0070665_100045847
1454 Ga0070665_100285732
1455 Ga0068855_100010177
1456 Ga0070664_100006695
1457 Ga0070664_100039956
1458 Ga0068854_100008963
1459 Ga0068852_100015244
1460 Ga0068851_10000036
1461 Ga0068858_100012442
1462 Ga0068862_100025868
1463 Ga0075365_10015334
1464 Ga0075365_10047671
1465 Ga0075368_10028187
1466 Ga0075363_100020181
1467 Ga0075364_10004890
1468 Ga0075364_10045657
1469 Ga0075364_10055063
1470 Ga0075432_10014775
1471 Ga0075432_10015068
1472 Ga0075432_10019567
1473 Ga0075367_10006333
1474 Ga0075367_10063209
1475 Ga0075369_10003995
1476 Ga0075370_10011113
1477 Ga0075431_100046346
1478 Ga0068865_100016055
1479 Ga0099823_1012610
1480 Ga0079104_1000244
1481 Ga0079104_1000432
1482 Ga0079104_1017120
1483 Ga0105251_10002904
1484 Ga0105251_10003926
1485 Ga0105251_10008444
1486 Ga0105251_10011323
1487 Ga0105244_10004755
1488 Ga0105244_10006270
1489 Ga0105244_10016889
1490 Ga0105244_10024105
1491 Ga0105244_10049022
1492 Ga0105250_10000459
1493 Ga0105250_10003197
1494 Ga0105250_10004391
1495 Ga0105250_10005134
1496 Ga0105250_10015148
1497 Ga0105250_10029162
1498 Ga0105240_10000255
1499 Ga0105240_10000256
1500 Ga0105240_10011407
1501 Ga0105240_10011525
1502 Ga0105240_10044459
1503 Ga0105245_10087058
1504 Ga0105247_10006364
1505 Ga0114129_10085223
1506 Ga0105243_10000808
1507 Ga0105243_10000910
1508 Ga0105243_10097046
1509 Ga0105243_10123575
1510 Ga0105241_10028129
1511 Ga0105242_10000547
1512 Ga0105248_10012821
1513 Ga0105237_10006662
1514 Ga0105237_10013057
1515 Ga0105237_10029717
1516 Ga0105237_10039300
1517 Ga0105238_10017098
1518 Ga0105238_10205138
1519 Ga0105239_10000932
1520 Ga0105239_10003360
1521 Ga0105239_10014404
1522 Ga0105239_10016000
1523 Ga0105239_10043155
1524 Ga0105239_10069581
1525 Ga0105246_10002160
1526 Ga0105246_10061350
1527 Ga0157345_1000109
1528 Ga0157373_10001399
1529 Ga0157373_10002268
1530 Ga0157373_10005118
1531 Ga0157373_10015951
1532 Ga0157373_10022663
1533 Ga0157373_10045315
1534 Ga0157373_10156982
1535 Ga0157371_10001380
1536 Ga0157371_10003050
1537 Ga0157371_10020875
1538 Ga0157371_10058276
1539 Ga0157371_10089665
1540 Ga0157370_10000070
1541 Ga0157370_10007058
1542 Ga0157370_10016668
1543 Ga0157370_10064065
1544 Ga0157370_10109795
1545 Ga0157369_10013332
1546 Ga0157369_10027737
1547 Ga0157369_10028371
1548 Ga0157369_10047573
1549 Ga0157369_10051527
1550 Ga0157369_10053069
1551 Ga0157369_10056516
1552 Ga0157378_10011013
1553 Ga0163162_10003189
1554 Ga0163162_10075602
1555 Ga0163162_10114468
1556 Ga0163162_10137467
1557 Ga0163162_10302758
1558 Ga0157372_10021418
1559 Ga0157375_10006419
1560 Ga0157375_10012360
1561 Ga0157375_10016590
1562 Ga0157375_10138927
1563 Ga0182008_10000593
1564 Ga0182008_10001437
1565 Ga0182008_10001850
1566 Ga0182008_10004969
1567 Ga0182008_10010920
1568 Ga0182008_10010972
1569 Ga0182008_10017510
1570 Ga0182008_10017710
1571 Ga0182008_10020679
1572 Ga0157379_10011341
1573 Ga0157376_10003637
1574 Ga0157376_10066194
1575 Ga0182006_1003011
1576 Ga0182006_1006211
1577 Ga0182006_1008002
1578 Ga0182006_1024370
1579 Ga0182007_10006882
1580 Ga0182007_10016001
1581 Ga0163161_10016315
1582 Ga0163161_10017758
1583 Ga0163161_10018742
1584 Ga0163161_10020038
1585 Ga0163161_10050869
1586 Ga0163161_10101208
1587 Ga0163161_10143095
1588 Ga0209435_100023
1589 Ga0209435_100671
1590 Ga0209760_100090
1591 Ga0209760_100106
1592 Ga0209784_100080
1593 Ga0209566_100096
1594 Ga0209674_100117
1595 Ga0209147_100123
1596 Ga0209563_100114
1597 Ga0209563_100947
1598 Ga0207427_100004
1599 Ga0207427_100007
1600 Ga0209437_100006
1601 Ga0209437_100028
1602 Ga0209437_102874
1603 Ga0209258_100174
1604 Ga0209646_1000080
1605 Ga0209646_1000422
1606 Ga0209026_1000076
1607 Ga0209677_100073
1608 Ga0209677_100272
1609 Ga0209148_1000921
1610 Ga0209759_1000059
1611 Ga0209759_1004309
1612 Ga0209759_1007300
1613 Ga0209233_1000008
1614 Ga0209233_1000086
1615 Ga0209233_1000282
1616 Ga0209233_1000310
1617 Ga0209455_1000150
1618 Ga0209676_1000006
1619 Ga0209676_1000010
1620 Ga0209676_1001133
1621 Ga0209676_1007590
1622 Ga0209564_1025789
1623 Ga0209758_1006795
1624 Ga0209050_1000019
1625 Ga0209050_1000070
1626 Ga0209050_1001703
1627 Ga0209050_1005922
1628 Ga0209051_1000093
1629 Ga0209051_1000146
1630 Ga0209051_1011790
1631 Ga0209257_1000040
1632 Ga0209257_1000303
1633 Ga0207656_10000021
1634 Ga0207696_1000073
1635 Ga0207696_1000246
1636 Ga0207696_1001465
1637 Ga0207696_1005199
1638 Ga0207655_1000005
1639 Ga0207655_1000015
1640 Ga0207655_1000701
1641 Ga0207655_1001021
1642 Ga0207655_1002919
1643 Ga0207655_1006300
1644 Ga0207655_1010879
1645 Ga0207655_1011785
1646 Ga0207655_1011887
1647 Ga0207655_1016207
1648 Ga0207713_1000426
1649 Ga0207713_1000543
1650 Ga0207713_1000600
1651 Ga0207713_1001527
1652 Ga0207713_1005163
1653 Ga0207713_1008166
1654 Ga0207713_1015009
1655 Ga0207713_1018361
1656 Ga0207710_10005346
1657 Ga0207647_10003622
1658 Ga0207647_10004058
1659 Ga0207654_10016121
1660 Ga0207695_10000352
1661 Ga0207695_10001755
1662 Ga0207695_10054008
1663 Ga0207671_10000534
1664 Ga0207671_10000766
1665 Ga0207671_10018516
1666 Ga0207671_10063802
1667 Ga0207657_10000111
1668 Ga0207649_10000006
1669 Ga0207681_10001988
1670 Ga0207681_10003269
1671 Ga0207650_10000188
1672 Ga0207650_10000561
1673 Ga0207687_10059204
1674 Ga0207690_10000009
1675 Ga0207706_10000205
1676 Ga0207706_10008376
1677 Ga0207706_10051537
1678 Ga0207686_10003836
1679 Ga0207709_10000013
1680 Ga0207709_10000586
1681 Ga0207709_10054723
1682 Ga0207711_10101031
1683 Ga0207661_10157182
1684 Ga0207679_10000010
1685 Ga0207667_10003058
1686 Ga0207640_10018604
1687 Ga0207658_10129106
1688 Ga0207703_10014678
1689 Ga0207639_10001976
1690 Ga0207639_10023522
1691 Ga0207639_10134362
1692 Ga0207678_10000347
1693 Ga0207698_10073392
1694 Ga0209281_1000049
1695 Ga0209281_1000202
1696 Ga0209281_1003441
1697 Ga0207428_10016226
1698 Ga0207428_10136292
1699 Ga0268266_10116692
1700 Ga0268265_10116215
1701 Ga0265326_10007166
1702 Ga0265338_10008078
1703 Ga0265338_10034157
1704 Ga0265338_10089674
1705 Ga0307511_10041818
1706 Ga0307511_10044765
1707 Ga0316179_1007569
1708 Ga0316178_1085488
1709 Ga0265330_10009700
1710 Ga0265325_10001901
1711 Ga0265339_10014882
1712 Ga0265331_10011374
1713 Ga0265327_10045761
1714 Ga0307513_10117147
1715 Ga0307509_10088442
1716 Ga0307408_100004523
1717 Ga0307408_100022392
1718 Ga0307408_100027290
1719 Ga0265313_10004543
1720 Ga0307514_10001067
1721 Ga0265314_10005751
1722 Ga0307405_10004895
1723 Ga0307405_10008531
1724 Ga0307405_10036019
1725 Ga0307413_10063951
1726 Ga0307406_10011704
1727 Ga0307412_10002215
1728 Ga0307412_10030858
1729 Ga0307409_100078077
1730 Ga0307409_100081478
1731 Ga0307416_100135158
1732 Ga0307414_10083713
1733 Ga0307411_10029815
1734 Ga0307411_10106522
1735 Ga0307510_10016790
1736 Ga0395900_0002853
1737 Ga0395900_0247148
1738 Ga0395905_0001778
1739 Ga0395905_0014404
1740 Ga0395905_0029858
1741 Ga0395901_0004406
1742 Ga0395901_0017627
1743 Ga0439438_000532
1744 Ga0439438_002698
1745 Ga0439438_002764
1746 Ga0439438_004435
1747 Ga0439438_005714
1748 Ga0439438_009523
1749 Ga0439447_001577
1750 Ga0439447_003653
1751 Ga0439447_003866
1752 Ga0439447_007780
1753 Ga0439466_0002401
1754 Ga0439466_0003005
1755 Ga0439466_0009803
1756 Ga0439466_0013997
1757 Ga0439466_0018978
1758 Ga0439432_001499
1759 Ga0439432_001529
1760 Ga0439432_007275
1761 Ga0439451_000472
1762 Ga0439451_001204
1763 Ga0439452_000732
1764 Ga0439452_000742
1765 Ga0439452_001257
1766 Ga0439452_011606
1767 Ga0439456_000071
1768 Ga0439456_003830
1769 Ga0439463_003557
1770 Ga0450911_000441
1771 Ga0450911_001298
1772 Ga0450911_002186
1773 Ga0450920_000209
1774 Ga0450922_001359
1775 Ga0450890_000618
1776 Ga0450899_001777
1777 Ga0450902_003704
1778 Ga0450904_000950
1779 Ga0450906_001861
1780 Ga0450906_009724
1781 Ga0450907_000015
1782 Ga0450907_000967
1783 Ga0450910_004102
1784 Ga0439446_0002404
1785 Ga0450908_006563
1786 Ga0439434_0000083
1787 Ga0439464_0002942
1788 Ga0439460_0001661
1789 Ga0439460_0003001
1790 Ga0439460_0003519
1791 Ga0439460_0006771
1792 Ga0439440_0004230
1793 Ga0495617_000789
1794 Ga0495617_002785
1795 Ga0495617_007706
1796 Ga0495617_013876
1797 Ga0495617_030650
1798 Ga0495627_002706
1799 Ga0495627_002977
1800 Ga0495627_003608
1801 Ga0495627_007871
1802 Ga0495627_008703
1803 Ga0495592_0025312
1804 Ga0495603_0082583
1805 Ga0495590_0002105
1806 Ga0495590_0002853
1807 Ga0495590_0006100
1808 Ga0495591_001192
1809 Ga0495591_001612
1810 Ga0495591_002052
1811 Ga0495591_002960
1812 Ga0495591_003835
1813 Ga0495591_008863
1814 Ga0495629_0000468
1815 Ga0495638_0006469
1816 Ga0495638_0008707
1817 Ga0495638_0010243
1818 Ga0495638_0015446
1819 Ga0495638_0015799
1820 Ga0495638_0015981
1821 Ga0495638_0016917
1822 Ga0495638_0017845
1823 Ga0495638_0024983
1824 Ga0495638_0040765
1825 Ga0495651_0015068
1826 Ga0495653_0038962
1827 Ga0495653_0048939
1828 Ga0495653_0080965
1829 Ga0495653_0140349
1830 Ga0495650_0003878
1831 Ga0495650_0011538
1832 Ga0495650_0012383
1833 Ga0495650_0029051
1834 Ga0495650_0029907
1835 Ga0495580_0000104
1836 Ga0495580_0009914
1837 Ga0495580_0023254
1838 Ga0495582_0009166
1839 Ga0495605_0001604
1840 Ga0495605_0004544
1841 Ga0495605_0006744
1842 Ga0495605_0011512
1843 Ga0495605_0012216
1844 Ga0495605_0032166
1845 Ga0495605_0049993
1846 Ga0495664_0029390
1847 Ga0495584_0000014
1848 Ga0495584_0001457
1849 Ga0495584_0001756
1850 Ga0495584_0003606
1851 Ga0495584_0004147
1852 Ga0495584_0009081
1853 Ga0495584_0015268
1854 Ga0495585_0000096
1855 Ga0495585_0002384
1856 Ga0495585_0004069
1857 Ga0495585_0011835
1858 Ga0495585_0013169
1859 Ga0495585_0035921
1860 Ga0495585_0040818
1861 Ga0495585_0041493
1862 Ga0495585_0075124
1863 Ga0495594_0043205
1864 Ga0495596_0000888
1865 Ga0495596_0007790
1866 Ga0495596_0017771
1867 Ga0495607_0001972
1868 Ga0495607_0005517
1869 Ga0495607_0006291
1870 Ga0495607_0013220
1871 Ga0495607_0016236
1872 Ga0495607_0042500
1873 Ga0495607_0046195
1874 Ga0495583_0002651
1875 Ga0495583_0005025
1876 Ga0495583_0005187
1877 Ga0495583_0005623
1878 Ga0495583_0012075
1879 Ga0495583_0018753
1880 Ga0495583_0028784
1881 Ga0495583_0028862
1882 Ga0495606_0000027
1883 Ga0495606_0006755
1884 Ga0495606_0007268
1885 Ga0495606_0007963
1886 Ga0495606_0010270
1887 Ga0495606_0028117
1888 Ga0495606_0035116
1889 Ga0495608_0001808
1890 Ga0495610_0006370
1891 Ga0495610_0006603
1892 Ga0495610_0007514
1893 Ga0495610_0009350
1894 Ga0495610_0013412
1895 Ga0495610_0015529
1896 Ga0495610_0016744
1897 Ga0495610_0028596
1898 Ga0495610_0029381
1899 Ga0495610_0044416
1900 Ga0495616_0005526
1901 Ga0495616_0011272
1902 Ga0495616_0011759
1903 Ga0495616_0030044
1904 Ga0495616_0038614
1905 Ga0495618_0005058
1906 Ga0495620_0001983
1907 Ga0495620_0002880
1908 Ga0495620_0010389
1909 Ga0495630_0008000
1910 Ga0495630_0011630
1911 Ga0495630_0021381
1912 Ga0495630_0025431
1913 Ga0495630_0044799
1914 Ga0495631_0000637
1915 Ga0495631_0002437
1916 Ga0495632_0002221
1917 Ga0495632_0006267
1918 Ga0495632_0021428
1919 Ga0495632_0024850
1920 Ga0495632_0037202
1921 Ga0495632_0058981
1922 Ga0495637_0000743
1923 Ga0495637_0004004
1924 Ga0495637_0004169
1925 Ga0495637_0004212
1926 Ga0495637_0010212
1927 Ga0495637_0010627
1928 Ga0495637_0020960
1929 Ga0495637_0023808
1930 Ga0495637_0049704
1931 Ga0495643_0000049
1932 Ga0495643_0005492
1933 Ga0495643_0014948
1934 Ga0495643_0021642
1935 Ga0495644_0002471
1936 Ga0495644_0003748
1937 Ga0495644_0005046
1938 Ga0495648_0006977
1939 Ga0495648_0015406
1940 Ga0495648_0019472
1941 Ga0495648_0024656
1942 Ga0495648_0036025
1943 Ga0495648_0059998
1944 Ga0495648_0062378
1945 Ga0495666_0000354
1946 Ga0495666_0002897
1947 Ga0495642_0000042
1948 Ga0495642_0001043
1949 Ga0495652_0009144
1950 Ga0495654_0001990
1951 Ga0495654_0003418
1952 Ga0495654_0003987
1953 Ga0495654_0004439
1954 Ga0495654_0009995
1955 Ga0495654_0031671
1956 Ga0495654_0044487
1957 Ga0495654_0055840
1958 Ga0495665_0001735
1959 Ga0495665_0022196
1960 Ga0495640_0029250
1961 Ga0495587_0000917
1962 Ga0495587_0018623
1963 Ga0495609_0000928
1964 Ga0495609_0002746
1965 Ga0495609_0008048
1966 Ga0495609_0014589
1967 Ga0495609_0014637
1968 Ga0495609_0027333
1969 Ga0495609_0053390
1970 Ga0495597_0003541
1971 Ga0495597_0008048
1972 Ga0495597_0012096
1973 Ga0495597_0034930
1974 Ga0495597_0037287
1975 Ga0495645_0079895
1976 Ga0495645_0118550
1977 Ga0495622_0009838
1978 Ga0495622_0010541
1979 Ga0495622_0010724
1980 Ga0495622_0025944
1981 Ga0495633_0003512
1982 Ga0495656_0002177
1983 Ga0495656_0041654
1984 Ga0495668_0003061
1985 Ga0495668_0006817
1986 Ga0495668_0010604
1987 Ga0495668_0011931
1988 Ga0495634_0028576
1989 Ga0495611_0001015
1990 Ga0495625_0004213
1991 Ga0495625_0006199
1992 Ga0495625_0010011
1993 Ga0495625_0022102
1994 Ga0495625_0023761
1995 Ga0495625_0049227
1996 Ga0495625_0060201
1997 Ga0495635_0005729
1998 Ga0495659_0006521
1999 Ga0495661_0004628
2000 Ga0495661_0007157
2001 Ga0495661_0018363
2002 Ga0495661_0032986
2003 Ga0495661_0036199
2004 Ga0495661_0039208
2005 Ga0495588_0004345
2006 Ga0495599_0013867
2007 Ga0495623_0003020
2008 Ga0495623_0003593
2009 Ga0495623_0014480
2010 Ga0495646_0023390
2011 Ga0495669_0017315
2012 Ga0495613_0002518
2013 Ga0495613_0077847
2014 Ga0495624_0001358
2015 Ga0495624_0004594
2016 Ga0495624_0014347
2017 Ga0495670_0002154
2018 Ga0495670_0003049
2019 Ga0495670_0003797
2020 Ga0495670_0018969
2021 Ga0495671_0000674
2022 Ga0495671_0001038
2023 Ga0495671_0004372
2024 Ga0495671_0008811
2025 Ga0495671_0010676
2026 Ga0495671_0011679
2027 Ga0495671_0054340
2028 Ga0495649_0000045
2029 Ga0495649_0002119
2030 Ga0495649_0006018
2031 Ga0495649_0009383
2032 Ga0495649_0015440
2033 Ga0495649_0017519
2034 Ga0495649_0017531
2035 Ga0495649_0027591
2036 Ga0495649_0032641
2037 Ga0495649_0042760
2038 Ga0495649_0063407
2039 Ga0495589_0000710
2040 Ga0495589_0001216
2041 Ga0495589_0003242
2042 Ga0495589_0004730
2043 Ga0495589_0005288
2044 Ga0495589_0008364
2045 Ga0495589_0016286
2046 Ga0495589_0023075
2047 Ga0495589_0029829
2048 Ga0495600_0000760
2049 Ga0495600_0042489
2050 Ga0495600_0103663
2051 Ga0495660_0012476
2052 Ga0495660_0032381
2053 Ga0495660_0055094
2054 Ga0495660_0060371
2055 Ga0495660_0086910
2056 Ga0495604_0055479
2057 Ga0495636_0009555
2058 Ga0495674_0007043
2059 Ga0495674_0010312
2060 Ga0495674_0022078
2061 Ga0495674_0032782
2062 Ga0495672_0000491
2063 Ga0495672_0006898
2064 Ga0495672_0010295
2065 Ga0495672_0010675
2066 Ga0495672_0012049
2067 Ga0495672_0012889
2068 Ga0495672_0014480
2069 Ga0495672_0014869
2070 Ga0495672_0040857
2071 Ga0495672_0042516
2072 Ga0495676_0021737
2073 Ga0495676_0047502
2074 Ga0495680_0022594
2075 Ga0495680_0024779
2076 Ga0495680_0045732
2077 Ga0495680_0088625
2078 Ga0495680_0113934
2079 Ga0495683_0001300
2080 Ga0495683_0001396
2081 Ga0495683_0004230
2082 Ga0495683_0005000
2083 Ga0495683_0010755
2084 Ga0495683_0016072
2085 Ga0495683_0070842
2086 Ga0495687_000391
2087 Ga0495687_002043
2088 Ga0495687_005506
2089 Ga0495687_005781
2090 Ga0495675_0001615
2091 Ga0495677_0015881
2092 Ga0495679_000099
2093 Ga0495679_004021
2094 Ga0495679_007433
2095 Ga0495679_007460
2096 Ga0495679_025500
2097 Ga0495673_0000138
2098 Ga0495673_0001881
2099 Ga0495673_0003310
2100 Ga0495673_0005487
2101 Ga0495673_0011480
2102 Ga0495673_0012351
2103 Ga0495673_0012998
2104 Ga0495673_0021585
2105 Ga0495673_0022476
2106 Ga0495673_0023859
2107 Ga0495673_0046515
2108 Ga0495673_0082830
2109 Ga0495681_0001868
2110 Ga0495681_0002951
2111 Ga0495681_0003683
2112 Ga0495681_0004182
2113 Ga0495681_0008619
2114 Ga0495681_0009879
2115 Ga0495681_0011262
2116 Ga0495681_0011768
2117 Ga0495681_0013301
2118 Ga0495681_0016467
2119 Ga0495681_0019611
2120 Ga0495681_0028480
2121 Ga0495681_0028807
2122 Ga0495684_0027096
2123 Ga0495686_0003876
2124 Ga0495686_0005847
2125 Ga0495686_0035291
2126 Ga0495593_0000669
2127 Ga0495593_0061855
2128 Ga0495602_0003358
2129 Ga0495602_0016506
2130 Ga0495602_0024407
2131 Ga0495614_0000359
2132 Ga0495626_0001033
2133 Ga0495626_0001736
2134 Ga0495626_0006717
2135 Ga0495626_0008794
2136 Ga0495626_0009686
2137 Ga0496100_0000804
2138 Ga0496100_0004424
2139 Ga0496100_0136633
2140 Ga0496101_0007867
2141 Ga0496102_0001622
2142 Ga0496103_0010728
2143 Ga0496103_0106475
2144 Ga0496104_0005909
2145 Ga0496104_0227007
2146 Ga0496105_0019530
2147 Ga0496106_0000114
2148 Ga0496106_0008022
2149 Ga0496107_0001207
2150 Ga0496108_0042541
2151 Ga0496112_0131925
2152 Ga0496113_0133324
2153 Ga0496114_0004038
2154 Ga0496115_0026149
2155 Ga0496115_0080871
2156 Ga0496116_0000399
2157 Ga0496116_0000810
2158 Ga0496116_0004905
2159 Ga0496116_0007180
2160 Ga0496116_0042753
2161 Ga0496117_0002593
2162 Ga0496117_0003951
2163 Ga0496117_0008920
2164 Ga0496117_0010763
2165 Ga0496117_0018404
2166 Ga0496118_0006873
2167 Ga0496118_0009751
2168 Ga0496118_0018912
2169 Ga0496118_0019180
2170 Ga0496118_0021107
2171 Ga0496118_0054205
2172 Ga0496118_0105790
2173 Ga0496118_0105878
2174 Ga0496119_0007808
2175 Ga0496119_0008144
2176 Ga0496119_0009601
2177 Ga0496119_0030671
2178 Ga0496120_0000931
2179 Ga0496120_0003224
2180 Ga0496121_0000691
2181 Ga0496121_0004080
2182 Ga0496121_0014819
2183 Ga0496121_0029335
2184 Ga0496121_0035167
2185 Ga0496121_0037360
2186 Ga0496121_0056868
2187 Ga0496121_0062868
2188 Ga0496122_0000505
2189 Ga0496122_0001469
2190 Ga0496122_0003049
2191 Ga0496122_0004296
2192 Ga0496122_0024973
2193 Ga0496122_0032638
2194 Ga0496122_0044116
2195 Ga0496122_0047433
2196 Ga0496123_0000400
2197 Ga0496123_0000971
2198 Ga0496123_0002513
2199 Ga0496123_0008313
2200 Ga0496123_0009181
2201 Ga0496124_0005167
2202 Ga0496124_0009488
2203 Ga0496124_0024513
2204 Ga0496124_0033527
2205 Ga0496124_0033716
2206 Ga0496124_0092685
2207 Ga0496124_0127912
2208 Ga0496124_0153785
2209 Ga0496125_0001896
2210 Ga0496125_0005264
2211 Ga0496125_0017090
2212 Ga0496125_0027457
2213 Ga0496125_0065760
2214 Ga0496125_0124077
2215 Ga0496125_0136853
2216 Ga0496126_0033065
2217 Ga0496126_0184061
2218 Ga0496126_0218023
2219 Ga0495678_004490
2220 Ga0495678_006097
2221 Ga0495678_009727
2222 Ga0495678_012376
2223 Ga0495678_012409
2224 Ga0495678_013969
2225 Ga0495682_0003906
2226 Ga0495682_0004603
2227 Ga0495682_0005731
2228 Ga0495682_0014099
2229 Ga0501031_0000010
2230 Ga0501031_0006499
2231 Ga0501031_0075269
2232 Ga0501032_0000023
2233 Ga0501032_0001104
2234 Ga0501032_0057249
2235 Ga0501033_0000104
2236 Ga0501033_0001424
2237 Ga0501033_0020261
2238 Ga0501033_0077708
2239 Ga0501033_0098443
2240 Ga0501034_0000116
2241 Ga0501034_0061943
2242 Ga0501036_0000015
2243 Ga0501036_0001104
2244 Ga0501036_0025512
2245 Ga0501036_0134265
2246 Ga0501037_0000023
2247 Ga0501037_0023642
2248 Ga0501038_0000025
2249 Ga0501038_0035235
2250 Ga0501038_0055071
2251 Ga0501038_0057467
2252 Ga0501039_0000037
2253 Ga0501039_0072647
2254 Ga0501040_0005598
2255 Ga0501043_0000070
2256 Ga0501043_0006747
2257 Ga0501047_0001244
2258 Ga0501047_0002705
2259 Ga0501067_0057993
2260 Ga0501070_0067260
2261 Ga0501076_0110937
2262 Ga0501083_0011128
2263 Ga0501035_0000074
2264 Ga0501035_0003834
2265 Ga0501035_0025760
2266 Ga0501035_0028382
2267 Ga0501044_0000069
2268 Ga0501044_0002371
2269 Ga0501044_0037706
2270 nmdc:mga03n38_4231_c2
2271 nmdc:mga00v17_99760_c1
2272 nmdc:mga0yw44_85201_c1
2273 nmdc:mga06z11_17879_c1
2274 nmdc:mga07m45_2758_c1
2275 nmdc:mga06r32_15033_c1
2276 nmdc:mga0sz30_18129_c1
2277 Ga0500647_0001267
2278 Ga0500647_0002844
2279 Ga0500608_006037
2280 Ga0500618_000529
2281 Ga0500618_000872
2282 Ga0500642_0001809
2283 Ga0500658_0019773
2284 Ga0500564_002158
2285 Ga0500634_0007749
2286 Ga0500638_000044
2287 Ga0500636_0000373
2288 Ga0501082_0100338
2289 Ga0501082_0118143
2290 Ga0530510_0070798
2291 2888340291
2292 2501075475
2293 2501410816
2294 2511096725
2295 2511102646
2296 2511256488
2297 2511256489
2298 2511265803
2299 2511265804
2300 2511280955
2301 2511280956
2302 2511287949
2303 2511287950
2304 2511298520
2305 2511298521
2306 2511301589
2307 2511301590
2308 2511314219
2309 2511314220
2310 2511319034
2311 2511319035
2312 2511323817
2313 2511323818
2314 2511332966
2315 2511332967
2316 2511337785
2317 2511337786
2318 2511343541
2319 2511343542
2320 2511348824
2321 2511348825
2322 2511355871
2323 2511363821
2324 2511363822
2325 2511371710
2326 2511371711
2327 2511375196
2328 2511410584
2329 2511410585
2330 2511823258
2331 2512327464
2332 2512327465
2333 2513613800
2334 2514052024
2335 2514417995
2336 2517566855
2337 2524454219
2338 2527076467
2339 2555246832
2340 2555246833
2341 2555671652
2342 2555671653
2343 2583794129
2344 2583794130
2345 2585276546
2346 2585283423
2347 2585329104
2348 2585333303
2349 2585537145
2350 2585557051
2351 2585900914
2352 2588518034
2353 2597859721
2354 2597859722
2355 2597865636
2356 2597865637
2357 2597871445
2358 2597871446
2359 2599354193
2360 2599354194
2361 2599360129
2362 2599360130
2363 2599366451
2364 2599366452
2365 2599373241
2366 2599373242
2367 2599379301
2368 2599379302
2369 2599385720
2370 2599385721
2371 2599392100
2372 2599392101
2373 2599399988
2374 2599399989
2375 2599403866
2376 2599403867
2377 2599452808
2378 2599452809
2379 2599461027
2380 2599461028
2381 2599469569
2382 2599469570
2383 2599482550
2384 2599482551
2385 2599490047
2386 2599490048
2387 2599510128
2388 2599510129
2389 2599514442
2390 2599514443
2391 2599520663
2392 2599520664
2393 2599614925
2394 2599770547
2395 2599803728
2396 2599803729
2397 2599882038
2398 2599882039
2399 2599886432
2400 2599893818
2401 2599893819
2402 2599896797
2403 2599944229
2404 2599946209
2405 2599950064
2406 2599950065
2407 2599954701
2408 2599957198
2409 2599959668
2410 2599969763
2411 2599981284
2412 2599996455
2413 2600006517
2414 2600015091
2415 2600016862
2416 2600024103
2417 2600031127
2418 2600035286
2419 2600042739
2420 2600053757
2421 2600058237
2422 2600064086
2423 2600072913
2424 2600078533
2425 2600213641
2426 2600213642
2427 2600360184
2428 2600364623
2429 2600364624
2430 2600445693
2431 2601692909
2432 2601692910
2433 2601773809
2434 2601773810
2435 2601796655
2436 2601796656
2437 2602012606
2438 2606073805
2439 2606073806
2440 2606126549
2441 2606126550
2442 2616312559
2443 2621297881
2444 2621297882
2445 2624482356
2446 2624482357
2447 2643772645
2448 2643841370
2449 2643873775
2450 2643873776
2451 2643955154
2452 2643955155
2453 2643988291
2454 2644023509
2455 2644023510
2456 2644132282
2457 2644156994
2458 2644202713
2459 2644207730
2460 2644282339
2461 2644624920
2462 2644624921
2463 2644651819
2464 2652546850
2465 2671092153
2466 2671096773
2467 2671096774
2468 2671116279
2469 2671127626
2470 2671770703
2471 2671770704
2472 2677897816
2473 2677897817
2474 2678261804
2475 2678261805
2476 2694631731
2477 2694638027
2478 2715750355
2479 2715750356
2480 2715755253
2481 2715755254
2482 2718635535
2483 2718635536
2484 2723250360
2485 2723250361
2486 2723578411
2487 2738670765
2488 2738670766
2489 2738749158
2490 2738749159
2491 2738811644
2492 2738811645
2493 2738858200
2494 2738858201
2495 2738899004
2496 2738899005
2497 2739196746
2498 2739257722
2499 2739257723
2500 2739287604
2501 2739292917
2502 2739313413
2503 2739313414
2504 2743739271
2505 2743739272
2506 2745008153
2507 2745008154
2508 2756677897
2509 2774133238
2510 2774133239
2511 2784262899
2512 2784262900
2513 2792629386
2514 2794594618
2515 2807409965
2516 2807409966
2517 2807458312
2518 2807458313
2519 2808856413
2520 2808931371
2521 2808936439
2522 2808953493
2523 2808958701
2524 2808964860
2525 2808979613
2526 2808979614
2527 2808995116
2528 2808995117
2529 2808999752
2530 2809219426
2531 2809219427
2532 2817492983
2533 2817492984
2534 2819642438
2535 2819656031
2536 2819656032
2537 2819701866
2538 2819701867
2539 2823424071
2540 2825653471
2541 2825653472
2542 2834031410
2543 2834031411
2544 2842805875
2545 2842832127
2546 2842832128
2547 2842837211
2548 2842837212
2549 2842840720
2550 2842840721
2551 2842845008
2552 2842845009
2553 2842857024
2554 2844004905
2555 2844672175
2556 2844672176
2557 2846958398
2558 2852612625
2559 2852612626
2560 2852660902
2561 2852660903
2562 2852669638
2563 2852669639
2564 2854915469
2565 2856343043
2566 2856363564
2567 2857354093
2568 2857366033
2569 2860341210
2570 2860872069
2571 2860872070
2572 2869162967
2573 2871471149
2574 2871492319
2575 2874128032
2576 2878034280
2577 2878034281
2578 2878759667
2579 2878785400
2580 2880234908
2581 2880234909
2582 2881849472
2583 2881865749
2584 2882912578
2585 2883091307
2586 2883357702
2587 2885308167
2588 2885316169
2589 2885322230
2590 2885328914
2591 2885334511
2592 2888352029
2593 2889014015
2594 2889021278
2595 2903496950
2596 2904522239
2597 2904522240
2598 2904553764
2599 2904553765
2600 2906328780
2601 2906360606
2602 2906383954
2603 2908451571
2604 2908451572
2605 2912964815
2606 2912964816
2607 2917075522
2608 2917075523
2609 2919066656
2610 2919066657
2611 2919388357
2612 2919388358
2613 2919459303
2614 2919459304
2615 2919483062
2616 2919493150
2617 2919493151
2618 2919493277
2619 2919503768
2620 2919543103
2621 2922136041
2622 2922155266
2623 2922190737
2624 2923158354
2625 2923158355
2626 2923528333
2627 2923590725
2628 2924734129
2629 2924785334
2630 2926065660
2631 2926760170
2632 2928158953
2633 2928167774
2634 2928525649
2635 2929145597
2636 2929194145
2637 2929194146
2638 2931371071
2639 2931395460
2640 2931395461
2641 2931396945
2642 2935356508
2643 2935356509
2644 2937849078
2645 2938019213
2646 2939637209
2647 2939637210
2648 2939652316
2649 2939652317
2650 2945931868
2651 2945931869
2652 2945965557
2653 2945965558
2654 2946007964
2655 2946007965
2656 2946032658
2657 2946032659
2658 2947233421
2659 2947233422
2660 2958106355
2661 2958176412
2662 2961173607
2663 2965116277
2664 2965121266
2665 2968005797
2666 2968120368
2667 2969309063
2668 2969309064
2669 2970495966
2670 2970506199
2671 2970543484
2672 2974289568
2673 2974289569
2674 2977828189
2675 2977834685
2676 2977923144
2677 2977949754
2678 2977973135
2679 2977992622
2680 2979714350
2681 2979745227
2682 2979810921
2683 2984287835
2684 2984287836
2685 2987642497
2686 2987653946
2687 2987680064
2688 2989351348
2689 2989774530
2690 2990710567
2691 2998144346
2692 2998144347
2693 3004210578
2694 3004211626
2695 3004218873
2696 3004272269
2697 3005419017
2698 3007397644
2699 3007397645
2700 3007420854
2701 3007516128
2702 3007516129
2703 3007615354
2704 3007620381
2705 3007620382
2706 3007720065
2707 3007720066
2708 3007858670
2709 3007858671
2710 3007865801
2711 3007865802
2712 637321970
2713 637321971
2714 642425049
2715 642592868
2716 8004381169
2717 8005320800
2718 8005645550
2719 8005685606
2720 8015692430
2721 8015692431
2722 8019773895
2723 8019773896
2724 8029996532
2725 8029996533
2726 8034965942
2727 8054285206
2728 8054285207
2729 8054351284
2730 8054351285
2731 8054507961
2732 8054507962
2733 8054934464
2734 8055775650
2735 8055775651
2736 8055822930
2737 8055822931
2738 8055883333
2739 8055883334
2740 8056120324
2741 8056121842
2742 8056130637
2743 8056130638
2744 8056136330
2745 8056136331
2746 8056147676
2747 8056153647
2748 8056153648
2749 8056155328
2750 8056155329
2751 8056162588
2752 8056162589
2753 8056166915
2754 8056166916
2755 8056172900
2756 8056172901
2757 8056183252
2758 8056572420
2759 8057804509
2760 8057804510

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13520

AA_permease_2

Amino acid permease

63

519

0.87

PF00324

AA_permease

Amino acid permease

67

524

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l1l-assembly1.cif.gz_A-2 structure of arg-bound escherichia coli adic 0.8697 20 459
3ob6-assembly1.cif.gz_A structure of adic(n101a) in the open-to-out arg+ bound conformation 0.8661 18 459
5j4i-assembly1.cif.gz_A crystal structure of the l-arginine/agmatine antiporter from e. coli at 2.2 angstroem resolution 0.8616 19 459
3l1l-assembly1.cif.gz_A-2 structure of arg-bound escherichia coli adic 0.8582 20 459
3ncy-assembly2.cif.gz_D x-ray crystal structure of an arginine agmatine antiporter (adic) in complex with a fab fragment 0.8576 21 459
ID Description Score Start End Superfamily
af_P0AAE5_1_447_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9226 18 467 1.20.1740.10
af_P0AAE5_1_447_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9147 18 467 1.20.1740.10
af_Q2FUX9_6_464_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8834 19 475 1.20.1740.10
af_Q2FUX9_6_464_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.878 19 475 1.20.1740.10
af_Q2FYJ4_6_440_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8655 18 454 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A369P457-F1-model_v4 deleted 0.9258 221 486
AF-A0A806PRT7-F1-model_v4 deleted 0.9252 18 485
AF-A0A157PLT9-F1-model_v4 Arginine/ornithine antiporter 0.9168 36 486 GO:0005886
GO:0006865
GO:0022857
AF-A0A369P457-F1-model_v4 deleted 0.9157 221 486
AF-A0A260SH09-F1-model_v4 Arginine-ornithine antiporter 0.9105 17 485 GO:0005886
GO:0006865
GO:0022857

Map