F494480
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1512 | 670 | 2760 | 473 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2888337043|2888340291 |
| Length | 530 |
| Sequence | PETGTPTPLFLFSNRLLTRIKAVSPVFLSIASHQSLQIGESIMTTADFNIPVPKVTTAAPTKLRLGSLTALVIGSMVGSGVFSLPQNMAAGAGPLAILIGWAITAVGMLALVFVYQSLATRKPELDAGPYAYAKAGFGPFIGFTSAWGYWISAWVGNVSYAVIVFSALSYFFPSFGDGNTWQAVLGASILLWLIHVLVLAGIRQAAIVNLIVTVAKIAPIVLFVGVVAVAFKLQVWSLDFTGLGNASLGSITAQVKSTMLVTLWVFIGIEGASVFSGRAERRKDIAMATVLGFVTCLALYALVSLLSLGILSQPELAALKNPSMAGVLEAVVGPWGAILINVALVVSVVGAFLSWTLLAAEIPHVAAKDGTMPKFFGHESSRGVPSTSLLITNLLVQAFLVITLFAQSTYQALFYIASAAILVPYIFSGAYAAKLALTGESYASGEQRAGPLFAGLLATVYGLWLVYAAGPAYLFMCAILYAPGIIFYIWARRETDQRVFHTAEAALAGTLIAVAILAVYEMWTGAISPL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 63 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 64 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 146 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 150 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 152 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 153 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 154 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 156 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 159 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 160 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 164 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 171 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 174 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 178 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 179 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 180 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 181 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 182 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 183 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 184 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 185 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 186 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 187 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 188 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 189 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 190 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 191 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 192 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 193 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 194 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 195 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 196 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 197 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 198 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 199 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 200 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 201 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 297 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 298 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 299 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 300 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 301 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 302 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 303 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 304 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 305 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 306 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 307 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 308 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 309 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 310 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 311 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 331 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 332 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 333 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 335 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 337 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 338 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 339 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 341 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 344 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 345 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 346 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 348 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 349 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 350 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 351 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 352 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 353 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 354 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 355 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 356 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 357 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 358 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 359 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 360 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 361 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 362 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 363 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 364 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 365 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 366 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 367 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 368 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 369 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 370 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 371 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 372 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 373 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 374 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 375 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 376 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 377 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 378 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 379 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 380 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 381 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 382 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 383 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 384 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 385 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 386 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 387 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 388 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 389 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 390 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 391 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 392 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 393 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 394 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 395 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 396 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 397 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 398 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 399 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 400 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 401 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 402 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 403 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 404 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 405 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 406 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 407 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 408 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 409 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 410 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 411 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 412 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 413 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 414 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 415 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 416 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 417 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 418 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 419 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 420 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 421 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 422 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 423 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 424 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 425 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 426 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 427 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 428 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 429 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 430 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 431 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 432 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 433 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 434 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 435 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 436 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 437 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 438 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 439 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 440 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 441 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 442 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 443 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 444 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 445 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 446 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 447 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 448 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 449 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 450 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 451 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 452 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 453 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 454 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 455 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 456 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 457 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 458 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 459 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 460 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 461 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 462 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 463 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 464 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 465 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 466 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 467 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 468 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 469 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 470 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 471 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 472 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 473 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 474 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 475 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 476 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 477 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 478 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 479 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 480 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 481 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 482 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 483 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 484 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 485 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 486 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 487 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 488 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 489 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 490 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 491 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 492 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 493 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 494 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 495 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 496 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 497 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 498 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 499 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 500 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 501 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 502 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 503 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 504 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 505 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 506 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 507 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 508 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 509 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 510 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 511 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 512 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 513 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 514 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 515 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 516 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 517 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 518 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 519 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 520 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 521 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 522 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 523 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 524 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 525 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 526 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 527 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 528 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 529 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 530 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 531 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 532 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 533 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 534 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 535 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 536 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 537 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 538 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 539 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 540 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 541 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 542 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 543 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 544 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 545 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 546 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 547 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 548 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 549 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 550 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 551 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 552 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 553 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 554 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 555 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 556 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 557 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 558 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 559 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 560 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 561 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 562 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 563 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 564 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 565 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 566 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 567 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 568 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 569 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 570 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 571 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 572 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 573 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 574 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 575 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 576 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 577 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 578 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 579 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 580 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 581 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 582 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 583 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 584 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 585 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 586 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 587 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 588 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 589 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 590 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 591 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 592 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 593 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 594 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 595 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 596 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 597 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 598 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 599 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 600 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 601 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 602 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 603 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 604 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 605 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 606 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 607 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 608 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 609 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 610 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 611 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 612 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 613 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 614 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 615 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 616 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 617 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 618 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 619 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 620 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 621 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 622 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 623 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 624 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 625 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 626 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 627 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 628 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 629 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 630 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 631 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 632 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 633 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 634 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 635 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 636 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 637 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 638 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 639 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 640 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 641 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 642 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 643 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 644 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 645 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 646 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 647 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 648 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 649 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 650 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 651 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 652 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 653 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 654 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 655 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 656 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 657 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 658 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 659 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 660 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 661 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 662 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 663 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 664 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 665 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 666 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 667 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 668 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 669 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 670 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 68.92 |
| Metatranscriptomes | 0 |
| Isolates | 31.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.47 |
| Nodule | 7.34 |
| Rhizoplane | 7.47 |
| Rhizosphere | 62.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001861 | 3300001979 | Bacteria | 9657 |
| 2 | JGI24735J21928_10022245 | 3300002067 | Bacteria | 1932 |
| 3 | JGI25155J39150_1000017 | 3300002704 | Bacteria | 159274 |
| 4 | JGI25155J39150_1001097 | 3300002704 | Bacteria | 2694 |
| 5 | JGI25156J39149_1000034 | 3300002705 | Bacteria | 114036 |
| 6 | JGI25162J39368_1000073 | 3300002737 | Bacteria | 121835 |
| 7 | JGI25162J39368_1000262 | 3300002737 | Bacteria | 50465 |
| 8 | JGI25154J39366_1000034 | 3300002738 | Bacteria | 176764 |
| 9 | JGI25154J39366_1005657 | 3300002738 | Bacteria | 1954 |
| 10 | JGI25154J39366_1005760 | 3300002738 | Bacteria | 1919 |
| 11 | JGI25157J39369_1000137 | 3300002741 | Bacteria | 61333 |
| 12 | JGI25163J39215_1000380 | 3300002771 | Bacteria | 14288 |
| 13 | JGI25164J39214_1000052 | 3300002772 | Bacteria | 121835 |
| 14 | JGI25164J39214_1000239 | 3300002772 | Bacteria | 41919 |
| 15 | JGI25165J46597_1000137 | 3300003214 | Bacteria | 121835 |
| 16 | JGI25165J46597_1000351 | 3300003214 | Bacteria | 52020 |
| 17 | JGI25165J46597_1000366 | 3300003214 | Bacteria | 50465 |
| 18 | JGI25165J46597_1003810 | 3300003214 | Bacteria | 3530 |
| 19 | rootH1_10103289 | 3300003316 | Bacteria | 5411 |
| 20 | rootH2_10027258 | 3300003320 | Bacteria | 13268 |
| 21 | rootL2_10008082 | 3300003322 | Bacteria | 60006 |
| 22 | rootL2_10008608 | 3300003322 | Bacteria | 32925 |
| 23 | rootH1_10107069 | 3300003323 | Bacteria | 7677 |
| 24 | rootH1_10143638 | 3300003323 | Bacteria | 3965 |
| 25 | Ga0055538_1000047 | 3300003751 | Bacteria | 135637 |
| 26 | Ga0055539_1000067 | 3300003752 | Bacteria | 135637 |
| 27 | Ga0055533_1000077 | 3300003756 | Bacteria | 135637 |
| 28 | Ga0055532_1000093 | 3300003758 | Bacteria | 103005 |
| 29 | Ga0055525_1000101 | 3300003759 | Bacteria | 135637 |
| 30 | Ga0055525_1002127 | 3300003759 | Bacteria | 2290 |
| 31 | Ga0055542_1003791 | 3300003762 | Bacteria | 3930 |
| 32 | Ga0055536_1000048 | 3300003781 | Bacteria | 115094 |
| 33 | Ga0055536_1000745 | 3300003781 | Bacteria | 21784 |
| 34 | Ga0055536_1000776 | 3300003781 | Bacteria | 21283 |
| 35 | Ga0055530_10000401 | 3300003791 | Bacteria | 38836 |
| 36 | Ga0055530_10001462 | 3300003791 | Bacteria | 17200 |
| 37 | Ga0055530_10008782 | 3300003791 | Bacteria | 3990 |
| 38 | Ga0055540_1000564 | 3300003792 | Bacteria | 27281 |
| 39 | Ga0055540_1011205 | 3300003792 | Bacteria | 2912 |
| 40 | Ga0055531_10000825 | 3300003794 | Bacteria | 25638 |
| 41 | Ga0055531_10009814 | 3300003794 | Bacteria | 4851 |
| 42 | Ga0055541_1000048 | 3300003841 | Bacteria | 135637 |
| 43 | Ga0065714_10002647 | 3300005288 | Bacteria | 26348 |
| 44 | Ga0065714_10006480 | 3300005288 | Bacteria | 7273 |
| 45 | Ga0065714_10007683 | 3300005288 | Bacteria | 4453 |
| 46 | Ga0065714_10016281 | 3300005288 | Bacteria | 2873 |
| 47 | Ga0065714_10075338 | 3300005288 | Bacteria | 2915 |
| 48 | Ga0065714_10078317 | 3300005288 | Bacteria | 2603 |
| 49 | Ga0065714_10084681 | 3300005288 | Bacteria | 2185 |
| 50 | Ga0065714_10087836 | 3300005288 | Bacteria | 2010 |
| 51 | Ga0065704_10000713 | 3300005289 | Bacteria | 18379 |
| 52 | Ga0065704_10005784 | 3300005289 | Bacteria | 3890 |
| 53 | Ga0065704_10110960 | 3300005289 | Bacteria | 1969 |
| 54 | Ga0065712_10070331 | 3300005290 | Bacteria | 6105 |
| 55 | Ga0070658_10004683 | 3300005327 | Bacteria | 11124 |
| 56 | Ga0070690_100046770 | 3300005330 | Bacteria | 2752 |
| 57 | Ga0070670_100000394 | 3300005331 | Bacteria | 36051 |
| 58 | Ga0070670_100009769 | 3300005331 | Bacteria | 8193 |
| 59 | Ga0070660_100000171 | 3300005339 | Bacteria | 42584 |
| 60 | Ga0070661_100000106 | 3300005344 | Bacteria | 69221 |
| 61 | Ga0070668_100076309 | 3300005347 | Bacteria | 2617 |
| 62 | Ga0070669_100001587 | 3300005353 | Bacteria | 16435 |
| 63 | Ga0070688_100032569 | 3300005365 | Bacteria | 3144 |
| 64 | Ga0070659_100000028 | 3300005366 | Bacteria | 140665 |
| 65 | Ga0070663_100001621 | 3300005455 | Bacteria | 12413 |
| 66 | Ga0070662_100000532 | 3300005457 | Bacteria | 23041 |
| 67 | Ga0070662_100094407 | 3300005457 | Bacteria | 2252 |
| 68 | Ga0070706_100098055 | 3300005467 | Bacteria | 2723 |
| 69 | Ga0070684_100066657 | 3300005535 | Bacteria | 3160 |
| 70 | Ga0070697_100097542 | 3300005536 | Bacteria | 2439 |
| 71 | Ga0068853_100014884 | 3300005539 | Bacteria | 6388 |
| 72 | Ga0070665_100019171 | 3300005548 | Bacteria | 6864 |
| 73 | Ga0070665_100045847 | 3300005548 | Bacteria | 4391 |
| 74 | Ga0070665_100285732 | 3300005548 | Bacteria | 1652 |
| 75 | Ga0068855_100010177 | 3300005563 | Bacteria | 11335 |
| 76 | Ga0070664_100006695 | 3300005564 | Bacteria | 9290 |
| 77 | Ga0070664_100039956 | 3300005564 | Bacteria | 3955 |
| 78 | Ga0068854_100008963 | 3300005578 | Bacteria | 6445 |
| 79 | Ga0068852_100015244 | 3300005616 | Bacteria | 5952 |
| 80 | Ga0068851_10000036 | 3300005834 | Bacteria | 105179 |
| 81 | Ga0068858_100012442 | 3300005842 | Bacteria | 8023 |
| 82 | Ga0068862_100025868 | 3300005844 | Bacteria | 4930 |
| 83 | Ga0075365_10015334 | 3300006038 | Bacteria | 4634 |
| 84 | Ga0075365_10047671 | 3300006038 | Bacteria | 2817 |
| 85 | Ga0075368_10028187 | 3300006042 | Bacteria | 2169 |
| 86 | Ga0075363_100020181 | 3300006048 | Bacteria | 3340 |
| 87 | Ga0075364_10004890 | 3300006051 | Bacteria | 7764 |
| 88 | Ga0075364_10045657 | 3300006051 | Bacteria | 2851 |
| 89 | Ga0075364_10055063 | 3300006051 | Bacteria | 2603 |
| 90 | Ga0075432_10014775 | 3300006058 | Bacteria | 2659 |
| 91 | Ga0075432_10015068 | 3300006058 | Bacteria | 2634 |
| 92 | Ga0075432_10019567 | 3300006058 | Bacteria | 2314 |
| 93 | Ga0075367_10006333 | 3300006178 | Bacteria | 5969 |
| 94 | Ga0075367_10063209 | 3300006178 | Bacteria | 2212 |
| 95 | Ga0075369_10003995 | 3300006186 | Bacteria | 5414 |
| 96 | Ga0075370_10011113 | 3300006353 | Bacteria | 4721 |
| 97 | Ga0075431_100046346 | 3300006847 | Bacteria | 4483 |
| 98 | Ga0068865_100016055 | 3300006881 | Bacteria | 4784 |
| 99 | Ga0099823_1012610 | 3300006944 | Bacteria | 8539 |
| 100 | Ga0079104_1000244 | 3300006946 | Bacteria | 72608 |
| 101 | Ga0079104_1000432 | 3300006946 | Bacteria | 47752 |
| 102 | Ga0079104_1017120 | 3300006946 | Bacteria | 2093 |
| 103 | Ga0105251_10002904 | 3300009011 | Bacteria | 12876 |
| 104 | Ga0105251_10003926 | 3300009011 | Bacteria | 10556 |
| 105 | Ga0105251_10008444 | 3300009011 | Bacteria | 6198 |
| 106 | Ga0105251_10011323 | 3300009011 | Bacteria | 5103 |
| 107 | Ga0105244_10004755 | 3300009036 | Bacteria | 9243 |
| 108 | Ga0105244_10006270 | 3300009036 | Bacteria | 7742 |
| 109 | Ga0105244_10016889 | 3300009036 | Bacteria | 4144 |
| 110 | Ga0105244_10024105 | 3300009036 | Bacteria | 3325 |
| 111 | Ga0105244_10049022 | 3300009036 | Bacteria | 2160 |
| 112 | Ga0105250_10000459 | 3300009092 | Bacteria | 29275 |
| 113 | Ga0105250_10003197 | 3300009092 | Bacteria | 7833 |
| 114 | Ga0105250_10004391 | 3300009092 | Bacteria | 6499 |
| 115 | Ga0105250_10005134 | 3300009092 | Bacteria | 5916 |
| 116 | Ga0105250_10015148 | 3300009092 | Bacteria | 3158 |
| 117 | Ga0105250_10029162 | 3300009092 | Bacteria | 2221 |
| 118 | Ga0105240_10000255 | 3300009093 | Bacteria | 105565 |
| 119 | Ga0105240_10000256 | 3300009093 | Bacteria | 105227 |
| 120 | Ga0105240_10011407 | 3300009093 | Bacteria | 12377 |
| 121 | Ga0105240_10011525 | 3300009093 | Bacteria | 12305 |
| 122 | Ga0105240_10044459 | 3300009093 | Bacteria | 5643 |
| 123 | Ga0105245_10087058 | 3300009098 | Bacteria | 2867 |
| 124 | Ga0105247_10006364 | 3300009101 | Bacteria | 7313 |
| 125 | Ga0114129_10085223 | 3300009147 | Bacteria | 4383 |
| 126 | Ga0105243_10000808 | 3300009148 | Bacteria | 29810 |
| 127 | Ga0105243_10000910 | 3300009148 | Bacteria | 27751 |
| 128 | Ga0105243_10097046 | 3300009148 | Bacteria | 2439 |
| 129 | Ga0105243_10123575 | 3300009148 | Bacteria | 2186 |
| 130 | Ga0105241_10028129 | 3300009174 | Bacteria | 4187 |
| 131 | Ga0105242_10000547 | 3300009176 | Bacteria | 29760 |
| 132 | Ga0105248_10012821 | 3300009177 | Bacteria | 9246 |
| 133 | Ga0105237_10006662 | 3300009545 | Bacteria | 12766 |
| 134 | Ga0105237_10013057 | 3300009545 | Bacteria | 8722 |
| 135 | Ga0105237_10029717 | 3300009545 | Bacteria | 5553 |
| 136 | Ga0105237_10039300 | 3300009545 | Bacteria | 4777 |
| 137 | Ga0105238_10017098 | 3300009551 | Bacteria | 7361 |
| 138 | Ga0105238_10205138 | 3300009551 | Bacteria | 1947 |
| 139 | Ga0105239_10000932 | 3300010375 | Bacteria | 41400 |
| 140 | Ga0105239_10003360 | 3300010375 | Bacteria | 19656 |
| 141 | Ga0105239_10014404 | 3300010375 | Bacteria | 8775 |
| 142 | Ga0105239_10016000 | 3300010375 | Bacteria | 8302 |
| 143 | Ga0105239_10043155 | 3300010375 | Bacteria | 4941 |
| 144 | Ga0105239_10069581 | 3300010375 | Bacteria | 3867 |
| 145 | Ga0105246_10002160 | 3300011119 | Bacteria | 11868 |
| 146 | Ga0105246_10061350 | 3300011119 | Bacteria | 2616 |
| 147 | Ga0157345_1000109 | 3300012498 | Bacteria | 15915 |
| 148 | Ga0157373_10001399 | 3300013100 | Bacteria | 18484 |
| 149 | Ga0157373_10002268 | 3300013100 | Bacteria | 14575 |
| 150 | Ga0157373_10005118 | 3300013100 | Bacteria | 9855 |
| 151 | Ga0157373_10015951 | 3300013100 | Bacteria | 5485 |
| 152 | Ga0157373_10022663 | 3300013100 | Bacteria | 4555 |
| 153 | Ga0157373_10045315 | 3300013100 | Bacteria | 3139 |
| 154 | Ga0157373_10156982 | 3300013100 | Bacteria | 1600 |
| 155 | Ga0157371_10001380 | 3300013102 | Bacteria | 25456 |
| 156 | Ga0157371_10003050 | 3300013102 | Bacteria | 15547 |
| 157 | Ga0157371_10020875 | 3300013102 | Bacteria | 4817 |
| 158 | Ga0157371_10058276 | 3300013102 | Bacteria | 2740 |
| 159 | Ga0157371_10089665 | 3300013102 | Bacteria | 2178 |
| 160 | Ga0157370_10000070 | 3300013104 | Bacteria | 112014 |
| 161 | Ga0157370_10007058 | 3300013104 | Bacteria | 12264 |
| 162 | Ga0157370_10016668 | 3300013104 | Bacteria | 7436 |
| 163 | Ga0157370_10064065 | 3300013104 | Bacteria | 3481 |
| 164 | Ga0157370_10109795 | 3300013104 | Bacteria | 2578 |
| 165 | Ga0157369_10013332 | 3300013105 | Bacteria | 9296 |
| 166 | Ga0157369_10027737 | 3300013105 | Bacteria | 6273 |
| 167 | Ga0157369_10028371 | 3300013105 | Bacteria | 6195 |
| 168 | Ga0157369_10047573 | 3300013105 | Bacteria | 4656 |
| 169 | Ga0157369_10051527 | 3300013105 | Bacteria | 4454 |
| 170 | Ga0157369_10053069 | 3300013105 | Bacteria | 4382 |
| 171 | Ga0157369_10056516 | 3300013105 | Bacteria | 4235 |
| 172 | Ga0157378_10011013 | 3300013297 | Bacteria | 7915 |
| 173 | Ga0163162_10003189 | 3300013306 | Bacteria | 15681 |
| 174 | Ga0163162_10075602 | 3300013306 | Bacteria | 3429 |
| 175 | Ga0163162_10114468 | 3300013306 | Bacteria | 2796 |
| 176 | Ga0163162_10137467 | 3300013306 | Bacteria | 2555 |
| 177 | Ga0163162_10302758 | 3300013306 | Bacteria | 1731 |
| 178 | Ga0157372_10021418 | 3300013307 | Bacteria | 6984 |
| 179 | Ga0157375_10006419 | 3300013308 | Bacteria | 10249 |
| 180 | Ga0157375_10012360 | 3300013308 | Bacteria | 7570 |
| 181 | Ga0157375_10016590 | 3300013308 | Bacteria | 6622 |
| 182 | Ga0157375_10138927 | 3300013308 | Bacteria | 2555 |
| 183 | Ga0182008_10000593 | 3300014497 | Bacteria | 26632 |
| 184 | Ga0182008_10001437 | 3300014497 | Bacteria | 15932 |
| 185 | Ga0182008_10001850 | 3300014497 | Bacteria | 13773 |
| 186 | Ga0182008_10004969 | 3300014497 | Bacteria | 7655 |
| 187 | Ga0182008_10010920 | 3300014497 | Bacteria | 4844 |
| 188 | Ga0182008_10010972 | 3300014497 | Bacteria | 4831 |
| 189 | Ga0182008_10017510 | 3300014497 | Bacteria | 3716 |
| 190 | Ga0182008_10017710 | 3300014497 | Bacteria | 3693 |
| 191 | Ga0182008_10020679 | 3300014497 | Bacteria | 3385 |
| 192 | Ga0157379_10011341 | 3300014968 | Bacteria | 7771 |
| 193 | Ga0157376_10003637 | 3300014969 | Bacteria | 10640 |
| 194 | Ga0157376_10066194 | 3300014969 | Bacteria | 3054 |
| 195 | Ga0182006_1003011 | 3300015261 | Bacteria | 8863 |
| 196 | Ga0182006_1006211 | 3300015261 | Bacteria | 5577 |
| 197 | Ga0182006_1008002 | 3300015261 | Bacteria | 4804 |
| 198 | Ga0182006_1024370 | 3300015261 | Bacteria | 2495 |
| 199 | Ga0182007_10006882 | 3300015262 | Bacteria | 4833 |
| 200 | Ga0182007_10016001 | 3300015262 | Bacteria | 2779 |
| 201 | Ga0163161_10016315 | 3300017792 | Bacteria | 5185 |
| 202 | Ga0163161_10017758 | 3300017792 | Bacteria | 4985 |
| 203 | Ga0163161_10018742 | 3300017792 | Bacteria | 4850 |
| 204 | Ga0163161_10020038 | 3300017792 | Bacteria | 4692 |
| 205 | Ga0163161_10050869 | 3300017792 | Bacteria | 3000 |
| 206 | Ga0163161_10101208 | 3300017792 | Bacteria | 2145 |
| 207 | Ga0163161_10143095 | 3300017792 | Bacteria | 1812 |
| 208 | Ga0209435_100023 | 3300025206 | Bacteria | 201972 |
| 209 | Ga0209435_100671 | 3300025206 | Bacteria | 6028 |
| 210 | Ga0209760_100090 | 3300025207 | Bacteria | 72214 |
| 211 | Ga0209760_100106 | 3300025207 | Bacteria | 63287 |
| 212 | Ga0209784_100080 | 3300025224 | Bacteria | 135689 |
| 213 | Ga0209566_100096 | 3300025225 | Bacteria | 135689 |
| 214 | Ga0209674_100117 | 3300025226 | Bacteria | 135689 |
| 215 | Ga0209147_100123 | 3300025229 | Bacteria | 135689 |
| 216 | Ga0209563_100114 | 3300025230 | Bacteria | 135689 |
| 217 | Ga0209563_100947 | 3300025230 | Bacteria | 8559 |
| 218 | Ga0207427_100004 | 3300025231 | Bacteria | 939600 |
| 219 | Ga0207427_100007 | 3300025231 | Bacteria | 746220 |
| 220 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 221 | Ga0209437_100028 | 3300025233 | Bacteria | 540136 |
| 222 | Ga0209437_102874 | 3300025233 | Bacteria | 3231 |
| 223 | Ga0209258_100174 | 3300025242 | Bacteria | 143702 |
| 224 | Ga0209646_1000080 | 3300025246 | Bacteria | 201975 |
| 225 | Ga0209646_1000422 | 3300025246 | Bacteria | 23757 |
| 226 | Ga0209026_1000076 | 3300025250 | Bacteria | 201975 |
| 227 | Ga0209677_100073 | 3300025253 | Bacteria | 135689 |
| 228 | Ga0209677_100272 | 3300025253 | Bacteria | 34642 |
| 229 | Ga0209148_1000921 | 3300025254 | Bacteria | 19607 |
| 230 | Ga0209759_1000059 | 3300025256 | Bacteria | 201975 |
| 231 | Ga0209759_1004309 | 3300025256 | Bacteria | 5352 |
| 232 | Ga0209759_1007300 | 3300025256 | Bacteria | 3575 |
| 233 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 234 | Ga0209233_1000086 | 3300025261 | Bacteria | 331687 |
| 235 | Ga0209233_1000282 | 3300025261 | Bacteria | 70340 |
| 236 | Ga0209233_1000310 | 3300025261 | Bacteria | 56582 |
| 237 | Ga0209455_1000150 | 3300025272 | Bacteria | 130892 |
| 238 | Ga0209676_1000006 | 3300025292 | Bacteria | 1039588 |
| 239 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 240 | Ga0209676_1001133 | 3300025292 | Bacteria | 29195 |
| 241 | Ga0209676_1007590 | 3300025292 | Bacteria | 5043 |
| 242 | Ga0209564_1025789 | 3300025295 | Bacteria | 1965 |
| 243 | Ga0209758_1006795 | 3300025297 | Bacteria | 8026 |
| 244 | Ga0209050_1000019 | 3300025298 | Bacteria | 608757 |
| 245 | Ga0209050_1000070 | 3300025298 | Bacteria | 296366 |
| 246 | Ga0209050_1001703 | 3300025298 | Bacteria | 21969 |
| 247 | Ga0209050_1005922 | 3300025298 | Bacteria | 7452 |
| 248 | Ga0209051_1000093 | 3300025303 | Bacteria | 169092 |
| 249 | Ga0209051_1000146 | 3300025303 | Bacteria | 134294 |
| 250 | Ga0209051_1011790 | 3300025303 | Bacteria | 4283 |
| 251 | Ga0209257_1000040 | 3300025304 | Bacteria | 538759 |
| 252 | Ga0209257_1000303 | 3300025304 | Bacteria | 107862 |
| 253 | Ga0207656_10000021 | 3300025321 | Bacteria | 113329 |
| 254 | Ga0207696_1000073 | 3300025711 | Bacteria | 215388 |
| 255 | Ga0207696_1000246 | 3300025711 | Bacteria | 73989 |
| 256 | Ga0207696_1001465 | 3300025711 | Bacteria | 12773 |
| 257 | Ga0207696_1005199 | 3300025711 | Bacteria | 5446 |
| 258 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 259 | Ga0207655_1000015 | 3300025728 | Bacteria | 600662 |
| 260 | Ga0207655_1000701 | 3300025728 | Bacteria | 38852 |
| 261 | Ga0207655_1001021 | 3300025728 | Bacteria | 28295 |
| 262 | Ga0207655_1002919 | 3300025728 | Bacteria | 13148 |
| 263 | Ga0207655_1006300 | 3300025728 | Bacteria | 7889 |
| 264 | Ga0207655_1010879 | 3300025728 | Bacteria | 5474 |
| 265 | Ga0207655_1011785 | 3300025728 | Bacteria | 5168 |
| 266 | Ga0207655_1011887 | 3300025728 | Bacteria | 5137 |
| 267 | Ga0207655_1016207 | 3300025728 | Bacteria | 4090 |
| 268 | Ga0207713_1000426 | 3300025735 | Bacteria | 44662 |
| 269 | Ga0207713_1000543 | 3300025735 | Bacteria | 37728 |
| 270 | Ga0207713_1000600 | 3300025735 | Bacteria | 35518 |
| 271 | Ga0207713_1001527 | 3300025735 | Bacteria | 18229 |
| 272 | Ga0207713_1005163 | 3300025735 | Bacteria | 8252 |
| 273 | Ga0207713_1008166 | 3300025735 | Bacteria | 6059 |
| 274 | Ga0207713_1015009 | 3300025735 | Bacteria | 3994 |
| 275 | Ga0207713_1018361 | 3300025735 | Bacteria | 3466 |
| 276 | Ga0207710_10005346 | 3300025900 | Bacteria | 5540 |
| 277 | Ga0207647_10003622 | 3300025904 | Bacteria | 11566 |
| 278 | Ga0207647_10004058 | 3300025904 | Bacteria | 10904 |
| 279 | Ga0207654_10016121 | 3300025911 | Bacteria | 3887 |
| 280 | Ga0207695_10000352 | 3300025913 | Bacteria | 105524 |
| 281 | Ga0207695_10001755 | 3300025913 | Bacteria | 34425 |
| 282 | Ga0207695_10054008 | 3300025913 | Bacteria | 4199 |
| 283 | Ga0207671_10000534 | 3300025914 | Bacteria | 51293 |
| 284 | Ga0207671_10000766 | 3300025914 | Bacteria | 40806 |
| 285 | Ga0207671_10018516 | 3300025914 | Bacteria | 5340 |
| 286 | Ga0207671_10063802 | 3300025914 | Bacteria | 2738 |
| 287 | Ga0207657_10000111 | 3300025919 | Bacteria | 79991 |
| 288 | Ga0207649_10000006 | 3300025920 | Bacteria | 349180 |
| 289 | Ga0207681_10001988 | 3300025923 | Bacteria | 13129 |
| 290 | Ga0207681_10003269 | 3300025923 | Bacteria | 10149 |
| 291 | Ga0207650_10000188 | 3300025925 | Bacteria | 72046 |
| 292 | Ga0207650_10000561 | 3300025925 | Bacteria | 30124 |
| 293 | Ga0207687_10059204 | 3300025927 | Bacteria | 2697 |
| 294 | Ga0207690_10000009 | 3300025932 | Bacteria | 366044 |
| 295 | Ga0207706_10000205 | 3300025933 | Bacteria | 65450 |
| 296 | Ga0207706_10008376 | 3300025933 | Bacteria | 9539 |
| 297 | Ga0207706_10051537 | 3300025933 | Bacteria | 3634 |
| 298 | Ga0207686_10003836 | 3300025934 | Bacteria | 8063 |
| 299 | Ga0207709_10000013 | 3300025935 | Bacteria | 531977 |
| 300 | Ga0207709_10000586 | 3300025935 | Bacteria | 30449 |
| 301 | Ga0207709_10054723 | 3300025935 | Bacteria | 2461 |
| 302 | Ga0207711_10101031 | 3300025941 | Bacteria | 2552 |
| 303 | Ga0207661_10157182 | 3300025944 | Bacteria | 1970 |
| 304 | Ga0207679_10000010 | 3300025945 | Bacteria | 349180 |
| 305 | Ga0207667_10003058 | 3300025949 | Bacteria | 20744 |
| 306 | Ga0207640_10018604 | 3300025981 | Bacteria | 4085 |
| 307 | Ga0207658_10129106 | 3300025986 | Bacteria | 2028 |
| 308 | Ga0207703_10014678 | 3300026035 | Bacteria | 6113 |
| 309 | Ga0207639_10001976 | 3300026041 | Bacteria | 13792 |
| 310 | Ga0207639_10023522 | 3300026041 | Bacteria | 4450 |
| 311 | Ga0207639_10134362 | 3300026041 | Bacteria | 2052 |
| 312 | Ga0207678_10000347 | 3300026067 | Bacteria | 41971 |
| 313 | Ga0207698_10073392 | 3300026142 | Bacteria | 2725 |
| 314 | Ga0209281_1000049 | 3300027111 | Bacteria | 322274 |
| 315 | Ga0209281_1000202 | 3300027111 | Bacteria | 135240 |
| 316 | Ga0209281_1003441 | 3300027111 | Bacteria | 5235 |
| 317 | Ga0207428_10016226 | 3300027907 | Bacteria | 6414 |
| 318 | Ga0207428_10136292 | 3300027907 | Bacteria | 1876 |
| 319 | Ga0268266_10116692 | 3300028379 | Bacteria | 2371 |
| 320 | Ga0268265_10116215 | 3300028380 | Bacteria | 2195 |
| 321 | Ga0265326_10007166 | 3300028558 | Bacteria | 3428 |
| 322 | Ga0265338_10008078 | 3300028800 | Bacteria | 12864 |
| 323 | Ga0265338_10034157 | 3300028800 | Bacteria | 4920 |
| 324 | Ga0265338_10089674 | 3300028800 | Bacteria | 2547 |
| 325 | Ga0307511_10041818 | 3300030521 | Bacteria | 3862 |
| 326 | Ga0307511_10044765 | 3300030521 | Bacteria | 3670 |
| 327 | Ga0316179_1007569 | 3300030734 | Bacteria | 2335 |
| 328 | Ga0316178_1085488 | 3300030735 | Bacteria | 13716 |
| 329 | Ga0265330_10009700 | 3300031235 | Bacteria | 4564 |
| 330 | Ga0265325_10001901 | 3300031241 | Bacteria | 14416 |
| 331 | Ga0265339_10014882 | 3300031249 | Bacteria | 4677 |
| 332 | Ga0265331_10011374 | 3300031250 | Bacteria | 4877 |
| 333 | Ga0265327_10045761 | 3300031251 | Bacteria | 2323 |
| 334 | Ga0307513_10117147 | 3300031456 | Bacteria | 2641 |
| 335 | Ga0307509_10088442 | 3300031507 | Bacteria | 3180 |
| 336 | Ga0307408_100004523 | 3300031548 | Bacteria | 9427 |
| 337 | Ga0307408_100022392 | 3300031548 | Bacteria | 4292 |
| 338 | Ga0307408_100027290 | 3300031548 | Bacteria | 3932 |
| 339 | Ga0265313_10004543 | 3300031595 | Bacteria | 10583 |
| 340 | Ga0307514_10001067 | 3300031649 | Bacteria | 38961 |
| 341 | Ga0265314_10005751 | 3300031711 | Bacteria | 11124 |
| 342 | Ga0307405_10004895 | 3300031731 | Bacteria | 6393 |
| 343 | Ga0307405_10008531 | 3300031731 | Bacteria | 5203 |
| 344 | Ga0307405_10036019 | 3300031731 | Bacteria | 2961 |
| 345 | Ga0307413_10063951 | 3300031824 | Bacteria | 2283 |
| 346 | Ga0307406_10011704 | 3300031901 | Bacteria | 4981 |
| 347 | Ga0307412_10002215 | 3300031911 | Bacteria | 10786 |
| 348 | Ga0307412_10030858 | 3300031911 | Bacteria | 3379 |
| 349 | Ga0307409_100078077 | 3300031995 | Bacteria | 2662 |
| 350 | Ga0307409_100081478 | 3300031995 | Bacteria | 2616 |
| 351 | Ga0307416_100135158 | 3300032002 | Bacteria | 2229 |
| 352 | Ga0307414_10083713 | 3300032004 | Bacteria | 2344 |
| 353 | Ga0307411_10029815 | 3300032005 | Bacteria | 3337 |
| 354 | Ga0307411_10106522 | 3300032005 | Bacteria | 1995 |
| 355 | Ga0307510_10016790 | 3300033180 | Bacteria | 8637 |
| 356 | Ga0395900_0002853 | 3300037418 | Bacteria | 18860 |
| 357 | Ga0395900_0247148 | 3300037418 | Bacteria | 1787 |
| 358 | Ga0395905_0001778 | 3300037471 | Bacteria | 25004 |
| 359 | Ga0395905_0014404 | 3300037471 | Bacteria | 7553 |
| 360 | Ga0395905_0029858 | 3300037471 | Bacteria | 5138 |
| 361 | Ga0395901_0004406 | 3300038443 | Bacteria | 14190 |
| 362 | Ga0395901_0017627 | 3300038443 | Bacteria | 7292 |
| 363 | Ga0439438_000532 | 3300041405 | Bacteria | 17336 |
| 364 | Ga0439438_002698 | 3300041405 | Bacteria | 7471 |
| 365 | Ga0439438_002764 | 3300041405 | Bacteria | 7349 |
| 366 | Ga0439438_004435 | 3300041405 | Bacteria | 5386 |
| 367 | Ga0439438_005714 | 3300041405 | Bacteria | 4526 |
| 368 | Ga0439438_009523 | 3300041405 | Bacteria | 3139 |
| 369 | Ga0439447_001577 | 3300041407 | Bacteria | 8344 |
| 370 | Ga0439447_003653 | 3300041407 | Bacteria | 5428 |
| 371 | Ga0439447_003866 | 3300041407 | Bacteria | 5253 |
| 372 | Ga0439447_007780 | 3300041407 | Bacteria | 3367 |
| 373 | Ga0439466_0002401 | 3300041411 | Bacteria | 7343 |
| 374 | Ga0439466_0003005 | 3300041411 | Bacteria | 6580 |
| 375 | Ga0439466_0009803 | 3300041411 | Bacteria | 3569 |
| 376 | Ga0439466_0013997 | 3300041411 | Bacteria | 2928 |
| 377 | Ga0439466_0018978 | 3300041411 | Bacteria | 2462 |
| 378 | Ga0439432_001499 | 3300042006 | Bacteria | 8761 |
| 379 | Ga0439432_001529 | 3300042006 | Bacteria | 8687 |
| 380 | Ga0439432_007275 | 3300042006 | Bacteria | 3930 |
| 381 | Ga0439451_000472 | 3300042009 | Bacteria | 7819 |
| 382 | Ga0439451_001204 | 3300042009 | Bacteria | 5102 |
| 383 | Ga0439452_000732 | 3300042010 | Bacteria | 15774 |
| 384 | Ga0439452_000742 | 3300042010 | Bacteria | 15669 |
| 385 | Ga0439452_001257 | 3300042010 | Bacteria | 10755 |
| 386 | Ga0439452_011606 | 3300042010 | Bacteria | 2524 |
| 387 | Ga0439456_000071 | 3300042013 | Bacteria | 36014 |
| 388 | Ga0439456_003830 | 3300042013 | Bacteria | 3054 |
| 389 | Ga0439463_003557 | 3300042016 | Bacteria | 3939 |
| 390 | Ga0450911_000441 | 3300042115 | Bacteria | 13478 |
| 391 | Ga0450911_001298 | 3300042115 | Bacteria | 5925 |
| 392 | Ga0450911_002186 | 3300042115 | Bacteria | 3957 |
| 393 | Ga0450920_000209 | 3300042122 | Bacteria | 8642 |
| 394 | Ga0450922_001359 | 3300042124 | Bacteria | 2410 |
| 395 | Ga0450890_000618 | 3300042127 | Bacteria | 5191 |
| 396 | Ga0450899_001777 | 3300042135 | Bacteria | 2393 |
| 397 | Ga0450902_003704 | 3300042137 | Bacteria | 2247 |
| 398 | Ga0450904_000950 | 3300042139 | Bacteria | 4577 |
| 399 | Ga0450906_001861 | 3300042145 | Bacteria | 4617 |
| 400 | Ga0450906_009724 | 3300042145 | Bacteria | 1827 |
| 401 | Ga0450907_000015 | 3300042146 | Bacteria | 85221 |
| 402 | Ga0450907_000967 | 3300042146 | Bacteria | 6788 |
| 403 | Ga0450910_004102 | 3300042147 | Bacteria | 1960 |
| 404 | Ga0439446_0002404 | 3300042156 | Bacteria | 4486 |
| 405 | Ga0450908_006563 | 3300042184 | Bacteria | 2206 |
| 406 | Ga0439434_0000083 | 3300042435 | Bacteria | 23647 |
| 407 | Ga0439464_0002942 | 3300042439 | Bacteria | 4247 |
| 408 | Ga0439460_0001661 | 3300042461 | Bacteria | 5272 |
| 409 | Ga0439460_0003001 | 3300042461 | Bacteria | 4072 |
| 410 | Ga0439460_0003519 | 3300042461 | Bacteria | 3787 |
| 411 | Ga0439460_0006771 | 3300042461 | Bacteria | 2851 |
| 412 | Ga0439440_0004230 | 3300042993 | Bacteria | 2814 |
| 413 | Ga0495617_000789 | 3300046452 | Bacteria | 15318 |
| 414 | Ga0495617_002785 | 3300046452 | Bacteria | 6744 |
| 415 | Ga0495617_007706 | 3300046452 | Bacteria | 3724 |
| 416 | Ga0495617_013876 | 3300046452 | Bacteria | 2740 |
| 417 | Ga0495617_030650 | 3300046452 | Bacteria | 1807 |
| 418 | Ga0495627_002706 | 3300046453 | Bacteria | 8291 |
| 419 | Ga0495627_002977 | 3300046453 | Bacteria | 7760 |
| 420 | Ga0495627_003608 | 3300046453 | Bacteria | 6736 |
| 421 | Ga0495627_007871 | 3300046453 | Bacteria | 4045 |
| 422 | Ga0495627_008703 | 3300046453 | Bacteria | 3785 |
| 423 | Ga0495592_0025312 | 3300046454 | Bacteria | 4505 |
| 424 | Ga0495603_0082583 | 3300046455 | Bacteria | 1882 |
| 425 | Ga0495590_0002105 | 3300046457 | Bacteria | 8339 |
| 426 | Ga0495590_0002853 | 3300046457 | Bacteria | 7119 |
| 427 | Ga0495590_0006100 | 3300046457 | Bacteria | 4725 |
| 428 | Ga0495591_001192 | 3300046458 | Bacteria | 16980 |
| 429 | Ga0495591_001612 | 3300046458 | Bacteria | 13633 |
| 430 | Ga0495591_002052 | 3300046458 | Bacteria | 11682 |
| 431 | Ga0495591_002960 | 3300046458 | Bacteria | 9068 |
| 432 | Ga0495591_003835 | 3300046458 | Bacteria | 7603 |
| 433 | Ga0495591_008863 | 3300046458 | Bacteria | 4063 |
| 434 | Ga0495629_0000468 | 3300046459 | Bacteria | 33837 |
| 435 | Ga0495638_0006469 | 3300046460 | Bacteria | 8521 |
| 436 | Ga0495638_0008707 | 3300046460 | Bacteria | 7173 |
| 437 | Ga0495638_0010243 | 3300046460 | Bacteria | 6523 |
| 438 | Ga0495638_0015446 | 3300046460 | Bacteria | 5125 |
| 439 | Ga0495638_0015799 | 3300046460 | Bacteria | 5057 |
| 440 | Ga0495638_0015981 | 3300046460 | Bacteria | 5030 |
| 441 | Ga0495638_0016917 | 3300046460 | Bacteria | 4875 |
| 442 | Ga0495638_0017845 | 3300046460 | Bacteria | 4723 |
| 443 | Ga0495638_0024983 | 3300046460 | Bacteria | 3888 |
| 444 | Ga0495638_0040765 | 3300046460 | Bacteria | 2941 |
| 445 | Ga0495651_0015068 | 3300046462 | Bacteria | 5975 |
| 446 | Ga0495653_0038962 | 3300046463 | Bacteria | 3726 |
| 447 | Ga0495653_0048939 | 3300046463 | Bacteria | 3259 |
| 448 | Ga0495653_0080965 | 3300046463 | Bacteria | 2400 |
| 449 | Ga0495653_0140349 | 3300046463 | Bacteria | 1700 |
| 450 | Ga0495650_0003878 | 3300046471 | Bacteria | 10584 |
| 451 | Ga0495650_0011538 | 3300046471 | Bacteria | 4830 |
| 452 | Ga0495650_0012383 | 3300046471 | Bacteria | 4592 |
| 453 | Ga0495650_0029051 | 3300046471 | Bacteria | 2526 |
| 454 | Ga0495650_0029907 | 3300046471 | Bacteria | 2475 |
| 455 | Ga0495580_0000104 | 3300046472 | Bacteria | 56812 |
| 456 | Ga0495580_0009914 | 3300046472 | Bacteria | 7457 |
| 457 | Ga0495580_0023254 | 3300046472 | Bacteria | 4553 |
| 458 | Ga0495582_0009166 | 3300046473 | Bacteria | 5459 |
| 459 | Ga0495605_0001604 | 3300046474 | Bacteria | 14652 |
| 460 | Ga0495605_0004544 | 3300046474 | Bacteria | 8126 |
| 461 | Ga0495605_0006744 | 3300046474 | Bacteria | 6564 |
| 462 | Ga0495605_0011512 | 3300046474 | Bacteria | 4926 |
| 463 | Ga0495605_0012216 | 3300046474 | Bacteria | 4769 |
| 464 | Ga0495605_0032166 | 3300046474 | Bacteria | 2673 |
| 465 | Ga0495605_0049993 | 3300046474 | Bacteria | 2040 |
| 466 | Ga0495664_0029390 | 3300046477 | Bacteria | 3214 |
| 467 | Ga0495584_0000014 | 3300046491 | Bacteria | 172880 |
| 468 | Ga0495584_0001457 | 3300046491 | Bacteria | 14215 |
| 469 | Ga0495584_0001756 | 3300046491 | Bacteria | 12646 |
| 470 | Ga0495584_0003606 | 3300046491 | Bacteria | 8446 |
| 471 | Ga0495584_0004147 | 3300046491 | Bacteria | 7824 |
| 472 | Ga0495584_0009081 | 3300046491 | Bacteria | 5134 |
| 473 | Ga0495584_0015268 | 3300046491 | Bacteria | 3913 |
| 474 | Ga0495585_0000096 | 3300046492 | Bacteria | 93635 |
| 475 | Ga0495585_0002384 | 3300046492 | Bacteria | 13478 |
| 476 | Ga0495585_0004069 | 3300046492 | Bacteria | 9605 |
| 477 | Ga0495585_0011835 | 3300046492 | Bacteria | 5153 |
| 478 | Ga0495585_0013169 | 3300046492 | Bacteria | 4846 |
| 479 | Ga0495585_0035921 | 3300046492 | Bacteria | 2798 |
| 480 | Ga0495585_0040818 | 3300046492 | Bacteria | 2604 |
| 481 | Ga0495585_0041493 | 3300046492 | Bacteria | 2580 |
| 482 | Ga0495585_0075124 | 3300046492 | Bacteria | 1837 |
| 483 | Ga0495594_0043205 | 3300046499 | Bacteria | 2470 |
| 484 | Ga0495596_0000888 | 3300046500 | Bacteria | 18032 |
| 485 | Ga0495596_0007790 | 3300046500 | Bacteria | 4805 |
| 486 | Ga0495596_0017771 | 3300046500 | Bacteria | 2940 |
| 487 | Ga0495607_0001972 | 3300046501 | Bacteria | 17295 |
| 488 | Ga0495607_0005517 | 3300046501 | Bacteria | 9025 |
| 489 | Ga0495607_0006291 | 3300046501 | Bacteria | 8371 |
| 490 | Ga0495607_0013220 | 3300046501 | Bacteria | 5419 |
| 491 | Ga0495607_0016236 | 3300046501 | Bacteria | 4808 |
| 492 | Ga0495607_0042500 | 3300046501 | Bacteria | 2693 |
| 493 | Ga0495607_0046195 | 3300046501 | Bacteria | 2558 |
| 494 | Ga0495583_0002651 | 3300046506 | Bacteria | 14916 |
| 495 | Ga0495583_0005025 | 3300046506 | Bacteria | 9154 |
| 496 | Ga0495583_0005187 | 3300046506 | Bacteria | 8970 |
| 497 | Ga0495583_0005623 | 3300046506 | Bacteria | 8448 |
| 498 | Ga0495583_0012075 | 3300046506 | Bacteria | 4917 |
| 499 | Ga0495583_0018753 | 3300046506 | Bacteria | 3632 |
| 500 | Ga0495583_0028784 | 3300046506 | Bacteria | 2727 |
| 501 | Ga0495583_0028862 | 3300046506 | Bacteria | 2722 |
| 502 | Ga0495606_0000027 | 3300046507 | Bacteria | 253573 |
| 503 | Ga0495606_0006755 | 3300046507 | Bacteria | 10498 |
| 504 | Ga0495606_0007268 | 3300046507 | Bacteria | 9980 |
| 505 | Ga0495606_0007963 | 3300046507 | Bacteria | 9326 |
| 506 | Ga0495606_0010270 | 3300046507 | Bacteria | 7796 |
| 507 | Ga0495606_0028117 | 3300046507 | Bacteria | 3971 |
| 508 | Ga0495606_0035116 | 3300046507 | Bacteria | 3431 |
| 509 | Ga0495608_0001808 | 3300046511 | Bacteria | 15286 |
| 510 | Ga0495610_0006370 | 3300046512 | Bacteria | 8143 |
| 511 | Ga0495610_0006603 | 3300046512 | Bacteria | 7926 |
| 512 | Ga0495610_0007514 | 3300046512 | Bacteria | 7235 |
| 513 | Ga0495610_0009350 | 3300046512 | Bacteria | 6206 |
| 514 | Ga0495610_0013412 | 3300046512 | Bacteria | 4870 |
| 515 | Ga0495610_0015529 | 3300046512 | Bacteria | 4420 |
| 516 | Ga0495610_0016744 | 3300046512 | Bacteria | 4208 |
| 517 | Ga0495610_0028596 | 3300046512 | Bacteria | 2945 |
| 518 | Ga0495610_0029381 | 3300046512 | Bacteria | 2895 |
| 519 | Ga0495610_0044416 | 3300046512 | Bacteria | 2205 |
| 520 | Ga0495616_0005526 | 3300046513 | Bacteria | 7768 |
| 521 | Ga0495616_0011272 | 3300046513 | Bacteria | 5131 |
| 522 | Ga0495616_0011759 | 3300046513 | Bacteria | 4999 |
| 523 | Ga0495616_0030044 | 3300046513 | Bacteria | 2860 |
| 524 | Ga0495616_0038614 | 3300046513 | Bacteria | 2450 |
| 525 | Ga0495618_0005058 | 3300046514 | Bacteria | 8054 |
| 526 | Ga0495620_0001983 | 3300046515 | Bacteria | 11965 |
| 527 | Ga0495620_0002880 | 3300046515 | Bacteria | 9888 |
| 528 | Ga0495620_0010389 | 3300046515 | Bacteria | 4913 |
| 529 | Ga0495630_0008000 | 3300046517 | Bacteria | 7594 |
| 530 | Ga0495630_0011630 | 3300046517 | Bacteria | 6377 |
| 531 | Ga0495630_0021381 | 3300046517 | Bacteria | 4778 |
| 532 | Ga0495630_0025431 | 3300046517 | Bacteria | 4378 |
| 533 | Ga0495630_0044799 | 3300046517 | Bacteria | 3306 |
| 534 | Ga0495631_0000637 | 3300046518 | Bacteria | 22916 |
| 535 | Ga0495631_0002437 | 3300046518 | Bacteria | 10490 |
| 536 | Ga0495632_0002221 | 3300046519 | Bacteria | 14973 |
| 537 | Ga0495632_0006267 | 3300046519 | Bacteria | 7687 |
| 538 | Ga0495632_0021428 | 3300046519 | Bacteria | 3482 |
| 539 | Ga0495632_0024850 | 3300046519 | Bacteria | 3176 |
| 540 | Ga0495632_0037202 | 3300046519 | Bacteria | 2471 |
| 541 | Ga0495632_0058981 | 3300046519 | Bacteria | 1868 |
| 542 | Ga0495637_0000743 | 3300046520 | Bacteria | 22023 |
| 543 | Ga0495637_0004004 | 3300046520 | Bacteria | 7687 |
| 544 | Ga0495637_0004169 | 3300046520 | Bacteria | 7520 |
| 545 | Ga0495637_0004212 | 3300046520 | Bacteria | 7473 |
| 546 | Ga0495637_0010212 | 3300046520 | Bacteria | 4549 |
| 547 | Ga0495637_0010627 | 3300046520 | Bacteria | 4445 |
| 548 | Ga0495637_0020960 | 3300046520 | Bacteria | 2998 |
| 549 | Ga0495637_0023808 | 3300046520 | Bacteria | 2776 |
| 550 | Ga0495637_0049704 | 3300046520 | Bacteria | 1760 |
| 551 | Ga0495643_0000049 | 3300046522 | Bacteria | 212242 |
| 552 | Ga0495643_0005492 | 3300046522 | Bacteria | 8557 |
| 553 | Ga0495643_0014948 | 3300046522 | Bacteria | 4602 |
| 554 | Ga0495643_0021642 | 3300046522 | Bacteria | 3684 |
| 555 | Ga0495644_0002471 | 3300046523 | Bacteria | 7375 |
| 556 | Ga0495644_0003748 | 3300046523 | Bacteria | 5982 |
| 557 | Ga0495644_0005046 | 3300046523 | Bacteria | 5162 |
| 558 | Ga0495648_0006977 | 3300046524 | Bacteria | 9110 |
| 559 | Ga0495648_0015406 | 3300046524 | Bacteria | 5553 |
| 560 | Ga0495648_0019472 | 3300046524 | Bacteria | 4771 |
| 561 | Ga0495648_0024656 | 3300046524 | Bacteria | 4089 |
| 562 | Ga0495648_0036025 | 3300046524 | Bacteria | 3199 |
| 563 | Ga0495648_0059998 | 3300046524 | Bacteria | 2265 |
| 564 | Ga0495648_0062378 | 3300046524 | Bacteria | 2207 |
| 565 | Ga0495666_0000354 | 3300046526 | Bacteria | 20158 |
| 566 | Ga0495666_0002897 | 3300046526 | Bacteria | 8593 |
| 567 | Ga0495642_0000042 | 3300046528 | Bacteria | 75891 |
| 568 | Ga0495642_0001043 | 3300046528 | Bacteria | 12868 |
| 569 | Ga0495652_0009144 | 3300046529 | Bacteria | 9006 |
| 570 | Ga0495654_0001990 | 3300046530 | Bacteria | 13453 |
| 571 | Ga0495654_0003418 | 3300046530 | Bacteria | 9744 |
| 572 | Ga0495654_0003987 | 3300046530 | Bacteria | 8884 |
| 573 | Ga0495654_0004439 | 3300046530 | Bacteria | 8322 |
| 574 | Ga0495654_0009995 | 3300046530 | Bacteria | 5182 |
| 575 | Ga0495654_0031671 | 3300046530 | Bacteria | 2684 |
| 576 | Ga0495654_0044487 | 3300046530 | Bacteria | 2196 |
| 577 | Ga0495654_0055840 | 3300046530 | Bacteria | 1910 |
| 578 | Ga0495665_0001735 | 3300046531 | Bacteria | 11719 |
| 579 | Ga0495665_0022196 | 3300046531 | Bacteria | 3413 |
| 580 | Ga0495640_0029250 | 3300046533 | Bacteria | 3958 |
| 581 | Ga0495587_0000917 | 3300046536 | Bacteria | 19460 |
| 582 | Ga0495587_0018623 | 3300046536 | Bacteria | 4304 |
| 583 | Ga0495609_0000928 | 3300046538 | Bacteria | 21198 |
| 584 | Ga0495609_0002746 | 3300046538 | Bacteria | 10597 |
| 585 | Ga0495609_0008048 | 3300046538 | Bacteria | 5197 |
| 586 | Ga0495609_0014589 | 3300046538 | Bacteria | 3691 |
| 587 | Ga0495609_0014637 | 3300046538 | Bacteria | 3684 |
| 588 | Ga0495609_0027333 | 3300046538 | Bacteria | 2608 |
| 589 | Ga0495609_0053390 | 3300046538 | Bacteria | 1797 |
| 590 | Ga0495597_0003541 | 3300046542 | Bacteria | 9030 |
| 591 | Ga0495597_0008048 | 3300046542 | Bacteria | 5305 |
| 592 | Ga0495597_0012096 | 3300046542 | Bacteria | 4171 |
| 593 | Ga0495597_0034930 | 3300046542 | Bacteria | 2270 |
| 594 | Ga0495597_0037287 | 3300046542 | Bacteria | 2183 |
| 595 | Ga0495645_0079895 | 3300046543 | Bacteria | 2348 |
| 596 | Ga0495645_0118550 | 3300046543 | Bacteria | 1866 |
| 597 | Ga0495622_0009838 | 3300046557 | Bacteria | 4422 |
| 598 | Ga0495622_0010541 | 3300046557 | Bacteria | 4268 |
| 599 | Ga0495622_0010724 | 3300046557 | Bacteria | 4228 |
| 600 | Ga0495622_0025944 | 3300046557 | Bacteria | 2738 |
| 601 | Ga0495633_0003512 | 3300046558 | Bacteria | 10400 |
| 602 | Ga0495656_0002177 | 3300046615 | Bacteria | 6477 |
| 603 | Ga0495656_0041654 | 3300046615 | Bacteria | 1920 |
| 604 | Ga0495668_0003061 | 3300046616 | Bacteria | 12952 |
| 605 | Ga0495668_0006817 | 3300046616 | Bacteria | 7414 |
| 606 | Ga0495668_0010604 | 3300046616 | Bacteria | 5567 |
| 607 | Ga0495668_0011931 | 3300046616 | Bacteria | 5174 |
| 608 | Ga0495634_0028576 | 3300046642 | Bacteria | 3869 |
| 609 | Ga0495611_0001015 | 3300046648 | Bacteria | 14886 |
| 610 | Ga0495625_0004213 | 3300046660 | Bacteria | 13703 |
| 611 | Ga0495625_0006199 | 3300046660 | Bacteria | 10713 |
| 612 | Ga0495625_0010011 | 3300046660 | Bacteria | 7884 |
| 613 | Ga0495625_0022102 | 3300046660 | Bacteria | 4882 |
| 614 | Ga0495625_0023761 | 3300046660 | Bacteria | 4678 |
| 615 | Ga0495625_0049227 | 3300046660 | Bacteria | 3030 |
| 616 | Ga0495625_0060201 | 3300046660 | Bacteria | 2691 |
| 617 | Ga0495635_0005729 | 3300046663 | Bacteria | 8653 |
| 618 | Ga0495659_0006521 | 3300046664 | Bacteria | 3686 |
| 619 | Ga0495661_0004628 | 3300046665 | Bacteria | 9899 |
| 620 | Ga0495661_0007157 | 3300046665 | Bacteria | 7786 |
| 621 | Ga0495661_0018363 | 3300046665 | Bacteria | 4602 |
| 622 | Ga0495661_0032986 | 3300046665 | Bacteria | 3268 |
| 623 | Ga0495661_0036199 | 3300046665 | Bacteria | 3092 |
| 624 | Ga0495661_0039208 | 3300046665 | Bacteria | 2945 |
| 625 | Ga0495588_0004345 | 3300046674 | Bacteria | 6256 |
| 626 | Ga0495599_0013867 | 3300046678 | Bacteria | 4987 |
| 627 | Ga0495623_0003020 | 3300046679 | Bacteria | 11074 |
| 628 | Ga0495623_0003593 | 3300046679 | Bacteria | 10255 |
| 629 | Ga0495623_0014480 | 3300046679 | Bacteria | 5104 |
| 630 | Ga0495646_0023390 | 3300046680 | Bacteria | 3890 |
| 631 | Ga0495669_0017315 | 3300046684 | Bacteria | 3091 |
| 632 | Ga0495613_0002518 | 3300046689 | Bacteria | 13807 |
| 633 | Ga0495613_0077847 | 3300046689 | Bacteria | 2412 |
| 634 | Ga0495624_0001358 | 3300046690 | Bacteria | 19089 |
| 635 | Ga0495624_0004594 | 3300046690 | Bacteria | 10075 |
| 636 | Ga0495624_0014347 | 3300046690 | Bacteria | 5380 |
| 637 | Ga0495670_0002154 | 3300046691 | Bacteria | 9733 |
| 638 | Ga0495670_0003049 | 3300046691 | Bacteria | 8262 |
| 639 | Ga0495670_0003797 | 3300046691 | Bacteria | 7423 |
| 640 | Ga0495670_0018969 | 3300046691 | Bacteria | 3388 |
| 641 | Ga0495671_0000674 | 3300046692 | Bacteria | 24630 |
| 642 | Ga0495671_0001038 | 3300046692 | Bacteria | 19312 |
| 643 | Ga0495671_0004372 | 3300046692 | Bacteria | 8466 |
| 644 | Ga0495671_0008811 | 3300046692 | Bacteria | 5665 |
| 645 | Ga0495671_0010676 | 3300046692 | Bacteria | 5081 |
| 646 | Ga0495671_0011679 | 3300046692 | Bacteria | 4818 |
| 647 | Ga0495671_0054340 | 3300046692 | Bacteria | 1985 |
| 648 | Ga0495649_0000045 | 3300046694 | Bacteria | 120562 |
| 649 | Ga0495649_0002119 | 3300046694 | Bacteria | 14235 |
| 650 | Ga0495649_0006018 | 3300046694 | Bacteria | 7593 |
| 651 | Ga0495649_0009383 | 3300046694 | Bacteria | 5821 |
| 652 | Ga0495649_0015440 | 3300046694 | Bacteria | 4346 |
| 653 | Ga0495649_0017519 | 3300046694 | Bacteria | 4040 |
| 654 | Ga0495649_0017531 | 3300046694 | Bacteria | 4039 |
| 655 | Ga0495649_0027591 | 3300046694 | Bacteria | 3149 |
| 656 | Ga0495649_0032641 | 3300046694 | Bacteria | 2866 |
| 657 | Ga0495649_0042760 | 3300046694 | Bacteria | 2474 |
| 658 | Ga0495649_0063407 | 3300046694 | Bacteria | 1985 |
| 659 | Ga0495589_0000710 | 3300046794 | Bacteria | 21647 |
| 660 | Ga0495589_0001216 | 3300046794 | Bacteria | 15315 |
| 661 | Ga0495589_0003242 | 3300046794 | Bacteria | 8871 |
| 662 | Ga0495589_0004730 | 3300046794 | Bacteria | 7226 |
| 663 | Ga0495589_0005288 | 3300046794 | Bacteria | 6821 |
| 664 | Ga0495589_0008364 | 3300046794 | Bacteria | 5406 |
| 665 | Ga0495589_0016286 | 3300046794 | Bacteria | 3821 |
| 666 | Ga0495589_0023075 | 3300046794 | Bacteria | 3171 |
| 667 | Ga0495589_0029829 | 3300046794 | Bacteria | 2749 |
| 668 | Ga0495600_0000760 | 3300046809 | Bacteria | 16970 |
| 669 | Ga0495600_0042489 | 3300046809 | Bacteria | 2963 |
| 670 | Ga0495600_0103663 | 3300046809 | Bacteria | 1854 |
| 671 | Ga0495660_0012476 | 3300046810 | Bacteria | 4933 |
| 672 | Ga0495660_0032381 | 3300046810 | Bacteria | 2935 |
| 673 | Ga0495660_0055094 | 3300046810 | Bacteria | 2153 |
| 674 | Ga0495660_0060371 | 3300046810 | Bacteria | 2036 |
| 675 | Ga0495660_0086910 | 3300046810 | Bacteria | 1631 |
| 676 | Ga0495604_0055479 | 3300047317 | Bacteria | 3053 |
| 677 | Ga0495636_0009555 | 3300047318 | Bacteria | 3819 |
| 678 | Ga0495674_0007043 | 3300047319 | Bacteria | 10756 |
| 679 | Ga0495674_0010312 | 3300047319 | Bacteria | 8847 |
| 680 | Ga0495674_0022078 | 3300047319 | Bacteria | 5874 |
| 681 | Ga0495674_0032782 | 3300047319 | Bacteria | 4708 |
| 682 | Ga0495672_0000491 | 3300047320 | Bacteria | 46089 |
| 683 | Ga0495672_0006898 | 3300047320 | Bacteria | 8659 |
| 684 | Ga0495672_0010295 | 3300047320 | Bacteria | 6680 |
| 685 | Ga0495672_0010675 | 3300047320 | Bacteria | 6522 |
| 686 | Ga0495672_0012049 | 3300047320 | Bacteria | 6056 |
| 687 | Ga0495672_0012889 | 3300047320 | Bacteria | 5797 |
| 688 | Ga0495672_0014480 | 3300047320 | Bacteria | 5399 |
| 689 | Ga0495672_0014869 | 3300047320 | Bacteria | 5307 |
| 690 | Ga0495672_0040857 | 3300047320 | Bacteria | 2809 |
| 691 | Ga0495672_0042516 | 3300047320 | Bacteria | 2739 |
| 692 | Ga0495676_0021737 | 3300047321 | Bacteria | 5594 |
| 693 | Ga0495676_0047502 | 3300047321 | Bacteria | 3470 |
| 694 | Ga0495680_0022594 | 3300047322 | Bacteria | 5239 |
| 695 | Ga0495680_0024779 | 3300047322 | Bacteria | 4971 |
| 696 | Ga0495680_0045732 | 3300047322 | Bacteria | 3455 |
| 697 | Ga0495680_0088625 | 3300047322 | Bacteria | 2324 |
| 698 | Ga0495680_0113934 | 3300047322 | Bacteria | 2001 |
| 699 | Ga0495683_0001300 | 3300047323 | Bacteria | 16871 |
| 700 | Ga0495683_0001396 | 3300047323 | Bacteria | 15956 |
| 701 | Ga0495683_0004230 | 3300047323 | Bacteria | 8198 |
| 702 | Ga0495683_0005000 | 3300047323 | Bacteria | 7425 |
| 703 | Ga0495683_0010755 | 3300047323 | Bacteria | 4825 |
| 704 | Ga0495683_0016072 | 3300047323 | Bacteria | 3886 |
| 705 | Ga0495683_0070842 | 3300047323 | Bacteria | 1711 |
| 706 | Ga0495687_000391 | 3300047443 | Bacteria | 54354 |
| 707 | Ga0495687_002043 | 3300047443 | Bacteria | 17006 |
| 708 | Ga0495687_005506 | 3300047443 | Bacteria | 8041 |
| 709 | Ga0495687_005781 | 3300047443 | Bacteria | 7764 |
| 710 | Ga0495675_0001615 | 3300047444 | Bacteria | 13542 |
| 711 | Ga0495677_0015881 | 3300047445 | Bacteria | 2734 |
| 712 | Ga0495679_000099 | 3300047446 | Bacteria | 79098 |
| 713 | Ga0495679_004021 | 3300047446 | Bacteria | 6911 |
| 714 | Ga0495679_007433 | 3300047446 | Bacteria | 4568 |
| 715 | Ga0495679_007460 | 3300047446 | Bacteria | 4557 |
| 716 | Ga0495679_025500 | 3300047446 | Bacteria | 1975 |
| 717 | Ga0495673_0000138 | 3300047469 | Bacteria | 130703 |
| 718 | Ga0495673_0001881 | 3300047469 | Bacteria | 15755 |
| 719 | Ga0495673_0003310 | 3300047469 | Bacteria | 10683 |
| 720 | Ga0495673_0005487 | 3300047469 | Bacteria | 7660 |
| 721 | Ga0495673_0011480 | 3300047469 | Bacteria | 4760 |
| 722 | Ga0495673_0012351 | 3300047469 | Bacteria | 4538 |
| 723 | Ga0495673_0012998 | 3300047469 | Bacteria | 4387 |
| 724 | Ga0495673_0021585 | 3300047469 | Bacteria | 3176 |
| 725 | Ga0495673_0022476 | 3300047469 | Bacteria | 3089 |
| 726 | Ga0495673_0023859 | 3300047469 | Bacteria | 2966 |
| 727 | Ga0495673_0046515 | 3300047469 | Bacteria | 1922 |
| 728 | Ga0495673_0082830 | 3300047469 | Bacteria | 1325 |
| 729 | Ga0495681_0001868 | 3300047470 | Bacteria | 15463 |
| 730 | Ga0495681_0002951 | 3300047470 | Bacteria | 12000 |
| 731 | Ga0495681_0003683 | 3300047470 | Bacteria | 10641 |
| 732 | Ga0495681_0004182 | 3300047470 | Bacteria | 9909 |
| 733 | Ga0495681_0008619 | 3300047470 | Bacteria | 6368 |
| 734 | Ga0495681_0009879 | 3300047470 | Bacteria | 5833 |
| 735 | Ga0495681_0011262 | 3300047470 | Bacteria | 5341 |
| 736 | Ga0495681_0011768 | 3300047470 | Bacteria | 5181 |
| 737 | Ga0495681_0013301 | 3300047470 | Bacteria | 4784 |
| 738 | Ga0495681_0016467 | 3300047470 | Bacteria | 4141 |
| 739 | Ga0495681_0019611 | 3300047470 | Bacteria | 3687 |
| 740 | Ga0495681_0028480 | 3300047470 | Bacteria | 2873 |
| 741 | Ga0495681_0028807 | 3300047470 | Bacteria | 2851 |
| 742 | Ga0495684_0027096 | 3300047471 | Bacteria | 4400 |
| 743 | Ga0495686_0003876 | 3300047472 | Bacteria | 12625 |
| 744 | Ga0495686_0005847 | 3300047472 | Bacteria | 9590 |
| 745 | Ga0495686_0035291 | 3300047472 | Bacteria | 3215 |
| 746 | Ga0495593_0000669 | 3300047673 | Bacteria | 19745 |
| 747 | Ga0495593_0061855 | 3300047673 | Bacteria | 1957 |
| 748 | Ga0495602_0003358 | 3300048088 | Bacteria | 16530 |
| 749 | Ga0495602_0016506 | 3300048088 | Bacteria | 7424 |
| 750 | Ga0495602_0024407 | 3300048088 | Bacteria | 5866 |
| 751 | Ga0495614_0000359 | 3300048089 | Bacteria | 18242 |
| 752 | Ga0495626_0001033 | 3300048091 | Bacteria | 23809 |
| 753 | Ga0495626_0001736 | 3300048091 | Bacteria | 16616 |
| 754 | Ga0495626_0006717 | 3300048091 | Bacteria | 6514 |
| 755 | Ga0495626_0008794 | 3300048091 | Bacteria | 5495 |
| 756 | Ga0495626_0009686 | 3300048091 | Bacteria | 5194 |
| 757 | Ga0496100_0000804 | 3300048903 | Bacteria | 15016 |
| 758 | Ga0496100_0004424 | 3300048903 | Bacteria | 7447 |
| 759 | Ga0496100_0136633 | 3300048903 | Bacteria | 1733 |
| 760 | Ga0496101_0007867 | 3300048904 | Bacteria | 6936 |
| 761 | Ga0496102_0001622 | 3300048905 | Bacteria | 19810 |
| 762 | Ga0496103_0010728 | 3300048906 | Bacteria | 5421 |
| 763 | Ga0496103_0106475 | 3300048906 | Bacteria | 1778 |
| 764 | Ga0496104_0005909 | 3300048907 | Bacteria | 10716 |
| 765 | Ga0496104_0227007 | 3300048907 | Bacteria | 1779 |
| 766 | Ga0496105_0019530 | 3300048908 | Bacteria | 5467 |
| 767 | Ga0496106_0000114 | 3300048909 | Bacteria | 61763 |
| 768 | Ga0496106_0008022 | 3300048909 | Bacteria | 7798 |
| 769 | Ga0496107_0001207 | 3300048910 | Bacteria | 15753 |
| 770 | Ga0496108_0042541 | 3300048911 | Bacteria | 3793 |
| 771 | Ga0496112_0131925 | 3300048915 | Bacteria | 2469 |
| 772 | Ga0496113_0133324 | 3300048916 | Bacteria | 1951 |
| 773 | Ga0496114_0004038 | 3300048917 | Bacteria | 11337 |
| 774 | Ga0496115_0026149 | 3300048918 | Bacteria | 4552 |
| 775 | Ga0496115_0080871 | 3300048918 | Bacteria | 2646 |
| 776 | Ga0496116_0000399 | 3300048919 | Bacteria | 63018 |
| 777 | Ga0496116_0000810 | 3300048919 | Bacteria | 39564 |
| 778 | Ga0496116_0004905 | 3300048919 | Bacteria | 12609 |
| 779 | Ga0496116_0007180 | 3300048919 | Bacteria | 9951 |
| 780 | Ga0496116_0042753 | 3300048919 | Bacteria | 3094 |
| 781 | Ga0496117_0002593 | 3300048920 | Bacteria | 22486 |
| 782 | Ga0496117_0003951 | 3300048920 | Bacteria | 16773 |
| 783 | Ga0496117_0008920 | 3300048920 | Bacteria | 9444 |
| 784 | Ga0496117_0010763 | 3300048920 | Bacteria | 8265 |
| 785 | Ga0496117_0018404 | 3300048920 | Bacteria | 5785 |
| 786 | Ga0496118_0006873 | 3300048921 | Bacteria | 12324 |
| 787 | Ga0496118_0009751 | 3300048921 | Bacteria | 9632 |
| 788 | Ga0496118_0018912 | 3300048921 | Bacteria | 6180 |
| 789 | Ga0496118_0019180 | 3300048921 | Bacteria | 6123 |
| 790 | Ga0496118_0021107 | 3300048921 | Bacteria | 5746 |
| 791 | Ga0496118_0054205 | 3300048921 | Bacteria | 3039 |
| 792 | Ga0496118_0105790 | 3300048921 | Bacteria | 1884 |
| 793 | Ga0496118_0105878 | 3300048921 | Bacteria | 1883 |
| 794 | Ga0496119_0007808 | 3300048922 | Bacteria | 9540 |
| 795 | Ga0496119_0008144 | 3300048922 | Bacteria | 9278 |
| 796 | Ga0496119_0009601 | 3300048922 | Bacteria | 8261 |
| 797 | Ga0496119_0030671 | 3300048922 | Bacteria | 3620 |
| 798 | Ga0496120_0000931 | 3300048923 | Bacteria | 40425 |
| 799 | Ga0496120_0003224 | 3300048923 | Bacteria | 15142 |
| 800 | Ga0496121_0000691 | 3300048924 | Bacteria | 62894 |
| 801 | Ga0496121_0004080 | 3300048924 | Bacteria | 20059 |
| 802 | Ga0496121_0014819 | 3300048924 | Bacteria | 8231 |
| 803 | Ga0496121_0029335 | 3300048924 | Bacteria | 5091 |
| 804 | Ga0496121_0035167 | 3300048924 | Bacteria | 4494 |
| 805 | Ga0496121_0037360 | 3300048924 | Bacteria | 4314 |
| 806 | Ga0496121_0056868 | 3300048924 | Bacteria | 3246 |
| 807 | Ga0496121_0062868 | 3300048924 | Bacteria | 3037 |
| 808 | Ga0496122_0000505 | 3300048925 | Bacteria | 80571 |
| 809 | Ga0496122_0001469 | 3300048925 | Bacteria | 37960 |
| 810 | Ga0496122_0003049 | 3300048925 | Bacteria | 22654 |
| 811 | Ga0496122_0004296 | 3300048925 | Bacteria | 17856 |
| 812 | Ga0496122_0024973 | 3300048925 | Bacteria | 5212 |
| 813 | Ga0496122_0032638 | 3300048925 | Bacteria | 4301 |
| 814 | Ga0496122_0044116 | 3300048925 | Bacteria | 3484 |
| 815 | Ga0496122_0047433 | 3300048925 | Bacteria | 3316 |
| 816 | Ga0496123_0000400 | 3300048926 | Bacteria | 80571 |
| 817 | Ga0496123_0000971 | 3300048926 | Bacteria | 44294 |
| 818 | Ga0496123_0002513 | 3300048926 | Bacteria | 22537 |
| 819 | Ga0496123_0008313 | 3300048926 | Bacteria | 9555 |
| 820 | Ga0496123_0009181 | 3300048926 | Bacteria | 8939 |
| 821 | Ga0496124_0005167 | 3300048927 | Bacteria | 14849 |
| 822 | Ga0496124_0009488 | 3300048927 | Bacteria | 10016 |
| 823 | Ga0496124_0024513 | 3300048927 | Bacteria | 5482 |
| 824 | Ga0496124_0033527 | 3300048927 | Bacteria | 4517 |
| 825 | Ga0496124_0033716 | 3300048927 | Bacteria | 4502 |
| 826 | Ga0496124_0092685 | 3300048927 | Bacteria | 2460 |
| 827 | Ga0496124_0127912 | 3300048927 | Bacteria | 2022 |
| 828 | Ga0496124_0153785 | 3300048927 | Bacteria | 1801 |
| 829 | Ga0496125_0001896 | 3300048928 | Bacteria | 28683 |
| 830 | Ga0496125_0005264 | 3300048928 | Bacteria | 14485 |
| 831 | Ga0496125_0017090 | 3300048928 | Bacteria | 6931 |
| 832 | Ga0496125_0027457 | 3300048928 | Bacteria | 5158 |
| 833 | Ga0496125_0065760 | 3300048928 | Bacteria | 2869 |
| 834 | Ga0496125_0124077 | 3300048928 | Bacteria | 1834 |
| 835 | Ga0496125_0136853 | 3300048928 | Bacteria | 1711 |
| 836 | Ga0496126_0033065 | 3300048929 | Bacteria | 4867 |
| 837 | Ga0496126_0184061 | 3300048929 | Bacteria | 1772 |
| 838 | Ga0496126_0218023 | 3300048929 | Bacteria | 1604 |
| 839 | Ga0495678_004490 | 3300049459 | Bacteria | 8055 |
| 840 | Ga0495678_006097 | 3300049459 | Bacteria | 6484 |
| 841 | Ga0495678_009727 | 3300049459 | Bacteria | 4725 |
| 842 | Ga0495678_012376 | 3300049459 | Bacteria | 4048 |
| 843 | Ga0495678_012409 | 3300049459 | Bacteria | 4042 |
| 844 | Ga0495678_013969 | 3300049459 | Bacteria | 3750 |
| 845 | Ga0495682_0003906 | 3300049460 | Bacteria | 6508 |
| 846 | Ga0495682_0004603 | 3300049460 | Bacteria | 5863 |
| 847 | Ga0495682_0005731 | 3300049460 | Bacteria | 5124 |
| 848 | Ga0495682_0014099 | 3300049460 | Bacteria | 3034 |
| 849 | Ga0501031_0000010 | 3300049568 | Bacteria | 146435 |
| 850 | Ga0501031_0006499 | 3300049568 | Bacteria | 7618 |
| 851 | Ga0501031_0075269 | 3300049568 | Bacteria | 2198 |
| 852 | Ga0501032_0000023 | 3300049569 | Bacteria | 146435 |
| 853 | Ga0501032_0001104 | 3300049569 | Bacteria | 21587 |
| 854 | Ga0501032_0057249 | 3300049569 | Bacteria | 2619 |
| 855 | Ga0501033_0000104 | 3300049570 | Bacteria | 81029 |
| 856 | Ga0501033_0001424 | 3300049570 | Bacteria | 21245 |
| 857 | Ga0501033_0020261 | 3300049570 | Bacteria | 5025 |
| 858 | Ga0501033_0077708 | 3300049570 | Bacteria | 2435 |
| 859 | Ga0501033_0098443 | 3300049570 | Bacteria | 2136 |
| 860 | Ga0501034_0000116 | 3300049571 | Bacteria | 146442 |
| 861 | Ga0501034_0061943 | 3300049571 | Bacteria | 3756 |
| 862 | Ga0501036_0000015 | 3300049572 | Bacteria | 146442 |
| 863 | Ga0501036_0001104 | 3300049572 | Bacteria | 20497 |
| 864 | Ga0501036_0025512 | 3300049572 | Bacteria | 4987 |
| 865 | Ga0501036_0134265 | 3300049572 | Bacteria | 2088 |
| 866 | Ga0501037_0000023 | 3300049573 | Bacteria | 146542 |
| 867 | Ga0501037_0023642 | 3300049573 | Bacteria | 4543 |
| 868 | Ga0501038_0000025 | 3300049574 | Bacteria | 146542 |
| 869 | Ga0501038_0035235 | 3300049574 | Bacteria | 4395 |
| 870 | Ga0501038_0055071 | 3300049574 | Bacteria | 3418 |
| 871 | Ga0501038_0057467 | 3300049574 | Bacteria | 3340 |
| 872 | Ga0501039_0000037 | 3300049575 | Bacteria | 122286 |
| 873 | Ga0501039_0072647 | 3300049575 | Bacteria | 2673 |
| 874 | Ga0501040_0005598 | 3300049576 | Bacteria | 8116 |
| 875 | Ga0501043_0000070 | 3300049579 | Bacteria | 89839 |
| 876 | Ga0501043_0006747 | 3300049579 | Bacteria | 9166 |
| 877 | Ga0501047_0001244 | 3300049581 | Bacteria | 25242 |
| 878 | Ga0501047_0002705 | 3300049581 | Bacteria | 16870 |
| 879 | Ga0501067_0057993 | 3300049583 | Bacteria | 2144 |
| 880 | Ga0501070_0067260 | 3300049586 | Bacteria | 2967 |
| 881 | Ga0501076_0110937 | 3300049592 | Bacteria | 2217 |
| 882 | Ga0501083_0011128 | 3300049744 | Bacteria | 6317 |
| 883 | Ga0501035_0000074 | 3300049822 | Bacteria | 122269 |
| 884 | Ga0501035_0003834 | 3300049822 | Bacteria | 14328 |
| 885 | Ga0501035_0025760 | 3300049822 | Bacteria | 5390 |
| 886 | Ga0501035_0028382 | 3300049822 | Bacteria | 5108 |
| 887 | Ga0501044_0000069 | 3300049823 | Bacteria | 125974 |
| 888 | Ga0501044_0002371 | 3300049823 | Bacteria | 21455 |
| 889 | Ga0501044_0037706 | 3300049823 | Bacteria | 5051 |
| 890 | nmdc:mga03n38_4231_c2 | 3300050490 | Bacteria | 2982 |
| 891 | nmdc:mga00v17_99760_c1 | 3300050491 | Bacteria | 1832 |
| 892 | nmdc:mga0yw44_85201_c1 | 3300050492 | Bacteria | 1988 |
| 893 | nmdc:mga06z11_17879_c1 | 3300050494 | Bacteria | 3228 |
| 894 | nmdc:mga07m45_2758_c1 | 3300050496 | Bacteria | 8286 |
| 895 | nmdc:mga06r32_15033_c1 | 3300050510 | Bacteria | 7027 |
| 896 | nmdc:mga0sz30_18129_c1 | 3300050516 | Bacteria | 2814 |
| 897 | Ga0500647_0001267 | 3300053091 | Bacteria | 8446 |
| 898 | Ga0500647_0002844 | 3300053091 | Bacteria | 6595 |
| 899 | Ga0500608_006037 | 3300053122 | Bacteria | 4884 |
| 900 | Ga0500618_000529 | 3300053125 | Bacteria | 23895 |
| 901 | Ga0500618_000872 | 3300053125 | Bacteria | 16107 |
| 902 | Ga0500642_0001809 | 3300053130 | Bacteria | 6172 |
| 903 | Ga0500658_0019773 | 3300053134 | Bacteria | 2537 |
| 904 | Ga0500564_002158 | 3300053138 | Bacteria | 7154 |
| 905 | Ga0500634_0007749 | 3300053161 | Bacteria | 5325 |
| 906 | Ga0500638_000044 | 3300053162 | Bacteria | 29743 |
| 907 | Ga0500636_0000373 | 3300053177 | Bacteria | 24563 |
| 908 | Ga0501082_0100338 | 3300060353 | Bacteria | 2504 |
| 909 | Ga0501082_0118143 | 3300060353 | Bacteria | 2297 |
| 910 | Ga0530510_0070798 | 3300061734 | Bacteria | 2531 |
| 911 | 2888340291 | 2888337043 | Bacteria | 6629336 |
| 912 | 2501075475 | 2501025501 | Bacteria | 7768574 |
| 913 | 2501410816 | 2501025504 | Bacteria | 8008976 |
| 914 | 2511096725 | 2510917014 | Bacteria | 8296963 |
| 915 | 2511102646 | 2510917015 | Bacteria | 7950052 |
| 916 | 2511256488 | 2511231004 | Bacteria | 6669789 |
| 917 | 2511256489 | 2511231004 | Bacteria | 6669789 |
| 918 | 2511265803 | 2511231006 | Bacteria | 6794709 |
| 919 | 2511265804 | 2511231006 | Bacteria | 6794709 |
| 920 | 2511280955 | 2511231008 | Bacteria | 6624100 |
| 921 | 2511280956 | 2511231008 | Bacteria | 6624100 |
| 922 | 2511287949 | 2511231010 | Bacteria | 6373152 |
| 923 | 2511287950 | 2511231010 | Bacteria | 6373152 |
| 924 | 2511298520 | 2511231011 | Bacteria | 6149768 |
| 925 | 2511298521 | 2511231011 | Bacteria | 6149768 |
| 926 | 2511301589 | 2511231012 | Bacteria | 6738011 |
| 927 | 2511301590 | 2511231012 | Bacteria | 6738011 |
| 928 | 2511314219 | 2511231014 | Bacteria | 6462302 |
| 929 | 2511314220 | 2511231014 | Bacteria | 6462302 |
| 930 | 2511319034 | 2511231015 | Bacteria | 6598026 |
| 931 | 2511319035 | 2511231015 | Bacteria | 6598026 |
| 932 | 2511323817 | 2511231016 | Bacteria | 6704427 |
| 933 | 2511323818 | 2511231016 | Bacteria | 6704427 |
| 934 | 2511332966 | 2511231017 | Bacteria | 6503007 |
| 935 | 2511332967 | 2511231017 | Bacteria | 6503007 |
| 936 | 2511337785 | 2511231018 | Bacteria | 6436256 |
| 937 | 2511337786 | 2511231018 | Bacteria | 6436256 |
| 938 | 2511343541 | 2511231019 | Bacteria | 6520662 |
| 939 | 2511343542 | 2511231019 | Bacteria | 6520662 |
| 940 | 2511348824 | 2511231020 | Bacteria | 6115223 |
| 941 | 2511348825 | 2511231020 | Bacteria | 6115223 |
| 942 | 2511355871 | 2511231021 | Bacteria | 7302637 |
| 943 | 2511363821 | 2511231022 | Bacteria | 6719296 |
| 944 | 2511363822 | 2511231022 | Bacteria | 6719296 |
| 945 | 2511371710 | 2511231023 | Bacteria | 6808468 |
| 946 | 2511371711 | 2511231023 | Bacteria | 6808468 |
| 947 | 2511375196 | 2511231024 | Bacteria | 5835885 |
| 948 | 2511410584 | 2511231031 | Bacteria | 6558529 |
| 949 | 2511410585 | 2511231031 | Bacteria | 6558529 |
| 950 | 2511823258 | 2511231156 | Bacteria | 6845832 |
| 951 | 2512327464 | 2512047018 | Bacteria | 6663241 |
| 952 | 2512327465 | 2512047018 | Bacteria | 6663241 |
| 953 | 2513613800 | 2513237090 | Bacteria | 7096802 |
| 954 | 2514052024 | 2513237166 | Bacteria | 10373764 |
| 955 | 2514417995 | 2513237305 | Bacteria | 7293571 |
| 956 | 2517566855 | 2517487022 | Bacteria | 7227575 |
| 957 | 2524454219 | 2524023207 | Bacteria | 6813453 |
| 958 | 2527076467 | 2526164713 | Bacteria | 6780608 |
| 959 | 2555246832 | 2554235231 | Bacteria | 5215788 |
| 960 | 2555246833 | 2554235231 | Bacteria | 5215788 |
| 961 | 2555671652 | 2554235341 | Bacteria | 6867980 |
| 962 | 2555671653 | 2554235341 | Bacteria | 6867980 |
| 963 | 2583794129 | 2582580891 | Bacteria | 6800976 |
| 964 | 2583794130 | 2582580891 | Bacteria | 6800976 |
| 965 | 2585276546 | 2582581307 | Bacteria | 6597605 |
| 966 | 2585283423 | 2582581308 | Bacteria | 7413247 |
| 967 | 2585329104 | 2582581315 | Bacteria | 7318924 |
| 968 | 2585333303 | 2582581316 | Bacteria | 7774528 |
| 969 | 2585537145 | 2585427527 | Bacteria | 7273426 |
| 970 | 2585557051 | 2585427530 | Bacteria | 7383882 |
| 971 | 2585900914 | 2585427608 | Bacteria | 6544331 |
| 972 | 2588518034 | 2588253730 | Bacteria | 6881675 |
| 973 | 2597859721 | 2597489887 | Bacteria | 6666321 |
| 974 | 2597859722 | 2597489887 | Bacteria | 6666321 |
| 975 | 2597865636 | 2597489888 | Bacteria | 6179543 |
| 976 | 2597865637 | 2597489888 | Bacteria | 6179543 |
| 977 | 2597871445 | 2597489889 | Bacteria | 6297495 |
| 978 | 2597871446 | 2597489889 | Bacteria | 6297495 |
| 979 | 2599354193 | 2599185160 | Bacteria | 6844013 |
| 980 | 2599354194 | 2599185160 | Bacteria | 6844013 |
| 981 | 2599360129 | 2599185161 | Bacteria | 6960462 |
| 982 | 2599360130 | 2599185161 | Bacteria | 6960462 |
| 983 | 2599366451 | 2599185162 | Bacteria | 6957254 |
| 984 | 2599366452 | 2599185162 | Bacteria | 6957254 |
| 985 | 2599373241 | 2599185163 | Bacteria | 6995158 |
| 986 | 2599373242 | 2599185163 | Bacteria | 6995158 |
| 987 | 2599379301 | 2599185164 | Bacteria | 6841688 |
| 988 | 2599379302 | 2599185164 | Bacteria | 6841688 |
| 989 | 2599385720 | 2599185165 | Bacteria | 6843250 |
| 990 | 2599385721 | 2599185165 | Bacteria | 6843250 |
| 991 | 2599392100 | 2599185166 | Bacteria | 6959206 |
| 992 | 2599392101 | 2599185166 | Bacteria | 6959206 |
| 993 | 2599399988 | 2599185167 | Bacteria | 6353609 |
| 994 | 2599399989 | 2599185167 | Bacteria | 6353609 |
| 995 | 2599403866 | 2599185168 | Bacteria | 6997636 |
| 996 | 2599403867 | 2599185168 | Bacteria | 6997636 |
| 997 | 2599452808 | 2599185179 | Bacteria | 6611171 |
| 998 | 2599452809 | 2599185179 | Bacteria | 6611171 |
| 999 | 2599461027 | 2599185181 | Bacteria | 6844519 |
| 1000 | 2599461028 | 2599185181 | Bacteria | 6844519 |
| 1001 | 2599469569 | 2599185182 | Bacteria | 6883168 |
| 1002 | 2599469570 | 2599185182 | Bacteria | 6883168 |
| 1003 | 2599482550 | 2599185185 | Bacteria | 6652270 |
| 1004 | 2599482551 | 2599185185 | Bacteria | 6652270 |
| 1005 | 2599490047 | 2599185186 | Bacteria | 6831633 |
| 1006 | 2599490048 | 2599185186 | Bacteria | 6831633 |
| 1007 | 2599510128 | 2599185189 | Bacteria | 5862825 |
| 1008 | 2599510129 | 2599185189 | Bacteria | 5862825 |
| 1009 | 2599514442 | 2599185190 | Bacteria | 6285678 |
| 1010 | 2599514443 | 2599185190 | Bacteria | 6285678 |
| 1011 | 2599520663 | 2599185191 | Bacteria | 6297582 |
| 1012 | 2599520664 | 2599185191 | Bacteria | 6297582 |
| 1013 | 2599614925 | 2599185212 | Bacteria | 6765997 |
| 1014 | 2599770547 | 2599185248 | Bacteria | 6696816 |
| 1015 | 2599803728 | 2599185257 | Bacteria | 6492581 |
| 1016 | 2599803729 | 2599185257 | Bacteria | 6492581 |
| 1017 | 2599882038 | 2599185288 | Bacteria | 6666191 |
| 1018 | 2599882039 | 2599185288 | Bacteria | 6666191 |
| 1019 | 2599886432 | 2599185289 | Bacteria | 6778765 |
| 1020 | 2599893818 | 2599185290 | Bacteria | 6289611 |
| 1021 | 2599893819 | 2599185290 | Bacteria | 6289611 |
| 1022 | 2599896797 | 2599185291 | Bacteria | 6775623 |
| 1023 | 2599944229 | 2599185302 | Bacteria | 5954930 |
| 1024 | 2599946209 | 2599185302 | Bacteria | 5954930 |
| 1025 | 2599950064 | 2599185303 | Bacteria | 6512725 |
| 1026 | 2599950065 | 2599185303 | Bacteria | 6512725 |
| 1027 | 2599954701 | 2599185304 | Bacteria | 5951361 |
| 1028 | 2599957198 | 2599185304 | Bacteria | 5951361 |
| 1029 | 2599959668 | 2599185305 | Bacteria | 6748700 |
| 1030 | 2599969763 | 2599185306 | Bacteria | 6637356 |
| 1031 | 2599981284 | 2599185308 | Bacteria | 6621546 |
| 1032 | 2599996455 | 2599185311 | Bacteria | 6354990 |
| 1033 | 2600006517 | 2599185313 | Bacteria | 6658188 |
| 1034 | 2600015091 | 2599185314 | Bacteria | 6621749 |
| 1035 | 2600016862 | 2599185315 | Bacteria | 6771107 |
| 1036 | 2600024103 | 2599185316 | Bacteria | 6320029 |
| 1037 | 2600031127 | 2599185317 | Bacteria | 6435722 |
| 1038 | 2600035286 | 2599185318 | Bacteria | 6961590 |
| 1039 | 2600042739 | 2599185319 | Bacteria | 6637840 |
| 1040 | 2600053757 | 2599185321 | Bacteria | 6764560 |
| 1041 | 2600058237 | 2599185322 | Bacteria | 6763055 |
| 1042 | 2600064086 | 2599185323 | Bacteria | 6688755 |
| 1043 | 2600072913 | 2599185324 | Bacteria | 6590677 |
| 1044 | 2600078533 | 2599185325 | Bacteria | 6324919 |
| 1045 | 2600213641 | 2599185356 | Bacteria | 6843884 |
| 1046 | 2600213642 | 2599185356 | Bacteria | 6843884 |
| 1047 | 2600360184 | 2600254930 | Bacteria | 6431253 |
| 1048 | 2600364623 | 2600254931 | Bacteria | 6734225 |
| 1049 | 2600364624 | 2600254931 | Bacteria | 6734225 |
| 1050 | 2600445693 | 2600254954 | Bacteria | 5100516 |
| 1051 | 2601692909 | 2600255296 | Bacteria | 5784754 |
| 1052 | 2601692910 | 2600255296 | Bacteria | 5784754 |
| 1053 | 2601773809 | 2600255313 | Bacteria | 6842543 |
| 1054 | 2601773810 | 2600255313 | Bacteria | 6842543 |
| 1055 | 2601796655 | 2600255318 | Bacteria | 6383414 |
| 1056 | 2601796656 | 2600255318 | Bacteria | 6383414 |
| 1057 | 2602012606 | 2600255389 | Bacteria | 5275336 |
| 1058 | 2606073805 | 2603880185 | Bacteria | 6379190 |
| 1059 | 2606073806 | 2603880185 | Bacteria | 6379190 |
| 1060 | 2606126549 | 2603880199 | Bacteria | 6377649 |
| 1061 | 2606126550 | 2603880199 | Bacteria | 6377649 |
| 1062 | 2616312559 | 2615840626 | Bacteria | 7921970 |
| 1063 | 2621297881 | 2619619299 | Bacteria | 6649820 |
| 1064 | 2621297882 | 2619619299 | Bacteria | 6649820 |
| 1065 | 2624482356 | 2623620443 | Bacteria | 6427864 |
| 1066 | 2624482357 | 2623620443 | Bacteria | 6427864 |
| 1067 | 2643772645 | 2643221550 | Bacteria | 4619371 |
| 1068 | 2643841370 | 2643221565 | Bacteria | 6216018 |
| 1069 | 2643873775 | 2643221571 | Bacteria | 6228673 |
| 1070 | 2643873776 | 2643221571 | Bacteria | 6228673 |
| 1071 | 2643955154 | 2643221589 | Bacteria | 6250934 |
| 1072 | 2643955155 | 2643221589 | Bacteria | 6250934 |
| 1073 | 2643988291 | 2643221595 | Bacteria | 6565519 |
| 1074 | 2644023509 | 2643221602 | Bacteria | 6249926 |
| 1075 | 2644023510 | 2643221602 | Bacteria | 6249926 |
| 1076 | 2644132282 | 2643221623 | Bacteria | 5239945 |
| 1077 | 2644156994 | 2643221627 | Bacteria | 6761570 |
| 1078 | 2644202713 | 2643221636 | Bacteria | 6583769 |
| 1079 | 2644207730 | 2643221637 | Bacteria | 5345260 |
| 1080 | 2644282339 | 2643221650 | Bacteria | 7029547 |
| 1081 | 2644624920 | 2643221713 | Bacteria | 6554480 |
| 1082 | 2644624921 | 2643221713 | Bacteria | 6554480 |
| 1083 | 2644651819 | 2643221718 | Bacteria | 5345506 |
| 1084 | 2652546850 | 2651869719 | Bacteria | 6047974 |
| 1085 | 2671092153 | 2667528170 | Bacteria | 6786960 |
| 1086 | 2671096773 | 2667528171 | Bacteria | 6900659 |
| 1087 | 2671096774 | 2667528171 | Bacteria | 6900659 |
| 1088 | 2671116279 | 2667528174 | Bacteria | 6435400 |
| 1089 | 2671127626 | 2667528176 | Bacteria | 6724917 |
| 1090 | 2671770703 | 2671180172 | Bacteria | 6495783 |
| 1091 | 2671770704 | 2671180172 | Bacteria | 6495783 |
| 1092 | 2677897816 | 2675903420 | Bacteria | 6247433 |
| 1093 | 2677897817 | 2675903420 | Bacteria | 6247433 |
| 1094 | 2678261804 | 2675903515 | Bacteria | 6580491 |
| 1095 | 2678261805 | 2675903515 | Bacteria | 6580491 |
| 1096 | 2694631731 | 2693429783 | Bacteria | 7019804 |
| 1097 | 2694638027 | 2693429784 | Bacteria | 7241525 |
| 1098 | 2715750355 | 2713897148 | Bacteria | 5883533 |
| 1099 | 2715750356 | 2713897148 | Bacteria | 5883533 |
| 1100 | 2715755253 | 2713897149 | Bacteria | 6506249 |
| 1101 | 2715755254 | 2713897149 | Bacteria | 6506249 |
| 1102 | 2718635535 | 2718217725 | Bacteria | 5758958 |
| 1103 | 2718635536 | 2718217725 | Bacteria | 5758958 |
| 1104 | 2723250360 | 2721755607 | Bacteria | 5841722 |
| 1105 | 2723250361 | 2721755607 | Bacteria | 5841722 |
| 1106 | 2723578411 | 2721755686 | Bacteria | 7343952 |
| 1107 | 2738670765 | 2738541265 | Bacteria | 6594665 |
| 1108 | 2738670766 | 2738541265 | Bacteria | 6594665 |
| 1109 | 2738749158 | 2738541282 | Bacteria | 6593925 |
| 1110 | 2738749159 | 2738541282 | Bacteria | 6593925 |
| 1111 | 2738811644 | 2738541294 | Bacteria | 6925949 |
| 1112 | 2738811645 | 2738541294 | Bacteria | 6925949 |
| 1113 | 2738858200 | 2738541303 | Bacteria | 6591772 |
| 1114 | 2738858201 | 2738541303 | Bacteria | 6591772 |
| 1115 | 2738899004 | 2738541309 | Bacteria | 6926455 |
| 1116 | 2738899005 | 2738541309 | Bacteria | 6926455 |
| 1117 | 2739196746 | 2738543004 | Bacteria | 6381073 |
| 1118 | 2739257722 | 2738543015 | Bacteria | 6750701 |
| 1119 | 2739257723 | 2738543015 | Bacteria | 6750701 |
| 1120 | 2739287604 | 2738543020 | Bacteria | 5718238 |
| 1121 | 2739292917 | 2738543021 | Bacteria | 5718241 |
| 1122 | 2739313413 | 2738543025 | Bacteria | 6600348 |
| 1123 | 2739313414 | 2738543025 | Bacteria | 6600348 |
| 1124 | 2743739271 | 2740892503 | Bacteria | 6855563 |
| 1125 | 2743739272 | 2740892503 | Bacteria | 6855563 |
| 1126 | 2745008153 | 2744054620 | Bacteria | 6551379 |
| 1127 | 2745008154 | 2744054620 | Bacteria | 6551379 |
| 1128 | 2756677897 | 2756170246 | Bacteria | 7451806 |
| 1129 | 2774133238 | 2773857673 | Bacteria | 6513460 |
| 1130 | 2774133239 | 2773857673 | Bacteria | 6513460 |
| 1131 | 2784262899 | 2784132063 | Bacteria | 6262788 |
| 1132 | 2784262900 | 2784132063 | Bacteria | 6262788 |
| 1133 | 2792629386 | 2791355092 | Bacteria | 6248105 |
| 1134 | 2794594618 | 2791355520 | Bacteria | 5948615 |
| 1135 | 2807409965 | 2806310737 | Bacteria | 5751088 |
| 1136 | 2807409966 | 2806310737 | Bacteria | 5751088 |
| 1137 | 2807458312 | 2806310745 | Bacteria | 5742165 |
| 1138 | 2807458313 | 2806310745 | Bacteria | 5742165 |
| 1139 | 2808856413 | 2808606361 | Bacteria | 6136259 |
| 1140 | 2808931371 | 2808606377 | Bacteria | 6646337 |
| 1141 | 2808936439 | 2808606378 | Bacteria | 6177535 |
| 1142 | 2808953493 | 2808606381 | Bacteria | 6646461 |
| 1143 | 2808958701 | 2808606382 | Bacteria | 6841132 |
| 1144 | 2808964860 | 2808606383 | Bacteria | 6138645 |
| 1145 | 2808979613 | 2808606385 | Bacteria | 6711065 |
| 1146 | 2808979614 | 2808606385 | Bacteria | 6711065 |
| 1147 | 2808995116 | 2808606388 | Bacteria | 6706662 |
| 1148 | 2808995117 | 2808606388 | Bacteria | 6706662 |
| 1149 | 2808999752 | 2808606389 | Bacteria | 6138126 |
| 1150 | 2809219426 | 2808606445 | Bacteria | 6057339 |
| 1151 | 2809219427 | 2808606445 | Bacteria | 6057339 |
| 1152 | 2817492983 | 2816332298 | Bacteria | 6852809 |
| 1153 | 2817492984 | 2816332298 | Bacteria | 6852809 |
| 1154 | 2819642438 | 2818991453 | Bacteria | 7181617 |
| 1155 | 2819656031 | 2818991456 | Bacteria | 6123676 |
| 1156 | 2819656032 | 2818991456 | Bacteria | 6123676 |
| 1157 | 2819701866 | 2818991464 | Bacteria | 6907494 |
| 1158 | 2819701867 | 2818991464 | Bacteria | 6907494 |
| 1159 | 2823424071 | 2823421272 | Bacteria | 5372474 |
| 1160 | 2825653471 | 2825651385 | Bacteria | 6715909 |
| 1161 | 2825653472 | 2825651385 | Bacteria | 6715909 |
| 1162 | 2834031410 | 2834028612 | Bacteria | 6354979 |
| 1163 | 2834031411 | 2834028612 | Bacteria | 6354979 |
| 1164 | 2842805875 | 2842805378 | Bacteria | 5385175 |
| 1165 | 2842832127 | 2842826826 | Bacteria | 5974129 |
| 1166 | 2842832128 | 2842826826 | Bacteria | 5974129 |
| 1167 | 2842837211 | 2842832357 | Bacteria | 5959113 |
| 1168 | 2842837212 | 2842832357 | Bacteria | 5959113 |
| 1169 | 2842840720 | 2842837860 | Bacteria | 6066181 |
| 1170 | 2842840721 | 2842837860 | Bacteria | 6066181 |
| 1171 | 2842845008 | 2842843487 | Bacteria | 6004777 |
| 1172 | 2842845009 | 2842843487 | Bacteria | 6004777 |
| 1173 | 2842857024 | 2842854478 | Bacteria | 6143501 |
| 1174 | 2844004905 | 2844002411 | Bacteria | 7168230 |
| 1175 | 2844672175 | 2844665904 | Bacteria | 6817974 |
| 1176 | 2844672176 | 2844665904 | Bacteria | 6817974 |
| 1177 | 2846958398 | 2846952575 | Bacteria | 6587527 |
| 1178 | 2852612625 | 2852612431 | Bacteria | 6885235 |
| 1179 | 2852612626 | 2852612431 | Bacteria | 6885235 |
| 1180 | 2852660902 | 2852657418 | Bacteria | 6472974 |
| 1181 | 2852660903 | 2852657418 | Bacteria | 6472974 |
| 1182 | 2852669638 | 2852667396 | Bacteria | 6885555 |
| 1183 | 2852669639 | 2852667396 | Bacteria | 6885555 |
| 1184 | 2854915469 | 2854911287 | Bacteria | 5582813 |
| 1185 | 2856343043 | 2856342000 | Bacteria | 7176905 |
| 1186 | 2856363564 | 2856356410 | Bacteria | 6297484 |
| 1187 | 2857354093 | 2857349434 | Bacteria | 7926032 |
| 1188 | 2857366033 | 2857357740 | Bacteria | 9937880 |
| 1189 | 2860341210 | 2860339153 | Bacteria | 6846989 |
| 1190 | 2860872069 | 2860867994 | Bacteria | 5645326 |
| 1191 | 2860872070 | 2860867994 | Bacteria | 5645326 |
| 1192 | 2869162967 | 2869162929 | Bacteria | 6399702 |
| 1193 | 2871471149 | 2871466892 | Bacteria | 6923287 |
| 1194 | 2871492319 | 2871488783 | Bacteria | 6929816 |
| 1195 | 2874128032 | 2874123672 | Bacteria | 7238285 |
| 1196 | 2878034280 | 2878029506 | Bacteria | 6418441 |
| 1197 | 2878034281 | 2878029506 | Bacteria | 6418441 |
| 1198 | 2878759667 | 2878753008 | Bacteria | 6922523 |
| 1199 | 2878785400 | 2878781027 | Bacteria | 6834456 |
| 1200 | 2880234908 | 2880230671 | Bacteria | 6140320 |
| 1201 | 2880234909 | 2880230671 | Bacteria | 6140320 |
| 1202 | 2881849472 | 2881845957 | Bacteria | 6611900 |
| 1203 | 2881865749 | 2881861095 | Bacteria | 7128710 |
| 1204 | 2882912578 | 2882912400 | Bacteria | 6801539 |
| 1205 | 2883091307 | 2883087390 | Bacteria | 9532701 |
| 1206 | 2883357702 | 2883354860 | Bacteria | 5865246 |
| 1207 | 2885308167 | 2885305155 | Bacteria | 7348390 |
| 1208 | 2885316169 | 2885312484 | Bacteria | 6415165 |
| 1209 | 2885322230 | 2885318864 | Bacteria | 6729568 |
| 1210 | 2885328914 | 2885326080 | Bacteria | 7134805 |
| 1211 | 2885334511 | 2885334103 | Bacteria | 7216818 |
| 1212 | 2888352029 | 2888350351 | Bacteria | 7372807 |
| 1213 | 2889014015 | 2889010040 | Bacteria | 6749192 |
| 1214 | 2889021278 | 2889016732 | Bacteria | 6700763 |
| 1215 | 2903496950 | 2903492973 | Bacteria | 13473544 |
| 1216 | 2904522239 | 2904518522 | Bacteria | 6068986 |
| 1217 | 2904522240 | 2904518522 | Bacteria | 6068986 |
| 1218 | 2904553764 | 2904550169 | Bacteria | 6221258 |
| 1219 | 2904553765 | 2904550169 | Bacteria | 6221258 |
| 1220 | 2906328780 | 2906328253 | Bacteria | 6585166 |
| 1221 | 2906360606 | 2906354277 | Bacteria | 6991324 |
| 1222 | 2906383954 | 2906378014 | Bacteria | 6911440 |
| 1223 | 2908451571 | 2908446538 | Bacteria | 6829095 |
| 1224 | 2908451572 | 2908446538 | Bacteria | 6829095 |
| 1225 | 2912964815 | 2912963787 | Bacteria | 5646108 |
| 1226 | 2912964816 | 2912963787 | Bacteria | 5646108 |
| 1227 | 2917075522 | 2917070673 | Bacteria | 6868303 |
| 1228 | 2917075523 | 2917070673 | Bacteria | 6868303 |
| 1229 | 2919066656 | 2919063839 | Bacteria | 6302690 |
| 1230 | 2919066657 | 2919063839 | Bacteria | 6302690 |
| 1231 | 2919388357 | 2919385768 | Bacteria | 5897293 |
| 1232 | 2919388358 | 2919385768 | Bacteria | 5897293 |
| 1233 | 2919459303 | 2919456309 | Bacteria | 6586567 |
| 1234 | 2919459304 | 2919456309 | Bacteria | 6586567 |
| 1235 | 2919483062 | 2919481497 | Bacteria | 6907839 |
| 1236 | 2919493150 | 2919487758 | Bacteria | 5929766 |
| 1237 | 2919493151 | 2919487758 | Bacteria | 5929766 |
| 1238 | 2919493277 | 2919493220 | Bacteria | 4598500 |
| 1239 | 2919503768 | 2919501602 | Bacteria | 5286340 |
| 1240 | 2919543103 | 2919543075 | Bacteria | 4728703 |
| 1241 | 2922136041 | 2922130491 | Bacteria | 7173936 |
| 1242 | 2922155266 | 2922151315 | Bacteria | 6902399 |
| 1243 | 2922190737 | 2922185730 | Bacteria | 7113964 |
| 1244 | 2923158354 | 2923153595 | Bacteria | 6870622 |
| 1245 | 2923158355 | 2923153595 | Bacteria | 6870622 |
| 1246 | 2923528333 | 2923525760 | Bacteria | 4472324 |
| 1247 | 2923590725 | 2923586266 | Bacteria | 6565975 |
| 1248 | 2924734129 | 2924733363 | Bacteria | 7574837 |
| 1249 | 2924785334 | 2924784321 | Bacteria | 7416538 |
| 1250 | 2926065660 | 2926063275 | Bacteria | 5285848 |
| 1251 | 2926760170 | 2926754445 | Bacteria | 5964435 |
| 1252 | 2928158953 | 2928157003 | Bacteria | 7522202 |
| 1253 | 2928167774 | 2928163908 | Bacteria | 7561269 |
| 1254 | 2928525649 | 2928521798 | Bacteria | 4960112 |
| 1255 | 2929145597 | 2929144301 | Bacteria | 6622272 |
| 1256 | 2929194145 | 2929189879 | Bacteria | 5930554 |
| 1257 | 2929194146 | 2929189879 | Bacteria | 5930554 |
| 1258 | 2931371071 | 2931369376 | Bacteria | 6847892 |
| 1259 | 2931395460 | 2931390751 | Bacteria | 6273349 |
| 1260 | 2931395461 | 2931390751 | Bacteria | 6273349 |
| 1261 | 2931396945 | 2931396565 | Bacteria | 7251677 |
| 1262 | 2935356508 | 2935353572 | Unclassified | 6955622 |
| 1263 | 2935356509 | 2935353572 | Unclassified | 6955622 |
| 1264 | 2937849078 | 2937848649 | Bacteria | 6983481 |
| 1265 | 2938019213 | 2938014810 | Bacteria | 6700592 |
| 1266 | 2939637209 | 2939636861 | Bacteria | 6297853 |
| 1267 | 2939637210 | 2939636861 | Bacteria | 6297853 |
| 1268 | 2939652316 | 2939651529 | Bacteria | 5895393 |
| 1269 | 2939652317 | 2939651529 | Bacteria | 5895393 |
| 1270 | 2945931868 | 2945928738 | Bacteria | 6053221 |
| 1271 | 2945931869 | 2945928738 | Bacteria | 6053221 |
| 1272 | 2945965557 | 2945961074 | Bacteria | 7342064 |
| 1273 | 2945965558 | 2945961074 | Bacteria | 7342064 |
| 1274 | 2946007964 | 2946006987 | Bacteria | 6705746 |
| 1275 | 2946007965 | 2946006987 | Bacteria | 6705746 |
| 1276 | 2946032658 | 2946027586 | Bacteria | 6049274 |
| 1277 | 2946032659 | 2946027586 | Bacteria | 6049274 |
| 1278 | 2947233421 | 2947233263 | Bacteria | 6439278 |
| 1279 | 2947233422 | 2947233263 | Bacteria | 6439278 |
| 1280 | 2958106355 | 2958100919 | Bacteria | 6800575 |
| 1281 | 2958176412 | 2958172287 | Bacteria | 6716688 |
| 1282 | 2961173607 | 2961170736 | Bacteria | 7072258 |
| 1283 | 2965116277 | 2965110997 | Bacteria | 6693150 |
| 1284 | 2965121266 | 2965119406 | Bacteria | 6956431 |
| 1285 | 2968005797 | 2968003550 | Bacteria | 6929263 |
| 1286 | 2968120368 | 2968117919 | Bacteria | 6536078 |
| 1287 | 2969309063 | 2969304461 | Bacteria | 6601805 |
| 1288 | 2969309064 | 2969304461 | Bacteria | 6601805 |
| 1289 | 2970495966 | 2970489779 | Bacteria | 6517260 |
| 1290 | 2970506199 | 2970503327 | Bacteria | 7099517 |
| 1291 | 2970543484 | 2970540015 | Bacteria | 6977556 |
| 1292 | 2974289568 | 2974289157 | Bacteria | 6080362 |
| 1293 | 2974289569 | 2974289157 | Bacteria | 6080362 |
| 1294 | 2977828189 | 2977821940 | Bacteria | 6906439 |
| 1295 | 2977834685 | 2977828996 | Bacteria | 7007971 |
| 1296 | 2977923144 | 2977922695 | Bacteria | 6956781 |
| 1297 | 2977949754 | 2977942078 | Bacteria | 7570577 |
| 1298 | 2977973135 | 2977971508 | Bacteria | 7472917 |
| 1299 | 2977992622 | 2977986579 | Bacteria | 6581278 |
| 1300 | 2979714350 | 2979710463 | Bacteria | 6785254 |
| 1301 | 2979745227 | 2979742915 | Bacteria | 7301278 |
| 1302 | 2979810921 | 2979808191 | Bacteria | 7179355 |
| 1303 | 2984287835 | 2984286254 | Bacteria | 6702062 |
| 1304 | 2984287836 | 2984286254 | Bacteria | 6702062 |
| 1305 | 2987642497 | 2987636660 | Bacteria | 8088555 |
| 1306 | 2987653946 | 2987652177 | Bacteria | 6969023 |
| 1307 | 2987680064 | 2987673487 | Bacteria | 6884027 |
| 1308 | 2989351348 | 2989349275 | Bacteria | 6349068 |
| 1309 | 2989774530 | 2989771324 | Bacteria | 5605128 |
| 1310 | 2990710567 | 2990703756 | Bacteria | 7715990 |
| 1311 | 2998144346 | 2998139840 | Bacteria | 6073514 |
| 1312 | 2998144347 | 2998139840 | Bacteria | 6073514 |
| 1313 | 3004210578 | 3004203850 | Bacteria | 7307914 |
| 1314 | 3004211626 | 3004211236 | Bacteria | 7417683 |
| 1315 | 3004218873 | 3004218560 | Bacteria | 7421728 |
| 1316 | 3004272269 | 3004268573 | Bacteria | 7043476 |
| 1317 | 3005419017 | 3005416602 | Bacteria | 7064308 |
| 1318 | 3007397644 | 3007395558 | Bacteria | 6755444 |
| 1319 | 3007397645 | 3007395558 | Bacteria | 6755444 |
| 1320 | 3007420854 | 3007419365 | Bacteria | 7026924 |
| 1321 | 3007516128 | 3007511990 | Bacteria | 6481491 |
| 1322 | 3007516129 | 3007511990 | Bacteria | 6481491 |
| 1323 | 3007615354 | 3007614139 | Bacteria | 6053559 |
| 1324 | 3007620381 | 3007619802 | Bacteria | 6411688 |
| 1325 | 3007620382 | 3007619802 | Bacteria | 6411688 |
| 1326 | 3007720065 | 3007718800 | Bacteria | 5971527 |
| 1327 | 3007720066 | 3007718800 | Bacteria | 5971527 |
| 1328 | 3007858670 | 3007855910 | Bacteria | 5637581 |
| 1329 | 3007858671 | 3007855910 | Bacteria | 5637581 |
| 1330 | 3007865801 | 3007861166 | Bacteria | 6045338 |
| 1331 | 3007865802 | 3007861166 | Bacteria | 6045338 |
| 1332 | 637321970 | 637000220 | Bacteria | 7074893 |
| 1333 | 637321971 | 637000220 | Bacteria | 7074893 |
| 1334 | 642425049 | 641736151 | Bacteria | 7477263 |
| 1335 | 642592868 | 642555112 | Bacteria | 8676562 |
| 1336 | 8004381169 | 8004374579 | Bacteria | 6898112 |
| 1337 | 8005320800 | 8005314921 | Bacteria | 7072929 |
| 1338 | 8005645550 | 8005645114 | Bacteria | 6950293 |
| 1339 | 8005685606 | 8005682033 | Bacteria | 6726518 |
| 1340 | 8015692430 | 8015687852 | Bacteria | 6613826 |
| 1341 | 8015692431 | 8015687852 | Bacteria | 6613826 |
| 1342 | 8019773895 | 8019769354 | Bacteria | 6924660 |
| 1343 | 8019773896 | 8019769354 | Bacteria | 6924660 |
| 1344 | 8029996532 | 8029995093 | Bacteria | 5990776 |
| 1345 | 8029996533 | 8029995093 | Bacteria | 5990776 |
| 1346 | 8034965942 | 8034962539 | Bacteria | 4884839 |
| 1347 | 8054285206 | 8054285046 | Bacteria | 6919322 |
| 1348 | 8054285207 | 8054285046 | Bacteria | 6919322 |
| 1349 | 8054351284 | 8054347763 | Bacteria | 5901107 |
| 1350 | 8054351285 | 8054347763 | Bacteria | 5901107 |
| 1351 | 8054507961 | 8054503363 | Bacteria | 6101651 |
| 1352 | 8054507962 | 8054503363 | Bacteria | 6101651 |
| 1353 | 8054934464 | 8054929484 | Bacteria | 5599761 |
| 1354 | 8055775650 | 8055770955 | Bacteria | 6827675 |
| 1355 | 8055775651 | 8055770955 | Bacteria | 6827675 |
| 1356 | 8055822930 | 8055817908 | Bacteria | 6609162 |
| 1357 | 8055822931 | 8055817908 | Bacteria | 6609162 |
| 1358 | 8055883333 | 8055878733 | Bacteria | 5907058 |
| 1359 | 8055883334 | 8055878733 | Bacteria | 5907058 |
| 1360 | 8056120324 | 8056115690 | Bacteria | 5527654 |
| 1361 | 8056121842 | 8056120720 | Bacteria | 5758328 |
| 1362 | 8056130637 | 8056125926 | Bacteria | 6228218 |
| 1363 | 8056130638 | 8056125926 | Bacteria | 6228218 |
| 1364 | 8056136330 | 8056131705 | Bacteria | 6107031 |
| 1365 | 8056136331 | 8056131705 | Bacteria | 6107031 |
| 1366 | 8056147676 | 8056143049 | Bacteria | 6307666 |
| 1367 | 8056153647 | 8056148874 | Bacteria | 6479865 |
| 1368 | 8056153648 | 8056148874 | Bacteria | 6479865 |
| 1369 | 8056155328 | 8056155041 | Bacteria | 6486948 |
| 1370 | 8056155329 | 8056155041 | Bacteria | 6486948 |
| 1371 | 8056162588 | 8056161164 | Bacteria | 6106669 |
| 1372 | 8056162589 | 8056161164 | Bacteria | 6106669 |
| 1373 | 8056166915 | 8056166840 | Bacteria | 5820959 |
| 1374 | 8056166916 | 8056166840 | Bacteria | 5820959 |
| 1375 | 8056172900 | 8056172158 | Bacteria | 6133900 |
| 1376 | 8056172901 | 8056172158 | Bacteria | 6133900 |
| 1377 | 8056183252 | 8056177738 | Bacteria | 6748268 |
| 1378 | 8056572420 | 8056569372 | Bacteria | 5997322 |
| 1379 | 8057804509 | 8057798959 | Bacteria | 6713499 |
| 1380 | 8057804510 | 8057798959 | Bacteria | 6713499 |
| 1381 | JGI24740J21852_10001861 | |||
| 1382 | JGI24735J21928_10022245 | |||
| 1383 | JGI25155J39150_1000017 | |||
| 1384 | JGI25155J39150_1001097 | |||
| 1385 | JGI25156J39149_1000034 | |||
| 1386 | JGI25162J39368_1000073 | |||
| 1387 | JGI25162J39368_1000262 | |||
| 1388 | JGI25154J39366_1000034 | |||
| 1389 | JGI25154J39366_1005657 | |||
| 1390 | JGI25154J39366_1005760 | |||
| 1391 | JGI25157J39369_1000137 | |||
| 1392 | JGI25163J39215_1000380 | |||
| 1393 | JGI25164J39214_1000052 | |||
| 1394 | JGI25164J39214_1000239 | |||
| 1395 | JGI25165J46597_1000137 | |||
| 1396 | JGI25165J46597_1000351 | |||
| 1397 | JGI25165J46597_1000366 | |||
| 1398 | JGI25165J46597_1003810 | |||
| 1399 | rootH1_10103289 | |||
| 1400 | rootH2_10027258 | |||
| 1401 | rootL2_10008082 | |||
| 1402 | rootL2_10008608 | |||
| 1403 | rootH1_10107069 | |||
| 1404 | rootH1_10143638 | |||
| 1405 | Ga0055538_1000047 | |||
| 1406 | Ga0055539_1000067 | |||
| 1407 | Ga0055533_1000077 | |||
| 1408 | Ga0055532_1000093 | |||
| 1409 | Ga0055525_1000101 | |||
| 1410 | Ga0055525_1002127 | |||
| 1411 | Ga0055542_1003791 | |||
| 1412 | Ga0055536_1000048 | |||
| 1413 | Ga0055536_1000745 | |||
| 1414 | Ga0055536_1000776 | |||
| 1415 | Ga0055530_10000401 | |||
| 1416 | Ga0055530_10001462 | |||
| 1417 | Ga0055530_10008782 | |||
| 1418 | Ga0055540_1000564 | |||
| 1419 | Ga0055540_1011205 | |||
| 1420 | Ga0055531_10000825 | |||
| 1421 | Ga0055531_10009814 | |||
| 1422 | Ga0055541_1000048 | |||
| 1423 | Ga0065714_10002647 | |||
| 1424 | Ga0065714_10006480 | |||
| 1425 | Ga0065714_10007683 | |||
| 1426 | Ga0065714_10016281 | |||
| 1427 | Ga0065714_10075338 | |||
| 1428 | Ga0065714_10078317 | |||
| 1429 | Ga0065714_10084681 | |||
| 1430 | Ga0065714_10087836 | |||
| 1431 | Ga0065704_10000713 | |||
| 1432 | Ga0065704_10005784 | |||
| 1433 | Ga0065704_10110960 | |||
| 1434 | Ga0065712_10070331 | |||
| 1435 | Ga0070658_10004683 | |||
| 1436 | Ga0070690_100046770 | |||
| 1437 | Ga0070670_100000394 | |||
| 1438 | Ga0070670_100009769 | |||
| 1439 | Ga0070660_100000171 | |||
| 1440 | Ga0070661_100000106 | |||
| 1441 | Ga0070668_100076309 | |||
| 1442 | Ga0070669_100001587 | |||
| 1443 | Ga0070688_100032569 | |||
| 1444 | Ga0070659_100000028 | |||
| 1445 | Ga0070663_100001621 | |||
| 1446 | Ga0070662_100000532 | |||
| 1447 | Ga0070662_100094407 | |||
| 1448 | Ga0070706_100098055 | |||
| 1449 | Ga0070684_100066657 | |||
| 1450 | Ga0070697_100097542 | |||
| 1451 | Ga0068853_100014884 | |||
| 1452 | Ga0070665_100019171 | |||
| 1453 | Ga0070665_100045847 | |||
| 1454 | Ga0070665_100285732 | |||
| 1455 | Ga0068855_100010177 | |||
| 1456 | Ga0070664_100006695 | |||
| 1457 | Ga0070664_100039956 | |||
| 1458 | Ga0068854_100008963 | |||
| 1459 | Ga0068852_100015244 | |||
| 1460 | Ga0068851_10000036 | |||
| 1461 | Ga0068858_100012442 | |||
| 1462 | Ga0068862_100025868 | |||
| 1463 | Ga0075365_10015334 | |||
| 1464 | Ga0075365_10047671 | |||
| 1465 | Ga0075368_10028187 | |||
| 1466 | Ga0075363_100020181 | |||
| 1467 | Ga0075364_10004890 | |||
| 1468 | Ga0075364_10045657 | |||
| 1469 | Ga0075364_10055063 | |||
| 1470 | Ga0075432_10014775 | |||
| 1471 | Ga0075432_10015068 | |||
| 1472 | Ga0075432_10019567 | |||
| 1473 | Ga0075367_10006333 | |||
| 1474 | Ga0075367_10063209 | |||
| 1475 | Ga0075369_10003995 | |||
| 1476 | Ga0075370_10011113 | |||
| 1477 | Ga0075431_100046346 | |||
| 1478 | Ga0068865_100016055 | |||
| 1479 | Ga0099823_1012610 | |||
| 1480 | Ga0079104_1000244 | |||
| 1481 | Ga0079104_1000432 | |||
| 1482 | Ga0079104_1017120 | |||
| 1483 | Ga0105251_10002904 | |||
| 1484 | Ga0105251_10003926 | |||
| 1485 | Ga0105251_10008444 | |||
| 1486 | Ga0105251_10011323 | |||
| 1487 | Ga0105244_10004755 | |||
| 1488 | Ga0105244_10006270 | |||
| 1489 | Ga0105244_10016889 | |||
| 1490 | Ga0105244_10024105 | |||
| 1491 | Ga0105244_10049022 | |||
| 1492 | Ga0105250_10000459 | |||
| 1493 | Ga0105250_10003197 | |||
| 1494 | Ga0105250_10004391 | |||
| 1495 | Ga0105250_10005134 | |||
| 1496 | Ga0105250_10015148 | |||
| 1497 | Ga0105250_10029162 | |||
| 1498 | Ga0105240_10000255 | |||
| 1499 | Ga0105240_10000256 | |||
| 1500 | Ga0105240_10011407 | |||
| 1501 | Ga0105240_10011525 | |||
| 1502 | Ga0105240_10044459 | |||
| 1503 | Ga0105245_10087058 | |||
| 1504 | Ga0105247_10006364 | |||
| 1505 | Ga0114129_10085223 | |||
| 1506 | Ga0105243_10000808 | |||
| 1507 | Ga0105243_10000910 | |||
| 1508 | Ga0105243_10097046 | |||
| 1509 | Ga0105243_10123575 | |||
| 1510 | Ga0105241_10028129 | |||
| 1511 | Ga0105242_10000547 | |||
| 1512 | Ga0105248_10012821 | |||
| 1513 | Ga0105237_10006662 | |||
| 1514 | Ga0105237_10013057 | |||
| 1515 | Ga0105237_10029717 | |||
| 1516 | Ga0105237_10039300 | |||
| 1517 | Ga0105238_10017098 | |||
| 1518 | Ga0105238_10205138 | |||
| 1519 | Ga0105239_10000932 | |||
| 1520 | Ga0105239_10003360 | |||
| 1521 | Ga0105239_10014404 | |||
| 1522 | Ga0105239_10016000 | |||
| 1523 | Ga0105239_10043155 | |||
| 1524 | Ga0105239_10069581 | |||
| 1525 | Ga0105246_10002160 | |||
| 1526 | Ga0105246_10061350 | |||
| 1527 | Ga0157345_1000109 | |||
| 1528 | Ga0157373_10001399 | |||
| 1529 | Ga0157373_10002268 | |||
| 1530 | Ga0157373_10005118 | |||
| 1531 | Ga0157373_10015951 | |||
| 1532 | Ga0157373_10022663 | |||
| 1533 | Ga0157373_10045315 | |||
| 1534 | Ga0157373_10156982 | |||
| 1535 | Ga0157371_10001380 | |||
| 1536 | Ga0157371_10003050 | |||
| 1537 | Ga0157371_10020875 | |||
| 1538 | Ga0157371_10058276 | |||
| 1539 | Ga0157371_10089665 | |||
| 1540 | Ga0157370_10000070 | |||
| 1541 | Ga0157370_10007058 | |||
| 1542 | Ga0157370_10016668 | |||
| 1543 | Ga0157370_10064065 | |||
| 1544 | Ga0157370_10109795 | |||
| 1545 | Ga0157369_10013332 | |||
| 1546 | Ga0157369_10027737 | |||
| 1547 | Ga0157369_10028371 | |||
| 1548 | Ga0157369_10047573 | |||
| 1549 | Ga0157369_10051527 | |||
| 1550 | Ga0157369_10053069 | |||
| 1551 | Ga0157369_10056516 | |||
| 1552 | Ga0157378_10011013 | |||
| 1553 | Ga0163162_10003189 | |||
| 1554 | Ga0163162_10075602 | |||
| 1555 | Ga0163162_10114468 | |||
| 1556 | Ga0163162_10137467 | |||
| 1557 | Ga0163162_10302758 | |||
| 1558 | Ga0157372_10021418 | |||
| 1559 | Ga0157375_10006419 | |||
| 1560 | Ga0157375_10012360 | |||
| 1561 | Ga0157375_10016590 | |||
| 1562 | Ga0157375_10138927 | |||
| 1563 | Ga0182008_10000593 | |||
| 1564 | Ga0182008_10001437 | |||
| 1565 | Ga0182008_10001850 | |||
| 1566 | Ga0182008_10004969 | |||
| 1567 | Ga0182008_10010920 | |||
| 1568 | Ga0182008_10010972 | |||
| 1569 | Ga0182008_10017510 | |||
| 1570 | Ga0182008_10017710 | |||
| 1571 | Ga0182008_10020679 | |||
| 1572 | Ga0157379_10011341 | |||
| 1573 | Ga0157376_10003637 | |||
| 1574 | Ga0157376_10066194 | |||
| 1575 | Ga0182006_1003011 | |||
| 1576 | Ga0182006_1006211 | |||
| 1577 | Ga0182006_1008002 | |||
| 1578 | Ga0182006_1024370 | |||
| 1579 | Ga0182007_10006882 | |||
| 1580 | Ga0182007_10016001 | |||
| 1581 | Ga0163161_10016315 | |||
| 1582 | Ga0163161_10017758 | |||
| 1583 | Ga0163161_10018742 | |||
| 1584 | Ga0163161_10020038 | |||
| 1585 | Ga0163161_10050869 | |||
| 1586 | Ga0163161_10101208 | |||
| 1587 | Ga0163161_10143095 | |||
| 1588 | Ga0209435_100023 | |||
| 1589 | Ga0209435_100671 | |||
| 1590 | Ga0209760_100090 | |||
| 1591 | Ga0209760_100106 | |||
| 1592 | Ga0209784_100080 | |||
| 1593 | Ga0209566_100096 | |||
| 1594 | Ga0209674_100117 | |||
| 1595 | Ga0209147_100123 | |||
| 1596 | Ga0209563_100114 | |||
| 1597 | Ga0209563_100947 | |||
| 1598 | Ga0207427_100004 | |||
| 1599 | Ga0207427_100007 | |||
| 1600 | Ga0209437_100006 | |||
| 1601 | Ga0209437_100028 | |||
| 1602 | Ga0209437_102874 | |||
| 1603 | Ga0209258_100174 | |||
| 1604 | Ga0209646_1000080 | |||
| 1605 | Ga0209646_1000422 | |||
| 1606 | Ga0209026_1000076 | |||
| 1607 | Ga0209677_100073 | |||
| 1608 | Ga0209677_100272 | |||
| 1609 | Ga0209148_1000921 | |||
| 1610 | Ga0209759_1000059 | |||
| 1611 | Ga0209759_1004309 | |||
| 1612 | Ga0209759_1007300 | |||
| 1613 | Ga0209233_1000008 | |||
| 1614 | Ga0209233_1000086 | |||
| 1615 | Ga0209233_1000282 | |||
| 1616 | Ga0209233_1000310 | |||
| 1617 | Ga0209455_1000150 | |||
| 1618 | Ga0209676_1000006 | |||
| 1619 | Ga0209676_1000010 | |||
| 1620 | Ga0209676_1001133 | |||
| 1621 | Ga0209676_1007590 | |||
| 1622 | Ga0209564_1025789 | |||
| 1623 | Ga0209758_1006795 | |||
| 1624 | Ga0209050_1000019 | |||
| 1625 | Ga0209050_1000070 | |||
| 1626 | Ga0209050_1001703 | |||
| 1627 | Ga0209050_1005922 | |||
| 1628 | Ga0209051_1000093 | |||
| 1629 | Ga0209051_1000146 | |||
| 1630 | Ga0209051_1011790 | |||
| 1631 | Ga0209257_1000040 | |||
| 1632 | Ga0209257_1000303 | |||
| 1633 | Ga0207656_10000021 | |||
| 1634 | Ga0207696_1000073 | |||
| 1635 | Ga0207696_1000246 | |||
| 1636 | Ga0207696_1001465 | |||
| 1637 | Ga0207696_1005199 | |||
| 1638 | Ga0207655_1000005 | |||
| 1639 | Ga0207655_1000015 | |||
| 1640 | Ga0207655_1000701 | |||
| 1641 | Ga0207655_1001021 | |||
| 1642 | Ga0207655_1002919 | |||
| 1643 | Ga0207655_1006300 | |||
| 1644 | Ga0207655_1010879 | |||
| 1645 | Ga0207655_1011785 | |||
| 1646 | Ga0207655_1011887 | |||
| 1647 | Ga0207655_1016207 | |||
| 1648 | Ga0207713_1000426 | |||
| 1649 | Ga0207713_1000543 | |||
| 1650 | Ga0207713_1000600 | |||
| 1651 | Ga0207713_1001527 | |||
| 1652 | Ga0207713_1005163 | |||
| 1653 | Ga0207713_1008166 | |||
| 1654 | Ga0207713_1015009 | |||
| 1655 | Ga0207713_1018361 | |||
| 1656 | Ga0207710_10005346 | |||
| 1657 | Ga0207647_10003622 | |||
| 1658 | Ga0207647_10004058 | |||
| 1659 | Ga0207654_10016121 | |||
| 1660 | Ga0207695_10000352 | |||
| 1661 | Ga0207695_10001755 | |||
| 1662 | Ga0207695_10054008 | |||
| 1663 | Ga0207671_10000534 | |||
| 1664 | Ga0207671_10000766 | |||
| 1665 | Ga0207671_10018516 | |||
| 1666 | Ga0207671_10063802 | |||
| 1667 | Ga0207657_10000111 | |||
| 1668 | Ga0207649_10000006 | |||
| 1669 | Ga0207681_10001988 | |||
| 1670 | Ga0207681_10003269 | |||
| 1671 | Ga0207650_10000188 | |||
| 1672 | Ga0207650_10000561 | |||
| 1673 | Ga0207687_10059204 | |||
| 1674 | Ga0207690_10000009 | |||
| 1675 | Ga0207706_10000205 | |||
| 1676 | Ga0207706_10008376 | |||
| 1677 | Ga0207706_10051537 | |||
| 1678 | Ga0207686_10003836 | |||
| 1679 | Ga0207709_10000013 | |||
| 1680 | Ga0207709_10000586 | |||
| 1681 | Ga0207709_10054723 | |||
| 1682 | Ga0207711_10101031 | |||
| 1683 | Ga0207661_10157182 | |||
| 1684 | Ga0207679_10000010 | |||
| 1685 | Ga0207667_10003058 | |||
| 1686 | Ga0207640_10018604 | |||
| 1687 | Ga0207658_10129106 | |||
| 1688 | Ga0207703_10014678 | |||
| 1689 | Ga0207639_10001976 | |||
| 1690 | Ga0207639_10023522 | |||
| 1691 | Ga0207639_10134362 | |||
| 1692 | Ga0207678_10000347 | |||
| 1693 | Ga0207698_10073392 | |||
| 1694 | Ga0209281_1000049 | |||
| 1695 | Ga0209281_1000202 | |||
| 1696 | Ga0209281_1003441 | |||
| 1697 | Ga0207428_10016226 | |||
| 1698 | Ga0207428_10136292 | |||
| 1699 | Ga0268266_10116692 | |||
| 1700 | Ga0268265_10116215 | |||
| 1701 | Ga0265326_10007166 | |||
| 1702 | Ga0265338_10008078 | |||
| 1703 | Ga0265338_10034157 | |||
| 1704 | Ga0265338_10089674 | |||
| 1705 | Ga0307511_10041818 | |||
| 1706 | Ga0307511_10044765 | |||
| 1707 | Ga0316179_1007569 | |||
| 1708 | Ga0316178_1085488 | |||
| 1709 | Ga0265330_10009700 | |||
| 1710 | Ga0265325_10001901 | |||
| 1711 | Ga0265339_10014882 | |||
| 1712 | Ga0265331_10011374 | |||
| 1713 | Ga0265327_10045761 | |||
| 1714 | Ga0307513_10117147 | |||
| 1715 | Ga0307509_10088442 | |||
| 1716 | Ga0307408_100004523 | |||
| 1717 | Ga0307408_100022392 | |||
| 1718 | Ga0307408_100027290 | |||
| 1719 | Ga0265313_10004543 | |||
| 1720 | Ga0307514_10001067 | |||
| 1721 | Ga0265314_10005751 | |||
| 1722 | Ga0307405_10004895 | |||
| 1723 | Ga0307405_10008531 | |||
| 1724 | Ga0307405_10036019 | |||
| 1725 | Ga0307413_10063951 | |||
| 1726 | Ga0307406_10011704 | |||
| 1727 | Ga0307412_10002215 | |||
| 1728 | Ga0307412_10030858 | |||
| 1729 | Ga0307409_100078077 | |||
| 1730 | Ga0307409_100081478 | |||
| 1731 | Ga0307416_100135158 | |||
| 1732 | Ga0307414_10083713 | |||
| 1733 | Ga0307411_10029815 | |||
| 1734 | Ga0307411_10106522 | |||
| 1735 | Ga0307510_10016790 | |||
| 1736 | Ga0395900_0002853 | |||
| 1737 | Ga0395900_0247148 | |||
| 1738 | Ga0395905_0001778 | |||
| 1739 | Ga0395905_0014404 | |||
| 1740 | Ga0395905_0029858 | |||
| 1741 | Ga0395901_0004406 | |||
| 1742 | Ga0395901_0017627 | |||
| 1743 | Ga0439438_000532 | |||
| 1744 | Ga0439438_002698 | |||
| 1745 | Ga0439438_002764 | |||
| 1746 | Ga0439438_004435 | |||
| 1747 | Ga0439438_005714 | |||
| 1748 | Ga0439438_009523 | |||
| 1749 | Ga0439447_001577 | |||
| 1750 | Ga0439447_003653 | |||
| 1751 | Ga0439447_003866 | |||
| 1752 | Ga0439447_007780 | |||
| 1753 | Ga0439466_0002401 | |||
| 1754 | Ga0439466_0003005 | |||
| 1755 | Ga0439466_0009803 | |||
| 1756 | Ga0439466_0013997 | |||
| 1757 | Ga0439466_0018978 | |||
| 1758 | Ga0439432_001499 | |||
| 1759 | Ga0439432_001529 | |||
| 1760 | Ga0439432_007275 | |||
| 1761 | Ga0439451_000472 | |||
| 1762 | Ga0439451_001204 | |||
| 1763 | Ga0439452_000732 | |||
| 1764 | Ga0439452_000742 | |||
| 1765 | Ga0439452_001257 | |||
| 1766 | Ga0439452_011606 | |||
| 1767 | Ga0439456_000071 | |||
| 1768 | Ga0439456_003830 | |||
| 1769 | Ga0439463_003557 | |||
| 1770 | Ga0450911_000441 | |||
| 1771 | Ga0450911_001298 | |||
| 1772 | Ga0450911_002186 | |||
| 1773 | Ga0450920_000209 | |||
| 1774 | Ga0450922_001359 | |||
| 1775 | Ga0450890_000618 | |||
| 1776 | Ga0450899_001777 | |||
| 1777 | Ga0450902_003704 | |||
| 1778 | Ga0450904_000950 | |||
| 1779 | Ga0450906_001861 | |||
| 1780 | Ga0450906_009724 | |||
| 1781 | Ga0450907_000015 | |||
| 1782 | Ga0450907_000967 | |||
| 1783 | Ga0450910_004102 | |||
| 1784 | Ga0439446_0002404 | |||
| 1785 | Ga0450908_006563 | |||
| 1786 | Ga0439434_0000083 | |||
| 1787 | Ga0439464_0002942 | |||
| 1788 | Ga0439460_0001661 | |||
| 1789 | Ga0439460_0003001 | |||
| 1790 | Ga0439460_0003519 | |||
| 1791 | Ga0439460_0006771 | |||
| 1792 | Ga0439440_0004230 | |||
| 1793 | Ga0495617_000789 | |||
| 1794 | Ga0495617_002785 | |||
| 1795 | Ga0495617_007706 | |||
| 1796 | Ga0495617_013876 | |||
| 1797 | Ga0495617_030650 | |||
| 1798 | Ga0495627_002706 | |||
| 1799 | Ga0495627_002977 | |||
| 1800 | Ga0495627_003608 | |||
| 1801 | Ga0495627_007871 | |||
| 1802 | Ga0495627_008703 | |||
| 1803 | Ga0495592_0025312 | |||
| 1804 | Ga0495603_0082583 | |||
| 1805 | Ga0495590_0002105 | |||
| 1806 | Ga0495590_0002853 | |||
| 1807 | Ga0495590_0006100 | |||
| 1808 | Ga0495591_001192 | |||
| 1809 | Ga0495591_001612 | |||
| 1810 | Ga0495591_002052 | |||
| 1811 | Ga0495591_002960 | |||
| 1812 | Ga0495591_003835 | |||
| 1813 | Ga0495591_008863 | |||
| 1814 | Ga0495629_0000468 | |||
| 1815 | Ga0495638_0006469 | |||
| 1816 | Ga0495638_0008707 | |||
| 1817 | Ga0495638_0010243 | |||
| 1818 | Ga0495638_0015446 | |||
| 1819 | Ga0495638_0015799 | |||
| 1820 | Ga0495638_0015981 | |||
| 1821 | Ga0495638_0016917 | |||
| 1822 | Ga0495638_0017845 | |||
| 1823 | Ga0495638_0024983 | |||
| 1824 | Ga0495638_0040765 | |||
| 1825 | Ga0495651_0015068 | |||
| 1826 | Ga0495653_0038962 | |||
| 1827 | Ga0495653_0048939 | |||
| 1828 | Ga0495653_0080965 | |||
| 1829 | Ga0495653_0140349 | |||
| 1830 | Ga0495650_0003878 | |||
| 1831 | Ga0495650_0011538 | |||
| 1832 | Ga0495650_0012383 | |||
| 1833 | Ga0495650_0029051 | |||
| 1834 | Ga0495650_0029907 | |||
| 1835 | Ga0495580_0000104 | |||
| 1836 | Ga0495580_0009914 | |||
| 1837 | Ga0495580_0023254 | |||
| 1838 | Ga0495582_0009166 | |||
| 1839 | Ga0495605_0001604 | |||
| 1840 | Ga0495605_0004544 | |||
| 1841 | Ga0495605_0006744 | |||
| 1842 | Ga0495605_0011512 | |||
| 1843 | Ga0495605_0012216 | |||
| 1844 | Ga0495605_0032166 | |||
| 1845 | Ga0495605_0049993 | |||
| 1846 | Ga0495664_0029390 | |||
| 1847 | Ga0495584_0000014 | |||
| 1848 | Ga0495584_0001457 | |||
| 1849 | Ga0495584_0001756 | |||
| 1850 | Ga0495584_0003606 | |||
| 1851 | Ga0495584_0004147 | |||
| 1852 | Ga0495584_0009081 | |||
| 1853 | Ga0495584_0015268 | |||
| 1854 | Ga0495585_0000096 | |||
| 1855 | Ga0495585_0002384 | |||
| 1856 | Ga0495585_0004069 | |||
| 1857 | Ga0495585_0011835 | |||
| 1858 | Ga0495585_0013169 | |||
| 1859 | Ga0495585_0035921 | |||
| 1860 | Ga0495585_0040818 | |||
| 1861 | Ga0495585_0041493 | |||
| 1862 | Ga0495585_0075124 | |||
| 1863 | Ga0495594_0043205 | |||
| 1864 | Ga0495596_0000888 | |||
| 1865 | Ga0495596_0007790 | |||
| 1866 | Ga0495596_0017771 | |||
| 1867 | Ga0495607_0001972 | |||
| 1868 | Ga0495607_0005517 | |||
| 1869 | Ga0495607_0006291 | |||
| 1870 | Ga0495607_0013220 | |||
| 1871 | Ga0495607_0016236 | |||
| 1872 | Ga0495607_0042500 | |||
| 1873 | Ga0495607_0046195 | |||
| 1874 | Ga0495583_0002651 | |||
| 1875 | Ga0495583_0005025 | |||
| 1876 | Ga0495583_0005187 | |||
| 1877 | Ga0495583_0005623 | |||
| 1878 | Ga0495583_0012075 | |||
| 1879 | Ga0495583_0018753 | |||
| 1880 | Ga0495583_0028784 | |||
| 1881 | Ga0495583_0028862 | |||
| 1882 | Ga0495606_0000027 | |||
| 1883 | Ga0495606_0006755 | |||
| 1884 | Ga0495606_0007268 | |||
| 1885 | Ga0495606_0007963 | |||
| 1886 | Ga0495606_0010270 | |||
| 1887 | Ga0495606_0028117 | |||
| 1888 | Ga0495606_0035116 | |||
| 1889 | Ga0495608_0001808 | |||
| 1890 | Ga0495610_0006370 | |||
| 1891 | Ga0495610_0006603 | |||
| 1892 | Ga0495610_0007514 | |||
| 1893 | Ga0495610_0009350 | |||
| 1894 | Ga0495610_0013412 | |||
| 1895 | Ga0495610_0015529 | |||
| 1896 | Ga0495610_0016744 | |||
| 1897 | Ga0495610_0028596 | |||
| 1898 | Ga0495610_0029381 | |||
| 1899 | Ga0495610_0044416 | |||
| 1900 | Ga0495616_0005526 | |||
| 1901 | Ga0495616_0011272 | |||
| 1902 | Ga0495616_0011759 | |||
| 1903 | Ga0495616_0030044 | |||
| 1904 | Ga0495616_0038614 | |||
| 1905 | Ga0495618_0005058 | |||
| 1906 | Ga0495620_0001983 | |||
| 1907 | Ga0495620_0002880 | |||
| 1908 | Ga0495620_0010389 | |||
| 1909 | Ga0495630_0008000 | |||
| 1910 | Ga0495630_0011630 | |||
| 1911 | Ga0495630_0021381 | |||
| 1912 | Ga0495630_0025431 | |||
| 1913 | Ga0495630_0044799 | |||
| 1914 | Ga0495631_0000637 | |||
| 1915 | Ga0495631_0002437 | |||
| 1916 | Ga0495632_0002221 | |||
| 1917 | Ga0495632_0006267 | |||
| 1918 | Ga0495632_0021428 | |||
| 1919 | Ga0495632_0024850 | |||
| 1920 | Ga0495632_0037202 | |||
| 1921 | Ga0495632_0058981 | |||
| 1922 | Ga0495637_0000743 | |||
| 1923 | Ga0495637_0004004 | |||
| 1924 | Ga0495637_0004169 | |||
| 1925 | Ga0495637_0004212 | |||
| 1926 | Ga0495637_0010212 | |||
| 1927 | Ga0495637_0010627 | |||
| 1928 | Ga0495637_0020960 | |||
| 1929 | Ga0495637_0023808 | |||
| 1930 | Ga0495637_0049704 | |||
| 1931 | Ga0495643_0000049 | |||
| 1932 | Ga0495643_0005492 | |||
| 1933 | Ga0495643_0014948 | |||
| 1934 | Ga0495643_0021642 | |||
| 1935 | Ga0495644_0002471 | |||
| 1936 | Ga0495644_0003748 | |||
| 1937 | Ga0495644_0005046 | |||
| 1938 | Ga0495648_0006977 | |||
| 1939 | Ga0495648_0015406 | |||
| 1940 | Ga0495648_0019472 | |||
| 1941 | Ga0495648_0024656 | |||
| 1942 | Ga0495648_0036025 | |||
| 1943 | Ga0495648_0059998 | |||
| 1944 | Ga0495648_0062378 | |||
| 1945 | Ga0495666_0000354 | |||
| 1946 | Ga0495666_0002897 | |||
| 1947 | Ga0495642_0000042 | |||
| 1948 | Ga0495642_0001043 | |||
| 1949 | Ga0495652_0009144 | |||
| 1950 | Ga0495654_0001990 | |||
| 1951 | Ga0495654_0003418 | |||
| 1952 | Ga0495654_0003987 | |||
| 1953 | Ga0495654_0004439 | |||
| 1954 | Ga0495654_0009995 | |||
| 1955 | Ga0495654_0031671 | |||
| 1956 | Ga0495654_0044487 | |||
| 1957 | Ga0495654_0055840 | |||
| 1958 | Ga0495665_0001735 | |||
| 1959 | Ga0495665_0022196 | |||
| 1960 | Ga0495640_0029250 | |||
| 1961 | Ga0495587_0000917 | |||
| 1962 | Ga0495587_0018623 | |||
| 1963 | Ga0495609_0000928 | |||
| 1964 | Ga0495609_0002746 | |||
| 1965 | Ga0495609_0008048 | |||
| 1966 | Ga0495609_0014589 | |||
| 1967 | Ga0495609_0014637 | |||
| 1968 | Ga0495609_0027333 | |||
| 1969 | Ga0495609_0053390 | |||
| 1970 | Ga0495597_0003541 | |||
| 1971 | Ga0495597_0008048 | |||
| 1972 | Ga0495597_0012096 | |||
| 1973 | Ga0495597_0034930 | |||
| 1974 | Ga0495597_0037287 | |||
| 1975 | Ga0495645_0079895 | |||
| 1976 | Ga0495645_0118550 | |||
| 1977 | Ga0495622_0009838 | |||
| 1978 | Ga0495622_0010541 | |||
| 1979 | Ga0495622_0010724 | |||
| 1980 | Ga0495622_0025944 | |||
| 1981 | Ga0495633_0003512 | |||
| 1982 | Ga0495656_0002177 | |||
| 1983 | Ga0495656_0041654 | |||
| 1984 | Ga0495668_0003061 | |||
| 1985 | Ga0495668_0006817 | |||
| 1986 | Ga0495668_0010604 | |||
| 1987 | Ga0495668_0011931 | |||
| 1988 | Ga0495634_0028576 | |||
| 1989 | Ga0495611_0001015 | |||
| 1990 | Ga0495625_0004213 | |||
| 1991 | Ga0495625_0006199 | |||
| 1992 | Ga0495625_0010011 | |||
| 1993 | Ga0495625_0022102 | |||
| 1994 | Ga0495625_0023761 | |||
| 1995 | Ga0495625_0049227 | |||
| 1996 | Ga0495625_0060201 | |||
| 1997 | Ga0495635_0005729 | |||
| 1998 | Ga0495659_0006521 | |||
| 1999 | Ga0495661_0004628 | |||
| 2000 | Ga0495661_0007157 | |||
| 2001 | Ga0495661_0018363 | |||
| 2002 | Ga0495661_0032986 | |||
| 2003 | Ga0495661_0036199 | |||
| 2004 | Ga0495661_0039208 | |||
| 2005 | Ga0495588_0004345 | |||
| 2006 | Ga0495599_0013867 | |||
| 2007 | Ga0495623_0003020 | |||
| 2008 | Ga0495623_0003593 | |||
| 2009 | Ga0495623_0014480 | |||
| 2010 | Ga0495646_0023390 | |||
| 2011 | Ga0495669_0017315 | |||
| 2012 | Ga0495613_0002518 | |||
| 2013 | Ga0495613_0077847 | |||
| 2014 | Ga0495624_0001358 | |||
| 2015 | Ga0495624_0004594 | |||
| 2016 | Ga0495624_0014347 | |||
| 2017 | Ga0495670_0002154 | |||
| 2018 | Ga0495670_0003049 | |||
| 2019 | Ga0495670_0003797 | |||
| 2020 | Ga0495670_0018969 | |||
| 2021 | Ga0495671_0000674 | |||
| 2022 | Ga0495671_0001038 | |||
| 2023 | Ga0495671_0004372 | |||
| 2024 | Ga0495671_0008811 | |||
| 2025 | Ga0495671_0010676 | |||
| 2026 | Ga0495671_0011679 | |||
| 2027 | Ga0495671_0054340 | |||
| 2028 | Ga0495649_0000045 | |||
| 2029 | Ga0495649_0002119 | |||
| 2030 | Ga0495649_0006018 | |||
| 2031 | Ga0495649_0009383 | |||
| 2032 | Ga0495649_0015440 | |||
| 2033 | Ga0495649_0017519 | |||
| 2034 | Ga0495649_0017531 | |||
| 2035 | Ga0495649_0027591 | |||
| 2036 | Ga0495649_0032641 | |||
| 2037 | Ga0495649_0042760 | |||
| 2038 | Ga0495649_0063407 | |||
| 2039 | Ga0495589_0000710 | |||
| 2040 | Ga0495589_0001216 | |||
| 2041 | Ga0495589_0003242 | |||
| 2042 | Ga0495589_0004730 | |||
| 2043 | Ga0495589_0005288 | |||
| 2044 | Ga0495589_0008364 | |||
| 2045 | Ga0495589_0016286 | |||
| 2046 | Ga0495589_0023075 | |||
| 2047 | Ga0495589_0029829 | |||
| 2048 | Ga0495600_0000760 | |||
| 2049 | Ga0495600_0042489 | |||
| 2050 | Ga0495600_0103663 | |||
| 2051 | Ga0495660_0012476 | |||
| 2052 | Ga0495660_0032381 | |||
| 2053 | Ga0495660_0055094 | |||
| 2054 | Ga0495660_0060371 | |||
| 2055 | Ga0495660_0086910 | |||
| 2056 | Ga0495604_0055479 | |||
| 2057 | Ga0495636_0009555 | |||
| 2058 | Ga0495674_0007043 | |||
| 2059 | Ga0495674_0010312 | |||
| 2060 | Ga0495674_0022078 | |||
| 2061 | Ga0495674_0032782 | |||
| 2062 | Ga0495672_0000491 | |||
| 2063 | Ga0495672_0006898 | |||
| 2064 | Ga0495672_0010295 | |||
| 2065 | Ga0495672_0010675 | |||
| 2066 | Ga0495672_0012049 | |||
| 2067 | Ga0495672_0012889 | |||
| 2068 | Ga0495672_0014480 | |||
| 2069 | Ga0495672_0014869 | |||
| 2070 | Ga0495672_0040857 | |||
| 2071 | Ga0495672_0042516 | |||
| 2072 | Ga0495676_0021737 | |||
| 2073 | Ga0495676_0047502 | |||
| 2074 | Ga0495680_0022594 | |||
| 2075 | Ga0495680_0024779 | |||
| 2076 | Ga0495680_0045732 | |||
| 2077 | Ga0495680_0088625 | |||
| 2078 | Ga0495680_0113934 | |||
| 2079 | Ga0495683_0001300 | |||
| 2080 | Ga0495683_0001396 | |||
| 2081 | Ga0495683_0004230 | |||
| 2082 | Ga0495683_0005000 | |||
| 2083 | Ga0495683_0010755 | |||
| 2084 | Ga0495683_0016072 | |||
| 2085 | Ga0495683_0070842 | |||
| 2086 | Ga0495687_000391 | |||
| 2087 | Ga0495687_002043 | |||
| 2088 | Ga0495687_005506 | |||
| 2089 | Ga0495687_005781 | |||
| 2090 | Ga0495675_0001615 | |||
| 2091 | Ga0495677_0015881 | |||
| 2092 | Ga0495679_000099 | |||
| 2093 | Ga0495679_004021 | |||
| 2094 | Ga0495679_007433 | |||
| 2095 | Ga0495679_007460 | |||
| 2096 | Ga0495679_025500 | |||
| 2097 | Ga0495673_0000138 | |||
| 2098 | Ga0495673_0001881 | |||
| 2099 | Ga0495673_0003310 | |||
| 2100 | Ga0495673_0005487 | |||
| 2101 | Ga0495673_0011480 | |||
| 2102 | Ga0495673_0012351 | |||
| 2103 | Ga0495673_0012998 | |||
| 2104 | Ga0495673_0021585 | |||
| 2105 | Ga0495673_0022476 | |||
| 2106 | Ga0495673_0023859 | |||
| 2107 | Ga0495673_0046515 | |||
| 2108 | Ga0495673_0082830 | |||
| 2109 | Ga0495681_0001868 | |||
| 2110 | Ga0495681_0002951 | |||
| 2111 | Ga0495681_0003683 | |||
| 2112 | Ga0495681_0004182 | |||
| 2113 | Ga0495681_0008619 | |||
| 2114 | Ga0495681_0009879 | |||
| 2115 | Ga0495681_0011262 | |||
| 2116 | Ga0495681_0011768 | |||
| 2117 | Ga0495681_0013301 | |||
| 2118 | Ga0495681_0016467 | |||
| 2119 | Ga0495681_0019611 | |||
| 2120 | Ga0495681_0028480 | |||
| 2121 | Ga0495681_0028807 | |||
| 2122 | Ga0495684_0027096 | |||
| 2123 | Ga0495686_0003876 | |||
| 2124 | Ga0495686_0005847 | |||
| 2125 | Ga0495686_0035291 | |||
| 2126 | Ga0495593_0000669 | |||
| 2127 | Ga0495593_0061855 | |||
| 2128 | Ga0495602_0003358 | |||
| 2129 | Ga0495602_0016506 | |||
| 2130 | Ga0495602_0024407 | |||
| 2131 | Ga0495614_0000359 | |||
| 2132 | Ga0495626_0001033 | |||
| 2133 | Ga0495626_0001736 | |||
| 2134 | Ga0495626_0006717 | |||
| 2135 | Ga0495626_0008794 | |||
| 2136 | Ga0495626_0009686 | |||
| 2137 | Ga0496100_0000804 | |||
| 2138 | Ga0496100_0004424 | |||
| 2139 | Ga0496100_0136633 | |||
| 2140 | Ga0496101_0007867 | |||
| 2141 | Ga0496102_0001622 | |||
| 2142 | Ga0496103_0010728 | |||
| 2143 | Ga0496103_0106475 | |||
| 2144 | Ga0496104_0005909 | |||
| 2145 | Ga0496104_0227007 | |||
| 2146 | Ga0496105_0019530 | |||
| 2147 | Ga0496106_0000114 | |||
| 2148 | Ga0496106_0008022 | |||
| 2149 | Ga0496107_0001207 | |||
| 2150 | Ga0496108_0042541 | |||
| 2151 | Ga0496112_0131925 | |||
| 2152 | Ga0496113_0133324 | |||
| 2153 | Ga0496114_0004038 | |||
| 2154 | Ga0496115_0026149 | |||
| 2155 | Ga0496115_0080871 | |||
| 2156 | Ga0496116_0000399 | |||
| 2157 | Ga0496116_0000810 | |||
| 2158 | Ga0496116_0004905 | |||
| 2159 | Ga0496116_0007180 | |||
| 2160 | Ga0496116_0042753 | |||
| 2161 | Ga0496117_0002593 | |||
| 2162 | Ga0496117_0003951 | |||
| 2163 | Ga0496117_0008920 | |||
| 2164 | Ga0496117_0010763 | |||
| 2165 | Ga0496117_0018404 | |||
| 2166 | Ga0496118_0006873 | |||
| 2167 | Ga0496118_0009751 | |||
| 2168 | Ga0496118_0018912 | |||
| 2169 | Ga0496118_0019180 | |||
| 2170 | Ga0496118_0021107 | |||
| 2171 | Ga0496118_0054205 | |||
| 2172 | Ga0496118_0105790 | |||
| 2173 | Ga0496118_0105878 | |||
| 2174 | Ga0496119_0007808 | |||
| 2175 | Ga0496119_0008144 | |||
| 2176 | Ga0496119_0009601 | |||
| 2177 | Ga0496119_0030671 | |||
| 2178 | Ga0496120_0000931 | |||
| 2179 | Ga0496120_0003224 | |||
| 2180 | Ga0496121_0000691 | |||
| 2181 | Ga0496121_0004080 | |||
| 2182 | Ga0496121_0014819 | |||
| 2183 | Ga0496121_0029335 | |||
| 2184 | Ga0496121_0035167 | |||
| 2185 | Ga0496121_0037360 | |||
| 2186 | Ga0496121_0056868 | |||
| 2187 | Ga0496121_0062868 | |||
| 2188 | Ga0496122_0000505 | |||
| 2189 | Ga0496122_0001469 | |||
| 2190 | Ga0496122_0003049 | |||
| 2191 | Ga0496122_0004296 | |||
| 2192 | Ga0496122_0024973 | |||
| 2193 | Ga0496122_0032638 | |||
| 2194 | Ga0496122_0044116 | |||
| 2195 | Ga0496122_0047433 | |||
| 2196 | Ga0496123_0000400 | |||
| 2197 | Ga0496123_0000971 | |||
| 2198 | Ga0496123_0002513 | |||
| 2199 | Ga0496123_0008313 | |||
| 2200 | Ga0496123_0009181 | |||
| 2201 | Ga0496124_0005167 | |||
| 2202 | Ga0496124_0009488 | |||
| 2203 | Ga0496124_0024513 | |||
| 2204 | Ga0496124_0033527 | |||
| 2205 | Ga0496124_0033716 | |||
| 2206 | Ga0496124_0092685 | |||
| 2207 | Ga0496124_0127912 | |||
| 2208 | Ga0496124_0153785 | |||
| 2209 | Ga0496125_0001896 | |||
| 2210 | Ga0496125_0005264 | |||
| 2211 | Ga0496125_0017090 | |||
| 2212 | Ga0496125_0027457 | |||
| 2213 | Ga0496125_0065760 | |||
| 2214 | Ga0496125_0124077 | |||
| 2215 | Ga0496125_0136853 | |||
| 2216 | Ga0496126_0033065 | |||
| 2217 | Ga0496126_0184061 | |||
| 2218 | Ga0496126_0218023 | |||
| 2219 | Ga0495678_004490 | |||
| 2220 | Ga0495678_006097 | |||
| 2221 | Ga0495678_009727 | |||
| 2222 | Ga0495678_012376 | |||
| 2223 | Ga0495678_012409 | |||
| 2224 | Ga0495678_013969 | |||
| 2225 | Ga0495682_0003906 | |||
| 2226 | Ga0495682_0004603 | |||
| 2227 | Ga0495682_0005731 | |||
| 2228 | Ga0495682_0014099 | |||
| 2229 | Ga0501031_0000010 | |||
| 2230 | Ga0501031_0006499 | |||
| 2231 | Ga0501031_0075269 | |||
| 2232 | Ga0501032_0000023 | |||
| 2233 | Ga0501032_0001104 | |||
| 2234 | Ga0501032_0057249 | |||
| 2235 | Ga0501033_0000104 | |||
| 2236 | Ga0501033_0001424 | |||
| 2237 | Ga0501033_0020261 | |||
| 2238 | Ga0501033_0077708 | |||
| 2239 | Ga0501033_0098443 | |||
| 2240 | Ga0501034_0000116 | |||
| 2241 | Ga0501034_0061943 | |||
| 2242 | Ga0501036_0000015 | |||
| 2243 | Ga0501036_0001104 | |||
| 2244 | Ga0501036_0025512 | |||
| 2245 | Ga0501036_0134265 | |||
| 2246 | Ga0501037_0000023 | |||
| 2247 | Ga0501037_0023642 | |||
| 2248 | Ga0501038_0000025 | |||
| 2249 | Ga0501038_0035235 | |||
| 2250 | Ga0501038_0055071 | |||
| 2251 | Ga0501038_0057467 | |||
| 2252 | Ga0501039_0000037 | |||
| 2253 | Ga0501039_0072647 | |||
| 2254 | Ga0501040_0005598 | |||
| 2255 | Ga0501043_0000070 | |||
| 2256 | Ga0501043_0006747 | |||
| 2257 | Ga0501047_0001244 | |||
| 2258 | Ga0501047_0002705 | |||
| 2259 | Ga0501067_0057993 | |||
| 2260 | Ga0501070_0067260 | |||
| 2261 | Ga0501076_0110937 | |||
| 2262 | Ga0501083_0011128 | |||
| 2263 | Ga0501035_0000074 | |||
| 2264 | Ga0501035_0003834 | |||
| 2265 | Ga0501035_0025760 | |||
| 2266 | Ga0501035_0028382 | |||
| 2267 | Ga0501044_0000069 | |||
| 2268 | Ga0501044_0002371 | |||
| 2269 | Ga0501044_0037706 | |||
| 2270 | nmdc:mga03n38_4231_c2 | |||
| 2271 | nmdc:mga00v17_99760_c1 | |||
| 2272 | nmdc:mga0yw44_85201_c1 | |||
| 2273 | nmdc:mga06z11_17879_c1 | |||
| 2274 | nmdc:mga07m45_2758_c1 | |||
| 2275 | nmdc:mga06r32_15033_c1 | |||
| 2276 | nmdc:mga0sz30_18129_c1 | |||
| 2277 | Ga0500647_0001267 | |||
| 2278 | Ga0500647_0002844 | |||
| 2279 | Ga0500608_006037 | |||
| 2280 | Ga0500618_000529 | |||
| 2281 | Ga0500618_000872 | |||
| 2282 | Ga0500642_0001809 | |||
| 2283 | Ga0500658_0019773 | |||
| 2284 | Ga0500564_002158 | |||
| 2285 | Ga0500634_0007749 | |||
| 2286 | Ga0500638_000044 | |||
| 2287 | Ga0500636_0000373 | |||
| 2288 | Ga0501082_0100338 | |||
| 2289 | Ga0501082_0118143 | |||
| 2290 | Ga0530510_0070798 | |||
| 2291 | 2888340291 | |||
| 2292 | 2501075475 | |||
| 2293 | 2501410816 | |||
| 2294 | 2511096725 | |||
| 2295 | 2511102646 | |||
| 2296 | 2511256488 | |||
| 2297 | 2511256489 | |||
| 2298 | 2511265803 | |||
| 2299 | 2511265804 | |||
| 2300 | 2511280955 | |||
| 2301 | 2511280956 | |||
| 2302 | 2511287949 | |||
| 2303 | 2511287950 | |||
| 2304 | 2511298520 | |||
| 2305 | 2511298521 | |||
| 2306 | 2511301589 | |||
| 2307 | 2511301590 | |||
| 2308 | 2511314219 | |||
| 2309 | 2511314220 | |||
| 2310 | 2511319034 | |||
| 2311 | 2511319035 | |||
| 2312 | 2511323817 | |||
| 2313 | 2511323818 | |||
| 2314 | 2511332966 | |||
| 2315 | 2511332967 | |||
| 2316 | 2511337785 | |||
| 2317 | 2511337786 | |||
| 2318 | 2511343541 | |||
| 2319 | 2511343542 | |||
| 2320 | 2511348824 | |||
| 2321 | 2511348825 | |||
| 2322 | 2511355871 | |||
| 2323 | 2511363821 | |||
| 2324 | 2511363822 | |||
| 2325 | 2511371710 | |||
| 2326 | 2511371711 | |||
| 2327 | 2511375196 | |||
| 2328 | 2511410584 | |||
| 2329 | 2511410585 | |||
| 2330 | 2511823258 | |||
| 2331 | 2512327464 | |||
| 2332 | 2512327465 | |||
| 2333 | 2513613800 | |||
| 2334 | 2514052024 | |||
| 2335 | 2514417995 | |||
| 2336 | 2517566855 | |||
| 2337 | 2524454219 | |||
| 2338 | 2527076467 | |||
| 2339 | 2555246832 | |||
| 2340 | 2555246833 | |||
| 2341 | 2555671652 | |||
| 2342 | 2555671653 | |||
| 2343 | 2583794129 | |||
| 2344 | 2583794130 | |||
| 2345 | 2585276546 | |||
| 2346 | 2585283423 | |||
| 2347 | 2585329104 | |||
| 2348 | 2585333303 | |||
| 2349 | 2585537145 | |||
| 2350 | 2585557051 | |||
| 2351 | 2585900914 | |||
| 2352 | 2588518034 | |||
| 2353 | 2597859721 | |||
| 2354 | 2597859722 | |||
| 2355 | 2597865636 | |||
| 2356 | 2597865637 | |||
| 2357 | 2597871445 | |||
| 2358 | 2597871446 | |||
| 2359 | 2599354193 | |||
| 2360 | 2599354194 | |||
| 2361 | 2599360129 | |||
| 2362 | 2599360130 | |||
| 2363 | 2599366451 | |||
| 2364 | 2599366452 | |||
| 2365 | 2599373241 | |||
| 2366 | 2599373242 | |||
| 2367 | 2599379301 | |||
| 2368 | 2599379302 | |||
| 2369 | 2599385720 | |||
| 2370 | 2599385721 | |||
| 2371 | 2599392100 | |||
| 2372 | 2599392101 | |||
| 2373 | 2599399988 | |||
| 2374 | 2599399989 | |||
| 2375 | 2599403866 | |||
| 2376 | 2599403867 | |||
| 2377 | 2599452808 | |||
| 2378 | 2599452809 | |||
| 2379 | 2599461027 | |||
| 2380 | 2599461028 | |||
| 2381 | 2599469569 | |||
| 2382 | 2599469570 | |||
| 2383 | 2599482550 | |||
| 2384 | 2599482551 | |||
| 2385 | 2599490047 | |||
| 2386 | 2599490048 | |||
| 2387 | 2599510128 | |||
| 2388 | 2599510129 | |||
| 2389 | 2599514442 | |||
| 2390 | 2599514443 | |||
| 2391 | 2599520663 | |||
| 2392 | 2599520664 | |||
| 2393 | 2599614925 | |||
| 2394 | 2599770547 | |||
| 2395 | 2599803728 | |||
| 2396 | 2599803729 | |||
| 2397 | 2599882038 | |||
| 2398 | 2599882039 | |||
| 2399 | 2599886432 | |||
| 2400 | 2599893818 | |||
| 2401 | 2599893819 | |||
| 2402 | 2599896797 | |||
| 2403 | 2599944229 | |||
| 2404 | 2599946209 | |||
| 2405 | 2599950064 | |||
| 2406 | 2599950065 | |||
| 2407 | 2599954701 | |||
| 2408 | 2599957198 | |||
| 2409 | 2599959668 | |||
| 2410 | 2599969763 | |||
| 2411 | 2599981284 | |||
| 2412 | 2599996455 | |||
| 2413 | 2600006517 | |||
| 2414 | 2600015091 | |||
| 2415 | 2600016862 | |||
| 2416 | 2600024103 | |||
| 2417 | 2600031127 | |||
| 2418 | 2600035286 | |||
| 2419 | 2600042739 | |||
| 2420 | 2600053757 | |||
| 2421 | 2600058237 | |||
| 2422 | 2600064086 | |||
| 2423 | 2600072913 | |||
| 2424 | 2600078533 | |||
| 2425 | 2600213641 | |||
| 2426 | 2600213642 | |||
| 2427 | 2600360184 | |||
| 2428 | 2600364623 | |||
| 2429 | 2600364624 | |||
| 2430 | 2600445693 | |||
| 2431 | 2601692909 | |||
| 2432 | 2601692910 | |||
| 2433 | 2601773809 | |||
| 2434 | 2601773810 | |||
| 2435 | 2601796655 | |||
| 2436 | 2601796656 | |||
| 2437 | 2602012606 | |||
| 2438 | 2606073805 | |||
| 2439 | 2606073806 | |||
| 2440 | 2606126549 | |||
| 2441 | 2606126550 | |||
| 2442 | 2616312559 | |||
| 2443 | 2621297881 | |||
| 2444 | 2621297882 | |||
| 2445 | 2624482356 | |||
| 2446 | 2624482357 | |||
| 2447 | 2643772645 | |||
| 2448 | 2643841370 | |||
| 2449 | 2643873775 | |||
| 2450 | 2643873776 | |||
| 2451 | 2643955154 | |||
| 2452 | 2643955155 | |||
| 2453 | 2643988291 | |||
| 2454 | 2644023509 | |||
| 2455 | 2644023510 | |||
| 2456 | 2644132282 | |||
| 2457 | 2644156994 | |||
| 2458 | 2644202713 | |||
| 2459 | 2644207730 | |||
| 2460 | 2644282339 | |||
| 2461 | 2644624920 | |||
| 2462 | 2644624921 | |||
| 2463 | 2644651819 | |||
| 2464 | 2652546850 | |||
| 2465 | 2671092153 | |||
| 2466 | 2671096773 | |||
| 2467 | 2671096774 | |||
| 2468 | 2671116279 | |||
| 2469 | 2671127626 | |||
| 2470 | 2671770703 | |||
| 2471 | 2671770704 | |||
| 2472 | 2677897816 | |||
| 2473 | 2677897817 | |||
| 2474 | 2678261804 | |||
| 2475 | 2678261805 | |||
| 2476 | 2694631731 | |||
| 2477 | 2694638027 | |||
| 2478 | 2715750355 | |||
| 2479 | 2715750356 | |||
| 2480 | 2715755253 | |||
| 2481 | 2715755254 | |||
| 2482 | 2718635535 | |||
| 2483 | 2718635536 | |||
| 2484 | 2723250360 | |||
| 2485 | 2723250361 | |||
| 2486 | 2723578411 | |||
| 2487 | 2738670765 | |||
| 2488 | 2738670766 | |||
| 2489 | 2738749158 | |||
| 2490 | 2738749159 | |||
| 2491 | 2738811644 | |||
| 2492 | 2738811645 | |||
| 2493 | 2738858200 | |||
| 2494 | 2738858201 | |||
| 2495 | 2738899004 | |||
| 2496 | 2738899005 | |||
| 2497 | 2739196746 | |||
| 2498 | 2739257722 | |||
| 2499 | 2739257723 | |||
| 2500 | 2739287604 | |||
| 2501 | 2739292917 | |||
| 2502 | 2739313413 | |||
| 2503 | 2739313414 | |||
| 2504 | 2743739271 | |||
| 2505 | 2743739272 | |||
| 2506 | 2745008153 | |||
| 2507 | 2745008154 | |||
| 2508 | 2756677897 | |||
| 2509 | 2774133238 | |||
| 2510 | 2774133239 | |||
| 2511 | 2784262899 | |||
| 2512 | 2784262900 | |||
| 2513 | 2792629386 | |||
| 2514 | 2794594618 | |||
| 2515 | 2807409965 | |||
| 2516 | 2807409966 | |||
| 2517 | 2807458312 | |||
| 2518 | 2807458313 | |||
| 2519 | 2808856413 | |||
| 2520 | 2808931371 | |||
| 2521 | 2808936439 | |||
| 2522 | 2808953493 | |||
| 2523 | 2808958701 | |||
| 2524 | 2808964860 | |||
| 2525 | 2808979613 | |||
| 2526 | 2808979614 | |||
| 2527 | 2808995116 | |||
| 2528 | 2808995117 | |||
| 2529 | 2808999752 | |||
| 2530 | 2809219426 | |||
| 2531 | 2809219427 | |||
| 2532 | 2817492983 | |||
| 2533 | 2817492984 | |||
| 2534 | 2819642438 | |||
| 2535 | 2819656031 | |||
| 2536 | 2819656032 | |||
| 2537 | 2819701866 | |||
| 2538 | 2819701867 | |||
| 2539 | 2823424071 | |||
| 2540 | 2825653471 | |||
| 2541 | 2825653472 | |||
| 2542 | 2834031410 | |||
| 2543 | 2834031411 | |||
| 2544 | 2842805875 | |||
| 2545 | 2842832127 | |||
| 2546 | 2842832128 | |||
| 2547 | 2842837211 | |||
| 2548 | 2842837212 | |||
| 2549 | 2842840720 | |||
| 2550 | 2842840721 | |||
| 2551 | 2842845008 | |||
| 2552 | 2842845009 | |||
| 2553 | 2842857024 | |||
| 2554 | 2844004905 | |||
| 2555 | 2844672175 | |||
| 2556 | 2844672176 | |||
| 2557 | 2846958398 | |||
| 2558 | 2852612625 | |||
| 2559 | 2852612626 | |||
| 2560 | 2852660902 | |||
| 2561 | 2852660903 | |||
| 2562 | 2852669638 | |||
| 2563 | 2852669639 | |||
| 2564 | 2854915469 | |||
| 2565 | 2856343043 | |||
| 2566 | 2856363564 | |||
| 2567 | 2857354093 | |||
| 2568 | 2857366033 | |||
| 2569 | 2860341210 | |||
| 2570 | 2860872069 | |||
| 2571 | 2860872070 | |||
| 2572 | 2869162967 | |||
| 2573 | 2871471149 | |||
| 2574 | 2871492319 | |||
| 2575 | 2874128032 | |||
| 2576 | 2878034280 | |||
| 2577 | 2878034281 | |||
| 2578 | 2878759667 | |||
| 2579 | 2878785400 | |||
| 2580 | 2880234908 | |||
| 2581 | 2880234909 | |||
| 2582 | 2881849472 | |||
| 2583 | 2881865749 | |||
| 2584 | 2882912578 | |||
| 2585 | 2883091307 | |||
| 2586 | 2883357702 | |||
| 2587 | 2885308167 | |||
| 2588 | 2885316169 | |||
| 2589 | 2885322230 | |||
| 2590 | 2885328914 | |||
| 2591 | 2885334511 | |||
| 2592 | 2888352029 | |||
| 2593 | 2889014015 | |||
| 2594 | 2889021278 | |||
| 2595 | 2903496950 | |||
| 2596 | 2904522239 | |||
| 2597 | 2904522240 | |||
| 2598 | 2904553764 | |||
| 2599 | 2904553765 | |||
| 2600 | 2906328780 | |||
| 2601 | 2906360606 | |||
| 2602 | 2906383954 | |||
| 2603 | 2908451571 | |||
| 2604 | 2908451572 | |||
| 2605 | 2912964815 | |||
| 2606 | 2912964816 | |||
| 2607 | 2917075522 | |||
| 2608 | 2917075523 | |||
| 2609 | 2919066656 | |||
| 2610 | 2919066657 | |||
| 2611 | 2919388357 | |||
| 2612 | 2919388358 | |||
| 2613 | 2919459303 | |||
| 2614 | 2919459304 | |||
| 2615 | 2919483062 | |||
| 2616 | 2919493150 | |||
| 2617 | 2919493151 | |||
| 2618 | 2919493277 | |||
| 2619 | 2919503768 | |||
| 2620 | 2919543103 | |||
| 2621 | 2922136041 | |||
| 2622 | 2922155266 | |||
| 2623 | 2922190737 | |||
| 2624 | 2923158354 | |||
| 2625 | 2923158355 | |||
| 2626 | 2923528333 | |||
| 2627 | 2923590725 | |||
| 2628 | 2924734129 | |||
| 2629 | 2924785334 | |||
| 2630 | 2926065660 | |||
| 2631 | 2926760170 | |||
| 2632 | 2928158953 | |||
| 2633 | 2928167774 | |||
| 2634 | 2928525649 | |||
| 2635 | 2929145597 | |||
| 2636 | 2929194145 | |||
| 2637 | 2929194146 | |||
| 2638 | 2931371071 | |||
| 2639 | 2931395460 | |||
| 2640 | 2931395461 | |||
| 2641 | 2931396945 | |||
| 2642 | 2935356508 | |||
| 2643 | 2935356509 | |||
| 2644 | 2937849078 | |||
| 2645 | 2938019213 | |||
| 2646 | 2939637209 | |||
| 2647 | 2939637210 | |||
| 2648 | 2939652316 | |||
| 2649 | 2939652317 | |||
| 2650 | 2945931868 | |||
| 2651 | 2945931869 | |||
| 2652 | 2945965557 | |||
| 2653 | 2945965558 | |||
| 2654 | 2946007964 | |||
| 2655 | 2946007965 | |||
| 2656 | 2946032658 | |||
| 2657 | 2946032659 | |||
| 2658 | 2947233421 | |||
| 2659 | 2947233422 | |||
| 2660 | 2958106355 | |||
| 2661 | 2958176412 | |||
| 2662 | 2961173607 | |||
| 2663 | 2965116277 | |||
| 2664 | 2965121266 | |||
| 2665 | 2968005797 | |||
| 2666 | 2968120368 | |||
| 2667 | 2969309063 | |||
| 2668 | 2969309064 | |||
| 2669 | 2970495966 | |||
| 2670 | 2970506199 | |||
| 2671 | 2970543484 | |||
| 2672 | 2974289568 | |||
| 2673 | 2974289569 | |||
| 2674 | 2977828189 | |||
| 2675 | 2977834685 | |||
| 2676 | 2977923144 | |||
| 2677 | 2977949754 | |||
| 2678 | 2977973135 | |||
| 2679 | 2977992622 | |||
| 2680 | 2979714350 | |||
| 2681 | 2979745227 | |||
| 2682 | 2979810921 | |||
| 2683 | 2984287835 | |||
| 2684 | 2984287836 | |||
| 2685 | 2987642497 | |||
| 2686 | 2987653946 | |||
| 2687 | 2987680064 | |||
| 2688 | 2989351348 | |||
| 2689 | 2989774530 | |||
| 2690 | 2990710567 | |||
| 2691 | 2998144346 | |||
| 2692 | 2998144347 | |||
| 2693 | 3004210578 | |||
| 2694 | 3004211626 | |||
| 2695 | 3004218873 | |||
| 2696 | 3004272269 | |||
| 2697 | 3005419017 | |||
| 2698 | 3007397644 | |||
| 2699 | 3007397645 | |||
| 2700 | 3007420854 | |||
| 2701 | 3007516128 | |||
| 2702 | 3007516129 | |||
| 2703 | 3007615354 | |||
| 2704 | 3007620381 | |||
| 2705 | 3007620382 | |||
| 2706 | 3007720065 | |||
| 2707 | 3007720066 | |||
| 2708 | 3007858670 | |||
| 2709 | 3007858671 | |||
| 2710 | 3007865801 | |||
| 2711 | 3007865802 | |||
| 2712 | 637321970 | |||
| 2713 | 637321971 | |||
| 2714 | 642425049 | |||
| 2715 | 642592868 | |||
| 2716 | 8004381169 | |||
| 2717 | 8005320800 | |||
| 2718 | 8005645550 | |||
| 2719 | 8005685606 | |||
| 2720 | 8015692430 | |||
| 2721 | 8015692431 | |||
| 2722 | 8019773895 | |||
| 2723 | 8019773896 | |||
| 2724 | 8029996532 | |||
| 2725 | 8029996533 | |||
| 2726 | 8034965942 | |||
| 2727 | 8054285206 | |||
| 2728 | 8054285207 | |||
| 2729 | 8054351284 | |||
| 2730 | 8054351285 | |||
| 2731 | 8054507961 | |||
| 2732 | 8054507962 | |||
| 2733 | 8054934464 | |||
| 2734 | 8055775650 | |||
| 2735 | 8055775651 | |||
| 2736 | 8055822930 | |||
| 2737 | 8055822931 | |||
| 2738 | 8055883333 | |||
| 2739 | 8055883334 | |||
| 2740 | 8056120324 | |||
| 2741 | 8056121842 | |||
| 2742 | 8056130637 | |||
| 2743 | 8056130638 | |||
| 2744 | 8056136330 | |||
| 2745 | 8056136331 | |||
| 2746 | 8056147676 | |||
| 2747 | 8056153647 | |||
| 2748 | 8056153648 | |||
| 2749 | 8056155328 | |||
| 2750 | 8056155329 | |||
| 2751 | 8056162588 | |||
| 2752 | 8056162589 | |||
| 2753 | 8056166915 | |||
| 2754 | 8056166916 | |||
| 2755 | 8056172900 | |||
| 2756 | 8056172901 | |||
| 2757 | 8056183252 | |||
| 2758 | 8056572420 | |||
| 2759 | 8057804509 | |||
| 2760 | 8057804510 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3l1l-assembly1.cif.gz_A-2 | structure of arg-bound escherichia coli adic | 0.8697 | 20 | 459 |
| 3ob6-assembly1.cif.gz_A | structure of adic(n101a) in the open-to-out arg+ bound conformation | 0.8661 | 18 | 459 |
| 5j4i-assembly1.cif.gz_A | crystal structure of the l-arginine/agmatine antiporter from e. coli at 2.2 angstroem resolution | 0.8616 | 19 | 459 |
| 3l1l-assembly1.cif.gz_A-2 | structure of arg-bound escherichia coli adic | 0.8582 | 20 | 459 |
| 3ncy-assembly2.cif.gz_D | x-ray crystal structure of an arginine agmatine antiporter (adic) in complex with a fab fragment | 0.8576 | 21 | 459 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAE5_1_447_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.9226 | 18 | 467 | 1.20.1740.10 |
| af_P0AAE5_1_447_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.9147 | 18 | 467 | 1.20.1740.10 |
| af_Q2FUX9_6_464_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.8834 | 19 | 475 | 1.20.1740.10 |
| af_Q2FUX9_6_464_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.878 | 19 | 475 | 1.20.1740.10 |
| af_Q2FYJ4_6_440_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.8655 | 18 | 454 | 1.20.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A369P457-F1-model_v4 | deleted | 0.9258 | 221 | 486 |
|
| AF-A0A806PRT7-F1-model_v4 | deleted | 0.9252 | 18 | 485 |
|
| AF-A0A157PLT9-F1-model_v4 | Arginine/ornithine antiporter | 0.9168 | 36 | 486 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A369P457-F1-model_v4 | deleted | 0.9157 | 221 | 486 |
|
| AF-A0A260SH09-F1-model_v4 | Arginine-ornithine antiporter | 0.9105 | 17 | 485 |
GO:0005886
GO:0006865 GO:0022857 |