F494487
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1513 | 1110 | 3026 | 378 |
Family's Representative Sequence
| Representative Sequence | 3300053103|Ga0500555_003659|Ga0500555_003659_2610_3761 |
| Length | 383 |
| Sequence | MMETATKALTSVPPLRAIFDALPNPILVIDENDIICFANSEAEDFFQVSSTVLARHRLEETMPFSSPVLEVVKQVRKSAGVMNEYSVGVGTPRMGGERIVDLQTALVNDDPRFVVLTFLRRSMAQKFDLQLTHRGAARSVSGMAAMLAHEIKNPLSGIRGAAQLLEPVLENNDRALAKLICEETDRIRDLVDQMEVFSDERPLERKPINIHVVLDRVKQLTAAGLPNSFNIREEYDPSLPSVLGNQDQLVQVFLNLAKNAAESIVTSGVAGEITLTTAFRPGVKLSVPGSNERVSLPFEVCVHDNGPGISEDLRPHIFDAFVTTKPQGRGLGLALVAKIVRDHGGVVECIPRERGTTFRVLLPMLRQHNEDSEIRKKVMTGER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 19 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 93 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 106 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 107 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 110 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 111 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 116 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 172 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 180 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 181 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 184 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 185 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 187 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 201 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 202 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 213 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 214 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 215 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 216 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 217 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 218 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 219 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 220 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 221 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 222 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 223 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 262 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 263 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 264 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 265 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 266 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 267 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 271 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 272 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 273 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 274 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 275 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 276 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 277 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 278 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 279 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 280 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 281 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 305 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 310 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 320 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 323 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 324 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 325 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 326 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 327 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 328 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 329 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 330 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 332 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 334 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 335 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 336 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 337 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 338 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 339 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 340 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 341 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 343 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 346 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 347 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 348 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 349 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 350 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 351 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 352 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 353 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 354 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 355 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 356 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 357 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 358 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 359 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 360 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 361 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 362 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 363 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 364 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 365 | 2512875024 | |||
| 366 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 367 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 368 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 369 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 370 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 371 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 372 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 373 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 374 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 375 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 376 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 377 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 378 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 379 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 380 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 381 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 382 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 383 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 384 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 385 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 386 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 387 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 388 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 389 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 390 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 391 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 392 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 393 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 394 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 395 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 396 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 397 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 398 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 399 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 400 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 401 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 402 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 403 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 404 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 405 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 406 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 407 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 408 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 409 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 410 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 411 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 412 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 413 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 414 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 415 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 416 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 417 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 418 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 419 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 420 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 421 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 422 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 423 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 424 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 425 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 426 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 427 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 428 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 429 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 430 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 431 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 432 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 433 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 434 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 435 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 436 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 437 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 438 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 439 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 440 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 441 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 442 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 443 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 444 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 445 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 446 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 447 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 448 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 449 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 450 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 451 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 452 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 453 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 454 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 455 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 456 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 457 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 458 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 459 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 460 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 461 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 462 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 463 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 464 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 465 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 466 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 467 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 468 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 469 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 470 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 471 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 472 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 473 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 474 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 475 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 476 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 477 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 478 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 479 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 480 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 481 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 482 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 483 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 484 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 485 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 486 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 487 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 488 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 489 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 490 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 491 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 492 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 493 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 494 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 495 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 496 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 497 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 498 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 499 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 500 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 501 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 502 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 503 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 504 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 505 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 506 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 507 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 508 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 509 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 510 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 511 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 512 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 513 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 514 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 515 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 516 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 517 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 518 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 519 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 520 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 521 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 522 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 523 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 524 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 525 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 526 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 527 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 528 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 529 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 530 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 531 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 532 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 533 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 534 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 535 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 536 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 537 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 538 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 539 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 540 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 541 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 542 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 543 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 544 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 545 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 546 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 547 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 548 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 549 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 550 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 551 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 552 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 553 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 554 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 555 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 556 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 557 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 558 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 559 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 560 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 561 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 562 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 563 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 564 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 565 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 566 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 567 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 568 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 569 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 570 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 571 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 572 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 573 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 574 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 575 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 576 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 577 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 578 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 579 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 580 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 581 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 582 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 583 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 584 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 585 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 586 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 587 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 588 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 589 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 590 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 591 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 592 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 593 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 594 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 595 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 596 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 597 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 598 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 599 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 600 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 601 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 602 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 603 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 604 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 605 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 606 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 607 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 608 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 609 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 610 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 611 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 612 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 613 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 614 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 615 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 616 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 617 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 618 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 619 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 620 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 621 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 622 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 623 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 624 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 625 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 626 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 627 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 628 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 629 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 630 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 631 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 632 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 633 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 634 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 635 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 636 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 637 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 638 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 639 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 640 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 641 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 642 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 643 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 644 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 645 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 646 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 647 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 648 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 649 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 650 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 651 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 652 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 653 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 654 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 655 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 656 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 657 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 658 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 659 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 660 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 661 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 662 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 663 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 664 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 665 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 666 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 667 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 668 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 669 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 670 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 671 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 672 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 673 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 674 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 675 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 676 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 677 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 678 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 679 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 680 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 681 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 682 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 683 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 684 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 685 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 686 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 687 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 688 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 689 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 690 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 691 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 692 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 693 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 694 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 695 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 696 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 697 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 698 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 699 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 700 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 701 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 702 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 703 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 704 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 705 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 706 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 707 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 708 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 709 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 710 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 711 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 712 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 713 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 714 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 715 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 716 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 717 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 718 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 719 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 720 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 721 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 722 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 723 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 724 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 725 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 726 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 727 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 728 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 729 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 730 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 731 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 732 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 733 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 734 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 735 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 736 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 737 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 738 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 739 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 740 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 741 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 742 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 743 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 744 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 745 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 746 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 747 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 748 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 749 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 750 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 751 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 752 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 753 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 754 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 755 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 756 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 757 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 758 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 759 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 760 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 761 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 762 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 763 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 764 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 765 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 766 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 767 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 768 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 769 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 770 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 771 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 772 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 773 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 774 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 775 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 776 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 777 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 778 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 779 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 780 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 781 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 782 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 783 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 784 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 785 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 786 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 787 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 788 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 789 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 790 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 791 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 792 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 793 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 794 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 795 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 796 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 797 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 798 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 799 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 800 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 801 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 802 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 803 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 804 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 805 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 806 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 807 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 808 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 809 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 810 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 811 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 812 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 813 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 814 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 815 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 816 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 817 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 818 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 819 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 820 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 821 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 822 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 823 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 824 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 825 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 826 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 827 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 828 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 829 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 830 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 831 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 832 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 833 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 834 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 835 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 836 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 837 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 838 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 839 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 840 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 841 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 842 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 843 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 844 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 845 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 846 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 847 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 848 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 849 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 850 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 851 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 852 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 853 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 854 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 855 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 856 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 857 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 858 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 859 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 860 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 861 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 862 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 863 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 864 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 865 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 866 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 867 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 868 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 869 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 870 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 871 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 872 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 873 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 874 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 875 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 876 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 877 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 878 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 879 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 880 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 881 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 882 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 883 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 884 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 885 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 886 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 887 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 888 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 889 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 890 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 891 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 892 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 893 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 894 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 895 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 896 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 897 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 898 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 899 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 900 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 901 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 902 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 903 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 904 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 905 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 906 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 907 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 908 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 909 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 910 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 911 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 912 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 913 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 914 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 915 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 916 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 917 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 918 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 919 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 920 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 921 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 922 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 923 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 924 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 925 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 926 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 927 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 928 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 929 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 930 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 931 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 932 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 933 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 934 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 935 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 936 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 937 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 938 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 939 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 940 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 941 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 942 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 943 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 944 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 945 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 946 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 947 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 948 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 949 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 950 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 951 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 952 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 953 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 954 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 955 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 956 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 957 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 958 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 959 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 960 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 961 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 962 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 963 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 964 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 965 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 966 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 967 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 968 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 969 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 970 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 971 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 972 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 973 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 974 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 975 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 976 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 977 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 978 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 979 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 980 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 981 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 982 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 983 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 984 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 985 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 986 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 987 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 988 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 989 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 990 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 991 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 992 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 993 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 994 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 995 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 996 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 997 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 998 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 999 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 1000 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 1001 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 1002 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 1003 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 1004 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 1005 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 1006 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 1007 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 1008 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 1009 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 1010 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 1011 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 1012 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 1013 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 1014 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 1015 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 1016 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 1017 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 1018 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 1019 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 1020 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 1021 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 1022 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 1023 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 1024 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 1025 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 1026 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 1027 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 1028 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 1029 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 1030 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 1031 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 1032 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 1033 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 1034 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 1035 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 1036 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 1037 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 1038 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 1039 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 1040 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 1041 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 1042 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 1043 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 1044 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 1045 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 1046 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 1047 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 1048 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 1049 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1050 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1051 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1052 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1053 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1054 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 1055 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1056 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1057 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1058 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1059 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1060 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1061 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1062 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1063 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1064 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1065 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1066 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1067 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1068 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1069 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1070 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1071 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1072 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1073 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1074 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1075 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1076 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1077 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1078 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1079 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1080 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1081 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1082 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1083 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1084 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1085 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1086 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1087 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1088 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1089 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1090 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1091 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1092 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1093 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1094 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1095 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1096 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1097 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1098 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1099 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1100 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1101 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1102 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1103 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1104 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1105 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 1106 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1107 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1108 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1109 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1110 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 49.24 |
| Metatranscriptomes | 0.07 |
| Isolates | 50.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.33 |
| Bulb | 0 |
| Endosphere | 14.08 |
| Nodule | 40.12 |
| Rhizoplane | 1.72 |
| Rhizosphere | 30.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500555_003659 | 3300053103 | Bacteria | 4376 |
| 2 | JGI24740J21852_10000001 | 3300001979 | Bacteria | 168537 |
| 3 | JGI25155J39150_1000011 | 3300002704 | Bacteria | 207685 |
| 4 | JGI25156J39149_1000027 | 3300002705 | Bacteria | 127396 |
| 5 | JGI25156J39149_1000030 | 3300002705 | Bacteria | 126029 |
| 6 | JGI25156J39149_1011404 | 3300002705 | Bacteria | 2014 |
| 7 | JGI25162J39368_1000351 | 3300002737 | Bacteria | 39572 |
| 8 | JGI25162J39368_1001364 | 3300002737 | Bacteria | 13458 |
| 9 | JGI25162J39368_1002538 | 3300002737 | Bacteria | 6971 |
| 10 | JGI25154J39366_1000057 | 3300002738 | Bacteria | 110584 |
| 11 | JGI25158J39367_1000245 | 3300002739 | Bacteria | 12465 |
| 12 | JGI25158J39367_1009771 | 3300002739 | Bacteria | 1308 |
| 13 | JGI25157J39369_1000010 | 3300002741 | Bacteria | 207685 |
| 14 | JGI25157J39369_1000604 | 3300002741 | Bacteria | 20770 |
| 15 | JGI25152J39213_1000288 | 3300002773 | Bacteria | 33211 |
| 16 | JGI25152J39213_1000724 | 3300002773 | Bacteria | 16980 |
| 17 | JGI25152J39213_1002131 | 3300002773 | Bacteria | 7762 |
| 18 | JGI25152J39213_1003666 | 3300002773 | Bacteria | 5162 |
| 19 | JGI25152J39213_1011614 | 3300002773 | Bacteria | 1939 |
| 20 | JGI25150J39212_1000010 | 3300002774 | Bacteria | 236260 |
| 21 | JGI25159J45721_1000006 | 3300002987 | Bacteria | 188201 |
| 22 | JGI25159J45721_1000683 | 3300002987 | Bacteria | 14907 |
| 23 | JGI25151J46595_10000026 | 3300003187 | Bacteria | 211045 |
| 24 | JGI25151J46595_10000238 | 3300003187 | Bacteria | 64884 |
| 25 | JGI25151J46595_10007967 | 3300003187 | Bacteria | 5137 |
| 26 | JGI25151J46595_10038293 | 3300003187 | Bacteria | 1786 |
| 27 | JGI25406J46586_10009023 | 3300003203 | Bacteria | 4482 |
| 28 | JGI25406J46586_10027468 | 3300003203 | Bacteria | 2182 |
| 29 | JGI25165J46597_1000033 | 3300003214 | Bacteria | 293030 |
| 30 | JGI25165J46597_1000189 | 3300003214 | Bacteria | 91790 |
| 31 | JGI25165J46597_1000777 | 3300003214 | Bacteria | 24294 |
| 32 | JGI25153J46596_10003069 | 3300003215 | Bacteria | 9430 |
| 33 | JGI25153J46596_10028474 | 3300003215 | Bacteria | 1936 |
| 34 | JGI25153J46596_10028476 | 3300003215 | Bacteria | 1936 |
| 35 | JGI25153J46596_10044121 | 3300003215 | Bacteria | 1343 |
| 36 | rootL2_10135068 | 3300003322 | Bacteria | 3541 |
| 37 | JGI25160J50197_1000004 | 3300003354 | Bacteria | 419797 |
| 38 | JGI25160J50197_1000019 | 3300003354 | Bacteria | 233980 |
| 39 | JGI25160J50197_1001596 | 3300003354 | Bacteria | 11167 |
| 40 | JGI25161J50226_1000003 | 3300003374 | Bacteria | 413345 |
| 41 | JGI25161J50226_1000330 | 3300003374 | Bacteria | 25735 |
| 42 | JGI25161J50226_1001454 | 3300003374 | Bacteria | 7115 |
| 43 | JGI25161J50226_1005034 | 3300003374 | Bacteria | 2649 |
| 44 | Ga0055539_1004539 | 3300003752 | Bacteria | 1845 |
| 45 | Ga0055526_1000382 | 3300003771 | Bacteria | 35903 |
| 46 | Ga0055526_1000565 | 3300003771 | Bacteria | 29180 |
| 47 | Ga0055526_1000669 | 3300003771 | Bacteria | 26309 |
| 48 | Ga0055526_1004202 | 3300003771 | Bacteria | 8745 |
| 49 | Ga0055524_1003035 | 3300003775 | Bacteria | 8307 |
| 50 | Ga0055524_1004474 | 3300003775 | Bacteria | 6452 |
| 51 | Ga0055524_1004820 | 3300003775 | Bacteria | 6149 |
| 52 | Ga0055524_1007966 | 3300003775 | Bacteria | 4447 |
| 53 | Ga0055524_1010914 | 3300003775 | Bacteria | 3582 |
| 54 | Ga0055536_1000212 | 3300003781 | Bacteria | 47611 |
| 55 | Ga0055536_1005870 | 3300003781 | Bacteria | 5891 |
| 56 | Ga0055536_1012344 | 3300003781 | Bacteria | 3178 |
| 57 | Ga0055528_1000918 | 3300003790 | Bacteria | 19824 |
| 58 | Ga0055528_1003069 | 3300003790 | Bacteria | 8582 |
| 59 | Ga0055528_1005988 | 3300003790 | Bacteria | 5570 |
| 60 | Ga0055528_1006131 | 3300003790 | Bacteria | 5490 |
| 61 | Ga0055528_1006493 | 3300003790 | Bacteria | 5300 |
| 62 | Ga0055528_1006683 | 3300003790 | Bacteria | 5204 |
| 63 | Ga0055528_1019407 | 3300003790 | Bacteria | 2254 |
| 64 | Ga0055530_10000740 | 3300003791 | Bacteria | 27171 |
| 65 | Ga0055530_10007317 | 3300003791 | Bacteria | 4680 |
| 66 | Ga0055530_10016645 | 3300003791 | Bacteria | 2337 |
| 67 | Ga0055540_1000285 | 3300003792 | Bacteria | 45310 |
| 68 | Ga0055540_1001884 | 3300003792 | Bacteria | 11760 |
| 69 | Ga0055540_1002932 | 3300003792 | Bacteria | 8600 |
| 70 | Ga0055540_1014240 | 3300003792 | Bacteria | 2380 |
| 71 | Ga0055531_10001165 | 3300003794 | Bacteria | 20245 |
| 72 | Ga0055531_10004924 | 3300003794 | Bacteria | 7938 |
| 73 | Ga0058692_1002385 | 3300003856 | Bacteria | 6306 |
| 74 | Ga0055543_1000001 | 3300004625 | Bacteria | 419949 |
| 75 | Ga0055543_1000019 | 3300004625 | Bacteria | 161035 |
| 76 | Ga0055543_1000147 | 3300004625 | Bacteria | 58621 |
| 77 | Ga0055543_1000808 | 3300004625 | Bacteria | 15443 |
| 78 | Ga0065165_1000049 | 3300005262 | Bacteria | 195588 |
| 79 | Ga0065165_1000180 | 3300005262 | Bacteria | 111768 |
| 80 | Ga0065165_1000277 | 3300005262 | Bacteria | 87540 |
| 81 | Ga0065165_1005991 | 3300005262 | Bacteria | 6559 |
| 82 | Ga0070658_10065948 | 3300005327 | Bacteria | 2956 |
| 83 | Ga0070658_10080578 | 3300005327 | Bacteria | 2674 |
| 84 | Ga0070676_10034424 | 3300005328 | Bacteria | 2909 |
| 85 | Ga0070670_100001443 | 3300005331 | Bacteria | 19089 |
| 86 | Ga0070680_100085741 | 3300005336 | Bacteria | 2602 |
| 87 | Ga0070660_100057146 | 3300005339 | Bacteria | 3021 |
| 88 | Ga0070660_100095551 | 3300005339 | Bacteria | 2349 |
| 89 | Ga0070689_100083799 | 3300005340 | Bacteria | 2505 |
| 90 | Ga0070691_10000580 | 3300005341 | Bacteria | 14004 |
| 91 | Ga0070668_100005749 | 3300005347 | Bacteria | 9200 |
| 92 | Ga0070668_100016044 | 3300005347 | Bacteria | 5604 |
| 93 | Ga0070668_100022821 | 3300005347 | Bacteria | 4731 |
| 94 | Ga0070668_100088881 | 3300005347 | Bacteria | 2433 |
| 95 | Ga0070671_100010443 | 3300005355 | Bacteria | 7449 |
| 96 | Ga0070671_100030699 | 3300005355 | Bacteria | 4435 |
| 97 | Ga0070671_100368037 | 3300005355 | Bacteria | 1227 |
| 98 | Ga0070673_100038873 | 3300005364 | Bacteria | 3637 |
| 99 | Ga0070688_100168247 | 3300005365 | Bacteria | 1511 |
| 100 | Ga0070659_100000206 | 3300005366 | Bacteria | 45867 |
| 101 | Ga0070659_100007044 | 3300005366 | Bacteria | 8143 |
| 102 | Ga0070659_100221241 | 3300005366 | Bacteria | 1562 |
| 103 | Ga0070667_100036538 | 3300005367 | Bacteria | 4118 |
| 104 | Ga0070667_100043831 | 3300005367 | Bacteria | 3755 |
| 105 | Ga0070711_100036164 | 3300005439 | Bacteria | 3308 |
| 106 | Ga0070663_100171843 | 3300005455 | Bacteria | 1676 |
| 107 | Ga0070681_10015949 | 3300005458 | Bacteria | 7492 |
| 108 | Ga0070681_10091580 | 3300005458 | Bacteria | 2991 |
| 109 | Ga0070707_100033261 | 3300005468 | Bacteria | 4916 |
| 110 | Ga0070679_100077472 | 3300005530 | Bacteria | 3313 |
| 111 | Ga0070684_100073150 | 3300005535 | Bacteria | 3020 |
| 112 | Ga0068853_100374454 | 3300005539 | Bacteria | 1329 |
| 113 | Ga0070696_100046383 | 3300005546 | Bacteria | 3013 |
| 114 | Ga0070665_100000116 | 3300005548 | Bacteria | 150141 |
| 115 | Ga0070665_100058585 | 3300005548 | Bacteria | 3861 |
| 116 | Ga0070665_100118304 | 3300005548 | Bacteria | 2652 |
| 117 | Ga0070665_100263157 | 3300005548 | Bacteria | 1726 |
| 118 | Ga0068855_100024601 | 3300005563 | Bacteria | 7204 |
| 119 | Ga0068855_100154427 | 3300005563 | Bacteria | 2608 |
| 120 | Ga0068855_100155438 | 3300005563 | Bacteria | 2599 |
| 121 | Ga0068855_100209386 | 3300005563 | Bacteria | 2192 |
| 122 | Ga0070664_100093010 | 3300005564 | Bacteria | 2612 |
| 123 | Ga0068857_100121917 | 3300005577 | Bacteria | 2348 |
| 124 | Ga0068854_100034387 | 3300005578 | Bacteria | 3540 |
| 125 | Ga0068854_100107903 | 3300005578 | Bacteria | 2096 |
| 126 | Ga0068856_100042875 | 3300005614 | Bacteria | 4453 |
| 127 | Ga0068852_100195717 | 3300005616 | Bacteria | 1910 |
| 128 | Ga0068859_100008475 | 3300005617 | Bacteria | 10403 |
| 129 | Ga0068859_100102241 | 3300005617 | Bacteria | 2923 |
| 130 | Ga0068859_100421453 | 3300005617 | Bacteria | 1431 |
| 131 | Ga0068864_100091486 | 3300005618 | Bacteria | 2684 |
| 132 | Ga0068864_100097380 | 3300005618 | Bacteria | 2604 |
| 133 | Ga0068864_100114133 | 3300005618 | Bacteria | 2409 |
| 134 | Ga0068861_100184759 | 3300005719 | Bacteria | 1738 |
| 135 | Ga0068863_100068534 | 3300005841 | Bacteria | 3356 |
| 136 | Ga0068863_100090185 | 3300005841 | Bacteria | 2907 |
| 137 | Ga0068860_100000145 | 3300005843 | Bacteria | 115830 |
| 138 | Ga0068860_100005851 | 3300005843 | Bacteria | 12380 |
| 139 | Ga0068862_100013415 | 3300005844 | Bacteria | 6780 |
| 140 | Ga0068862_100015461 | 3300005844 | Bacteria | 6338 |
| 141 | Ga0068862_100372155 | 3300005844 | Bacteria | 1330 |
| 142 | Ga0081538_10002190 | 3300005981 | Bacteria | 19382 |
| 143 | Ga0081540_1008246 | 3300005983 | Bacteria | 7299 |
| 144 | Ga0081540_1012786 | 3300005983 | Bacteria | 5495 |
| 145 | Ga0081539_10001354 | 3300005985 | Bacteria | 42654 |
| 146 | Ga0070717_10131058 | 3300006028 | Bacteria | 2156 |
| 147 | Ga0070717_10307172 | 3300006028 | Bacteria | 1411 |
| 148 | Ga0075365_10005577 | 3300006038 | Bacteria | 6804 |
| 149 | Ga0075365_10013397 | 3300006038 | Bacteria | 4901 |
| 150 | Ga0075365_10016756 | 3300006038 | Bacteria | 4467 |
| 151 | Ga0075365_10017898 | 3300006038 | Bacteria | 4348 |
| 152 | Ga0075365_10145404 | 3300006038 | Bacteria | 1647 |
| 153 | Ga0075363_100008477 | 3300006048 | Bacteria | 4789 |
| 154 | Ga0075364_10031424 | 3300006051 | Bacteria | 3411 |
| 155 | Ga0070712_100303606 | 3300006175 | Bacteria | 1293 |
| 156 | Ga0075362_10004704 | 3300006177 | Bacteria | 4927 |
| 157 | Ga0075362_10020925 | 3300006177 | Bacteria | 2738 |
| 158 | Ga0075362_10059651 | 3300006177 | Bacteria | 1723 |
| 159 | Ga0075367_10003238 | 3300006178 | Bacteria | 7700 |
| 160 | Ga0075367_10041909 | 3300006178 | Bacteria | 2677 |
| 161 | Ga0075369_10080883 | 3300006186 | Bacteria | 1441 |
| 162 | Ga0075366_10001654 | 3300006195 | Bacteria | 11197 |
| 163 | Ga0075366_10008896 | 3300006195 | Bacteria | 5594 |
| 164 | Ga0075366_10137519 | 3300006195 | Bacteria | 1476 |
| 165 | Ga0075428_100001218 | 3300006844 | Bacteria | 27549 |
| 166 | Ga0075428_100129102 | 3300006844 | Bacteria | 2750 |
| 167 | Ga0075430_100044128 | 3300006846 | Bacteria | 3770 |
| 168 | Ga0075431_100000613 | 3300006847 | Bacteria | 30137 |
| 169 | Ga0075431_100017312 | 3300006847 | Bacteria | 7324 |
| 170 | Ga0075431_100018072 | 3300006847 | Bacteria | 7172 |
| 171 | Ga0075431_100208114 | 3300006847 | Bacteria | 1999 |
| 172 | Ga0075434_100011257 | 3300006871 | Bacteria | 8426 |
| 173 | Ga0075429_100013425 | 3300006880 | Bacteria | 7103 |
| 174 | Ga0068865_100001650 | 3300006881 | Bacteria | 13080 |
| 175 | Ga0097620_100008475 | 3300006931 | Bacteria | 10403 |
| 176 | Ga0097620_100102253 | 3300006931 | Bacteria | 2923 |
| 177 | Ga0097620_100421511 | 3300006931 | Bacteria | 1431 |
| 178 | Ga0079104_1000187 | 3300006946 | Bacteria | 86957 |
| 179 | Ga0079104_1001924 | 3300006946 | Bacteria | 12460 |
| 180 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 181 | Ga0105240_10015964 | 3300009093 | Bacteria | 10180 |
| 182 | Ga0105240_10027898 | 3300009093 | Bacteria | 7386 |
| 183 | Ga0105240_10066214 | 3300009093 | Bacteria | 4483 |
| 184 | Ga0105240_10544402 | 3300009093 | Bacteria | 1285 |
| 185 | Ga0111539_10203844 | 3300009094 | Bacteria | 2306 |
| 186 | Ga0111539_10375644 | 3300009094 | Bacteria | 1655 |
| 187 | Ga0105247_10008257 | 3300009101 | Bacteria | 6354 |
| 188 | Ga0114129_10004627 | 3300009147 | Bacteria | 19421 |
| 189 | Ga0114129_10064420 | 3300009147 | Bacteria | 5115 |
| 190 | Ga0105248_10000154 | 3300009177 | Bacteria | 80081 |
| 191 | Ga0105237_10000708 | 3300009545 | Bacteria | 46177 |
| 192 | Ga0105237_10025668 | 3300009545 | Bacteria | 6023 |
| 193 | Ga0105237_10169520 | 3300009545 | Bacteria | 2183 |
| 194 | Ga0105238_10017778 | 3300009551 | Bacteria | 7229 |
| 195 | Ga0105238_10104877 | 3300009551 | Bacteria | 2808 |
| 196 | Ga0105238_10174121 | 3300009551 | Bacteria | 2128 |
| 197 | Ga0105238_10291902 | 3300009551 | Bacteria | 1613 |
| 198 | Ga0105249_10002692 | 3300009553 | Bacteria | 15360 |
| 199 | Ga0123341_1000001 | 3300009765 | Bacteria | 314908 |
| 200 | Ga0123342_1008195 | 3300009766 | Bacteria | 13325 |
| 201 | Ga0123342_1034638 | 3300009766 | Bacteria | 2210 |
| 202 | Ga0105239_10000739 | 3300010375 | Bacteria | 46483 |
| 203 | Ga0105239_10028635 | 3300010375 | Bacteria | 6125 |
| 204 | Ga0105239_10130617 | 3300010375 | Bacteria | 2793 |
| 205 | Ga0105239_10312229 | 3300010375 | Bacteria | 1772 |
| 206 | Ga0105246_10280664 | 3300011119 | Bacteria | 1336 |
| 207 | Ga0157371_10005765 | 3300013102 | Bacteria | 10378 |
| 208 | Ga0157370_10000284 | 3300013104 | Bacteria | 64323 |
| 209 | Ga0157370_10105632 | 3300013104 | Bacteria | 2635 |
| 210 | Ga0157369_10182886 | 3300013105 | Bacteria | 2205 |
| 211 | Ga0171463_1011 | 3300013249 | Bacteria | 230603 |
| 212 | Ga0163163_10135021 | 3300014325 | Bacteria | 2508 |
| 213 | Ga0163163_10197852 | 3300014325 | Bacteria | 2058 |
| 214 | Ga0182008_10021177 | 3300014497 | Bacteria | 3341 |
| 215 | Ga0157377_10008119 | 3300014745 | Bacteria | 5103 |
| 216 | Ga0182006_1043239 | 3300015261 | Bacteria | 1761 |
| 217 | Ga0182005_1006504 | 3300015265 | Bacteria | 3563 |
| 218 | Ga0183363_1111 | 3300015690 | Bacteria | 22277 |
| 219 | Ga0214542_1000015 | 3300021321 | Bacteria | 227912 |
| 220 | Ga0214542_1019302 | 3300021321 | Bacteria | 5418 |
| 221 | Ga0214543_1000011 | 3300021327 | Bacteria | 344093 |
| 222 | Ga0214543_1000032 | 3300021327 | Bacteria | 200766 |
| 223 | Ga0213876_10024578 | 3300021384 | Bacteria | 3181 |
| 224 | Ga0213876_10041739 | 3300021384 | Bacteria | 2424 |
| 225 | Ga0228711_1000012 | 3300022739 | Bacteria | 132594 |
| 226 | Ga0228710_1000006 | 3300022740 | Bacteria | 209134 |
| 227 | Ga0209435_100022 | 3300025206 | Bacteria | 207766 |
| 228 | Ga0209436_100038 | 3300025208 | Bacteria | 76733 |
| 229 | Ga0209436_100837 | 3300025208 | Bacteria | 12443 |
| 230 | Ga0209437_100160 | 3300025233 | Bacteria | 149451 |
| 231 | Ga0209437_100310 | 3300025233 | Bacteria | 65905 |
| 232 | Ga0207425_1000010 | 3300025245 | Bacteria | 572898 |
| 233 | Ga0207425_1001758 | 3300025245 | Bacteria | 8456 |
| 234 | Ga0209646_1000078 | 3300025246 | Bacteria | 207766 |
| 235 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 236 | Ga0209026_1000065 | 3300025250 | Bacteria | 207766 |
| 237 | Ga0209026_1012621 | 3300025250 | Bacteria | 1466 |
| 238 | Ga0209677_101256 | 3300025253 | Bacteria | 11408 |
| 239 | Ga0209148_1000570 | 3300025254 | Bacteria | 34441 |
| 240 | Ga0209759_1000055 | 3300025256 | Bacteria | 207766 |
| 241 | Ga0209759_1000119 | 3300025256 | Bacteria | 141051 |
| 242 | Ga0209129_1000099 | 3300025258 | Bacteria | 162471 |
| 243 | Ga0209129_1000432 | 3300025258 | Bacteria | 31411 |
| 244 | Ga0209129_1000442 | 3300025258 | Bacteria | 30980 |
| 245 | Ga0209129_1001010 | 3300025258 | Bacteria | 16767 |
| 246 | Ga0209129_1001971 | 3300025258 | Bacteria | 10704 |
| 247 | Ga0209129_1002862 | 3300025258 | Bacteria | 7972 |
| 248 | Ga0209233_1000027 | 3300025261 | Bacteria | 652089 |
| 249 | Ga0209233_1000168 | 3300025261 | Bacteria | 149312 |
| 250 | Ga0209233_1000269 | 3300025261 | Bacteria | 74071 |
| 251 | Ga0209233_1000303 | 3300025261 | Bacteria | 59138 |
| 252 | Ga0209455_1000204 | 3300025272 | Bacteria | 85420 |
| 253 | Ga0209673_1000068 | 3300025273 | Bacteria | 245891 |
| 254 | Ga0209673_1000139 | 3300025273 | Bacteria | 157765 |
| 255 | Ga0209673_1001538 | 3300025273 | Bacteria | 20946 |
| 256 | Ga0209673_1001716 | 3300025273 | Bacteria | 18528 |
| 257 | Ga0209673_1002227 | 3300025273 | Bacteria | 14064 |
| 258 | Ga0209673_1002802 | 3300025273 | Bacteria | 11286 |
| 259 | Ga0209673_1005579 | 3300025273 | Bacteria | 6290 |
| 260 | Ga0209673_1035943 | 3300025273 | Bacteria | 1477 |
| 261 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 262 | Ga0209130_1000012 | 3300025284 | Bacteria | 421329 |
| 263 | Ga0209130_1000097 | 3300025284 | Bacteria | 143750 |
| 264 | Ga0209676_1000399 | 3300025292 | Bacteria | 79312 |
| 265 | Ga0209676_1006026 | 3300025292 | Bacteria | 6116 |
| 266 | Ga0209025_1000022 | 3300025294 | Bacteria | 574487 |
| 267 | Ga0209025_1000237 | 3300025294 | Bacteria | 128553 |
| 268 | Ga0209025_1000358 | 3300025294 | Bacteria | 97655 |
| 269 | Ga0209025_1000729 | 3300025294 | Bacteria | 55773 |
| 270 | Ga0209025_1000923 | 3300025294 | Bacteria | 45012 |
| 271 | Ga0209025_1000949 | 3300025294 | Bacteria | 43938 |
| 272 | Ga0209025_1004865 | 3300025294 | Bacteria | 11329 |
| 273 | Ga0209025_1014684 | 3300025294 | Bacteria | 4792 |
| 274 | Ga0209025_1021924 | 3300025294 | Bacteria | 3413 |
| 275 | Ga0209025_1024577 | 3300025294 | Bacteria | 3103 |
| 276 | Ga0209025_1026821 | 3300025294 | Bacteria | 2877 |
| 277 | Ga0209564_1000140 | 3300025295 | Bacteria | 179856 |
| 278 | Ga0209564_1000794 | 3300025295 | Bacteria | 43506 |
| 279 | Ga0209564_1000802 | 3300025295 | Bacteria | 43078 |
| 280 | Ga0209564_1000868 | 3300025295 | Bacteria | 40261 |
| 281 | Ga0209564_1001618 | 3300025295 | Bacteria | 21851 |
| 282 | Ga0209564_1005687 | 3300025295 | Bacteria | 6993 |
| 283 | Ga0209564_1029829 | 3300025295 | Bacteria | 1705 |
| 284 | Ga0209564_1032595 | 3300025295 | Bacteria | 1566 |
| 285 | Ga0209758_1000086 | 3300025297 | Bacteria | 254778 |
| 286 | Ga0209758_1000155 | 3300025297 | Bacteria | 160455 |
| 287 | Ga0209758_1000545 | 3300025297 | Bacteria | 59830 |
| 288 | Ga0209758_1000587 | 3300025297 | Bacteria | 56803 |
| 289 | Ga0209758_1001100 | 3300025297 | Bacteria | 34985 |
| 290 | Ga0209758_1002445 | 3300025297 | Bacteria | 18964 |
| 291 | Ga0209758_1009072 | 3300025297 | Bacteria | 6274 |
| 292 | Ga0209758_1026976 | 3300025297 | Bacteria | 2469 |
| 293 | Ga0209758_1050684 | 3300025297 | Bacteria | 1453 |
| 294 | Ga0209050_1000200 | 3300025298 | Bacteria | 134115 |
| 295 | Ga0209050_1000650 | 3300025298 | Bacteria | 53753 |
| 296 | Ga0209050_1005095 | 3300025298 | Bacteria | 8471 |
| 297 | Ga0209050_1012900 | 3300025298 | Bacteria | 3780 |
| 298 | Ga0209256_1000557 | 3300025299 | Bacteria | 53444 |
| 299 | Ga0209256_1000687 | 3300025299 | Bacteria | 45327 |
| 300 | Ga0209256_1001048 | 3300025299 | Bacteria | 32169 |
| 301 | Ga0209256_1001371 | 3300025299 | Bacteria | 25602 |
| 302 | Ga0209256_1004371 | 3300025299 | Bacteria | 8941 |
| 303 | Ga0209256_1007616 | 3300025299 | Bacteria | 5278 |
| 304 | Ga0209256_1008484 | 3300025299 | Bacteria | 4754 |
| 305 | Ga0209256_1031180 | 3300025299 | Bacteria | 1461 |
| 306 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 307 | Ga0207426_1000010 | 3300025302 | Bacteria | 796003 |
| 308 | Ga0207426_1000111 | 3300025302 | Bacteria | 234032 |
| 309 | Ga0207426_1001840 | 3300025302 | Bacteria | 15628 |
| 310 | Ga0207426_1002511 | 3300025302 | Bacteria | 11539 |
| 311 | Ga0209051_1000095 | 3300025303 | Bacteria | 167840 |
| 312 | Ga0209051_1001031 | 3300025303 | Bacteria | 26450 |
| 313 | Ga0209051_1001191 | 3300025303 | Bacteria | 23500 |
| 314 | Ga0209051_1003503 | 3300025303 | Bacteria | 10260 |
| 315 | Ga0209051_1007144 | 3300025303 | Bacteria | 6154 |
| 316 | Ga0209051_1018527 | 3300025303 | Bacteria | 3076 |
| 317 | Ga0209257_1000225 | 3300025304 | Bacteria | 134023 |
| 318 | Ga0209257_1001135 | 3300025304 | Bacteria | 34110 |
| 319 | Ga0209257_1001962 | 3300025304 | Bacteria | 22185 |
| 320 | Ga0209257_1002482 | 3300025304 | Bacteria | 18242 |
| 321 | Ga0209257_1003296 | 3300025304 | Bacteria | 14065 |
| 322 | Ga0207647_10009171 | 3300025904 | Bacteria | 7038 |
| 323 | Ga0207645_10047975 | 3300025907 | Bacteria | 2727 |
| 324 | Ga0207705_10002109 | 3300025909 | Bacteria | 15460 |
| 325 | Ga0207684_10044863 | 3300025910 | Bacteria | 3749 |
| 326 | Ga0207707_10043776 | 3300025912 | Bacteria | 3903 |
| 327 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 328 | Ga0207695_10001670 | 3300025913 | Bacteria | 35733 |
| 329 | Ga0207695_10001727 | 3300025913 | Bacteria | 34901 |
| 330 | Ga0207695_10032467 | 3300025913 | Bacteria | 5712 |
| 331 | Ga0207695_10040997 | 3300025913 | Bacteria | 4957 |
| 332 | Ga0207695_10109166 | 3300025913 | Bacteria | 2749 |
| 333 | Ga0207671_10000544 | 3300025914 | Bacteria | 50912 |
| 334 | Ga0207663_10056508 | 3300025916 | Bacteria | 2468 |
| 335 | Ga0207660_10024849 | 3300025917 | Bacteria | 4059 |
| 336 | Ga0207660_10229845 | 3300025917 | Bacteria | 1458 |
| 337 | Ga0207657_10009919 | 3300025919 | Bacteria | 9531 |
| 338 | Ga0207657_10011260 | 3300025919 | Bacteria | 8888 |
| 339 | Ga0207657_10031173 | 3300025919 | Bacteria | 4833 |
| 340 | Ga0207652_10099157 | 3300025921 | Bacteria | 2570 |
| 341 | Ga0207646_10009642 | 3300025922 | Bacteria | 9521 |
| 342 | Ga0207646_10203736 | 3300025922 | Bacteria | 1787 |
| 343 | Ga0207694_10043945 | 3300025924 | Bacteria | 3449 |
| 344 | Ga0207650_10002090 | 3300025925 | Bacteria | 13962 |
| 345 | Ga0207650_10034339 | 3300025925 | Bacteria | 3678 |
| 346 | Ga0207650_10043564 | 3300025925 | Bacteria | 3295 |
| 347 | Ga0207687_10135206 | 3300025927 | Bacteria | 1864 |
| 348 | Ga0207687_10208249 | 3300025927 | Bacteria | 1533 |
| 349 | Ga0207644_10019674 | 3300025931 | Bacteria | 4584 |
| 350 | Ga0207690_10000129 | 3300025932 | Bacteria | 62350 |
| 351 | Ga0207690_10069496 | 3300025932 | Bacteria | 2423 |
| 352 | Ga0207670_10076286 | 3300025936 | Bacteria | 2332 |
| 353 | Ga0207711_10003316 | 3300025941 | Bacteria | 13965 |
| 354 | Ga0207689_10037734 | 3300025942 | Bacteria | 4005 |
| 355 | Ga0207679_10209322 | 3300025945 | Bacteria | 1634 |
| 356 | Ga0207667_10012057 | 3300025949 | Bacteria | 9997 |
| 357 | Ga0207667_10076819 | 3300025949 | Bacteria | 3465 |
| 358 | Ga0207667_10094113 | 3300025949 | Bacteria | 3094 |
| 359 | Ga0207651_10001247 | 3300025960 | Bacteria | 11446 |
| 360 | Ga0207651_10153666 | 3300025960 | Bacteria | 1795 |
| 361 | Ga0207712_10003857 | 3300025961 | Bacteria | 9469 |
| 362 | Ga0207668_10005551 | 3300025972 | Bacteria | 7437 |
| 363 | Ga0207668_10019991 | 3300025972 | Bacteria | 4246 |
| 364 | Ga0207668_10097082 | 3300025972 | Bacteria | 2180 |
| 365 | Ga0207640_10184906 | 3300025981 | Bacteria | 1566 |
| 366 | Ga0207658_10014480 | 3300025986 | Bacteria | 5401 |
| 367 | Ga0207658_10030279 | 3300025986 | Bacteria | 3830 |
| 368 | Ga0207703_10155370 | 3300026035 | Bacteria | 1999 |
| 369 | Ga0207639_10012996 | 3300026041 | Bacteria | 5812 |
| 370 | Ga0207678_10196436 | 3300026067 | Bacteria | 1724 |
| 371 | Ga0207678_10238197 | 3300026067 | Bacteria | 1559 |
| 372 | Ga0207702_10306121 | 3300026078 | Bacteria | 1509 |
| 373 | Ga0207641_10080568 | 3300026088 | Bacteria | 2825 |
| 374 | Ga0207641_10196921 | 3300026088 | Bacteria | 1855 |
| 375 | Ga0207648_10280931 | 3300026089 | Bacteria | 1489 |
| 376 | Ga0207676_10092246 | 3300026095 | Bacteria | 2490 |
| 377 | Ga0207676_10157549 | 3300026095 | Bacteria | 1963 |
| 378 | Ga0207674_10037025 | 3300026116 | Bacteria | 5077 |
| 379 | Ga0207674_10313778 | 3300026116 | Bacteria | 1517 |
| 380 | Ga0207675_100088449 | 3300026118 | Bacteria | 2909 |
| 381 | Ga0207675_100106878 | 3300026118 | Bacteria | 2639 |
| 382 | Ga0207698_10032339 | 3300026142 | Bacteria | 3789 |
| 383 | Ga0207698_10156809 | 3300026142 | Bacteria | 1985 |
| 384 | Ga0209281_1000310 | 3300027111 | Bacteria | 87212 |
| 385 | Ga0209281_1000334 | 3300027111 | Bacteria | 81109 |
| 386 | Ga0209281_1000361 | 3300027111 | Bacteria | 74287 |
| 387 | Ga0209371_1000021 | 3300027312 | Bacteria | 555864 |
| 388 | Ga0209371_1000469 | 3300027312 | Bacteria | 39757 |
| 389 | Ga0209371_1001465 | 3300027312 | Bacteria | 15917 |
| 390 | Ga0209981_1001336 | 3300027378 | Bacteria | 3119 |
| 391 | Ga0209282_1000073 | 3300027666 | Bacteria | 81125 |
| 392 | Ga0207428_10143703 | 3300027907 | Bacteria | 1819 |
| 393 | Ga0268266_10000064 | 3300028379 | Bacteria | 249533 |
| 394 | Ga0268266_10096180 | 3300028379 | Bacteria | 2602 |
| 395 | Ga0268266_10118022 | 3300028379 | Bacteria | 2358 |
| 396 | Ga0268265_10296647 | 3300028380 | Bacteria | 1453 |
| 397 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 398 | Ga0268264_10008753 | 3300028381 | Bacteria | 8402 |
| 399 | Ga0307517_10012250 | 3300028786 | Bacteria | 11791 |
| 400 | Ga0307515_10000844 | 3300028794 | Bacteria | 70375 |
| 401 | Ga0307515_10004389 | 3300028794 | Bacteria | 29220 |
| 402 | Ga0307515_10013773 | 3300028794 | Bacteria | 15073 |
| 403 | Ga0307515_10020621 | 3300028794 | Bacteria | 11742 |
| 404 | Ga0307515_10136352 | 3300028794 | Bacteria | 2666 |
| 405 | Ga0265338_10102967 | 3300028800 | Bacteria | 2320 |
| 406 | Ga0268256_1000020 | 3300030500 | Bacteria | 557873 |
| 407 | Ga0268256_1001794 | 3300030500 | Bacteria | 12086 |
| 408 | Ga0268256_1005314 | 3300030500 | Bacteria | 5095 |
| 409 | Ga0307511_10020348 | 3300030521 | Bacteria | 6286 |
| 410 | Ga0316181_1029502 | 3300030744 | Bacteria | 1646 |
| 411 | Ga0265332_10002681 | 3300031238 | Bacteria | 8915 |
| 412 | Ga0265340_10004410 | 3300031247 | Bacteria | 7873 |
| 413 | Ga0265340_10007323 | 3300031247 | Bacteria | 5996 |
| 414 | Ga0265340_10045900 | 3300031247 | Bacteria | 2132 |
| 415 | Ga0265340_10058938 | 3300031247 | Bacteria | 1842 |
| 416 | Ga0265339_10005244 | 3300031249 | Bacteria | 8652 |
| 417 | Ga0265331_10076144 | 3300031250 | Bacteria | 1564 |
| 418 | Ga0265327_10010519 | 3300031251 | Bacteria | 6494 |
| 419 | Ga0265316_10019975 | 3300031344 | Bacteria | 5714 |
| 420 | Ga0265316_10144053 | 3300031344 | Bacteria | 1788 |
| 421 | Ga0265316_10153431 | 3300031344 | Bacteria | 1725 |
| 422 | Ga0265316_10174053 | 3300031344 | Bacteria | 1605 |
| 423 | Ga0307513_10001153 | 3300031456 | Bacteria | 38347 |
| 424 | Ga0307513_10002223 | 3300031456 | Bacteria | 27113 |
| 425 | Ga0307513_10126591 | 3300031456 | Bacteria | 2509 |
| 426 | Ga0307513_10131453 | 3300031456 | Bacteria | 2448 |
| 427 | Ga0307513_10246589 | 3300031456 | Bacteria | 1586 |
| 428 | Ga0307408_100044283 | 3300031548 | Bacteria | 3171 |
| 429 | Ga0307408_100106122 | 3300031548 | Bacteria | 2149 |
| 430 | Ga0265313_10000115 | 3300031595 | Bacteria | 81365 |
| 431 | Ga0265313_10005411 | 3300031595 | Bacteria | 9409 |
| 432 | Ga0265342_10000291 | 3300031712 | Bacteria | 56828 |
| 433 | Ga0265342_10004760 | 3300031712 | Bacteria | 10550 |
| 434 | Ga0307405_10000865 | 3300031731 | Bacteria | 11966 |
| 435 | Ga0315914_1000008 | 3300031967 | Bacteria | 209133 |
| 436 | Ga0307409_100090327 | 3300031995 | Bacteria | 2507 |
| 437 | Ga0307415_100156003 | 3300032126 | Bacteria | 1763 |
| 438 | Ga0307510_10215800 | 3300033180 | Bacteria | 1435 |
| 439 | Ga0315913_1000688 | 3300033430 | Bacteria | 32300 |
| 440 | Ga0315915_1000014 | 3300033464 | Bacteria | 171068 |
| 441 | Ga0373936_0001078 | 3300035113 | Bacteria | 9771 |
| 442 | Ga0373955_0006909 | 3300035172 | Bacteria | 5189 |
| 443 | Ga0373935_0180676 | 3300035692 | Bacteria | 1449 |
| 444 | Ga0373947_0103714 | 3300035725 | Bacteria | 1790 |
| 445 | Ga0373937_0003965 | 3300036401 | Bacteria | 12517 |
| 446 | Ga0316582_0178570 | 3300036647 | Bacteria | 1444 |
| 447 | Ga0395900_0105421 | 3300037418 | Bacteria | 2896 |
| 448 | Ga0395900_0148717 | 3300037418 | Bacteria | 2394 |
| 449 | Ga0395898_0129795 | 3300037466 | Bacteria | 2414 |
| 450 | Ga0395905_0000325 | 3300037471 | Bacteria | 68813 |
| 451 | Ga0395905_0013938 | 3300037471 | Bacteria | 7688 |
| 452 | Ga0395905_0018905 | 3300037471 | Bacteria | 6534 |
| 453 | Ga0395905_0036384 | 3300037471 | Bacteria | 4623 |
| 454 | Ga0395905_0084322 | 3300037471 | Bacteria | 2977 |
| 455 | Ga0395905_0118398 | 3300037471 | Bacteria | 2489 |
| 456 | Ga0395905_0151442 | 3300037471 | Bacteria | 2182 |
| 457 | Ga0395905_0203822 | 3300037471 | Bacteria | 1854 |
| 458 | Ga0395905_0362075 | 3300037471 | Bacteria | 1343 |
| 459 | Ga0395901_0034892 | 3300038443 | Bacteria | 5196 |
| 460 | Ga0395901_0080149 | 3300038443 | Bacteria | 3408 |
| 461 | Ga0436365_1022390 | 3300039437 | Bacteria | 9083 |
| 462 | Ga0436365_1373120 | 3300039437 | Bacteria | 3307 |
| 463 | Ga0436365_1821915 | 3300039437 | Bacteria | 4592 |
| 464 | Ga0436360_1164335 | 3300039438 | Bacteria | 2240 |
| 465 | Ga0439436_0005547 | 3300041404 | Bacteria | 3865 |
| 466 | Ga0439447_014419 | 3300041407 | Bacteria | 2218 |
| 467 | Ga0439465_0002132 | 3300041413 | Bacteria | 6507 |
| 468 | Ga0439465_0008511 | 3300041413 | Bacteria | 3236 |
| 469 | Ga0439465_0009217 | 3300041413 | Bacteria | 3110 |
| 470 | Ga0439449_0016399 | 3300042007 | Bacteria | 2784 |
| 471 | Ga0439462_0020296 | 3300042015 | Bacteria | 1732 |
| 472 | Ga0439434_0006059 | 3300042435 | Bacteria | 3528 |
| 473 | Ga0450918_004111 | 3300042531 | Bacteria | 2668 |
| 474 | Ga0439440_0026012 | 3300042993 | Bacteria | 1351 |
| 475 | Ga0466972_0016538 | 3300044658 | Bacteria | 3688 |
| 476 | Ga0466957_0006564 | 3300044842 | Bacteria | 6574 |
| 477 | Ga0451576_0255328 | 3300045051 | Bacteria | 1832 |
| 478 | Ga0495638_0000335 | 3300046460 | Bacteria | 59334 |
| 479 | Ga0495638_0070997 | 3300046460 | Bacteria | 2130 |
| 480 | Ga0495605_0008898 | 3300046474 | Bacteria | 5661 |
| 481 | Ga0495585_0085021 | 3300046492 | Bacteria | 1710 |
| 482 | Ga0495583_0040752 | 3300046506 | Bacteria | 2179 |
| 483 | Ga0495606_0001859 | 3300046507 | Bacteria | 26548 |
| 484 | Ga0495610_0006199 | 3300046512 | Bacteria | 8308 |
| 485 | Ga0495616_0072333 | 3300046513 | Bacteria | 1665 |
| 486 | Ga0495620_0011481 | 3300046515 | Bacteria | 4620 |
| 487 | Ga0495620_0037347 | 3300046515 | Bacteria | 2164 |
| 488 | Ga0495628_0096660 | 3300046516 | Bacteria | 2282 |
| 489 | Ga0495631_0044543 | 3300046518 | Bacteria | 1954 |
| 490 | Ga0495632_0007829 | 3300046519 | Bacteria | 6650 |
| 491 | Ga0495632_0016533 | 3300046519 | Bacteria | 4100 |
| 492 | Ga0495632_0054495 | 3300046519 | Bacteria | 1960 |
| 493 | Ga0495643_0017640 | 3300046522 | Bacteria | 4168 |
| 494 | Ga0495643_0019594 | 3300046522 | Bacteria | 3912 |
| 495 | Ga0495648_0078720 | 3300046524 | Bacteria | 1884 |
| 496 | Ga0495642_0003747 | 3300046528 | Bacteria | 5949 |
| 497 | Ga0495652_0145320 | 3300046529 | Bacteria | 1860 |
| 498 | Ga0495654_0006825 | 3300046530 | Bacteria | 6442 |
| 499 | Ga0495609_0047737 | 3300046538 | Bacteria | 1915 |
| 500 | Ga0495597_0037496 | 3300046542 | Bacteria | 2176 |
| 501 | Ga0495597_0051685 | 3300046542 | Bacteria | 1811 |
| 502 | Ga0495622_0023852 | 3300046557 | Bacteria | 2854 |
| 503 | Ga0495656_0013990 | 3300046615 | Bacteria | 2999 |
| 504 | Ga0495668_0026182 | 3300046616 | Bacteria | 3311 |
| 505 | Ga0495668_0036672 | 3300046616 | Bacteria | 2747 |
| 506 | Ga0495668_0044359 | 3300046616 | Bacteria | 2471 |
| 507 | Ga0495634_0102449 | 3300046642 | Bacteria | 1849 |
| 508 | Ga0495625_0003150 | 3300046660 | Bacteria | 16795 |
| 509 | Ga0495625_0022163 | 3300046660 | Bacteria | 4874 |
| 510 | Ga0495625_0121613 | 3300046660 | Bacteria | 1776 |
| 511 | Ga0495588_0001585 | 3300046674 | Bacteria | 9715 |
| 512 | Ga0495657_0041914 | 3300046675 | Bacteria | 3129 |
| 513 | Ga0495623_0135070 | 3300046679 | Bacteria | 1473 |
| 514 | Ga0495669_0020443 | 3300046684 | Bacteria | 2866 |
| 515 | Ga0495613_0004373 | 3300046689 | Bacteria | 10572 |
| 516 | Ga0495671_0072418 | 3300046692 | Bacteria | 1692 |
| 517 | Ga0495600_0083742 | 3300046809 | Bacteria | 2081 |
| 518 | Ga0495681_0002954 | 3300047470 | Bacteria | 11989 |
| 519 | Ga0495686_0004865 | 3300047472 | Bacteria | 10832 |
| 520 | Ga0495686_0023724 | 3300047472 | Bacteria | 4040 |
| 521 | Ga0495686_0032058 | 3300047472 | Bacteria | 3403 |
| 522 | Ga0495686_0075994 | 3300047472 | Bacteria | 2058 |
| 523 | Ga0495686_0149061 | 3300047472 | Bacteria | 1375 |
| 524 | Ga0495602_0125809 | 3300048088 | Bacteria | 2054 |
| 525 | Ga0496100_0139285 | 3300048903 | Bacteria | 1717 |
| 526 | Ga0496101_0077391 | 3300048904 | Bacteria | 2451 |
| 527 | Ga0496102_0187894 | 3300048905 | Bacteria | 1947 |
| 528 | Ga0496103_0211605 | 3300048906 | Bacteria | 1247 |
| 529 | Ga0496105_0127464 | 3300048908 | Bacteria | 2098 |
| 530 | Ga0496105_0151629 | 3300048908 | Bacteria | 1905 |
| 531 | Ga0496105_0288371 | 3300048908 | Bacteria | 1322 |
| 532 | Ga0496106_0004921 | 3300048909 | Bacteria | 9886 |
| 533 | Ga0496107_0141570 | 3300048910 | Bacteria | 1778 |
| 534 | Ga0496110_0151666 | 3300048913 | Bacteria | 2099 |
| 535 | Ga0496111_0001499 | 3300048914 | Bacteria | 13379 |
| 536 | Ga0496112_0033343 | 3300048915 | Bacteria | 5006 |
| 537 | Ga0496112_0050254 | 3300048915 | Bacteria | 4088 |
| 538 | Ga0496112_0161662 | 3300048915 | Bacteria | 2206 |
| 539 | Ga0496112_0176656 | 3300048915 | Bacteria | 2100 |
| 540 | Ga0496114_0305178 | 3300048917 | Bacteria | 1406 |
| 541 | Ga0496115_0000598 | 3300048918 | Bacteria | 27622 |
| 542 | Ga0496115_0013865 | 3300048918 | Bacteria | 6104 |
| 543 | Ga0496116_0000043 | 3300048919 | Bacteria | 328085 |
| 544 | Ga0496116_0005367 | 3300048919 | Bacteria | 11929 |
| 545 | Ga0496116_0008089 | 3300048919 | Bacteria | 9192 |
| 546 | Ga0496116_0009102 | 3300048919 | Bacteria | 8512 |
| 547 | Ga0496116_0089980 | 3300048919 | Bacteria | 1870 |
| 548 | Ga0496117_0000338 | 3300048920 | Bacteria | 82688 |
| 549 | Ga0496117_0018243 | 3300048920 | Bacteria | 5823 |
| 550 | Ga0496117_0053521 | 3300048920 | Bacteria | 2835 |
| 551 | Ga0496117_0074710 | 3300048920 | Bacteria | 2255 |
| 552 | Ga0496117_0112688 | 3300048920 | Bacteria | 1691 |
| 553 | Ga0496118_0000958 | 3300048921 | Bacteria | 45054 |
| 554 | Ga0496118_0012461 | 3300048921 | Bacteria | 8161 |
| 555 | Ga0496118_0058725 | 3300048921 | Bacteria | 2871 |
| 556 | Ga0496119_0000407 | 3300048922 | Bacteria | 59063 |
| 557 | Ga0496119_0020566 | 3300048922 | Bacteria | 4811 |
| 558 | Ga0496119_0118030 | 3300048922 | Bacteria | 1462 |
| 559 | Ga0496120_0000589 | 3300048923 | Bacteria | 55133 |
| 560 | Ga0496120_0001472 | 3300048923 | Bacteria | 28063 |
| 561 | Ga0496120_0039468 | 3300048923 | Bacteria | 2784 |
| 562 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 563 | Ga0496121_0002723 | 3300048924 | Bacteria | 26365 |
| 564 | Ga0496121_0009941 | 3300048924 | Bacteria | 10830 |
| 565 | Ga0496121_0015230 | 3300048924 | Bacteria | 8079 |
| 566 | Ga0496121_0021685 | 3300048924 | Bacteria | 6279 |
| 567 | Ga0496121_0243555 | 3300048924 | Bacteria | 1251 |
| 568 | Ga0496122_0000025 | 3300048925 | Bacteria | 362915 |
| 569 | Ga0496122_0001020 | 3300048925 | Bacteria | 49521 |
| 570 | Ga0496122_0011791 | 3300048925 | Bacteria | 8798 |
| 571 | Ga0496122_0016499 | 3300048925 | Bacteria | 6981 |
| 572 | Ga0496122_0045297 | 3300048925 | Bacteria | 3420 |
| 573 | Ga0496122_0060685 | 3300048925 | Bacteria | 2782 |
| 574 | Ga0496122_0066491 | 3300048925 | Bacteria | 2604 |
| 575 | Ga0496122_0080187 | 3300048925 | Bacteria | 2277 |
| 576 | Ga0496123_0000032 | 3300048926 | Bacteria | 285282 |
| 577 | Ga0496123_0000043 | 3300048926 | Bacteria | 253752 |
| 578 | Ga0496123_0005929 | 3300048926 | Bacteria | 12038 |
| 579 | Ga0496123_0033060 | 3300048926 | Bacteria | 3729 |
| 580 | Ga0496123_0034781 | 3300048926 | Bacteria | 3602 |
| 581 | Ga0496124_0004564 | 3300048927 | Bacteria | 16090 |
| 582 | Ga0496124_0009370 | 3300048927 | Bacteria | 10090 |
| 583 | Ga0496124_0017870 | 3300048927 | Bacteria | 6667 |
| 584 | Ga0496124_0023770 | 3300048927 | Bacteria | 5586 |
| 585 | Ga0496124_0043644 | 3300048927 | Bacteria | 3853 |
| 586 | Ga0496124_0057788 | 3300048927 | Bacteria | 3267 |
| 587 | Ga0496124_0116299 | 3300048927 | Bacteria | 2144 |
| 588 | Ga0496124_0122643 | 3300048927 | Bacteria | 2074 |
| 589 | Ga0496124_0164845 | 3300048927 | Bacteria | 1723 |
| 590 | Ga0496125_0000141 | 3300048928 | Bacteria | 158991 |
| 591 | Ga0496125_0000946 | 3300048928 | Bacteria | 45578 |
| 592 | Ga0496125_0047515 | 3300048928 | Bacteria | 3588 |
| 593 | Ga0496125_0076177 | 3300048928 | Bacteria | 2591 |
| 594 | Ga0496125_0091985 | 3300048928 | Bacteria | 2270 |
| 595 | Ga0496126_0000362 | 3300048929 | Bacteria | 94734 |
| 596 | Ga0496126_0001471 | 3300048929 | Bacteria | 36655 |
| 597 | Ga0496126_0094112 | 3300048929 | Bacteria | 2630 |
| 598 | Ga0496126_0282256 | 3300048929 | Bacteria | 1375 |
| 599 | Ga0501031_0000095 | 3300049568 | Bacteria | 47538 |
| 600 | Ga0501032_0000084 | 3300049569 | Bacteria | 82148 |
| 601 | Ga0501032_0018154 | 3300049569 | Bacteria | 4929 |
| 602 | Ga0501033_0000102 | 3300049570 | Bacteria | 81583 |
| 603 | Ga0501033_0002401 | 3300049570 | Bacteria | 15945 |
| 604 | Ga0501033_0109595 | 3300049570 | Bacteria | 2010 |
| 605 | Ga0501033_0216347 | 3300049570 | Bacteria | 1365 |
| 606 | Ga0501034_0001404 | 3300049571 | Bacteria | 32372 |
| 607 | Ga0501034_0002050 | 3300049571 | Bacteria | 25291 |
| 608 | Ga0501034_0051983 | 3300049571 | Bacteria | 4130 |
| 609 | Ga0501034_0063545 | 3300049571 | Bacteria | 3705 |
| 610 | Ga0501034_0070355 | 3300049571 | Bacteria | 3510 |
| 611 | Ga0501034_0114321 | 3300049571 | Bacteria | 2688 |
| 612 | Ga0501034_0119062 | 3300049571 | Bacteria | 2627 |
| 613 | Ga0501034_0146432 | 3300049571 | Bacteria | 2339 |
| 614 | Ga0501034_0221666 | 3300049571 | Bacteria | 1843 |
| 615 | Ga0501034_0269726 | 3300049571 | Bacteria | 1643 |
| 616 | Ga0501036_0000040 | 3300049572 | Bacteria | 81588 |
| 617 | Ga0501036_0099353 | 3300049572 | Bacteria | 2461 |
| 618 | Ga0501036_0133787 | 3300049572 | Bacteria | 2092 |
| 619 | Ga0501037_0000098 | 3300049573 | Bacteria | 81588 |
| 620 | Ga0501037_0116670 | 3300049573 | Bacteria | 1921 |
| 621 | Ga0501037_0127251 | 3300049573 | Bacteria | 1828 |
| 622 | Ga0501038_0000002 | 3300049574 | Bacteria | 330446 |
| 623 | Ga0501038_0041862 | 3300049574 | Bacteria | 3993 |
| 624 | Ga0501038_0079363 | 3300049574 | Bacteria | 2768 |
| 625 | Ga0501038_0087687 | 3300049574 | Bacteria | 2613 |
| 626 | Ga0501038_0204517 | 3300049574 | Bacteria | 1583 |
| 627 | Ga0501039_0000002 | 3300049575 | Bacteria | 375152 |
| 628 | Ga0501039_0070611 | 3300049575 | Bacteria | 2713 |
| 629 | Ga0501039_0123771 | 3300049575 | Bacteria | 2027 |
| 630 | Ga0501040_0018811 | 3300049576 | Bacteria | 4589 |
| 631 | Ga0501040_0087537 | 3300049576 | Bacteria | 2163 |
| 632 | Ga0501041_0085751 | 3300049577 | Bacteria | 1942 |
| 633 | Ga0501043_0006479 | 3300049579 | Bacteria | 9399 |
| 634 | Ga0501043_0091348 | 3300049579 | Bacteria | 2394 |
| 635 | Ga0501046_0040082 | 3300049580 | Bacteria | 3745 |
| 636 | Ga0501046_0040474 | 3300049580 | Bacteria | 3724 |
| 637 | Ga0501046_0097247 | 3300049580 | Bacteria | 2262 |
| 638 | Ga0501047_0002237 | 3300049581 | Bacteria | 18521 |
| 639 | Ga0501047_0009623 | 3300049581 | Bacteria | 9138 |
| 640 | Ga0501047_0039107 | 3300049581 | Bacteria | 4589 |
| 641 | Ga0501047_0152057 | 3300049581 | Bacteria | 2190 |
| 642 | Ga0501047_0207448 | 3300049581 | Bacteria | 1819 |
| 643 | Ga0501067_0027657 | 3300049583 | Bacteria | 3143 |
| 644 | Ga0501067_0103293 | 3300049583 | Bacteria | 1584 |
| 645 | Ga0501070_0001215 | 3300049586 | Bacteria | 23032 |
| 646 | Ga0501070_0007158 | 3300049586 | Bacteria | 9480 |
| 647 | Ga0501070_0012619 | 3300049586 | Bacteria | 7127 |
| 648 | Ga0501070_0100753 | 3300049586 | Bacteria | 2390 |
| 649 | Ga0501070_0130711 | 3300049586 | Bacteria | 2074 |
| 650 | Ga0501070_0134744 | 3300049586 | Bacteria | 2039 |
| 651 | Ga0501070_0161841 | 3300049586 | Bacteria | 1845 |
| 652 | Ga0501073_0021969 | 3300049589 | Bacteria | 4597 |
| 653 | Ga0501073_0068421 | 3300049589 | Bacteria | 2475 |
| 654 | Ga0501073_0102510 | 3300049589 | Bacteria | 1987 |
| 655 | Ga0501074_0078145 | 3300049590 | Bacteria | 2375 |
| 656 | Ga0501074_0122459 | 3300049590 | Bacteria | 1860 |
| 657 | Ga0501074_0156517 | 3300049590 | Bacteria | 1628 |
| 658 | Ga0501075_0053150 | 3300049591 | Bacteria | 3046 |
| 659 | Ga0501077_0008398 | 3300049593 | Bacteria | 6394 |
| 660 | Ga0501077_0061769 | 3300049593 | Bacteria | 2378 |
| 661 | Ga0501079_0016684 | 3300049741 | Bacteria | 5608 |
| 662 | Ga0501079_0189767 | 3300049741 | Bacteria | 1604 |
| 663 | Ga0501080_0115959 | 3300049742 | Bacteria | 2483 |
| 664 | Ga0501080_0116216 | 3300049742 | Bacteria | 2480 |
| 665 | Ga0501081_0002292 | 3300049743 | Bacteria | 12049 |
| 666 | Ga0501083_0008060 | 3300049744 | Bacteria | 7452 |
| 667 | Ga0501083_0087908 | 3300049744 | Bacteria | 2055 |
| 668 | Ga0501083_0122816 | 3300049744 | Bacteria | 1703 |
| 669 | Ga0501280_001402 | 3300049776 | Bacteria | 4488 |
| 670 | Ga0501035_0000163 | 3300049822 | Bacteria | 81898 |
| 671 | Ga0501035_0000636 | 3300049822 | Bacteria | 38713 |
| 672 | Ga0501035_0006001 | 3300049822 | Bacteria | 11439 |
| 673 | Ga0501035_0053793 | 3300049822 | Bacteria | 3599 |
| 674 | Ga0501035_0100213 | 3300049822 | Bacteria | 2543 |
| 675 | Ga0501035_0119403 | 3300049822 | Bacteria | 2306 |
| 676 | Ga0501035_0158231 | 3300049822 | Bacteria | 1962 |
| 677 | Ga0501044_0000002 | 3300049823 | Bacteria | 375152 |
| 678 | Ga0501044_0008237 | 3300049823 | Bacteria | 11434 |
| 679 | Ga0501044_0101028 | 3300049823 | Bacteria | 2902 |
| 680 | Ga0501044_0122644 | 3300049823 | Bacteria | 2598 |
| 681 | Ga0501044_0129502 | 3300049823 | Bacteria | 2518 |
| 682 | Ga0501044_0171180 | 3300049823 | Bacteria | 2143 |
| 683 | nmdc:mga00v17_115039_c1 | 3300050491 | Bacteria | 1709 |
| 684 | nmdc:mga0yw44_22286_c1 | 3300050492 | Bacteria | 3550 |
| 685 | nmdc:mga0yw44_2486_c2 | 3300050492 | Bacteria | 7320 |
| 686 | nmdc:mga0k408_85117_c1 | 3300050493 | Bacteria | 1856 |
| 687 | nmdc:mga06z11_11767_c1 | 3300050494 | Bacteria | 3783 |
| 688 | nmdc:mga05p37_3347_c1 | 3300050507 | Bacteria | 18694 |
| 689 | nmdc:mga05p37_51639_c1 | 3300050507 | Bacteria | 5055 |
| 690 | nmdc:mga06r32_173970_c1 | 3300050510 | Bacteria | 2137 |
| 691 | nmdc:mga06r32_397_c1 | 3300050510 | Bacteria | 36835 |
| 692 | nmdc:mga06r32_4570_c1 | 3300050510 | Bacteria | 12407 |
| 693 | nmdc:mga06r32_65217_c1 | 3300050510 | Bacteria | 3512 |
| 694 | nmdc:mga08y16_125660_c1 | 3300050511 | Bacteria | 2668 |
| 695 | nmdc:mga08y16_184_c1 | 3300050511 | Bacteria | 55479 |
| 696 | nmdc:mga08y16_317269_c1 | 3300050511 | Bacteria | 1605 |
| 697 | nmdc:mga08y16_341208_c1 | 3300050511 | Bacteria | 1540 |
| 698 | nmdc:mga0n895_34584_c1 | 3300050512 | Bacteria | 4865 |
| 699 | nmdc:mga0n895_83347_c1 | 3300050512 | Bacteria | 3188 |
| 700 | nmdc:mga0rr50_112960_c1 | 3300050513 | Bacteria | 2152 |
| 701 | nmdc:mga0a205_189122_c1 | 3300050515 | Bacteria | 1951 |
| 702 | nmdc:mga0sz30_40695_c1 | 3300050516 | Bacteria | 1954 |
| 703 | Ga0495601_0026160 | 3300053077 | Bacteria | 3601 |
| 704 | Ga0495601_0051134 | 3300053077 | Bacteria | 2608 |
| 705 | Ga0500610_0068381 | 3300053079 | Bacteria | 1852 |
| 706 | Ga0500610_0104760 | 3300053079 | Bacteria | 1460 |
| 707 | Ga0495595_0004834 | 3300053084 | Bacteria | 5426 |
| 708 | Ga0495619_0084124 | 3300053085 | Bacteria | 2147 |
| 709 | Ga0495619_0132219 | 3300053085 | Bacteria | 1715 |
| 710 | Ga0495619_0196040 | 3300053085 | Bacteria | 1398 |
| 711 | Ga0500578_0059011 | 3300053086 | Bacteria | 2452 |
| 712 | Ga0500643_029906 | 3300053087 | Bacteria | 1672 |
| 713 | Ga0500643_040753 | 3300053087 | Bacteria | 1367 |
| 714 | Ga0500556_0000048 | 3300053104 | Bacteria | 123558 |
| 715 | Ga0500557_000677 | 3300053105 | Bacteria | 4745 |
| 716 | Ga0500560_035252 | 3300053107 | Bacteria | 1539 |
| 717 | Ga0500569_038673 | 3300053109 | Bacteria | 1386 |
| 718 | Ga0500572_017220 | 3300053111 | Bacteria | 1854 |
| 719 | Ga0500595_010690 | 3300053119 | Bacteria | 3634 |
| 720 | Ga0500618_001230 | 3300053125 | Bacteria | 11999 |
| 721 | Ga0500618_001417 | 3300053125 | Bacteria | 10714 |
| 722 | Ga0500652_000002 | 3300053131 | Bacteria | 273315 |
| 723 | Ga0500658_0001009 | 3300053134 | Bacteria | 11474 |
| 724 | Ga0500568_0005268 | 3300053139 | Bacteria | 6725 |
| 725 | Ga0500568_0007791 | 3300053139 | Bacteria | 5217 |
| 726 | Ga0500573_0005547 | 3300053140 | Bacteria | 6763 |
| 727 | Ga0500573_0052004 | 3300053140 | Bacteria | 2355 |
| 728 | Ga0500604_0015719 | 3300053151 | Bacteria | 2076 |
| 729 | Ga0500604_0023625 | 3300053151 | Bacteria | 1755 |
| 730 | Ga0500616_0000417 | 3300053153 | Bacteria | 57047 |
| 731 | Ga0500616_0003179 | 3300053153 | Bacteria | 12786 |
| 732 | Ga0500616_0008458 | 3300053153 | Bacteria | 6387 |
| 733 | Ga0500616_0050895 | 3300053153 | Bacteria | 2185 |
| 734 | Ga0500620_000455 | 3300053155 | Bacteria | 7365 |
| 735 | Ga0500620_025179 | 3300053155 | Bacteria | 1828 |
| 736 | Ga0500622_0002220 | 3300053156 | Bacteria | 14314 |
| 737 | Ga0500622_0002307 | 3300053156 | Bacteria | 13947 |
| 738 | Ga0500624_000439 | 3300053157 | Bacteria | 12586 |
| 739 | Ga0500634_0105582 | 3300053161 | Bacteria | 1401 |
| 740 | Ga0500636_0000065 | 3300053177 | Bacteria | 51565 |
| 741 | Ga0500636_0007738 | 3300053177 | Bacteria | 6214 |
| 742 | Ga0500645_004747 | 3300053730 | Bacteria | 5147 |
| 743 | Ga0587090_002011 | 3300059510 | Bacteria | 2171 |
| 744 | Ga0501082_0001446 | 3300060353 | Bacteria | 20856 |
| 745 | Ga0530510_0041490 | 3300061734 | Bacteria | 3323 |
| 746 | Ga0530510_0117563 | 3300061734 | Bacteria | 1950 |
| 747 | 2503202580 | 2503198000 | Bacteria | 6884444 |
| 748 | 2509107866 | 2508501122 | Bacteria | 6292184 |
| 749 | 2509114387 | 2508501123 | Bacteria | 6283661 |
| 750 | 2509373176 | 2509276018 | Bacteria | 6910194 |
| 751 | 2509376263 | 2509276019 | Bacteria | 6802256 |
| 752 | 2509387053 | 2509276021 | Bacteria | 7634384 |
| 753 | 2509397094 | 2509276022 | Bacteria | 6200534 |
| 754 | 2509442549 | 2509276033 | Bacteria | 7180565 |
| 755 | 2510132910 | 2510065019 | Bacteria | 6903379 |
| 756 | 2510307048 | 2510065057 | Bacteria | 6649661 |
| 757 | 2510317137 | 2510065059 | Bacteria | 6847884 |
| 758 | 2510894282 | 2510461076 | Bacteria | 8618824 |
| 759 | 2510899307 | 2510461076 | Bacteria | 8618824 |
| 760 | 2511133714 | 2510917022 | Bacteria | 6504556 |
| 761 | 2511175907 | 2510917026 | Bacteria | 7046020 |
| 762 | 2511183665 | 2510917028 | Bacteria | 6185411 |
| 763 | 2511198275 | 2510917030 | Bacteria | 7460662 |
| 764 | 2511501367 | 2511231052 | Bacteria | 6974333 |
| 765 | 2512532786 | 2512047086 | Bacteria | 6850303 |
| 766 | 2512930643 | 2512875016 | Bacteria | 6529530 |
| 767 | 2512958390 | 2512875024 | Bacteria | 7195110 |
| 768 | 2512971882 | 2512875026 | Bacteria | 6861065 |
| 769 | 2513570003 | 2513237084 | Bacteria | 7231967 |
| 770 | 2513575258 | 2513237085 | Bacteria | 7695351 |
| 771 | 2513587778 | 2513237086 | Bacteria | 7265287 |
| 772 | 2513592683 | 2513237087 | Bacteria | 5817514 |
| 773 | 2513598983 | 2513237088 | Bacteria | 6927906 |
| 774 | 2513606284 | 2513237089 | Bacteria | 6553624 |
| 775 | 2513614329 | 2513237090 | Bacteria | 7096802 |
| 776 | 2513617802 | 2513237091 | Bacteria | 6900273 |
| 777 | 2513633054 | 2513237093 | Bacteria | 7545552 |
| 778 | 2513710225 | 2513237103 | Bacteria | 7647401 |
| 779 | 2513869377 | 2513237138 | Bacteria | 7368160 |
| 780 | 2513886247 | 2513237140 | Bacteria | 7076289 |
| 781 | 2513906302 | 2513237143 | Bacteria | 6664116 |
| 782 | 2513909796 | 2513237144 | Bacteria | 7530820 |
| 783 | 2513926565 | 2513237146 | Bacteria | 7166346 |
| 784 | 2513987423 | 2513237156 | Bacteria | 6402557 |
| 785 | 2514000276 | 2513237159 | Bacteria | 6810126 |
| 786 | 2514005433 | 2513237160 | Bacteria | 6650282 |
| 787 | 2514019905 | 2513237162 | Bacteria | 7468464 |
| 788 | 2514038355 | 2513237164 | Bacteria | 7563725 |
| 789 | 2515111862 | 2515075009 | Bacteria | 7288508 |
| 790 | 2515611495 | 2515154107 | Bacteria | 6795637 |
| 791 | 2515633647 | 2515154113 | Bacteria | 7807172 |
| 792 | 2515642190 | 2515154114 | Bacteria | 7848616 |
| 793 | 2515656245 | 2515154116 | Bacteria | 7552979 |
| 794 | 2515738956 | 2515154134 | Bacteria | 7220242 |
| 795 | 2516209241 | 2516143018 | Bacteria | 6951533 |
| 796 | 2516892645 | 2516653046 | Bacteria | 6989037 |
| 797 | 2517035580 | 2516653077 | Bacteria | 7555578 |
| 798 | 2517076039 | 2516653085 | Bacteria | 7346596 |
| 799 | 2517094779 | 2517093000 | Bacteria | 7412387 |
| 800 | 2517406406 | 2517287029 | Bacteria | 6905599 |
| 801 | 2517569460 | 2517487022 | Bacteria | 7227575 |
| 802 | 2520376175 | 2519899620 | Bacteria | 6499161 |
| 803 | 2523470300 | 2523231067 | Bacteria | 5230452 |
| 804 | 2524452873 | 2524023207 | Bacteria | 6813453 |
| 805 | 2524460395 | 2524023209 | Bacteria | 6679728 |
| 806 | 2530645162 | 2529292951 | Bacteria | 6916614 |
| 807 | 2535516179 | 2534681796 | Bacteria | 7146037 |
| 808 | 2537874643 | 2537561587 | Bacteria | 5425293 |
| 809 | 2551682279 | 2551306084 | Bacteria | 8942552 |
| 810 | 2551684602 | 2551306085 | Bacteria | 7347181 |
| 811 | 2551693591 | 2551306086 | Bacteria | 6843938 |
| 812 | 2551703232 | 2551306087 | Bacteria | 7351905 |
| 813 | 2551708983 | 2551306089 | Bacteria | 7162724 |
| 814 | 2551719087 | 2551306090 | Bacteria | 7953713 |
| 815 | 2551730633 | 2551306091 | Bacteria | 7086830 |
| 816 | 2551736439 | 2551306092 | Bacteria | 6992595 |
| 817 | 2551740115 | 2551306093 | Bacteria | 7064773 |
| 818 | 2558863131 | 2558860100 | Bacteria | 8458965 |
| 819 | 2561466540 | 2558860983 | Bacteria | 4133860 |
| 820 | 2585168293 | 2582581283 | Bacteria | 6030556 |
| 821 | 2585199899 | 2582581294 | Bacteria | 6626667 |
| 822 | 2585225873 | 2582581298 | Bacteria | 7315509 |
| 823 | 2585268920 | 2582581306 | Bacteria | 6450535 |
| 824 | 2585270604 | 2582581307 | Bacteria | 6597605 |
| 825 | 2585276951 | 2582581308 | Bacteria | 7413247 |
| 826 | 2585324049 | 2582581315 | Bacteria | 7318924 |
| 827 | 2585333558 | 2582581316 | Bacteria | 7774528 |
| 828 | 2585389445 | 2582581865 | Bacteria | 6644329 |
| 829 | 2585393944 | 2582581866 | Bacteria | 6859583 |
| 830 | 2585400737 | 2582581867 | Bacteria | 7184437 |
| 831 | 2585528181 | 2585427526 | Bacteria | 7258840 |
| 832 | 2585534743 | 2585427527 | Bacteria | 7273426 |
| 833 | 2585540389 | 2585427528 | Bacteria | 6842387 |
| 834 | 2585546833 | 2585427529 | Bacteria | 7395659 |
| 835 | 2585551812 | 2585427530 | Bacteria | 7383882 |
| 836 | 2585558309 | 2585427531 | Bacteria | 6992870 |
| 837 | 2585819703 | 2585427590 | Bacteria | 6824633 |
| 838 | 2585838588 | 2585427593 | Bacteria | 7141551 |
| 839 | 2585845802 | 2585427594 | Bacteria | 6180594 |
| 840 | 2585897701 | 2585427608 | Bacteria | 6544331 |
| 841 | 2585904703 | 2585427609 | Bacteria | 6667127 |
| 842 | 2585995665 | 2585427633 | Bacteria | 6413184 |
| 843 | 2586000233 | 2585427634 | Bacteria | 6455027 |
| 844 | 2587980181 | 2585428125 | Bacteria | 6662905 |
| 845 | 2588516292 | 2588253730 | Bacteria | 6881675 |
| 846 | 2599333423 | 2599185156 | Bacteria | 5403036 |
| 847 | 2599418004 | 2599185170 | Bacteria | 7295545 |
| 848 | 2599602210 | 2599185210 | Bacteria | 5624189 |
| 849 | 2599721195 | 2599185236 | Bacteria | 6875203 |
| 850 | 2599939613 | 2599185301 | Bacteria | 6161860 |
| 851 | 2600192322 | 2599185352 | Bacteria | 7228948 |
| 852 | 2600374450 | 2600254933 | Bacteria | 4750527 |
| 853 | 2616292789 | 2615840624 | Bacteria | 6557588 |
| 854 | 2616308324 | 2615840626 | Bacteria | 7921970 |
| 855 | 2616556616 | 2615840698 | Bacteria | 7319877 |
| 856 | 2617381674 | 2617270742 | Bacteria | 6808054 |
| 857 | 2643772816 | 2643221550 | Bacteria | 4619371 |
| 858 | 2643775645 | 2643221551 | Bacteria | 3750538 |
| 859 | 2643794092 | 2643221555 | Bacteria | 3749717 |
| 860 | 2643808403 | 2643221557 | Bacteria | 7184309 |
| 861 | 2643811848 | 2643221558 | Bacteria | 5460675 |
| 862 | 2643855518 | 2643221568 | Bacteria | 5187270 |
| 863 | 2643919146 | 2643221582 | Bacteria | 5804683 |
| 864 | 2643987151 | 2643221595 | Bacteria | 6565519 |
| 865 | 2644000218 | 2643221598 | Bacteria | 4578346 |
| 866 | 2644005861 | 2643221599 | Bacteria | 6292121 |
| 867 | 2644049569 | 2643221607 | Bacteria | 6314006 |
| 868 | 2644066503 | 2643221610 | Bacteria | 7480339 |
| 869 | 2644109535 | 2643221618 | Bacteria | 7717186 |
| 870 | 2644132117 | 2643221623 | Bacteria | 5239945 |
| 871 | 2644145219 | 2643221626 | Bacteria | 8069654 |
| 872 | 2644155702 | 2643221627 | Bacteria | 6761570 |
| 873 | 2644204023 | 2643221636 | Bacteria | 6583769 |
| 874 | 2644207611 | 2643221637 | Bacteria | 5345260 |
| 875 | 2644300411 | 2643221653 | Bacteria | 4569637 |
| 876 | 2644307800 | 2643221655 | Bacteria | 7722067 |
| 877 | 2644332576 | 2643221659 | Bacteria | 7890716 |
| 878 | 2644378092 | 2643221668 | Bacteria | 7306521 |
| 879 | 2644415284 | 2643221675 | Bacteria | 7473456 |
| 880 | 2644450315 | 2643221680 | Bacteria | 7473610 |
| 881 | 2644482603 | 2643221686 | Bacteria | 6310811 |
| 882 | 2644494720 | 2643221688 | Bacteria | 5260751 |
| 883 | 2644499104 | 2643221689 | Bacteria | 6042950 |
| 884 | 2644544322 | 2643221698 | Bacteria | 7756764 |
| 885 | 2644613889 | 2643221712 | Bacteria | 7729434 |
| 886 | 2644654582 | 2643221718 | Bacteria | 5345506 |
| 887 | 2644658635 | 2643221719 | Bacteria | 4568197 |
| 888 | 2644677898 | 2643221723 | Bacteria | 7095460 |
| 889 | 2644687867 | 2643221726 | Bacteria | 7455827 |
| 890 | 2657683709 | 2657244999 | Bacteria | 5946535 |
| 891 | 2671115720 | 2667528174 | Bacteria | 6435400 |
| 892 | 2688599139 | 2687453392 | Bacteria | 6880454 |
| 893 | 2692316437 | 2690316117 | Bacteria | 6800650 |
| 894 | 2694631984 | 2693429783 | Bacteria | 7019804 |
| 895 | 2694634595 | 2693429784 | Bacteria | 7241525 |
| 896 | 2719180800 | 2718217882 | Bacteria | 6556348 |
| 897 | 2719385439 | 2718217927 | Bacteria | 6972593 |
| 898 | 2719665266 | 2718217997 | Bacteria | 6740740 |
| 899 | 2719731549 | 2718218009 | Bacteria | 6478651 |
| 900 | 2720491686 | 2718218199 | Bacteria | 6740745 |
| 901 | 2720612940 | 2718218232 | Bacteria | 6720332 |
| 902 | 2720619799 | 2718218233 | Bacteria | 6662049 |
| 903 | 2720631230 | 2718218235 | Bacteria | 6630699 |
| 904 | 2720774957 | 2718218269 | Bacteria | 6906114 |
| 905 | 2721146894 | 2718218363 | Bacteria | 6524337 |
| 906 | 2721158421 | 2718218365 | Bacteria | 6274507 |
| 907 | 2721163773 | 2718218366 | Bacteria | 6425255 |
| 908 | 2721399188 | 2718218423 | Bacteria | 6438183 |
| 909 | 2722839943 | 2721755514 | Bacteria | 6424414 |
| 910 | 2723026594 | 2721755556 | Bacteria | 6745503 |
| 911 | 2723560198 | 2721755684 | Bacteria | 6859907 |
| 912 | 2723566777 | 2721755685 | Bacteria | 6704835 |
| 913 | 2724038001 | 2721755809 | Bacteria | 6438790 |
| 914 | 2724044305 | 2721755810 | Bacteria | 6479005 |
| 915 | 2724089564 | 2721755819 | Bacteria | 6906405 |
| 916 | 2724104042 | 2721755822 | Bacteria | 6726041 |
| 917 | 2724109858 | 2721755823 | Bacteria | 6752556 |
| 918 | 2725952354 | 2724679232 | Bacteria | 7646494 |
| 919 | 2730107530 | 2728369352 | Bacteria | 6745171 |
| 920 | 2730164037 | 2728369365 | Bacteria | 6555560 |
| 921 | 2730298053 | 2728369397 | Bacteria | 6274511 |
| 922 | 2738799237 | 2738541293 | Bacteria | 7065685 |
| 923 | 2738945516 | 2738541317 | Bacteria | 5340176 |
| 924 | 2739038314 | 2738541333 | Bacteria | 7106503 |
| 925 | 2739307930 | 2738543024 | Bacteria | 5603683 |
| 926 | 2739350337 | 2738543031 | Bacteria | 5769731 |
| 927 | 2756676985 | 2756170246 | Bacteria | 7451806 |
| 928 | 2766067891 | 2765235942 | Bacteria | 7445910 |
| 929 | 2776913336 | 2775507049 | Bacteria | 6284736 |
| 930 | 2778176461 | 2775507266 | Bacteria | 7392367 |
| 931 | 2792581201 | 2791355082 | Bacteria | 5973319 |
| 932 | 2792623209 | 2791355091 | Bacteria | 6135441 |
| 933 | 2792626973 | 2791355092 | Bacteria | 6248105 |
| 934 | 2792642491 | 2791355094 | Bacteria | 7011481 |
| 935 | 2793279470 | 2791355253 | Bacteria | 5171699 |
| 936 | 2793299210 | 2791355256 | Bacteria | 6798008 |
| 937 | 2793313847 | 2791355259 | Bacteria | 7254731 |
| 938 | 2793321223 | 2791355260 | Bacteria | 6598818 |
| 939 | 2793326362 | 2791355261 | Bacteria | 6661293 |
| 940 | 2793336947 | 2791355262 | Bacteria | 6774204 |
| 941 | 2793344838 | 2791355263 | Bacteria | 6872478 |
| 942 | 2793347742 | 2791355264 | Bacteria | 6429314 |
| 943 | 2793352296 | 2791355265 | Bacteria | 6539969 |
| 944 | 2793360358 | 2791355266 | Bacteria | 7116587 |
| 945 | 2793366434 | 2791355267 | Bacteria | 7222458 |
| 946 | 2802718878 | 2802428858 | Bacteria | 6636079 |
| 947 | 2802726489 | 2802428859 | Bacteria | 6667919 |
| 948 | 2802733781 | 2802428860 | Bacteria | 6525526 |
| 949 | 2802738387 | 2802428861 | Bacteria | 6534206 |
| 950 | 2802744719 | 2802428862 | Bacteria | 6633353 |
| 951 | 2802751075 | 2802428863 | Bacteria | 6410669 |
| 952 | 2804751854 | 2802429268 | Bacteria | 6094027 |
| 953 | 2805927623 | 2802429605 | Bacteria | 6875453 |
| 954 | 2805936099 | 2802429606 | Bacteria | 6346811 |
| 955 | 2806045510 | 2802429633 | Bacteria | 7341974 |
| 956 | 2806051685 | 2802429634 | Bacteria | 7083200 |
| 957 | 2806061729 | 2802429635 | Bacteria | 7650140 |
| 958 | 2806067910 | 2802429636 | Bacteria | 7597525 |
| 959 | 2806072738 | 2802429637 | Bacteria | 7067217 |
| 960 | 2819241971 | 2818991272 | Bacteria | 4622173 |
| 961 | 2819559991 | 2818991439 | Bacteria | 6907412 |
| 962 | 2819610425 | 2818991448 | Bacteria | 6772224 |
| 963 | 2819638160 | 2818991453 | Bacteria | 7181617 |
| 964 | 2819687401 | 2818991461 | Bacteria | 7026071 |
| 965 | 2821127714 | 2821123053 | Bacteria | 7836056 |
| 966 | 2828309734 | 2828305725 | Bacteria | 4916900 |
| 967 | 2837653802 | 2837651117 | Bacteria | 3772164 |
| 968 | 2837679465 | 2837678835 | Bacteria | 5252418 |
| 969 | 2837682943 | 2837678835 | Bacteria | 5252418 |
| 970 | 2838018794 | 2838016132 | Bacteria | 6577831 |
| 971 | 2838025500 | 2838022645 | Bacteria | 6494267 |
| 972 | 2838034617 | 2838029111 | Bacteria | 6603031 |
| 973 | 2838040942 | 2838035591 | Bacteria | 7166484 |
| 974 | 2838043101 | 2838042994 | Bacteria | 6046894 |
| 975 | 2838052134 | 2838048938 | Bacteria | 6044578 |
| 976 | 2838067255 | 2838061910 | Bacteria | 6794874 |
| 977 | 2838071361 | 2838068647 | Bacteria | 6208656 |
| 978 | 2838079320 | 2838074704 | Bacteria | 6785777 |
| 979 | 2838666212 | 2838661181 | Bacteria | 7385261 |
| 980 | 2838670065 | 2838668709 | Bacteria | 6671819 |
| 981 | 2838676409 | 2838675328 | Bacteria | 4909118 |
| 982 | 2838689112 | 2838686498 | Bacteria | 7807632 |
| 983 | 2838697164 | 2838694306 | Bacteria | 6853137 |
| 984 | 2838702437 | 2838701080 | Bacteria | 6669771 |
| 985 | 2838715292 | 2838714209 | Bacteria | 5525906 |
| 986 | 2838720908 | 2838719591 | Bacteria | 5523910 |
| 987 | 2838726050 | 2838724970 | Bacteria | 4908691 |
| 988 | 2838730447 | 2838729681 | Bacteria | 7400765 |
| 989 | 2838738137 | 2838736955 | Bacteria | 5760694 |
| 990 | 2838743388 | 2838742623 | Bacteria | 7396178 |
| 991 | 2841841494 | 2841840854 | Bacteria | 5761912 |
| 992 | 2841847837 | 2841846520 | Bacteria | 5345850 |
| 993 | 2841854925 | 2841851746 | Bacteria | 7532261 |
| 994 | 2841859625 | 2841859092 | Bacteria | 5436171 |
| 995 | 2841864923 | 2841864319 | Bacteria | 6742987 |
| 996 | 2842077769 | 2842077413 | Bacteria | 6508645 |
| 997 | 2842110902 | 2842110456 | Bacteria | 7656360 |
| 998 | 2842119722 | 2842118031 | Bacteria | 7033875 |
| 999 | 2842126133 | 2842124991 | Bacteria | 5346824 |
| 1000 | 2842131303 | 2842130223 | Bacteria | 4909145 |
| 1001 | 2842141272 | 2842140634 | Bacteria | 5759631 |
| 1002 | 2842147018 | 2842146304 | Bacteria | 5957337 |
| 1003 | 2842153527 | 2842152218 | Bacteria | 4908957 |
| 1004 | 2842157787 | 2842156927 | Bacteria | 6894975 |
| 1005 | 2842165000 | 2842163707 | Bacteria | 6916235 |
| 1006 | 2842171535 | 2842170452 | Bacteria | 5525737 |
| 1007 | 2842177147 | 2842175837 | Bacteria | 4908771 |
| 1008 | 2842180629 | 2842180545 | Bacteria | 6888678 |
| 1009 | 2842188400 | 2842187318 | Bacteria | 5524014 |
| 1010 | 2842197013 | 2842192696 | Bacteria | 6147454 |
| 1011 | 2842201069 | 2842198810 | Bacteria | 6608673 |
| 1012 | 2842206416 | 2842205361 | Bacteria | 6340321 |
| 1013 | 2842212711 | 2842211629 | Bacteria | 5523832 |
| 1014 | 2842220607 | 2842217011 | Bacteria | 7497767 |
| 1015 | 2842225670 | 2842224351 | Bacteria | 5524473 |
| 1016 | 2842231320 | 2842229732 | Bacteria | 7475766 |
| 1017 | 2842244566 | 2842243621 | Bacteria | 7421798 |
| 1018 | 2842252083 | 2842250916 | Bacteria | 6579627 |
| 1019 | 2842258379 | 2842257432 | Bacteria | 7401195 |
| 1020 | 2842267532 | 2842264693 | Bacteria | 6472963 |
| 1021 | 2842273132 | 2842271015 | Bacteria | 7807131 |
| 1022 | 2842279873 | 2842278818 | Bacteria | 6340002 |
| 1023 | 2842287506 | 2842285085 | Bacteria | 6011953 |
| 1024 | 2842291431 | 2842291075 | Bacteria | 7076806 |
| 1025 | 2842301852 | 2842298080 | Bacteria | 6123127 |
| 1026 | 2842309385 | 2842304105 | Bacteria | 7023636 |
| 1027 | 2842315418 | 2842311132 | Bacteria | 6616990 |
| 1028 | 2842318264 | 2842317721 | Bacteria | 6793725 |
| 1029 | 2842347161 | 2842341865 | Bacteria | 7003929 |
| 1030 | 2842362350 | 2842357229 | Bacteria | 6485165 |
| 1031 | 2842366749 | 2842363717 | Bacteria | 6844742 |
| 1032 | 2842373160 | 2842370503 | Bacteria | 7038661 |
| 1033 | 2842377827 | 2842377471 | Bacteria | 7140707 |
| 1034 | 2842386232 | 2842384541 | Bacteria | 7057858 |
| 1035 | 2842397286 | 2842395702 | Bacteria | 6780583 |
| 1036 | 2842404965 | 2842402390 | Bacteria | 6681310 |
| 1037 | 2842411547 | 2842409023 | Bacteria | 6687331 |
| 1038 | 2842418002 | 2842415677 | Bacteria | 6596907 |
| 1039 | 2842424982 | 2842422224 | Bacteria | 6239196 |
| 1040 | 2842431890 | 2842428310 | Bacteria | 6767288 |
| 1041 | 2842438003 | 2842434925 | Bacteria | 6502746 |
| 1042 | 2842444817 | 2842441272 | Bacteria | 6769273 |
| 1043 | 2842451733 | 2842447887 | Bacteria | 6754142 |
| 1044 | 2842465806 | 2842462802 | Bacteria | 6588055 |
| 1045 | 2842472620 | 2842469257 | Bacteria | 6752936 |
| 1046 | 2842481364 | 2842475841 | Bacteria | 6603183 |
| 1047 | 2842487148 | 2842482326 | Bacteria | 7212537 |
| 1048 | 2842492755 | 2842489311 | Bacteria | 6620893 |
| 1049 | 2842496535 | 2842495871 | Bacteria | 6820686 |
| 1050 | 2842508264 | 2842502639 | Bacteria | 6604161 |
| 1051 | 2842516410 | 2842515876 | Bacteria | 5436280 |
| 1052 | 2842525945 | 2842521101 | Bacteria | 6569494 |
| 1053 | 2842695565 | 2842694124 | Bacteria | 4063419 |
| 1054 | 2842925169 | 2842922631 | Bacteria | 5824079 |
| 1055 | 2844006713 | 2844002411 | Bacteria | 7168230 |
| 1056 | 2844014318 | 2844009547 | Bacteria | 6728125 |
| 1057 | 2844170412 | 2844163670 | Bacteria | 7266046 |
| 1058 | 2844459534 | 2844454524 | Bacteria | 7952546 |
| 1059 | 2847418496 | 2847417321 | Bacteria | 6913799 |
| 1060 | 2847670862 | 2847670302 | Bacteria | 6165597 |
| 1061 | 2847686996 | 2847686936 | Bacteria | 6278406 |
| 1062 | 2848993473 | 2848992105 | Bacteria | 6810864 |
| 1063 | 2850080797 | 2850079185 | Bacteria | 6848280 |
| 1064 | 2852389605 | 2852387548 | Bacteria | 8025568 |
| 1065 | 2854899082 | 2854896431 | Bacteria | 5869725 |
| 1066 | 2854916970 | 2854916844 | Bacteria | 5725939 |
| 1067 | 2855825458 | 2855825444 | Bacteria | 6785811 |
| 1068 | 2855840835 | 2855839649 | Bacteria | 7135830 |
| 1069 | 2855873342 | 2855872281 | Bacteria | 6964271 |
| 1070 | 2856316319 | 2856314179 | Bacteria | 6477897 |
| 1071 | 2856323621 | 2856320880 | Bacteria | 7263508 |
| 1072 | 2856329088 | 2856328259 | Bacteria | 6528202 |
| 1073 | 2856335899 | 2856334872 | Bacteria | 7037011 |
| 1074 | 2856353283 | 2856349417 | Bacteria | 6230045 |
| 1075 | 2856369070 | 2856364286 | Bacteria | 6939991 |
| 1076 | 2857355662 | 2857349434 | Bacteria | 7926032 |
| 1077 | 2857373750 | 2857367948 | Bacteria | 6965560 |
| 1078 | 2857523704 | 2857516855 | Bacteria | 7787325 |
| 1079 | 2857534623 | 2857531043 | Bacteria | 6754041 |
| 1080 | 2858801380 | 2858800743 | Bacteria | 6603254 |
| 1081 | 2869175655 | 2869169390 | Bacteria | 6659796 |
| 1082 | 2869241456 | 2869234852 | Bacteria | 6654993 |
| 1083 | 2869245802 | 2869242130 | Bacteria | 6609239 |
| 1084 | 2869251100 | 2869249662 | Bacteria | 6868783 |
| 1085 | 2869266794 | 2869264136 | Bacteria | 6880765 |
| 1086 | 2869275703 | 2869271264 | Bacteria | 6908218 |
| 1087 | 2869278883 | 2869278585 | Bacteria | 7077053 |
| 1088 | 2869291588 | 2869285874 | Bacteria | 6901219 |
| 1089 | 2871433888 | 2871429161 | Bacteria | 6547891 |
| 1090 | 2871440971 | 2871435913 | Bacteria | 6880295 |
| 1091 | 2871456114 | 2871451962 | Bacteria | 7336357 |
| 1092 | 2871462055 | 2871459585 | Bacteria | 6866887 |
| 1093 | 2871485119 | 2871481445 | Bacteria | 6700002 |
| 1094 | 2874107932 | 2874102143 | Bacteria | 6342645 |
| 1095 | 2874119861 | 2874116593 | Bacteria | 6674494 |
| 1096 | 2874125779 | 2874123672 | Bacteria | 7238285 |
| 1097 | 2874136061 | 2874131515 | Bacteria | 6820270 |
| 1098 | 2874145475 | 2874139085 | Bacteria | 7021506 |
| 1099 | 2874153447 | 2874146452 | Bacteria | 7533118 |
| 1100 | 2874160711 | 2874155637 | Bacteria | 6724144 |
| 1101 | 2874167882 | 2874162495 | Bacteria | 6174670 |
| 1102 | 2876368010 | 2876363079 | Bacteria | 6544991 |
| 1103 | 2876374000 | 2876369609 | Bacteria | 6807521 |
| 1104 | 2876385409 | 2876377896 | Bacteria | 6565995 |
| 1105 | 2876387860 | 2876386047 | Bacteria | 6698674 |
| 1106 | 2876395185 | 2876392853 | Bacteria | 6660880 |
| 1107 | 2876403324 | 2876399893 | Bacteria | 6927900 |
| 1108 | 2876412278 | 2876406927 | Bacteria | 6191900 |
| 1109 | 2876419737 | 2876413966 | Bacteria | 6831344 |
| 1110 | 2876422663 | 2876420981 | Bacteria | 6687741 |
| 1111 | 2878041642 | 2878035449 | Bacteria | 6555736 |
| 1112 | 2878731552 | 2878730984 | Bacteria | 6380721 |
| 1113 | 2878743778 | 2878738818 | Bacteria | 7136951 |
| 1114 | 2878751500 | 2878745973 | Bacteria | 6867388 |
| 1115 | 2878778506 | 2878774303 | Bacteria | 6108671 |
| 1116 | 2878787073 | 2878781027 | Bacteria | 6834456 |
| 1117 | 2881152633 | 2881147464 | Bacteria | 7779814 |
| 1118 | 2881156192 | 2881155292 | Bacteria | 6461656 |
| 1119 | 2881168553 | 2881161766 | Bacteria | 7127907 |
| 1120 | 2881860816 | 2881853255 | Bacteria | 6698367 |
| 1121 | 2882633141 | 2882632389 | Bacteria | 8154593 |
| 1122 | 2885310601 | 2885305155 | Bacteria | 7348390 |
| 1123 | 2885317364 | 2885312484 | Bacteria | 6415165 |
| 1124 | 2885334053 | 2885326080 | Bacteria | 7134805 |
| 1125 | 2885339891 | 2885334103 | Bacteria | 7216818 |
| 1126 | 2885346062 | 2885342637 | Bacteria | 7011821 |
| 1127 | 2885356795 | 2885350715 | Bacteria | 6787678 |
| 1128 | 2889011865 | 2889010040 | Bacteria | 6749192 |
| 1129 | 2889023206 | 2889016732 | Bacteria | 6700763 |
| 1130 | 2891375567 | 2891373044 | Bacteria | 5202277 |
| 1131 | 2896386986 | 2896384573 | Bacteria | 7700774 |
| 1132 | 2899796382 | 2899792073 | Bacteria | 4926588 |
| 1133 | 2899808938 | 2899803654 | Bacteria | 5577784 |
| 1134 | 2903449771 | 2903448605 | Bacteria | 7357801 |
| 1135 | 2903505492 | 2903492973 | Bacteria | 13473544 |
| 1136 | 2903527006 | 2903521522 | Bacteria | 6525694 |
| 1137 | 2903533233 | 2903528002 | Bacteria | 6586099 |
| 1138 | 2904661816 | 2904659560 | Bacteria | 6685615 |
| 1139 | 2906313398 | 2906308376 | Bacteria | 6841989 |
| 1140 | 2906326107 | 2906321335 | Bacteria | 6579571 |
| 1141 | 2906328431 | 2906328253 | Bacteria | 6585166 |
| 1142 | 2906357557 | 2906354277 | Bacteria | 6991324 |
| 1143 | 2906376910 | 2906370794 | Bacteria | 6881062 |
| 1144 | 2906382533 | 2906378014 | Bacteria | 6911440 |
| 1145 | 2906392870 | 2906386501 | Bacteria | 5977019 |
| 1146 | 2906397996 | 2906393657 | Bacteria | 6790866 |
| 1147 | 2906402766 | 2906401398 | Bacteria | 6693206 |
| 1148 | 2906414370 | 2906408224 | Bacteria | 6162342 |
| 1149 | 2906416456 | 2906414383 | Bacteria | 6580790 |
| 1150 | 2913300409 | 2913295892 | Bacteria | 6333755 |
| 1151 | 2913310222 | 2913308742 | Bacteria | 5350706 |
| 1152 | 2915651817 | 2915650412 | Bacteria | 4288180 |
| 1153 | 2915985201 | 2915980308 | Bacteria | 6624279 |
| 1154 | 2915987807 | 2915986958 | Bacteria | 6739310 |
| 1155 | 2915997479 | 2915993759 | Bacteria | 7016183 |
| 1156 | 2916003914 | 2916000859 | Bacteria | 6865702 |
| 1157 | 2916014449 | 2916007675 | Bacteria | 6898660 |
| 1158 | 2916015346 | 2916014648 | Bacteria | 6946486 |
| 1159 | 2916028373 | 2916021584 | Bacteria | 6854472 |
| 1160 | 2916034853 | 2916028427 | Bacteria | 6748433 |
| 1161 | 2916041168 | 2916035215 | Bacteria | 6755766 |
| 1162 | 2916046296 | 2916041962 | Bacteria | 6820487 |
| 1163 | 2916051076 | 2916048683 | Bacteria | 6543552 |
| 1164 | 2916060614 | 2916055098 | Bacteria | 6758838 |
| 1165 | 2916067392 | 2916061851 | Bacteria | 6737736 |
| 1166 | 2916070780 | 2916068649 | Bacteria | 6943657 |
| 1167 | 2916078612 | 2916076590 | Bacteria | 6596108 |
| 1168 | 2917555526 | 2917554339 | Bacteria | 4987857 |
| 1169 | 2919107799 | 2919100787 | Bacteria | 7710546 |
| 1170 | 2919115385 | 2919114240 | Bacteria | 5700270 |
| 1171 | 2919167721 | 2919166419 | Bacteria | 4952238 |
| 1172 | 2919175328 | 2919171160 | Bacteria | 6499771 |
| 1173 | 2919409774 | 2919408235 | Bacteria | 6149349 |
| 1174 | 2920765571 | 2920760137 | Bacteria | 7427611 |
| 1175 | 2920824208 | 2920822456 | Bacteria | 6897201 |
| 1176 | 2921207792 | 2921201388 | Bacteria | 6926299 |
| 1177 | 2921210220 | 2921208531 | Bacteria | 6745326 |
| 1178 | 2921243784 | 2921237296 | Bacteria | 6876710 |
| 1179 | 2921250332 | 2921244191 | Bacteria | 6568419 |
| 1180 | 2921253042 | 2921250672 | Bacteria | 6677771 |
| 1181 | 2921260466 | 2921257292 | Bacteria | 6808382 |
| 1182 | 2921270423 | 2921263974 | Bacteria | 6864552 |
| 1183 | 2921289132 | 2921282425 | Bacteria | 6826397 |
| 1184 | 2921293500 | 2921289301 | Bacteria | 7316391 |
| 1185 | 2921304693 | 2921296804 | Bacteria | 7176999 |
| 1186 | 2922153783 | 2922151315 | Bacteria | 6902399 |
| 1187 | 2922165485 | 2922158528 | Bacteria | 6573167 |
| 1188 | 2922172416 | 2922172374 | Bacteria | 6167644 |
| 1189 | 2922193182 | 2922185730 | Bacteria | 7113964 |
| 1190 | 2923558141 | 2923556063 | Bacteria | 6793593 |
| 1191 | 2924147587 | 2924144063 | Bacteria | 6883928 |
| 1192 | 2924156407 | 2924150972 | Bacteria | 7169444 |
| 1193 | 2924165141 | 2924158325 | Bacteria | 7188855 |
| 1194 | 2924172834 | 2924165586 | Bacteria | 7260590 |
| 1195 | 2924179343 | 2924172951 | Bacteria | 6749356 |
| 1196 | 2924183014 | 2924179722 | Bacteria | 6843264 |
| 1197 | 2924192768 | 2924186466 | Bacteria | 6876637 |
| 1198 | 2924197849 | 2924193448 | Bacteria | 6955718 |
| 1199 | 2924206433 | 2924200457 | Bacteria | 6757188 |
| 1200 | 2924211544 | 2924207177 | Bacteria | 6917007 |
| 1201 | 2924215551 | 2924214083 | Bacteria | 7080103 |
| 1202 | 2924223354 | 2924221636 | Bacteria | 7113495 |
| 1203 | 2924234673 | 2924228884 | Bacteria | 6633132 |
| 1204 | 2924724939 | 2924718760 | Bacteria | 6331356 |
| 1205 | 2924726775 | 2924726620 | Bacteria | 6271473 |
| 1206 | 2924734645 | 2924733363 | Bacteria | 7574837 |
| 1207 | 2924745663 | 2924741084 | Bacteria | 6661321 |
| 1208 | 2924749306 | 2924748358 | Bacteria | 6154725 |
| 1209 | 2924763906 | 2924762789 | Bacteria | 6561353 |
| 1210 | 2924781591 | 2924776078 | Bacteria | 7492003 |
| 1211 | 2926756435 | 2926754445 | Bacteria | 5964435 |
| 1212 | 2929140609 | 2929138655 | Bacteria | 5810547 |
| 1213 | 2933008171 | 2933006813 | Bacteria | 4912075 |
| 1214 | 2933012950 | 2933011516 | Bacteria | 5439334 |
| 1215 | 2933575842 | 2933570622 | Bacteria | 7023390 |
| 1216 | 2933586927 | 2933586486 | Bacteria | 7667493 |
| 1217 | 2933602160 | 2933599457 | Bacteria | 5858799 |
| 1218 | 2935904835 | 2935901341 | Bacteria | 7341747 |
| 1219 | 2936373131 | 2936367885 | Bacteria | 7324495 |
| 1220 | 2936381276 | 2936375103 | Bacteria | 6652732 |
| 1221 | 2936384548 | 2936381700 | Bacteria | 7006523 |
| 1222 | 2936997725 | 2936996657 | Bacteria | 6298727 |
| 1223 | 2937007263 | 2937002841 | Bacteria | 6934057 |
| 1224 | 2937012432 | 2937009748 | Bacteria | 6746052 |
| 1225 | 2937022582 | 2937016420 | Bacteria | 6782579 |
| 1226 | 2937029207 | 2937023124 | Bacteria | 6815156 |
| 1227 | 2937031176 | 2937029754 | Bacteria | 6424026 |
| 1228 | 2937040878 | 2937036028 | Bacteria | 6846469 |
| 1229 | 2937049689 | 2937042894 | Bacteria | 6741576 |
| 1230 | 2937050085 | 2937049772 | Bacteria | 6757901 |
| 1231 | 2937059644 | 2937056579 | Bacteria | 7107896 |
| 1232 | 2937071207 | 2937063883 | Bacteria | 7199456 |
| 1233 | 2937075653 | 2937071275 | Bacteria | 6984483 |
| 1234 | 2937079970 | 2937078374 | Bacteria | 6610289 |
| 1235 | 2937086615 | 2937084907 | Bacteria | 6618516 |
| 1236 | 2937092275 | 2937091812 | Bacteria | 6979387 |
| 1237 | 2937105865 | 2937098957 | Bacteria | 7249374 |
| 1238 | 2937113125 | 2937106411 | Bacteria | 6947143 |
| 1239 | 2937117273 | 2937113482 | Bacteria | 6505872 |
| 1240 | 2937125322 | 2937119839 | Bacteria | 6597547 |
| 1241 | 2937130388 | 2937126314 | Bacteria | 6771275 |
| 1242 | 2937820452 | 2937813078 | Bacteria | 7783518 |
| 1243 | 2937827015 | 2937822353 | Bacteria | 7290551 |
| 1244 | 2937877058 | 2937868953 | Bacteria | 6639878 |
| 1245 | 2937879244 | 2937877337 | Bacteria | 7246526 |
| 1246 | 2937895067 | 2937891427 | Bacteria | 6357007 |
| 1247 | 2937975023 | 2937972304 | Bacteria | 7532020 |
| 1248 | 2937987121 | 2937980651 | Bacteria | 6517427 |
| 1249 | 2938016194 | 2938014810 | Bacteria | 6700592 |
| 1250 | 2939670875 | 2939669807 | Bacteria | 5028511 |
| 1251 | 2941499834 | 2941499720 | Bacteria | 7599444 |
| 1252 | 2957380848 | 2957375807 | Bacteria | 6425588 |
| 1253 | 2957388045 | 2957382221 | Bacteria | 6737050 |
| 1254 | 2957394237 | 2957388812 | Bacteria | 6778072 |
| 1255 | 2957399335 | 2957395598 | Bacteria | 6822399 |
| 1256 | 2957407900 | 2957402308 | Bacteria | 6741770 |
| 1257 | 2957412570 | 2957408893 | Bacteria | 6558585 |
| 1258 | 2957416076 | 2957415311 | Bacteria | 6991633 |
| 1259 | 2957422947 | 2957422303 | Bacteria | 7172205 |
| 1260 | 2957436773 | 2957430029 | Bacteria | 7022557 |
| 1261 | 2957439173 | 2957437181 | Bacteria | 6568994 |
| 1262 | 2957450059 | 2957443900 | Bacteria | 6869977 |
| 1263 | 2957456754 | 2957450854 | Bacteria | 6765715 |
| 1264 | 2957464632 | 2957457609 | Bacteria | 6967680 |
| 1265 | 2957470652 | 2957464669 | Bacteria | 6568877 |
| 1266 | 2957472321 | 2957471148 | Bacteria | 6797643 |
| 1267 | 2957483509 | 2957478035 | Bacteria | 6756658 |
| 1268 | 2957491516 | 2957484790 | Bacteria | 6703082 |
| 1269 | 2957494963 | 2957491536 | Bacteria | 6695180 |
| 1270 | 2957505071 | 2957498199 | Bacteria | 7126688 |
| 1271 | 2957505858 | 2957505466 | Bacteria | 7253085 |
| 1272 | 2958034998 | 2958034702 | Bacteria | 6989922 |
| 1273 | 2958042872 | 2958041894 | Bacteria | 13082850 |
| 1274 | 2958067198 | 2958064165 | Bacteria | 7158582 |
| 1275 | 2958086419 | 2958084443 | Bacteria | 7312792 |
| 1276 | 2958103293 | 2958100919 | Bacteria | 6800575 |
| 1277 | 2958111326 | 2958108152 | Bacteria | 6681128 |
| 1278 | 2958122566 | 2958115193 | Bacteria | 6923548 |
| 1279 | 2958123327 | 2958122699 | Bacteria | 7280457 |
| 1280 | 2958135989 | 2958130278 | Bacteria | 6897202 |
| 1281 | 2958139657 | 2958137437 | Bacteria | 6050276 |
| 1282 | 2958162786 | 2958158011 | Bacteria | 6058449 |
| 1283 | 2958174763 | 2958172287 | Bacteria | 6716688 |
| 1284 | 2958185455 | 2958179912 | Bacteria | 6874908 |
| 1285 | 2960590904 | 2960584000 | Bacteria | 6864594 |
| 1286 | 2960596136 | 2960591022 | Bacteria | 6622873 |
| 1287 | 2960602836 | 2960597568 | Bacteria | 6550735 |
| 1288 | 2960607246 | 2960603979 | Bacteria | 6898737 |
| 1289 | 2960614981 | 2960610863 | Bacteria | 6691244 |
| 1290 | 2960623209 | 2960617483 | Bacteria | 6727748 |
| 1291 | 2960626148 | 2960624210 | Bacteria | 6875384 |
| 1292 | 2960634634 | 2960631154 | Bacteria | 6732508 |
| 1293 | 2960639212 | 2960637947 | Bacteria | 7296468 |
| 1294 | 2960652682 | 2960645483 | Bacteria | 7211087 |
| 1295 | 2960666733 | 2960660292 | Bacteria | 7041660 |
| 1296 | 2960673335 | 2960667422 | Bacteria | 6763020 |
| 1297 | 2960680454 | 2960674078 | Bacteria | 6609048 |
| 1298 | 2960686832 | 2960680706 | Bacteria | 6624464 |
| 1299 | 2960693817 | 2960687367 | Bacteria | 6535474 |
| 1300 | 2960699783 | 2960693952 | Bacteria | 6749742 |
| 1301 | 2961083723 | 2961077736 | Bacteria | 7079850 |
| 1302 | 2961116969 | 2961114664 | Bacteria | 6680456 |
| 1303 | 2961131861 | 2961127735 | Bacteria | 7196641 |
| 1304 | 2961143269 | 2961136820 | Bacteria | 6775228 |
| 1305 | 2961187963 | 2961183825 | Bacteria | 6688536 |
| 1306 | 2963648583 | 2963644680 | Bacteria | 6530403 |
| 1307 | 2964611139 | 2964607997 | Bacteria | 7101408 |
| 1308 | 2964620759 | 2964615318 | Bacteria | 6809089 |
| 1309 | 2964628854 | 2964621998 | Bacteria | 6834995 |
| 1310 | 2964635924 | 2964628898 | Bacteria | 7083044 |
| 1311 | 2964637900 | 2964636051 | Bacteria | 7091832 |
| 1312 | 2964649144 | 2964643177 | Bacteria | 6820887 |
| 1313 | 2964655808 | 2964649959 | Bacteria | 6675118 |
| 1314 | 2964660213 | 2964656573 | Bacteria | 7100150 |
| 1315 | 2964666185 | 2964663802 | Bacteria | 7019362 |
| 1316 | 2964678088 | 2964670856 | Bacteria | 6851364 |
| 1317 | 2964679323 | 2964678106 | Bacteria | 6792020 |
| 1318 | 2964685372 | 2964685014 | Bacteria | 6839111 |
| 1319 | 2964698660 | 2964691889 | Bacteria | 6802758 |
| 1320 | 2964702081 | 2964698721 | Bacteria | 6765331 |
| 1321 | 2964709236 | 2964705432 | Bacteria | 7114648 |
| 1322 | 2964713771 | 2964712639 | Bacteria | 6695970 |
| 1323 | 2964719622 | 2964719344 | Bacteria | 7286602 |
| 1324 | 2965029242 | 2965025482 | Bacteria | 6532201 |
| 1325 | 2965036374 | 2965032056 | Bacteria | 6887443 |
| 1326 | 2965045730 | 2965040258 | Bacteria | 6855979 |
| 1327 | 2965052021 | 2965047637 | Bacteria | 6623551 |
| 1328 | 2965066304 | 2965062239 | Bacteria | 7412989 |
| 1329 | 2965093561 | 2965089291 | Bacteria | 6866420 |
| 1330 | 2965111352 | 2965110997 | Bacteria | 6693150 |
| 1331 | 2965121030 | 2965119406 | Bacteria | 6956431 |
| 1332 | 2967668635 | 2967664464 | Bacteria | 6948836 |
| 1333 | 2967674557 | 2967671571 | Bacteria | 7021409 |
| 1334 | 2967685642 | 2967678726 | Bacteria | 7264382 |
| 1335 | 2967688758 | 2967686174 | Bacteria | 6678622 |
| 1336 | 2967699141 | 2967693043 | Bacteria | 6804451 |
| 1337 | 2967699998 | 2967699805 | Bacteria | 6854538 |
| 1338 | 2967714348 | 2967706974 | Bacteria | 7186053 |
| 1339 | 2967720573 | 2967714385 | Bacteria | 7000047 |
| 1340 | 2967728166 | 2967721400 | Bacteria | 7073753 |
| 1341 | 2967734273 | 2967728569 | Bacteria | 6641507 |
| 1342 | 2967741289 | 2967735183 | Bacteria | 6827012 |
| 1343 | 2967753381 | 2967748971 | Bacteria | 6733771 |
| 1344 | 2967758003 | 2967755722 | Bacteria | 6814706 |
| 1345 | 2967769178 | 2967762386 | Bacteria | 6923502 |
| 1346 | 2967775278 | 2967769361 | Bacteria | 6587838 |
| 1347 | 2967782808 | 2967775926 | Bacteria | 6738189 |
| 1348 | 2968017538 | 2968016561 | Bacteria | 7022047 |
| 1349 | 2968083811 | 2968083720 | Bacteria | 7351627 |
| 1350 | 2968092434 | 2968091066 | Bacteria | 6052692 |
| 1351 | 2968100504 | 2968097103 | Bacteria | 6107094 |
| 1352 | 2968112877 | 2968110612 | Bacteria | 6814636 |
| 1353 | 2968122891 | 2968117919 | Bacteria | 6536078 |
| 1354 | 2968128836 | 2968128360 | Bacteria | 6270294 |
| 1355 | 2968143228 | 2968138860 | Bacteria | 6605449 |
| 1356 | 2970026393 | 2970019648 | Bacteria | 7072033 |
| 1357 | 2970032689 | 2970026789 | Bacteria | 6785236 |
| 1358 | 2970038229 | 2970033650 | Bacteria | 7118744 |
| 1359 | 2970041715 | 2970040964 | Bacteria | 6731123 |
| 1360 | 2970054893 | 2970047711 | Bacteria | 7088379 |
| 1361 | 2970060857 | 2970054988 | Bacteria | 6611507 |
| 1362 | 2970061919 | 2970061556 | Bacteria | 7099761 |
| 1363 | 2970075925 | 2970068827 | Bacteria | 7123112 |
| 1364 | 2970081099 | 2970076120 | Bacteria | 6697332 |
| 1365 | 2970084816 | 2970082768 | Bacteria | 6183754 |
| 1366 | 2970095255 | 2970088815 | Bacteria | 6933825 |
| 1367 | 2970099396 | 2970095765 | Bacteria | 6936963 |
| 1368 | 2970103658 | 2970102677 | Bacteria | 6812532 |
| 1369 | 2970112182 | 2970109326 | Bacteria | 6863976 |
| 1370 | 2970121827 | 2970116247 | Bacteria | 6501857 |
| 1371 | 2970127053 | 2970122695 | Bacteria | 6625855 |
| 1372 | 2970135106 | 2970129317 | Bacteria | 6806560 |
| 1373 | 2970136596 | 2970136068 | Bacteria | 7207982 |
| 1374 | 2970145546 | 2970143518 | Bacteria | 6446480 |
| 1375 | 2970155269 | 2970149975 | Bacteria | 6779706 |
| 1376 | 2970158385 | 2970156795 | Bacteria | 7168044 |
| 1377 | 2970168124 | 2970164137 | Bacteria | 6861252 |
| 1378 | 2970174827 | 2970170962 | Bacteria | 6876229 |
| 1379 | 2970181732 | 2970177841 | Bacteria | 6768001 |
| 1380 | 2970187945 | 2970184632 | Bacteria | 7054431 |
| 1381 | 2970193539 | 2970191845 | Bacteria | 7032787 |
| 1382 | 2970472286 | 2970469710 | Bacteria | 6969209 |
| 1383 | 2970489789 | 2970489779 | Bacteria | 6517260 |
| 1384 | 2970517946 | 2970510686 | Bacteria | 7006402 |
| 1385 | 2970538617 | 2970532167 | Bacteria | 6553173 |
| 1386 | 2970551932 | 2970547951 | Bacteria | 6931819 |
| 1387 | 2970593478 | 2970593180 | Bacteria | 7073582 |
| 1388 | 2970623570 | 2970619444 | Bacteria | 6986144 |
| 1389 | 2970632255 | 2970627176 | Bacteria | 6680862 |
| 1390 | 2977520720 | 2977516862 | Bacteria | 6940108 |
| 1391 | 2977524401 | 2977523885 | Bacteria | 6960446 |
| 1392 | 2977533833 | 2977530762 | Bacteria | 6951399 |
| 1393 | 2977542214 | 2977537788 | Bacteria | 6929320 |
| 1394 | 2977547234 | 2977544691 | Bacteria | 6875412 |
| 1395 | 2977557408 | 2977551784 | Bacteria | 7125765 |
| 1396 | 2977565875 | 2977558990 | Bacteria | 6863948 |
| 1397 | 2977571966 | 2977565890 | Bacteria | 6901543 |
| 1398 | 2977579124 | 2977572785 | Bacteria | 6763888 |
| 1399 | 2977585329 | 2977579622 | Bacteria | 6772100 |
| 1400 | 2977848752 | 2977843712 | Bacteria | 6753583 |
| 1401 | 2977860986 | 2977858184 | Bacteria | 6215359 |
| 1402 | 2977872035 | 2977864932 | Bacteria | 7534097 |
| 1403 | 2977879624 | 2977872689 | Bacteria | 7270173 |
| 1404 | 2977906562 | 2977898635 | Bacteria | 6675551 |
| 1405 | 2977911461 | 2977907340 | Bacteria | 6577984 |
| 1406 | 2977918666 | 2977915119 | Bacteria | 6829656 |
| 1407 | 2977937525 | 2977935797 | Bacteria | 6252826 |
| 1408 | 2977946127 | 2977942078 | Bacteria | 7570577 |
| 1409 | 2977954012 | 2977950692 | Bacteria | 6893264 |
| 1410 | 2977958592 | 2977957713 | Bacteria | 6877875 |
| 1411 | 2977976383 | 2977971508 | Bacteria | 7472917 |
| 1412 | 2978974176 | 2978969890 | Bacteria | 5400756 |
| 1413 | 2979106075 | 2979100975 | Bacteria | 5423623 |
| 1414 | 2979713993 | 2979710463 | Bacteria | 6785254 |
| 1415 | 2979775257 | 2979772303 | Bacteria | 6618277 |
| 1416 | 2979779950 | 2979779861 | Bacteria | 6219781 |
| 1417 | 2984512136 | 2984509177 | Bacteria | 5274802 |
| 1418 | 2984521503 | 2984518228 | Bacteria | 5277463 |
| 1419 | 2984540797 | 2984537506 | Bacteria | 5277481 |
| 1420 | 2984589504 | 2984587000 | Bacteria | 5263363 |
| 1421 | 2984603064 | 2984601300 | Bacteria | 5455244 |
| 1422 | 2987640796 | 2987636660 | Bacteria | 8088555 |
| 1423 | 2987645728 | 2987645492 | Bacteria | 6117018 |
| 1424 | 2987656479 | 2987652177 | Bacteria | 6969023 |
| 1425 | 2987670374 | 2987666974 | Bacteria | 6509233 |
| 1426 | 2987680961 | 2987673487 | Bacteria | 6884027 |
| 1427 | 2989352916 | 2989349275 | Bacteria | 6349068 |
| 1428 | 2989773707 | 2989771324 | Bacteria | 5605128 |
| 1429 | 2989778755 | 2989776772 | Bacteria | 4843317 |
| 1430 | 2996341813 | 2996336353 | Bacteria | 5511628 |
| 1431 | 2996348852 | 2996341866 | Bacteria | 6643098 |
| 1432 | 2996351157 | 2996348954 | Bacteria | 7239054 |
| 1433 | 2996388322 | 2996386984 | Bacteria | 6978667 |
| 1434 | 2996892439 | 2996887358 | Bacteria | 5795980 |
| 1435 | 2996898451 | 2996893221 | Bacteria | 5823108 |
| 1436 | 3000136251 | 3000135777 | Bacteria | 6891109 |
| 1437 | 3003933386 | 3003930520 | Bacteria | 5667563 |
| 1438 | 3004170109 | 3004167301 | Bacteria | 8330599 |
| 1439 | 3004202782 | 3004195979 | Bacteria | 6776956 |
| 1440 | 3004208993 | 3004203850 | Bacteria | 7307914 |
| 1441 | 3004238452 | 3004232784 | Bacteria | 6662140 |
| 1442 | 3004246039 | 3004239961 | Bacteria | 6892290 |
| 1443 | 3004254527 | 3004248173 | Bacteria | 6563236 |
| 1444 | 3004269797 | 3004268573 | Bacteria | 7043476 |
| 1445 | 3004277855 | 3004275668 | Bacteria | 7114440 |
| 1446 | 3004291749 | 3004289098 | Bacteria | 6135450 |
| 1447 | 3004340332 | 3004334049 | Bacteria | 8449246 |
| 1448 | 3005409646 | 3005409236 | Bacteria | 7188837 |
| 1449 | 3005420363 | 3005416602 | Bacteria | 7064308 |
| 1450 | 3005447248 | 3005445848 | Bacteria | 6906074 |
| 1451 | 3005453957 | 3005452660 | Bacteria | 5889319 |
| 1452 | 637073634 | 637000159 | Bacteria | 7596297 |
| 1453 | 639648140 | 639633055 | Bacteria | 7751309 |
| 1454 | 643825501 | 643692032 | Bacteria | 6891900 |
| 1455 | 648740132 | 648276728 | Bacteria | 6968865 |
| 1456 | 649873570 | 649633066 | Bacteria | 6690028 |
| 1457 | 8001848689 | 8001845381 | Bacteria | 5804942 |
| 1458 | 8002286145 | 8002285264 | Bacteria | 6717907 |
| 1459 | 8003570898 | 8003570095 | Bacteria | 5747666 |
| 1460 | 8003993333 | 8003992118 | Bacteria | 7266902 |
| 1461 | 8004000589 | 8003999396 | Bacteria | 7063185 |
| 1462 | 8004306595 | 8004300914 | Bacteria | 6132239 |
| 1463 | 8004313773 | 8004312739 | Bacteria | 7444653 |
| 1464 | 8004364202 | 8004361976 | Bacteria | 6858373 |
| 1465 | 8004393856 | 8004387939 | Bacteria | 7049250 |
| 1466 | 8004450054 | 8004445564 | Bacteria | 6322258 |
| 1467 | 8004643190 | 8004640170 | Bacteria | 6723001 |
| 1468 | 8004714526 | 8004703790 | Bacteria | 8006957 |
| 1469 | 8004719652 | 8004714634 | Bacteria | 6776161 |
| 1470 | 8005248307 | 8005246636 | Bacteria | 4933972 |
| 1471 | 8005259721 | 8005258706 | Bacteria | 6184835 |
| 1472 | 8005280210 | 8005275841 | Bacteria | 6929066 |
| 1473 | 8005288277 | 8005282627 | Bacteria | 6675747 |
| 1474 | 8005294803 | 8005289223 | Bacteria | 6634003 |
| 1475 | 8005307038 | 8005301065 | Bacteria | 6614431 |
| 1476 | 8005314553 | 8005307578 | Bacteria | 7395396 |
| 1477 | 8005317314 | 8005314921 | Bacteria | 7072929 |
| 1478 | 8005326966 | 8005321885 | Bacteria | 5795980 |
| 1479 | 8005378789 | 8005376324 | Bacteria | 6590079 |
| 1480 | 8005388011 | 8005382845 | Bacteria | 6732062 |
| 1481 | 8005397034 | 8005395548 | Bacteria | 6806915 |
| 1482 | 8005433241 | 8005430974 | Bacteria | 6689030 |
| 1483 | 8005462522 | 8005460587 | Bacteria | 7157962 |
| 1484 | 8005486622 | 8005484373 | Bacteria | 6297373 |
| 1485 | 8005499900 | 8005497431 | Bacteria | 6477605 |
| 1486 | 8005544877 | 8005542996 | Bacteria | 7077758 |
| 1487 | 8005558109 | 8005556819 | Bacteria | 6908598 |
| 1488 | 8005569287 | 8005563573 | Bacteria | 7153261 |
| 1489 | 8005575436 | 8005570704 | Bacteria | 6957481 |
| 1490 | 8005621267 | 8005619151 | Bacteria | 7030230 |
| 1491 | 8005631433 | 8005626139 | Bacteria | 6534237 |
| 1492 | 8005646236 | 8005645114 | Bacteria | 6950293 |
| 1493 | 8005659423 | 8005658619 | Bacteria | 4500593 |
| 1494 | 8005671318 | 8005668836 | Bacteria | 6953162 |
| 1495 | 8005686370 | 8005682033 | Bacteria | 6726518 |
| 1496 | 8005694952 | 8005688590 | Bacteria | 6610080 |
| 1497 | 8005696152 | 8005695170 | Bacteria | 6912330 |
| 1498 | 8018129562 | 8018127388 | Bacteria | 7351159 |
| 1499 | 8018155608 | 8018150411 | Bacteria | 5549903 |
| 1500 | 8018168103 | 8018163183 | Bacteria | 7277977 |
| 1501 | 8018177899 | 8018176218 | Bacteria | 6896178 |
| 1502 | 8023680977 | 8023680758 | Bacteria | 7729763 |
| 1503 | 8024485753 | 8024479707 | Bacteria | 6954785 |
| 1504 | 8024492570 | 8024486573 | Bacteria | 6540512 |
| 1505 | 8024505219 | 8024501048 | Bacteria | 6427847 |
| 1506 | 8046770330 | 8046767195 | Bacteria | 7547379 |
| 1507 | 8049294388 | 8049293176 | Bacteria | 6128433 |
| 1508 | 8055435053 | 8055431914 | Bacteria | 4551896 |
| 1509 | 8056380146 | 8056375014 | Bacteria | 7006639 |
| 1510 | 8056387549 | 8056382006 | Bacteria | 6408074 |
| 1511 | 8056876763 | 8056875544 | Bacteria | 4355797 |
| 1512 | 8057578260 | 8057575449 | Bacteria | 7367519 |
| 1513 | 8057875492 | 8057874678 | Bacteria | 7494653 |
| 1514 | Ga0500555_003659 | |||
| 1515 | JGI24740J21852_10000001 | |||
| 1516 | JGI25155J39150_1000011 | |||
| 1517 | JGI25156J39149_1000027 | |||
| 1518 | JGI25156J39149_1000030 | |||
| 1519 | JGI25156J39149_1011404 | |||
| 1520 | JGI25162J39368_1000351 | |||
| 1521 | JGI25162J39368_1001364 | |||
| 1522 | JGI25162J39368_1002538 | |||
| 1523 | JGI25154J39366_1000057 | |||
| 1524 | JGI25158J39367_1000245 | |||
| 1525 | JGI25158J39367_1009771 | |||
| 1526 | JGI25157J39369_1000010 | |||
| 1527 | JGI25157J39369_1000604 | |||
| 1528 | JGI25152J39213_1000288 | |||
| 1529 | JGI25152J39213_1000724 | |||
| 1530 | JGI25152J39213_1002131 | |||
| 1531 | JGI25152J39213_1003666 | |||
| 1532 | JGI25152J39213_1011614 | |||
| 1533 | JGI25150J39212_1000010 | |||
| 1534 | JGI25159J45721_1000006 | |||
| 1535 | JGI25159J45721_1000683 | |||
| 1536 | JGI25151J46595_10000026 | |||
| 1537 | JGI25151J46595_10000238 | |||
| 1538 | JGI25151J46595_10007967 | |||
| 1539 | JGI25151J46595_10038293 | |||
| 1540 | JGI25406J46586_10009023 | |||
| 1541 | JGI25406J46586_10027468 | |||
| 1542 | JGI25165J46597_1000033 | |||
| 1543 | JGI25165J46597_1000189 | |||
| 1544 | JGI25165J46597_1000777 | |||
| 1545 | JGI25153J46596_10003069 | |||
| 1546 | JGI25153J46596_10028474 | |||
| 1547 | JGI25153J46596_10028476 | |||
| 1548 | JGI25153J46596_10044121 | |||
| 1549 | rootL2_10135068 | |||
| 1550 | JGI25160J50197_1000004 | |||
| 1551 | JGI25160J50197_1000019 | |||
| 1552 | JGI25160J50197_1001596 | |||
| 1553 | JGI25161J50226_1000003 | |||
| 1554 | JGI25161J50226_1000330 | |||
| 1555 | JGI25161J50226_1001454 | |||
| 1556 | JGI25161J50226_1005034 | |||
| 1557 | Ga0055539_1004539 | |||
| 1558 | Ga0055526_1000382 | |||
| 1559 | Ga0055526_1000565 | |||
| 1560 | Ga0055526_1000669 | |||
| 1561 | Ga0055526_1004202 | |||
| 1562 | Ga0055524_1003035 | |||
| 1563 | Ga0055524_1004474 | |||
| 1564 | Ga0055524_1004820 | |||
| 1565 | Ga0055524_1007966 | |||
| 1566 | Ga0055524_1010914 | |||
| 1567 | Ga0055536_1000212 | |||
| 1568 | Ga0055536_1005870 | |||
| 1569 | Ga0055536_1012344 | |||
| 1570 | Ga0055528_1000918 | |||
| 1571 | Ga0055528_1003069 | |||
| 1572 | Ga0055528_1005988 | |||
| 1573 | Ga0055528_1006131 | |||
| 1574 | Ga0055528_1006493 | |||
| 1575 | Ga0055528_1006683 | |||
| 1576 | Ga0055528_1019407 | |||
| 1577 | Ga0055530_10000740 | |||
| 1578 | Ga0055530_10007317 | |||
| 1579 | Ga0055530_10016645 | |||
| 1580 | Ga0055540_1000285 | |||
| 1581 | Ga0055540_1001884 | |||
| 1582 | Ga0055540_1002932 | |||
| 1583 | Ga0055540_1014240 | |||
| 1584 | Ga0055531_10001165 | |||
| 1585 | Ga0055531_10004924 | |||
| 1586 | Ga0058692_1002385 | |||
| 1587 | Ga0055543_1000001 | |||
| 1588 | Ga0055543_1000019 | |||
| 1589 | Ga0055543_1000147 | |||
| 1590 | Ga0055543_1000808 | |||
| 1591 | Ga0065165_1000049 | |||
| 1592 | Ga0065165_1000180 | |||
| 1593 | Ga0065165_1000277 | |||
| 1594 | Ga0065165_1005991 | |||
| 1595 | Ga0070658_10065948 | |||
| 1596 | Ga0070658_10080578 | |||
| 1597 | Ga0070676_10034424 | |||
| 1598 | Ga0070670_100001443 | |||
| 1599 | Ga0070680_100085741 | |||
| 1600 | Ga0070660_100057146 | |||
| 1601 | Ga0070660_100095551 | |||
| 1602 | Ga0070689_100083799 | |||
| 1603 | Ga0070691_10000580 | |||
| 1604 | Ga0070668_100005749 | |||
| 1605 | Ga0070668_100016044 | |||
| 1606 | Ga0070668_100022821 | |||
| 1607 | Ga0070668_100088881 | |||
| 1608 | Ga0070671_100010443 | |||
| 1609 | Ga0070671_100030699 | |||
| 1610 | Ga0070671_100368037 | |||
| 1611 | Ga0070673_100038873 | |||
| 1612 | Ga0070688_100168247 | |||
| 1613 | Ga0070659_100000206 | |||
| 1614 | Ga0070659_100007044 | |||
| 1615 | Ga0070659_100221241 | |||
| 1616 | Ga0070667_100036538 | |||
| 1617 | Ga0070667_100043831 | |||
| 1618 | Ga0070711_100036164 | |||
| 1619 | Ga0070663_100171843 | |||
| 1620 | Ga0070681_10015949 | |||
| 1621 | Ga0070681_10091580 | |||
| 1622 | Ga0070707_100033261 | |||
| 1623 | Ga0070679_100077472 | |||
| 1624 | Ga0070684_100073150 | |||
| 1625 | Ga0068853_100374454 | |||
| 1626 | Ga0070696_100046383 | |||
| 1627 | Ga0070665_100000116 | |||
| 1628 | Ga0070665_100058585 | |||
| 1629 | Ga0070665_100118304 | |||
| 1630 | Ga0070665_100263157 | |||
| 1631 | Ga0068855_100024601 | |||
| 1632 | Ga0068855_100154427 | |||
| 1633 | Ga0068855_100155438 | |||
| 1634 | Ga0068855_100209386 | |||
| 1635 | Ga0070664_100093010 | |||
| 1636 | Ga0068857_100121917 | |||
| 1637 | Ga0068854_100034387 | |||
| 1638 | Ga0068854_100107903 | |||
| 1639 | Ga0068856_100042875 | |||
| 1640 | Ga0068852_100195717 | |||
| 1641 | Ga0068859_100008475 | |||
| 1642 | Ga0068859_100102241 | |||
| 1643 | Ga0068859_100421453 | |||
| 1644 | Ga0068864_100091486 | |||
| 1645 | Ga0068864_100097380 | |||
| 1646 | Ga0068864_100114133 | |||
| 1647 | Ga0068861_100184759 | |||
| 1648 | Ga0068863_100068534 | |||
| 1649 | Ga0068863_100090185 | |||
| 1650 | Ga0068860_100000145 | |||
| 1651 | Ga0068860_100005851 | |||
| 1652 | Ga0068862_100013415 | |||
| 1653 | Ga0068862_100015461 | |||
| 1654 | Ga0068862_100372155 | |||
| 1655 | Ga0081538_10002190 | |||
| 1656 | Ga0081540_1008246 | |||
| 1657 | Ga0081540_1012786 | |||
| 1658 | Ga0081539_10001354 | |||
| 1659 | Ga0070717_10131058 | |||
| 1660 | Ga0070717_10307172 | |||
| 1661 | Ga0075365_10005577 | |||
| 1662 | Ga0075365_10013397 | |||
| 1663 | Ga0075365_10016756 | |||
| 1664 | Ga0075365_10017898 | |||
| 1665 | Ga0075365_10145404 | |||
| 1666 | Ga0075363_100008477 | |||
| 1667 | Ga0075364_10031424 | |||
| 1668 | Ga0070712_100303606 | |||
| 1669 | Ga0075362_10004704 | |||
| 1670 | Ga0075362_10020925 | |||
| 1671 | Ga0075362_10059651 | |||
| 1672 | Ga0075367_10003238 | |||
| 1673 | Ga0075367_10041909 | |||
| 1674 | Ga0075369_10080883 | |||
| 1675 | Ga0075366_10001654 | |||
| 1676 | Ga0075366_10008896 | |||
| 1677 | Ga0075366_10137519 | |||
| 1678 | Ga0075428_100001218 | |||
| 1679 | Ga0075428_100129102 | |||
| 1680 | Ga0075430_100044128 | |||
| 1681 | Ga0075431_100000613 | |||
| 1682 | Ga0075431_100017312 | |||
| 1683 | Ga0075431_100018072 | |||
| 1684 | Ga0075431_100208114 | |||
| 1685 | Ga0075434_100011257 | |||
| 1686 | Ga0075429_100013425 | |||
| 1687 | Ga0068865_100001650 | |||
| 1688 | Ga0097620_100008475 | |||
| 1689 | Ga0097620_100102253 | |||
| 1690 | Ga0097620_100421511 | |||
| 1691 | Ga0079104_1000187 | |||
| 1692 | Ga0079104_1001924 | |||
| 1693 | Ga0105240_10000005 | |||
| 1694 | Ga0105240_10015964 | |||
| 1695 | Ga0105240_10027898 | |||
| 1696 | Ga0105240_10066214 | |||
| 1697 | Ga0105240_10544402 | |||
| 1698 | Ga0111539_10203844 | |||
| 1699 | Ga0111539_10375644 | |||
| 1700 | Ga0105247_10008257 | |||
| 1701 | Ga0114129_10004627 | |||
| 1702 | Ga0114129_10064420 | |||
| 1703 | Ga0105248_10000154 | |||
| 1704 | Ga0105237_10000708 | |||
| 1705 | Ga0105237_10025668 | |||
| 1706 | Ga0105237_10169520 | |||
| 1707 | Ga0105238_10017778 | |||
| 1708 | Ga0105238_10104877 | |||
| 1709 | Ga0105238_10174121 | |||
| 1710 | Ga0105238_10291902 | |||
| 1711 | Ga0105249_10002692 | |||
| 1712 | Ga0123341_1000001 | |||
| 1713 | Ga0123342_1008195 | |||
| 1714 | Ga0123342_1034638 | |||
| 1715 | Ga0105239_10000739 | |||
| 1716 | Ga0105239_10028635 | |||
| 1717 | Ga0105239_10130617 | |||
| 1718 | Ga0105239_10312229 | |||
| 1719 | Ga0105246_10280664 | |||
| 1720 | Ga0157371_10005765 | |||
| 1721 | Ga0157370_10000284 | |||
| 1722 | Ga0157370_10105632 | |||
| 1723 | Ga0157369_10182886 | |||
| 1724 | Ga0171463_1011 | |||
| 1725 | Ga0163163_10135021 | |||
| 1726 | Ga0163163_10197852 | |||
| 1727 | Ga0182008_10021177 | |||
| 1728 | Ga0157377_10008119 | |||
| 1729 | Ga0182006_1043239 | |||
| 1730 | Ga0182005_1006504 | |||
| 1731 | Ga0183363_1111 | |||
| 1732 | Ga0214542_1000015 | |||
| 1733 | Ga0214542_1019302 | |||
| 1734 | Ga0214543_1000011 | |||
| 1735 | Ga0214543_1000032 | |||
| 1736 | Ga0213876_10024578 | |||
| 1737 | Ga0213876_10041739 | |||
| 1738 | Ga0228711_1000012 | |||
| 1739 | Ga0228710_1000006 | |||
| 1740 | Ga0209435_100022 | |||
| 1741 | Ga0209436_100038 | |||
| 1742 | Ga0209436_100837 | |||
| 1743 | Ga0209437_100160 | |||
| 1744 | Ga0209437_100310 | |||
| 1745 | Ga0207425_1000010 | |||
| 1746 | Ga0207425_1001758 | |||
| 1747 | Ga0209646_1000078 | |||
| 1748 | Ga0209026_1000002 | |||
| 1749 | Ga0209026_1000065 | |||
| 1750 | Ga0209026_1012621 | |||
| 1751 | Ga0209677_101256 | |||
| 1752 | Ga0209148_1000570 | |||
| 1753 | Ga0209759_1000055 | |||
| 1754 | Ga0209759_1000119 | |||
| 1755 | Ga0209129_1000099 | |||
| 1756 | Ga0209129_1000432 | |||
| 1757 | Ga0209129_1000442 | |||
| 1758 | Ga0209129_1001010 | |||
| 1759 | Ga0209129_1001971 | |||
| 1760 | Ga0209129_1002862 | |||
| 1761 | Ga0209233_1000027 | |||
| 1762 | Ga0209233_1000168 | |||
| 1763 | Ga0209233_1000269 | |||
| 1764 | Ga0209233_1000303 | |||
| 1765 | Ga0209455_1000204 | |||
| 1766 | Ga0209673_1000068 | |||
| 1767 | Ga0209673_1000139 | |||
| 1768 | Ga0209673_1001538 | |||
| 1769 | Ga0209673_1001716 | |||
| 1770 | Ga0209673_1002227 | |||
| 1771 | Ga0209673_1002802 | |||
| 1772 | Ga0209673_1005579 | |||
| 1773 | Ga0209673_1035943 | |||
| 1774 | Ga0209130_1000007 | |||
| 1775 | Ga0209130_1000012 | |||
| 1776 | Ga0209130_1000097 | |||
| 1777 | Ga0209676_1000399 | |||
| 1778 | Ga0209676_1006026 | |||
| 1779 | Ga0209025_1000022 | |||
| 1780 | Ga0209025_1000237 | |||
| 1781 | Ga0209025_1000358 | |||
| 1782 | Ga0209025_1000729 | |||
| 1783 | Ga0209025_1000923 | |||
| 1784 | Ga0209025_1000949 | |||
| 1785 | Ga0209025_1004865 | |||
| 1786 | Ga0209025_1014684 | |||
| 1787 | Ga0209025_1021924 | |||
| 1788 | Ga0209025_1024577 | |||
| 1789 | Ga0209025_1026821 | |||
| 1790 | Ga0209564_1000140 | |||
| 1791 | Ga0209564_1000794 | |||
| 1792 | Ga0209564_1000802 | |||
| 1793 | Ga0209564_1000868 | |||
| 1794 | Ga0209564_1001618 | |||
| 1795 | Ga0209564_1005687 | |||
| 1796 | Ga0209564_1029829 | |||
| 1797 | Ga0209564_1032595 | |||
| 1798 | Ga0209758_1000086 | |||
| 1799 | Ga0209758_1000155 | |||
| 1800 | Ga0209758_1000545 | |||
| 1801 | Ga0209758_1000587 | |||
| 1802 | Ga0209758_1001100 | |||
| 1803 | Ga0209758_1002445 | |||
| 1804 | Ga0209758_1009072 | |||
| 1805 | Ga0209758_1026976 | |||
| 1806 | Ga0209758_1050684 | |||
| 1807 | Ga0209050_1000200 | |||
| 1808 | Ga0209050_1000650 | |||
| 1809 | Ga0209050_1005095 | |||
| 1810 | Ga0209050_1012900 | |||
| 1811 | Ga0209256_1000557 | |||
| 1812 | Ga0209256_1000687 | |||
| 1813 | Ga0209256_1001048 | |||
| 1814 | Ga0209256_1001371 | |||
| 1815 | Ga0209256_1004371 | |||
| 1816 | Ga0209256_1007616 | |||
| 1817 | Ga0209256_1008484 | |||
| 1818 | Ga0209256_1031180 | |||
| 1819 | Ga0207426_1000003 | |||
| 1820 | Ga0207426_1000010 | |||
| 1821 | Ga0207426_1000111 | |||
| 1822 | Ga0207426_1001840 | |||
| 1823 | Ga0207426_1002511 | |||
| 1824 | Ga0209051_1000095 | |||
| 1825 | Ga0209051_1001031 | |||
| 1826 | Ga0209051_1001191 | |||
| 1827 | Ga0209051_1003503 | |||
| 1828 | Ga0209051_1007144 | |||
| 1829 | Ga0209051_1018527 | |||
| 1830 | Ga0209257_1000225 | |||
| 1831 | Ga0209257_1001135 | |||
| 1832 | Ga0209257_1001962 | |||
| 1833 | Ga0209257_1002482 | |||
| 1834 | Ga0209257_1003296 | |||
| 1835 | Ga0207647_10009171 | |||
| 1836 | Ga0207645_10047975 | |||
| 1837 | Ga0207705_10002109 | |||
| 1838 | Ga0207684_10044863 | |||
| 1839 | Ga0207707_10043776 | |||
| 1840 | Ga0207695_10000011 | |||
| 1841 | Ga0207695_10001670 | |||
| 1842 | Ga0207695_10001727 | |||
| 1843 | Ga0207695_10032467 | |||
| 1844 | Ga0207695_10040997 | |||
| 1845 | Ga0207695_10109166 | |||
| 1846 | Ga0207671_10000544 | |||
| 1847 | Ga0207663_10056508 | |||
| 1848 | Ga0207660_10024849 | |||
| 1849 | Ga0207660_10229845 | |||
| 1850 | Ga0207657_10009919 | |||
| 1851 | Ga0207657_10011260 | |||
| 1852 | Ga0207657_10031173 | |||
| 1853 | Ga0207652_10099157 | |||
| 1854 | Ga0207646_10009642 | |||
| 1855 | Ga0207646_10203736 | |||
| 1856 | Ga0207694_10043945 | |||
| 1857 | Ga0207650_10002090 | |||
| 1858 | Ga0207650_10034339 | |||
| 1859 | Ga0207650_10043564 | |||
| 1860 | Ga0207687_10135206 | |||
| 1861 | Ga0207687_10208249 | |||
| 1862 | Ga0207644_10019674 | |||
| 1863 | Ga0207690_10000129 | |||
| 1864 | Ga0207690_10069496 | |||
| 1865 | Ga0207670_10076286 | |||
| 1866 | Ga0207711_10003316 | |||
| 1867 | Ga0207689_10037734 | |||
| 1868 | Ga0207679_10209322 | |||
| 1869 | Ga0207667_10012057 | |||
| 1870 | Ga0207667_10076819 | |||
| 1871 | Ga0207667_10094113 | |||
| 1872 | Ga0207651_10001247 | |||
| 1873 | Ga0207651_10153666 | |||
| 1874 | Ga0207712_10003857 | |||
| 1875 | Ga0207668_10005551 | |||
| 1876 | Ga0207668_10019991 | |||
| 1877 | Ga0207668_10097082 | |||
| 1878 | Ga0207640_10184906 | |||
| 1879 | Ga0207658_10014480 | |||
| 1880 | Ga0207658_10030279 | |||
| 1881 | Ga0207703_10155370 | |||
| 1882 | Ga0207639_10012996 | |||
| 1883 | Ga0207678_10196436 | |||
| 1884 | Ga0207678_10238197 | |||
| 1885 | Ga0207702_10306121 | |||
| 1886 | Ga0207641_10080568 | |||
| 1887 | Ga0207641_10196921 | |||
| 1888 | Ga0207648_10280931 | |||
| 1889 | Ga0207676_10092246 | |||
| 1890 | Ga0207676_10157549 | |||
| 1891 | Ga0207674_10037025 | |||
| 1892 | Ga0207674_10313778 | |||
| 1893 | Ga0207675_100088449 | |||
| 1894 | Ga0207675_100106878 | |||
| 1895 | Ga0207698_10032339 | |||
| 1896 | Ga0207698_10156809 | |||
| 1897 | Ga0209281_1000310 | |||
| 1898 | Ga0209281_1000334 | |||
| 1899 | Ga0209281_1000361 | |||
| 1900 | Ga0209371_1000021 | |||
| 1901 | Ga0209371_1000469 | |||
| 1902 | Ga0209371_1001465 | |||
| 1903 | Ga0209981_1001336 | |||
| 1904 | Ga0209282_1000073 | |||
| 1905 | Ga0207428_10143703 | |||
| 1906 | Ga0268266_10000064 | |||
| 1907 | Ga0268266_10096180 | |||
| 1908 | Ga0268266_10118022 | |||
| 1909 | Ga0268265_10296647 | |||
| 1910 | Ga0268264_10000046 | |||
| 1911 | Ga0268264_10008753 | |||
| 1912 | Ga0307517_10012250 | |||
| 1913 | Ga0307515_10000844 | |||
| 1914 | Ga0307515_10004389 | |||
| 1915 | Ga0307515_10013773 | |||
| 1916 | Ga0307515_10020621 | |||
| 1917 | Ga0307515_10136352 | |||
| 1918 | Ga0265338_10102967 | |||
| 1919 | Ga0268256_1000020 | |||
| 1920 | Ga0268256_1001794 | |||
| 1921 | Ga0268256_1005314 | |||
| 1922 | Ga0307511_10020348 | |||
| 1923 | Ga0316181_1029502 | |||
| 1924 | Ga0265332_10002681 | |||
| 1925 | Ga0265340_10004410 | |||
| 1926 | Ga0265340_10007323 | |||
| 1927 | Ga0265340_10045900 | |||
| 1928 | Ga0265340_10058938 | |||
| 1929 | Ga0265339_10005244 | |||
| 1930 | Ga0265331_10076144 | |||
| 1931 | Ga0265327_10010519 | |||
| 1932 | Ga0265316_10019975 | |||
| 1933 | Ga0265316_10144053 | |||
| 1934 | Ga0265316_10153431 | |||
| 1935 | Ga0265316_10174053 | |||
| 1936 | Ga0307513_10001153 | |||
| 1937 | Ga0307513_10002223 | |||
| 1938 | Ga0307513_10126591 | |||
| 1939 | Ga0307513_10131453 | |||
| 1940 | Ga0307513_10246589 | |||
| 1941 | Ga0307408_100044283 | |||
| 1942 | Ga0307408_100106122 | |||
| 1943 | Ga0265313_10000115 | |||
| 1944 | Ga0265313_10005411 | |||
| 1945 | Ga0265342_10000291 | |||
| 1946 | Ga0265342_10004760 | |||
| 1947 | Ga0307405_10000865 | |||
| 1948 | Ga0315914_1000008 | |||
| 1949 | Ga0307409_100090327 | |||
| 1950 | Ga0307415_100156003 | |||
| 1951 | Ga0307510_10215800 | |||
| 1952 | Ga0315913_1000688 | |||
| 1953 | Ga0315915_1000014 | |||
| 1954 | Ga0373936_0001078 | |||
| 1955 | Ga0373955_0006909 | |||
| 1956 | Ga0373935_0180676 | |||
| 1957 | Ga0373947_0103714 | |||
| 1958 | Ga0373937_0003965 | |||
| 1959 | Ga0316582_0178570 | |||
| 1960 | Ga0395900_0105421 | |||
| 1961 | Ga0395900_0148717 | |||
| 1962 | Ga0395898_0129795 | |||
| 1963 | Ga0395905_0000325 | |||
| 1964 | Ga0395905_0013938 | |||
| 1965 | Ga0395905_0018905 | |||
| 1966 | Ga0395905_0036384 | |||
| 1967 | Ga0395905_0084322 | |||
| 1968 | Ga0395905_0118398 | |||
| 1969 | Ga0395905_0151442 | |||
| 1970 | Ga0395905_0203822 | |||
| 1971 | Ga0395905_0362075 | |||
| 1972 | Ga0395901_0034892 | |||
| 1973 | Ga0395901_0080149 | |||
| 1974 | Ga0436365_1022390 | |||
| 1975 | Ga0436365_1373120 | |||
| 1976 | Ga0436365_1821915 | |||
| 1977 | Ga0436360_1164335 | |||
| 1978 | Ga0439436_0005547 | |||
| 1979 | Ga0439447_014419 | |||
| 1980 | Ga0439465_0002132 | |||
| 1981 | Ga0439465_0008511 | |||
| 1982 | Ga0439465_0009217 | |||
| 1983 | Ga0439449_0016399 | |||
| 1984 | Ga0439462_0020296 | |||
| 1985 | Ga0439434_0006059 | |||
| 1986 | Ga0450918_004111 | |||
| 1987 | Ga0439440_0026012 | |||
| 1988 | Ga0466972_0016538 | |||
| 1989 | Ga0466957_0006564 | |||
| 1990 | Ga0451576_0255328 | |||
| 1991 | Ga0495638_0000335 | |||
| 1992 | Ga0495638_0070997 | |||
| 1993 | Ga0495605_0008898 | |||
| 1994 | Ga0495585_0085021 | |||
| 1995 | Ga0495583_0040752 | |||
| 1996 | Ga0495606_0001859 | |||
| 1997 | Ga0495610_0006199 | |||
| 1998 | Ga0495616_0072333 | |||
| 1999 | Ga0495620_0011481 | |||
| 2000 | Ga0495620_0037347 | |||
| 2001 | Ga0495628_0096660 | |||
| 2002 | Ga0495631_0044543 | |||
| 2003 | Ga0495632_0007829 | |||
| 2004 | Ga0495632_0016533 | |||
| 2005 | Ga0495632_0054495 | |||
| 2006 | Ga0495643_0017640 | |||
| 2007 | Ga0495643_0019594 | |||
| 2008 | Ga0495648_0078720 | |||
| 2009 | Ga0495642_0003747 | |||
| 2010 | Ga0495652_0145320 | |||
| 2011 | Ga0495654_0006825 | |||
| 2012 | Ga0495609_0047737 | |||
| 2013 | Ga0495597_0037496 | |||
| 2014 | Ga0495597_0051685 | |||
| 2015 | Ga0495622_0023852 | |||
| 2016 | Ga0495656_0013990 | |||
| 2017 | Ga0495668_0026182 | |||
| 2018 | Ga0495668_0036672 | |||
| 2019 | Ga0495668_0044359 | |||
| 2020 | Ga0495634_0102449 | |||
| 2021 | Ga0495625_0003150 | |||
| 2022 | Ga0495625_0022163 | |||
| 2023 | Ga0495625_0121613 | |||
| 2024 | Ga0495588_0001585 | |||
| 2025 | Ga0495657_0041914 | |||
| 2026 | Ga0495623_0135070 | |||
| 2027 | Ga0495669_0020443 | |||
| 2028 | Ga0495613_0004373 | |||
| 2029 | Ga0495671_0072418 | |||
| 2030 | Ga0495600_0083742 | |||
| 2031 | Ga0495681_0002954 | |||
| 2032 | Ga0495686_0004865 | |||
| 2033 | Ga0495686_0023724 | |||
| 2034 | Ga0495686_0032058 | |||
| 2035 | Ga0495686_0075994 | |||
| 2036 | Ga0495686_0149061 | |||
| 2037 | Ga0495602_0125809 | |||
| 2038 | Ga0496100_0139285 | |||
| 2039 | Ga0496101_0077391 | |||
| 2040 | Ga0496102_0187894 | |||
| 2041 | Ga0496103_0211605 | |||
| 2042 | Ga0496105_0127464 | |||
| 2043 | Ga0496105_0151629 | |||
| 2044 | Ga0496105_0288371 | |||
| 2045 | Ga0496106_0004921 | |||
| 2046 | Ga0496107_0141570 | |||
| 2047 | Ga0496110_0151666 | |||
| 2048 | Ga0496111_0001499 | |||
| 2049 | Ga0496112_0033343 | |||
| 2050 | Ga0496112_0050254 | |||
| 2051 | Ga0496112_0161662 | |||
| 2052 | Ga0496112_0176656 | |||
| 2053 | Ga0496114_0305178 | |||
| 2054 | Ga0496115_0000598 | |||
| 2055 | Ga0496115_0013865 | |||
| 2056 | Ga0496116_0000043 | |||
| 2057 | Ga0496116_0005367 | |||
| 2058 | Ga0496116_0008089 | |||
| 2059 | Ga0496116_0009102 | |||
| 2060 | Ga0496116_0089980 | |||
| 2061 | Ga0496117_0000338 | |||
| 2062 | Ga0496117_0018243 | |||
| 2063 | Ga0496117_0053521 | |||
| 2064 | Ga0496117_0074710 | |||
| 2065 | Ga0496117_0112688 | |||
| 2066 | Ga0496118_0000958 | |||
| 2067 | Ga0496118_0012461 | |||
| 2068 | Ga0496118_0058725 | |||
| 2069 | Ga0496119_0000407 | |||
| 2070 | Ga0496119_0020566 | |||
| 2071 | Ga0496119_0118030 | |||
| 2072 | Ga0496120_0000589 | |||
| 2073 | Ga0496120_0001472 | |||
| 2074 | Ga0496120_0039468 | |||
| 2075 | Ga0496121_0000003 | |||
| 2076 | Ga0496121_0002723 | |||
| 2077 | Ga0496121_0009941 | |||
| 2078 | Ga0496121_0015230 | |||
| 2079 | Ga0496121_0021685 | |||
| 2080 | Ga0496121_0243555 | |||
| 2081 | Ga0496122_0000025 | |||
| 2082 | Ga0496122_0001020 | |||
| 2083 | Ga0496122_0011791 | |||
| 2084 | Ga0496122_0016499 | |||
| 2085 | Ga0496122_0045297 | |||
| 2086 | Ga0496122_0060685 | |||
| 2087 | Ga0496122_0066491 | |||
| 2088 | Ga0496122_0080187 | |||
| 2089 | Ga0496123_0000032 | |||
| 2090 | Ga0496123_0000043 | |||
| 2091 | Ga0496123_0005929 | |||
| 2092 | Ga0496123_0033060 | |||
| 2093 | Ga0496123_0034781 | |||
| 2094 | Ga0496124_0004564 | |||
| 2095 | Ga0496124_0009370 | |||
| 2096 | Ga0496124_0017870 | |||
| 2097 | Ga0496124_0023770 | |||
| 2098 | Ga0496124_0043644 | |||
| 2099 | Ga0496124_0057788 | |||
| 2100 | Ga0496124_0116299 | |||
| 2101 | Ga0496124_0122643 | |||
| 2102 | Ga0496124_0164845 | |||
| 2103 | Ga0496125_0000141 | |||
| 2104 | Ga0496125_0000946 | |||
| 2105 | Ga0496125_0047515 | |||
| 2106 | Ga0496125_0076177 | |||
| 2107 | Ga0496125_0091985 | |||
| 2108 | Ga0496126_0000362 | |||
| 2109 | Ga0496126_0001471 | |||
| 2110 | Ga0496126_0094112 | |||
| 2111 | Ga0496126_0282256 | |||
| 2112 | Ga0501031_0000095 | |||
| 2113 | Ga0501032_0000084 | |||
| 2114 | Ga0501032_0018154 | |||
| 2115 | Ga0501033_0000102 | |||
| 2116 | Ga0501033_0002401 | |||
| 2117 | Ga0501033_0109595 | |||
| 2118 | Ga0501033_0216347 | |||
| 2119 | Ga0501034_0001404 | |||
| 2120 | Ga0501034_0002050 | |||
| 2121 | Ga0501034_0051983 | |||
| 2122 | Ga0501034_0063545 | |||
| 2123 | Ga0501034_0070355 | |||
| 2124 | Ga0501034_0114321 | |||
| 2125 | Ga0501034_0119062 | |||
| 2126 | Ga0501034_0146432 | |||
| 2127 | Ga0501034_0221666 | |||
| 2128 | Ga0501034_0269726 | |||
| 2129 | Ga0501036_0000040 | |||
| 2130 | Ga0501036_0099353 | |||
| 2131 | Ga0501036_0133787 | |||
| 2132 | Ga0501037_0000098 | |||
| 2133 | Ga0501037_0116670 | |||
| 2134 | Ga0501037_0127251 | |||
| 2135 | Ga0501038_0000002 | |||
| 2136 | Ga0501038_0041862 | |||
| 2137 | Ga0501038_0079363 | |||
| 2138 | Ga0501038_0087687 | |||
| 2139 | Ga0501038_0204517 | |||
| 2140 | Ga0501039_0000002 | |||
| 2141 | Ga0501039_0070611 | |||
| 2142 | Ga0501039_0123771 | |||
| 2143 | Ga0501040_0018811 | |||
| 2144 | Ga0501040_0087537 | |||
| 2145 | Ga0501041_0085751 | |||
| 2146 | Ga0501043_0006479 | |||
| 2147 | Ga0501043_0091348 | |||
| 2148 | Ga0501046_0040082 | |||
| 2149 | Ga0501046_0040474 | |||
| 2150 | Ga0501046_0097247 | |||
| 2151 | Ga0501047_0002237 | |||
| 2152 | Ga0501047_0009623 | |||
| 2153 | Ga0501047_0039107 | |||
| 2154 | Ga0501047_0152057 | |||
| 2155 | Ga0501047_0207448 | |||
| 2156 | Ga0501067_0027657 | |||
| 2157 | Ga0501067_0103293 | |||
| 2158 | Ga0501070_0001215 | |||
| 2159 | Ga0501070_0007158 | |||
| 2160 | Ga0501070_0012619 | |||
| 2161 | Ga0501070_0100753 | |||
| 2162 | Ga0501070_0130711 | |||
| 2163 | Ga0501070_0134744 | |||
| 2164 | Ga0501070_0161841 | |||
| 2165 | Ga0501073_0021969 | |||
| 2166 | Ga0501073_0068421 | |||
| 2167 | Ga0501073_0102510 | |||
| 2168 | Ga0501074_0078145 | |||
| 2169 | Ga0501074_0122459 | |||
| 2170 | Ga0501074_0156517 | |||
| 2171 | Ga0501075_0053150 | |||
| 2172 | Ga0501077_0008398 | |||
| 2173 | Ga0501077_0061769 | |||
| 2174 | Ga0501079_0016684 | |||
| 2175 | Ga0501079_0189767 | |||
| 2176 | Ga0501080_0115959 | |||
| 2177 | Ga0501080_0116216 | |||
| 2178 | Ga0501081_0002292 | |||
| 2179 | Ga0501083_0008060 | |||
| 2180 | Ga0501083_0087908 | |||
| 2181 | Ga0501083_0122816 | |||
| 2182 | Ga0501280_001402 | |||
| 2183 | Ga0501035_0000163 | |||
| 2184 | Ga0501035_0000636 | |||
| 2185 | Ga0501035_0006001 | |||
| 2186 | Ga0501035_0053793 | |||
| 2187 | Ga0501035_0100213 | |||
| 2188 | Ga0501035_0119403 | |||
| 2189 | Ga0501035_0158231 | |||
| 2190 | Ga0501044_0000002 | |||
| 2191 | Ga0501044_0008237 | |||
| 2192 | Ga0501044_0101028 | |||
| 2193 | Ga0501044_0122644 | |||
| 2194 | Ga0501044_0129502 | |||
| 2195 | Ga0501044_0171180 | |||
| 2196 | nmdc:mga00v17_115039_c1 | |||
| 2197 | nmdc:mga0yw44_22286_c1 | |||
| 2198 | nmdc:mga0yw44_2486_c2 | |||
| 2199 | nmdc:mga0k408_85117_c1 | |||
| 2200 | nmdc:mga06z11_11767_c1 | |||
| 2201 | nmdc:mga05p37_3347_c1 | |||
| 2202 | nmdc:mga05p37_51639_c1 | |||
| 2203 | nmdc:mga06r32_173970_c1 | |||
| 2204 | nmdc:mga06r32_397_c1 | |||
| 2205 | nmdc:mga06r32_4570_c1 | |||
| 2206 | nmdc:mga06r32_65217_c1 | |||
| 2207 | nmdc:mga08y16_125660_c1 | |||
| 2208 | nmdc:mga08y16_184_c1 | |||
| 2209 | nmdc:mga08y16_317269_c1 | |||
| 2210 | nmdc:mga08y16_341208_c1 | |||
| 2211 | nmdc:mga0n895_34584_c1 | |||
| 2212 | nmdc:mga0n895_83347_c1 | |||
| 2213 | nmdc:mga0rr50_112960_c1 | |||
| 2214 | nmdc:mga0a205_189122_c1 | |||
| 2215 | nmdc:mga0sz30_40695_c1 | |||
| 2216 | Ga0495601_0026160 | |||
| 2217 | Ga0495601_0051134 | |||
| 2218 | Ga0500610_0068381 | |||
| 2219 | Ga0500610_0104760 | |||
| 2220 | Ga0495595_0004834 | |||
| 2221 | Ga0495619_0084124 | |||
| 2222 | Ga0495619_0132219 | |||
| 2223 | Ga0495619_0196040 | |||
| 2224 | Ga0500578_0059011 | |||
| 2225 | Ga0500643_029906 | |||
| 2226 | Ga0500643_040753 | |||
| 2227 | Ga0500556_0000048 | |||
| 2228 | Ga0500557_000677 | |||
| 2229 | Ga0500560_035252 | |||
| 2230 | Ga0500569_038673 | |||
| 2231 | Ga0500572_017220 | |||
| 2232 | Ga0500595_010690 | |||
| 2233 | Ga0500618_001230 | |||
| 2234 | Ga0500618_001417 | |||
| 2235 | Ga0500652_000002 | |||
| 2236 | Ga0500658_0001009 | |||
| 2237 | Ga0500568_0005268 | |||
| 2238 | Ga0500568_0007791 | |||
| 2239 | Ga0500573_0005547 | |||
| 2240 | Ga0500573_0052004 | |||
| 2241 | Ga0500604_0015719 | |||
| 2242 | Ga0500604_0023625 | |||
| 2243 | Ga0500616_0000417 | |||
| 2244 | Ga0500616_0003179 | |||
| 2245 | Ga0500616_0008458 | |||
| 2246 | Ga0500616_0050895 | |||
| 2247 | Ga0500620_000455 | |||
| 2248 | Ga0500620_025179 | |||
| 2249 | Ga0500622_0002220 | |||
| 2250 | Ga0500622_0002307 | |||
| 2251 | Ga0500624_000439 | |||
| 2252 | Ga0500634_0105582 | |||
| 2253 | Ga0500636_0000065 | |||
| 2254 | Ga0500636_0007738 | |||
| 2255 | Ga0500645_004747 | |||
| 2256 | Ga0587090_002011 | |||
| 2257 | Ga0501082_0001446 | |||
| 2258 | Ga0530510_0041490 | |||
| 2259 | Ga0530510_0117563 | |||
| 2260 | 2503202580 | |||
| 2261 | 2509107866 | |||
| 2262 | 2509114387 | |||
| 2263 | 2509373176 | |||
| 2264 | 2509376263 | |||
| 2265 | 2509387053 | |||
| 2266 | 2509397094 | |||
| 2267 | 2509442549 | |||
| 2268 | 2510132910 | |||
| 2269 | 2510307048 | |||
| 2270 | 2510317137 | |||
| 2271 | 2510894282 | |||
| 2272 | 2510899307 | |||
| 2273 | 2511133714 | |||
| 2274 | 2511175907 | |||
| 2275 | 2511183665 | |||
| 2276 | 2511198275 | |||
| 2277 | 2511501367 | |||
| 2278 | 2512532786 | |||
| 2279 | 2512930643 | |||
| 2280 | 2512958390 | |||
| 2281 | 2512971882 | |||
| 2282 | 2513570003 | |||
| 2283 | 2513575258 | |||
| 2284 | 2513587778 | |||
| 2285 | 2513592683 | |||
| 2286 | 2513598983 | |||
| 2287 | 2513606284 | |||
| 2288 | 2513614329 | |||
| 2289 | 2513617802 | |||
| 2290 | 2513633054 | |||
| 2291 | 2513710225 | |||
| 2292 | 2513869377 | |||
| 2293 | 2513886247 | |||
| 2294 | 2513906302 | |||
| 2295 | 2513909796 | |||
| 2296 | 2513926565 | |||
| 2297 | 2513987423 | |||
| 2298 | 2514000276 | |||
| 2299 | 2514005433 | |||
| 2300 | 2514019905 | |||
| 2301 | 2514038355 | |||
| 2302 | 2515111862 | |||
| 2303 | 2515611495 | |||
| 2304 | 2515633647 | |||
| 2305 | 2515642190 | |||
| 2306 | 2515656245 | |||
| 2307 | 2515738956 | |||
| 2308 | 2516209241 | |||
| 2309 | 2516892645 | |||
| 2310 | 2517035580 | |||
| 2311 | 2517076039 | |||
| 2312 | 2517094779 | |||
| 2313 | 2517406406 | |||
| 2314 | 2517569460 | |||
| 2315 | 2520376175 | |||
| 2316 | 2523470300 | |||
| 2317 | 2524452873 | |||
| 2318 | 2524460395 | |||
| 2319 | 2530645162 | |||
| 2320 | 2535516179 | |||
| 2321 | 2537874643 | |||
| 2322 | 2551682279 | |||
| 2323 | 2551684602 | |||
| 2324 | 2551693591 | |||
| 2325 | 2551703232 | |||
| 2326 | 2551708983 | |||
| 2327 | 2551719087 | |||
| 2328 | 2551730633 | |||
| 2329 | 2551736439 | |||
| 2330 | 2551740115 | |||
| 2331 | 2558863131 | |||
| 2332 | 2561466540 | |||
| 2333 | 2585168293 | |||
| 2334 | 2585199899 | |||
| 2335 | 2585225873 | |||
| 2336 | 2585268920 | |||
| 2337 | 2585270604 | |||
| 2338 | 2585276951 | |||
| 2339 | 2585324049 | |||
| 2340 | 2585333558 | |||
| 2341 | 2585389445 | |||
| 2342 | 2585393944 | |||
| 2343 | 2585400737 | |||
| 2344 | 2585528181 | |||
| 2345 | 2585534743 | |||
| 2346 | 2585540389 | |||
| 2347 | 2585546833 | |||
| 2348 | 2585551812 | |||
| 2349 | 2585558309 | |||
| 2350 | 2585819703 | |||
| 2351 | 2585838588 | |||
| 2352 | 2585845802 | |||
| 2353 | 2585897701 | |||
| 2354 | 2585904703 | |||
| 2355 | 2585995665 | |||
| 2356 | 2586000233 | |||
| 2357 | 2587980181 | |||
| 2358 | 2588516292 | |||
| 2359 | 2599333423 | |||
| 2360 | 2599418004 | |||
| 2361 | 2599602210 | |||
| 2362 | 2599721195 | |||
| 2363 | 2599939613 | |||
| 2364 | 2600192322 | |||
| 2365 | 2600374450 | |||
| 2366 | 2616292789 | |||
| 2367 | 2616308324 | |||
| 2368 | 2616556616 | |||
| 2369 | 2617381674 | |||
| 2370 | 2643772816 | |||
| 2371 | 2643775645 | |||
| 2372 | 2643794092 | |||
| 2373 | 2643808403 | |||
| 2374 | 2643811848 | |||
| 2375 | 2643855518 | |||
| 2376 | 2643919146 | |||
| 2377 | 2643987151 | |||
| 2378 | 2644000218 | |||
| 2379 | 2644005861 | |||
| 2380 | 2644049569 | |||
| 2381 | 2644066503 | |||
| 2382 | 2644109535 | |||
| 2383 | 2644132117 | |||
| 2384 | 2644145219 | |||
| 2385 | 2644155702 | |||
| 2386 | 2644204023 | |||
| 2387 | 2644207611 | |||
| 2388 | 2644300411 | |||
| 2389 | 2644307800 | |||
| 2390 | 2644332576 | |||
| 2391 | 2644378092 | |||
| 2392 | 2644415284 | |||
| 2393 | 2644450315 | |||
| 2394 | 2644482603 | |||
| 2395 | 2644494720 | |||
| 2396 | 2644499104 | |||
| 2397 | 2644544322 | |||
| 2398 | 2644613889 | |||
| 2399 | 2644654582 | |||
| 2400 | 2644658635 | |||
| 2401 | 2644677898 | |||
| 2402 | 2644687867 | |||
| 2403 | 2657683709 | |||
| 2404 | 2671115720 | |||
| 2405 | 2688599139 | |||
| 2406 | 2692316437 | |||
| 2407 | 2694631984 | |||
| 2408 | 2694634595 | |||
| 2409 | 2719180800 | |||
| 2410 | 2719385439 | |||
| 2411 | 2719665266 | |||
| 2412 | 2719731549 | |||
| 2413 | 2720491686 | |||
| 2414 | 2720612940 | |||
| 2415 | 2720619799 | |||
| 2416 | 2720631230 | |||
| 2417 | 2720774957 | |||
| 2418 | 2721146894 | |||
| 2419 | 2721158421 | |||
| 2420 | 2721163773 | |||
| 2421 | 2721399188 | |||
| 2422 | 2722839943 | |||
| 2423 | 2723026594 | |||
| 2424 | 2723560198 | |||
| 2425 | 2723566777 | |||
| 2426 | 2724038001 | |||
| 2427 | 2724044305 | |||
| 2428 | 2724089564 | |||
| 2429 | 2724104042 | |||
| 2430 | 2724109858 | |||
| 2431 | 2725952354 | |||
| 2432 | 2730107530 | |||
| 2433 | 2730164037 | |||
| 2434 | 2730298053 | |||
| 2435 | 2738799237 | |||
| 2436 | 2738945516 | |||
| 2437 | 2739038314 | |||
| 2438 | 2739307930 | |||
| 2439 | 2739350337 | |||
| 2440 | 2756676985 | |||
| 2441 | 2766067891 | |||
| 2442 | 2776913336 | |||
| 2443 | 2778176461 | |||
| 2444 | 2792581201 | |||
| 2445 | 2792623209 | |||
| 2446 | 2792626973 | |||
| 2447 | 2792642491 | |||
| 2448 | 2793279470 | |||
| 2449 | 2793299210 | |||
| 2450 | 2793313847 | |||
| 2451 | 2793321223 | |||
| 2452 | 2793326362 | |||
| 2453 | 2793336947 | |||
| 2454 | 2793344838 | |||
| 2455 | 2793347742 | |||
| 2456 | 2793352296 | |||
| 2457 | 2793360358 | |||
| 2458 | 2793366434 | |||
| 2459 | 2802718878 | |||
| 2460 | 2802726489 | |||
| 2461 | 2802733781 | |||
| 2462 | 2802738387 | |||
| 2463 | 2802744719 | |||
| 2464 | 2802751075 | |||
| 2465 | 2804751854 | |||
| 2466 | 2805927623 | |||
| 2467 | 2805936099 | |||
| 2468 | 2806045510 | |||
| 2469 | 2806051685 | |||
| 2470 | 2806061729 | |||
| 2471 | 2806067910 | |||
| 2472 | 2806072738 | |||
| 2473 | 2819241971 | |||
| 2474 | 2819559991 | |||
| 2475 | 2819610425 | |||
| 2476 | 2819638160 | |||
| 2477 | 2819687401 | |||
| 2478 | 2821127714 | |||
| 2479 | 2828309734 | |||
| 2480 | 2837653802 | |||
| 2481 | 2837679465 | |||
| 2482 | 2837682943 | |||
| 2483 | 2838018794 | |||
| 2484 | 2838025500 | |||
| 2485 | 2838034617 | |||
| 2486 | 2838040942 | |||
| 2487 | 2838043101 | |||
| 2488 | 2838052134 | |||
| 2489 | 2838067255 | |||
| 2490 | 2838071361 | |||
| 2491 | 2838079320 | |||
| 2492 | 2838666212 | |||
| 2493 | 2838670065 | |||
| 2494 | 2838676409 | |||
| 2495 | 2838689112 | |||
| 2496 | 2838697164 | |||
| 2497 | 2838702437 | |||
| 2498 | 2838715292 | |||
| 2499 | 2838720908 | |||
| 2500 | 2838726050 | |||
| 2501 | 2838730447 | |||
| 2502 | 2838738137 | |||
| 2503 | 2838743388 | |||
| 2504 | 2841841494 | |||
| 2505 | 2841847837 | |||
| 2506 | 2841854925 | |||
| 2507 | 2841859625 | |||
| 2508 | 2841864923 | |||
| 2509 | 2842077769 | |||
| 2510 | 2842110902 | |||
| 2511 | 2842119722 | |||
| 2512 | 2842126133 | |||
| 2513 | 2842131303 | |||
| 2514 | 2842141272 | |||
| 2515 | 2842147018 | |||
| 2516 | 2842153527 | |||
| 2517 | 2842157787 | |||
| 2518 | 2842165000 | |||
| 2519 | 2842171535 | |||
| 2520 | 2842177147 | |||
| 2521 | 2842180629 | |||
| 2522 | 2842188400 | |||
| 2523 | 2842197013 | |||
| 2524 | 2842201069 | |||
| 2525 | 2842206416 | |||
| 2526 | 2842212711 | |||
| 2527 | 2842220607 | |||
| 2528 | 2842225670 | |||
| 2529 | 2842231320 | |||
| 2530 | 2842244566 | |||
| 2531 | 2842252083 | |||
| 2532 | 2842258379 | |||
| 2533 | 2842267532 | |||
| 2534 | 2842273132 | |||
| 2535 | 2842279873 | |||
| 2536 | 2842287506 | |||
| 2537 | 2842291431 | |||
| 2538 | 2842301852 | |||
| 2539 | 2842309385 | |||
| 2540 | 2842315418 | |||
| 2541 | 2842318264 | |||
| 2542 | 2842347161 | |||
| 2543 | 2842362350 | |||
| 2544 | 2842366749 | |||
| 2545 | 2842373160 | |||
| 2546 | 2842377827 | |||
| 2547 | 2842386232 | |||
| 2548 | 2842397286 | |||
| 2549 | 2842404965 | |||
| 2550 | 2842411547 | |||
| 2551 | 2842418002 | |||
| 2552 | 2842424982 | |||
| 2553 | 2842431890 | |||
| 2554 | 2842438003 | |||
| 2555 | 2842444817 | |||
| 2556 | 2842451733 | |||
| 2557 | 2842465806 | |||
| 2558 | 2842472620 | |||
| 2559 | 2842481364 | |||
| 2560 | 2842487148 | |||
| 2561 | 2842492755 | |||
| 2562 | 2842496535 | |||
| 2563 | 2842508264 | |||
| 2564 | 2842516410 | |||
| 2565 | 2842525945 | |||
| 2566 | 2842695565 | |||
| 2567 | 2842925169 | |||
| 2568 | 2844006713 | |||
| 2569 | 2844014318 | |||
| 2570 | 2844170412 | |||
| 2571 | 2844459534 | |||
| 2572 | 2847418496 | |||
| 2573 | 2847670862 | |||
| 2574 | 2847686996 | |||
| 2575 | 2848993473 | |||
| 2576 | 2850080797 | |||
| 2577 | 2852389605 | |||
| 2578 | 2854899082 | |||
| 2579 | 2854916970 | |||
| 2580 | 2855825458 | |||
| 2581 | 2855840835 | |||
| 2582 | 2855873342 | |||
| 2583 | 2856316319 | |||
| 2584 | 2856323621 | |||
| 2585 | 2856329088 | |||
| 2586 | 2856335899 | |||
| 2587 | 2856353283 | |||
| 2588 | 2856369070 | |||
| 2589 | 2857355662 | |||
| 2590 | 2857373750 | |||
| 2591 | 2857523704 | |||
| 2592 | 2857534623 | |||
| 2593 | 2858801380 | |||
| 2594 | 2869175655 | |||
| 2595 | 2869241456 | |||
| 2596 | 2869245802 | |||
| 2597 | 2869251100 | |||
| 2598 | 2869266794 | |||
| 2599 | 2869275703 | |||
| 2600 | 2869278883 | |||
| 2601 | 2869291588 | |||
| 2602 | 2871433888 | |||
| 2603 | 2871440971 | |||
| 2604 | 2871456114 | |||
| 2605 | 2871462055 | |||
| 2606 | 2871485119 | |||
| 2607 | 2874107932 | |||
| 2608 | 2874119861 | |||
| 2609 | 2874125779 | |||
| 2610 | 2874136061 | |||
| 2611 | 2874145475 | |||
| 2612 | 2874153447 | |||
| 2613 | 2874160711 | |||
| 2614 | 2874167882 | |||
| 2615 | 2876368010 | |||
| 2616 | 2876374000 | |||
| 2617 | 2876385409 | |||
| 2618 | 2876387860 | |||
| 2619 | 2876395185 | |||
| 2620 | 2876403324 | |||
| 2621 | 2876412278 | |||
| 2622 | 2876419737 | |||
| 2623 | 2876422663 | |||
| 2624 | 2878041642 | |||
| 2625 | 2878731552 | |||
| 2626 | 2878743778 | |||
| 2627 | 2878751500 | |||
| 2628 | 2878778506 | |||
| 2629 | 2878787073 | |||
| 2630 | 2881152633 | |||
| 2631 | 2881156192 | |||
| 2632 | 2881168553 | |||
| 2633 | 2881860816 | |||
| 2634 | 2882633141 | |||
| 2635 | 2885310601 | |||
| 2636 | 2885317364 | |||
| 2637 | 2885334053 | |||
| 2638 | 2885339891 | |||
| 2639 | 2885346062 | |||
| 2640 | 2885356795 | |||
| 2641 | 2889011865 | |||
| 2642 | 2889023206 | |||
| 2643 | 2891375567 | |||
| 2644 | 2896386986 | |||
| 2645 | 2899796382 | |||
| 2646 | 2899808938 | |||
| 2647 | 2903449771 | |||
| 2648 | 2903505492 | |||
| 2649 | 2903527006 | |||
| 2650 | 2903533233 | |||
| 2651 | 2904661816 | |||
| 2652 | 2906313398 | |||
| 2653 | 2906326107 | |||
| 2654 | 2906328431 | |||
| 2655 | 2906357557 | |||
| 2656 | 2906376910 | |||
| 2657 | 2906382533 | |||
| 2658 | 2906392870 | |||
| 2659 | 2906397996 | |||
| 2660 | 2906402766 | |||
| 2661 | 2906414370 | |||
| 2662 | 2906416456 | |||
| 2663 | 2913300409 | |||
| 2664 | 2913310222 | |||
| 2665 | 2915651817 | |||
| 2666 | 2915985201 | |||
| 2667 | 2915987807 | |||
| 2668 | 2915997479 | |||
| 2669 | 2916003914 | |||
| 2670 | 2916014449 | |||
| 2671 | 2916015346 | |||
| 2672 | 2916028373 | |||
| 2673 | 2916034853 | |||
| 2674 | 2916041168 | |||
| 2675 | 2916046296 | |||
| 2676 | 2916051076 | |||
| 2677 | 2916060614 | |||
| 2678 | 2916067392 | |||
| 2679 | 2916070780 | |||
| 2680 | 2916078612 | |||
| 2681 | 2917555526 | |||
| 2682 | 2919107799 | |||
| 2683 | 2919115385 | |||
| 2684 | 2919167721 | |||
| 2685 | 2919175328 | |||
| 2686 | 2919409774 | |||
| 2687 | 2920765571 | |||
| 2688 | 2920824208 | |||
| 2689 | 2921207792 | |||
| 2690 | 2921210220 | |||
| 2691 | 2921243784 | |||
| 2692 | 2921250332 | |||
| 2693 | 2921253042 | |||
| 2694 | 2921260466 | |||
| 2695 | 2921270423 | |||
| 2696 | 2921289132 | |||
| 2697 | 2921293500 | |||
| 2698 | 2921304693 | |||
| 2699 | 2922153783 | |||
| 2700 | 2922165485 | |||
| 2701 | 2922172416 | |||
| 2702 | 2922193182 | |||
| 2703 | 2923558141 | |||
| 2704 | 2924147587 | |||
| 2705 | 2924156407 | |||
| 2706 | 2924165141 | |||
| 2707 | 2924172834 | |||
| 2708 | 2924179343 | |||
| 2709 | 2924183014 | |||
| 2710 | 2924192768 | |||
| 2711 | 2924197849 | |||
| 2712 | 2924206433 | |||
| 2713 | 2924211544 | |||
| 2714 | 2924215551 | |||
| 2715 | 2924223354 | |||
| 2716 | 2924234673 | |||
| 2717 | 2924724939 | |||
| 2718 | 2924726775 | |||
| 2719 | 2924734645 | |||
| 2720 | 2924745663 | |||
| 2721 | 2924749306 | |||
| 2722 | 2924763906 | |||
| 2723 | 2924781591 | |||
| 2724 | 2926756435 | |||
| 2725 | 2929140609 | |||
| 2726 | 2933008171 | |||
| 2727 | 2933012950 | |||
| 2728 | 2933575842 | |||
| 2729 | 2933586927 | |||
| 2730 | 2933602160 | |||
| 2731 | 2935904835 | |||
| 2732 | 2936373131 | |||
| 2733 | 2936381276 | |||
| 2734 | 2936384548 | |||
| 2735 | 2936997725 | |||
| 2736 | 2937007263 | |||
| 2737 | 2937012432 | |||
| 2738 | 2937022582 | |||
| 2739 | 2937029207 | |||
| 2740 | 2937031176 | |||
| 2741 | 2937040878 | |||
| 2742 | 2937049689 | |||
| 2743 | 2937050085 | |||
| 2744 | 2937059644 | |||
| 2745 | 2937071207 | |||
| 2746 | 2937075653 | |||
| 2747 | 2937079970 | |||
| 2748 | 2937086615 | |||
| 2749 | 2937092275 | |||
| 2750 | 2937105865 | |||
| 2751 | 2937113125 | |||
| 2752 | 2937117273 | |||
| 2753 | 2937125322 | |||
| 2754 | 2937130388 | |||
| 2755 | 2937820452 | |||
| 2756 | 2937827015 | |||
| 2757 | 2937877058 | |||
| 2758 | 2937879244 | |||
| 2759 | 2937895067 | |||
| 2760 | 2937975023 | |||
| 2761 | 2937987121 | |||
| 2762 | 2938016194 | |||
| 2763 | 2939670875 | |||
| 2764 | 2941499834 | |||
| 2765 | 2957380848 | |||
| 2766 | 2957388045 | |||
| 2767 | 2957394237 | |||
| 2768 | 2957399335 | |||
| 2769 | 2957407900 | |||
| 2770 | 2957412570 | |||
| 2771 | 2957416076 | |||
| 2772 | 2957422947 | |||
| 2773 | 2957436773 | |||
| 2774 | 2957439173 | |||
| 2775 | 2957450059 | |||
| 2776 | 2957456754 | |||
| 2777 | 2957464632 | |||
| 2778 | 2957470652 | |||
| 2779 | 2957472321 | |||
| 2780 | 2957483509 | |||
| 2781 | 2957491516 | |||
| 2782 | 2957494963 | |||
| 2783 | 2957505071 | |||
| 2784 | 2957505858 | |||
| 2785 | 2958034998 | |||
| 2786 | 2958042872 | |||
| 2787 | 2958067198 | |||
| 2788 | 2958086419 | |||
| 2789 | 2958103293 | |||
| 2790 | 2958111326 | |||
| 2791 | 2958122566 | |||
| 2792 | 2958123327 | |||
| 2793 | 2958135989 | |||
| 2794 | 2958139657 | |||
| 2795 | 2958162786 | |||
| 2796 | 2958174763 | |||
| 2797 | 2958185455 | |||
| 2798 | 2960590904 | |||
| 2799 | 2960596136 | |||
| 2800 | 2960602836 | |||
| 2801 | 2960607246 | |||
| 2802 | 2960614981 | |||
| 2803 | 2960623209 | |||
| 2804 | 2960626148 | |||
| 2805 | 2960634634 | |||
| 2806 | 2960639212 | |||
| 2807 | 2960652682 | |||
| 2808 | 2960666733 | |||
| 2809 | 2960673335 | |||
| 2810 | 2960680454 | |||
| 2811 | 2960686832 | |||
| 2812 | 2960693817 | |||
| 2813 | 2960699783 | |||
| 2814 | 2961083723 | |||
| 2815 | 2961116969 | |||
| 2816 | 2961131861 | |||
| 2817 | 2961143269 | |||
| 2818 | 2961187963 | |||
| 2819 | 2963648583 | |||
| 2820 | 2964611139 | |||
| 2821 | 2964620759 | |||
| 2822 | 2964628854 | |||
| 2823 | 2964635924 | |||
| 2824 | 2964637900 | |||
| 2825 | 2964649144 | |||
| 2826 | 2964655808 | |||
| 2827 | 2964660213 | |||
| 2828 | 2964666185 | |||
| 2829 | 2964678088 | |||
| 2830 | 2964679323 | |||
| 2831 | 2964685372 | |||
| 2832 | 2964698660 | |||
| 2833 | 2964702081 | |||
| 2834 | 2964709236 | |||
| 2835 | 2964713771 | |||
| 2836 | 2964719622 | |||
| 2837 | 2965029242 | |||
| 2838 | 2965036374 | |||
| 2839 | 2965045730 | |||
| 2840 | 2965052021 | |||
| 2841 | 2965066304 | |||
| 2842 | 2965093561 | |||
| 2843 | 2965111352 | |||
| 2844 | 2965121030 | |||
| 2845 | 2967668635 | |||
| 2846 | 2967674557 | |||
| 2847 | 2967685642 | |||
| 2848 | 2967688758 | |||
| 2849 | 2967699141 | |||
| 2850 | 2967699998 | |||
| 2851 | 2967714348 | |||
| 2852 | 2967720573 | |||
| 2853 | 2967728166 | |||
| 2854 | 2967734273 | |||
| 2855 | 2967741289 | |||
| 2856 | 2967753381 | |||
| 2857 | 2967758003 | |||
| 2858 | 2967769178 | |||
| 2859 | 2967775278 | |||
| 2860 | 2967782808 | |||
| 2861 | 2968017538 | |||
| 2862 | 2968083811 | |||
| 2863 | 2968092434 | |||
| 2864 | 2968100504 | |||
| 2865 | 2968112877 | |||
| 2866 | 2968122891 | |||
| 2867 | 2968128836 | |||
| 2868 | 2968143228 | |||
| 2869 | 2970026393 | |||
| 2870 | 2970032689 | |||
| 2871 | 2970038229 | |||
| 2872 | 2970041715 | |||
| 2873 | 2970054893 | |||
| 2874 | 2970060857 | |||
| 2875 | 2970061919 | |||
| 2876 | 2970075925 | |||
| 2877 | 2970081099 | |||
| 2878 | 2970084816 | |||
| 2879 | 2970095255 | |||
| 2880 | 2970099396 | |||
| 2881 | 2970103658 | |||
| 2882 | 2970112182 | |||
| 2883 | 2970121827 | |||
| 2884 | 2970127053 | |||
| 2885 | 2970135106 | |||
| 2886 | 2970136596 | |||
| 2887 | 2970145546 | |||
| 2888 | 2970155269 | |||
| 2889 | 2970158385 | |||
| 2890 | 2970168124 | |||
| 2891 | 2970174827 | |||
| 2892 | 2970181732 | |||
| 2893 | 2970187945 | |||
| 2894 | 2970193539 | |||
| 2895 | 2970472286 | |||
| 2896 | 2970489789 | |||
| 2897 | 2970517946 | |||
| 2898 | 2970538617 | |||
| 2899 | 2970551932 | |||
| 2900 | 2970593478 | |||
| 2901 | 2970623570 | |||
| 2902 | 2970632255 | |||
| 2903 | 2977520720 | |||
| 2904 | 2977524401 | |||
| 2905 | 2977533833 | |||
| 2906 | 2977542214 | |||
| 2907 | 2977547234 | |||
| 2908 | 2977557408 | |||
| 2909 | 2977565875 | |||
| 2910 | 2977571966 | |||
| 2911 | 2977579124 | |||
| 2912 | 2977585329 | |||
| 2913 | 2977848752 | |||
| 2914 | 2977860986 | |||
| 2915 | 2977872035 | |||
| 2916 | 2977879624 | |||
| 2917 | 2977906562 | |||
| 2918 | 2977911461 | |||
| 2919 | 2977918666 | |||
| 2920 | 2977937525 | |||
| 2921 | 2977946127 | |||
| 2922 | 2977954012 | |||
| 2923 | 2977958592 | |||
| 2924 | 2977976383 | |||
| 2925 | 2978974176 | |||
| 2926 | 2979106075 | |||
| 2927 | 2979713993 | |||
| 2928 | 2979775257 | |||
| 2929 | 2979779950 | |||
| 2930 | 2984512136 | |||
| 2931 | 2984521503 | |||
| 2932 | 2984540797 | |||
| 2933 | 2984589504 | |||
| 2934 | 2984603064 | |||
| 2935 | 2987640796 | |||
| 2936 | 2987645728 | |||
| 2937 | 2987656479 | |||
| 2938 | 2987670374 | |||
| 2939 | 2987680961 | |||
| 2940 | 2989352916 | |||
| 2941 | 2989773707 | |||
| 2942 | 2989778755 | |||
| 2943 | 2996341813 | |||
| 2944 | 2996348852 | |||
| 2945 | 2996351157 | |||
| 2946 | 2996388322 | |||
| 2947 | 2996892439 | |||
| 2948 | 2996898451 | |||
| 2949 | 3000136251 | |||
| 2950 | 3003933386 | |||
| 2951 | 3004170109 | |||
| 2952 | 3004202782 | |||
| 2953 | 3004208993 | |||
| 2954 | 3004238452 | |||
| 2955 | 3004246039 | |||
| 2956 | 3004254527 | |||
| 2957 | 3004269797 | |||
| 2958 | 3004277855 | |||
| 2959 | 3004291749 | |||
| 2960 | 3004340332 | |||
| 2961 | 3005409646 | |||
| 2962 | 3005420363 | |||
| 2963 | 3005447248 | |||
| 2964 | 3005453957 | |||
| 2965 | 637073634 | |||
| 2966 | 639648140 | |||
| 2967 | 643825501 | |||
| 2968 | 648740132 | |||
| 2969 | 649873570 | |||
| 2970 | 8001848689 | |||
| 2971 | 8002286145 | |||
| 2972 | 8003570898 | |||
| 2973 | 8003993333 | |||
| 2974 | 8004000589 | |||
| 2975 | 8004306595 | |||
| 2976 | 8004313773 | |||
| 2977 | 8004364202 | |||
| 2978 | 8004393856 | |||
| 2979 | 8004450054 | |||
| 2980 | 8004643190 | |||
| 2981 | 8004714526 | |||
| 2982 | 8004719652 | |||
| 2983 | 8005248307 | |||
| 2984 | 8005259721 | |||
| 2985 | 8005280210 | |||
| 2986 | 8005288277 | |||
| 2987 | 8005294803 | |||
| 2988 | 8005307038 | |||
| 2989 | 8005314553 | |||
| 2990 | 8005317314 | |||
| 2991 | 8005326966 | |||
| 2992 | 8005378789 | |||
| 2993 | 8005388011 | |||
| 2994 | 8005397034 | |||
| 2995 | 8005433241 | |||
| 2996 | 8005462522 | |||
| 2997 | 8005486622 | |||
| 2998 | 8005499900 | |||
| 2999 | 8005544877 | |||
| 3000 | 8005558109 | |||
| 3001 | 8005569287 | |||
| 3002 | 8005575436 | |||
| 3003 | 8005621267 | |||
| 3004 | 8005631433 | |||
| 3005 | 8005646236 | |||
| 3006 | 8005659423 | |||
| 3007 | 8005671318 | |||
| 3008 | 8005686370 | |||
| 3009 | 8005694952 | |||
| 3010 | 8005696152 | |||
| 3011 | 8018129562 | |||
| 3012 | 8018155608 | |||
| 3013 | 8018168103 | |||
| 3014 | 8018177899 | |||
| 3015 | 8023680977 | |||
| 3016 | 8024485753 | |||
| 3017 | 8024492570 | |||
| 3018 | 8024505219 | |||
| 3019 | 8046770330 | |||
| 3020 | 8049294388 | |||
| 3021 | 8055435053 | |||
| 3022 | 8056380146 | |||
| 3023 | 8056387549 | |||
| 3024 | 8056876763 | |||
| 3025 | 8057578260 | |||
| 3026 | 8057875492 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3a0w-assembly2.cif.gz_B | catalytic domain of histidine kinase thka (tm1359) for mad phasing (nucleotide free form 2, orthorombic) | 0.8771 | 208 | 365 |
| 3a0y-assembly1.cif.gz_A | catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 3: 1,2-propanediol, orthorombic) | 0.8753 | 208 | 365 |
| 6blk-assembly3.cif.gz_A | mycobacterial sensor histidine kinase mprb | 0.874 | 208 | 365 |
| 3a0z-assembly1.cif.gz_A | catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 4: isopropanol, orthorombic) | 0.8739 | 208 | 365 |
| 8dx0-assembly2.cif.gz_B | vansc ca domain | 0.873 | 209 | 366 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q06067_453_606_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.9267 | 208 | 365 | 3.30.565.10 |
| af_P0AFB5_191_349_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.9254 | 205 | 366 | 3.30.565.10 |
| af_P14377_310_462_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.9105 | 208 | 366 | 3.30.565.10 |
| af_P0AFB5_191_349_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.9088 | 205 | 366 | 3.30.565.10 |
| 4q20B02 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.9023 | 206 | 365 | 3.30.565.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C3C2B2-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9547 | 258 | 368 |
GO:0000155
GO:0005524 |
| AF-A0A355T5V6-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9535 | 129 | 366 |
GO:0000155
GO:0005737 GO:0009399 GO:0016787 |
| AF-A0A843CHX9-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9503 | 300 | 367 |
GO:0000155
GO:0005524 GO:0005886 GO:0009927 |
| AF-A0A6I1F7R3-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9378 | 231 | 365 |
GO:0000160
GO:0005524 GO:0016301 |
| AF-A0A366JHS1-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9292 | 231 | 365 |
GO:0000160
GO:0005524 GO:0016301 |