F494487

General Info

Members Datasets Scaffolds Average Seq Length
1513 1110 3026 378

Family's Representative Sequence

Representative Sequence 3300053103|Ga0500555_003659|Ga0500555_003659_2610_3761
Length 383
Sequence MMETATKALTSVPPLRAIFDALPNPILVIDENDIICFANSEAEDFFQVSSTVLARHRLEETMPFSSPVLEVVKQVRKSAGVMNEYSVGVGTPRMGGERIVDLQTALVNDDPRFVVLTFLRRSMAQKFDLQLTHRGAARSVSGMAAMLAHEIKNPLSGIRGAAQLLEPVLENNDRALAKLICEETDRIRDLVDQMEVFSDERPLERKPINIHVVLDRVKQLTAAGLPNSFNIREEYDPSLPSVLGNQDQLVQVFLNLAKNAAESIVTSGVAGEITLTTAFRPGVKLSVPGSNERVSLPFEVCVHDNGPGISEDLRPHIFDAFVTTKPQGRGLGLALVAKIVRDHGGVVECIPRERGTTFRVLLPMLRQHNEDSEIRKKVMTGER

Samples

Sample ID Description Type Environment
1 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
93 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
106 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
107 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
110 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
111 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
112 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
115 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
172 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
183 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
184 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
187 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
188 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
189 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
194 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
201 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
214 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
215 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
216 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
217 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
218 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
219 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
220 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
221 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
222 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
229 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
230 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
231 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
232 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
238 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
242 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
243 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
271 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
272 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
273 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
274 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
275 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
276 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
277 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
278 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
279 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
280 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
281 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
303 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
304 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
310 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
317 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
320 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
323 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
324 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
325 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
326 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
327 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
328 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
329 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
330 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
331 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
332 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
333 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
334 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
335 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
338 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
339 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
340 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
341 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
342 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
343 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
345 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
346 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
347 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
348 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
349 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
350 2509276019 Ensifer aridi TW10 Isolate Nodule
351 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
352 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
353 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
354 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
355 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
356 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
357 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
358 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
359 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
360 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
361 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
362 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
363 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
364 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
365 2512875024
366 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
367 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
368 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
369 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
370 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
371 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
372 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
373 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
374 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
375 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
376 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
377 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
378 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
379 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
380 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
381 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
382 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
383 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
384 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
385 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
386 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
387 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
388 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
389 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
390 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
391 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
392 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
393 2516143018 Ensifer sp. BR816 Isolate Nodule
394 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
395 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
396 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
397 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
398 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
399 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
400 2519899620 Rhizobium sp. Pop5 Isolate Nodule
401 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
402 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
403 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
404 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
405 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
406 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
407 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
408 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
409 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
410 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
411 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
412 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
413 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
414 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
415 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
416 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
417 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
418 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
419 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
420 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
421 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
422 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
423 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
424 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
425 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
426 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
427 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
428 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
429 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
430 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
431 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
432 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
433 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
434 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
435 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
436 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
437 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
438 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
439 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
440 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
441 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
442 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
443 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
444 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
445 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
446 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
447 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
448 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
449 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
450 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
451 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
452 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
453 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
454 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
455 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
456 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
457 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
458 2643221557 Ensifer sp. Root558 Isolate Unclassified
459 2643221558 Rhizobium sp. Root149 Isolate Unclassified
460 2643221568 Rhizobium sp. Root564 Isolate Unclassified
461 2643221582 Rhizobium sp. Root651 Isolate Unclassified
462 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
463 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
464 2643221599 Rhizobium sp. Root708 Isolate Unclassified
465 2643221607 Rhizobium sp. Root73 Isolate Unclassified
466 2643221610 Ensifer sp. Root74 Isolate Unclassified
467 2643221618 Ensifer sp. Root231 Isolate Unclassified
468 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
469 2643221626 Ensifer sp. Root31 Isolate Unclassified
470 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
471 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
472 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
473 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
474 2643221655 Ensifer sp. Root1252 Isolate Unclassified
475 2643221659 Ensifer sp. Root127 Isolate Unclassified
476 2643221668 Ensifer sp. Root423 Isolate Unclassified
477 2643221675 Ensifer sp. Root1298 Isolate Unclassified
478 2643221680 Ensifer sp. Root1312 Isolate Unclassified
479 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
480 2643221688 Rhizobium sp. Root482 Isolate Unclassified
481 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
482 2643221698 Ensifer sp. Root142 Isolate Unclassified
483 2643221712 Ensifer sp. Root258 Isolate Unclassified
484 2643221718 Rhizobium sp. Root268 Isolate Unclassified
485 2643221719 Rhizobium sp. Root274 Isolate Unclassified
486 2643221723 Ensifer sp. Root278 Isolate Unclassified
487 2643221726 Ensifer sp. Root954 Isolate Unclassified
488 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
489 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
490 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
491 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
492 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
493 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
494 2718217882 Rhizobium sp. N741 Isolate Nodule
495 2718217927 Rhizobium sp. N324 Isolate Nodule
496 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
497 2718218009 Rhizobium sp. N561 Isolate Nodule
498 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
499 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
500 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
501 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
502 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
503 2718218363 Rhizobium sp. N113 Isolate Nodule
504 2718218365 Rhizobium sp. N731 Isolate Nodule
505 2718218366 Rhizobium sp. N621 Isolate Nodule
506 2718218423 Rhizobium sp. N941 Isolate Nodule
507 2721755514 Rhizobium sp. N6212 Isolate Nodule
508 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
509 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
510 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
511 2721755809 Rhizobium sp. N541 Isolate Nodule
512 2721755810 Rhizobium sp. N871 Isolate Nodule
513 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
514 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
515 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
516 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
517 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
518 2728369365 Rhizobium sp. N1341 Isolate Nodule
519 2728369397 Rhizobium sp. N1314 Isolate Nodule
520 2738541293 Rhizobium sp. GV031 Isolate Unclassified
521 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
522 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
523 2738543024 Aminobacter sp. AP02 Isolate Unclassified
524 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
525 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
526 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
527 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
528 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
529 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
530 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
531 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
532 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
533 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
534 2791355256 Rhizobium sp. M10 Isolate Nodule
535 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
536 2791355260 Rhizobium sp. L9 Isolate Nodule
537 2791355261 Rhizobium sp. J15 Isolate Nodule
538 2791355262 Rhizobium sp. M1 Isolate Nodule
539 2791355263 Rhizobium chutanense C5 Isolate Nodule
540 2791355264 Rhizobium sp. S9 Isolate Nodule
541 2791355265 Rhizobium sp. H4 Isolate Nodule
542 2791355266 Rhizobium sp. L43 Isolate Nodule
543 2791355267 Rhizobium sp. L18 Isolate Nodule
544 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
545 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
546 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
547 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
548 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
549 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
550 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
551 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
552 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
553 2802429633 Rhizobium anhuiense J3 Isolate Nodule
554 2802429634 Rhizobium anhuiense S10 Isolate Nodule
555 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
556 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
557 2802429637 Rhizobium anhuiense C15 Isolate Nodule
558 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
559 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
560 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
561 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
562 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
563 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
564 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
565 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
566 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
567 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
568 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
569 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
570 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
571 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
572 2838048938 Rhizobium pisi 27/80 Isolate Nodule
573 2838061910 Rhizobium phaseoli L15 Isolate Nodule
574 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
575 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
576 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
577 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
578 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
579 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
580 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
581 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
582 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
583 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
584 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
585 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
586 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
587 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
588 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
589 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
590 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
591 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
592 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
593 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
594 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
595 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
596 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
597 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
598 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
599 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
600 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
601 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
602 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
603 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
604 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
605 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
606 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
607 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
608 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
609 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
610 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
611 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
612 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
613 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
614 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
615 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
616 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
617 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
618 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
619 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
620 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
621 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
622 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
623 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
624 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
625 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
626 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
627 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
628 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
629 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
630 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
631 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
632 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
633 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
634 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
635 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
636 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
637 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
638 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
639 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
640 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
641 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
642 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
643 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
644 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
645 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
646 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
647 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
648 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
649 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
650 2842694124 Methylopila sp. R-72369 Isolate Unclassified
651 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
652 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
653 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
654 2844163670 Ensifer sp. 1H6 Isolate Unclassified
655 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
656 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
657 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
658 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
659 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
660 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
661 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
662 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
663 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
664 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
665 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
666 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
667 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
668 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
669 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
670 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
671 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
672 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
673 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
674 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
675 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
676 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
677 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
678 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
679 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
680 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
681 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
682 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
683 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
684 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
685 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
686 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
687 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
688 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
689 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
690 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
691 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
692 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
693 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
694 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
695 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
696 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
697 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
698 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
699 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
700 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
701 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
702 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
703 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
704 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
705 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
706 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
707 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
708 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
709 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
710 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
711 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
712 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
713 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
714 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
715 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
716 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
717 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
718 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
719 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
720 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
721 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
722 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
723 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
724 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
725 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
726 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
727 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
728 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
729 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
730 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
731 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
732 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
733 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
734 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
735 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
736 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
737 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
738 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
739 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
740 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
741 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
742 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
743 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
744 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
745 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
746 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
747 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
748 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
749 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
750 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
751 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
752 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
753 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
754 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
755 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
756 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
757 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
758 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
759 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
760 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
761 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
762 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
763 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
764 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
765 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
766 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
767 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
768 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
769 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
770 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
771 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
772 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
773 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
774 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
775 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
776 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
777 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
778 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
779 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
780 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
781 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
782 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
783 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
784 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
785 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
786 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
787 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
788 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
789 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
790 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
791 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
792 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
793 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
794 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
795 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
796 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
797 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
798 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
799 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
800 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
801 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
802 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
803 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
804 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
805 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
806 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
807 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
808 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
809 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
810 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
811 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
812 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
813 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
814 2933599457 Rhizobium phaseoli M3 Isolate Nodule
815 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
816 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
817 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
818 2936381700 Rhizobium chutanense C16 Isolate Unclassified
819 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
820 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
821 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
822 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
823 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
824 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
825 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
826 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
827 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
828 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
829 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
830 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
831 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
832 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
833 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
834 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
835 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
836 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
837 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
838 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
839 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
840 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
841 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
842 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
843 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
844 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
845 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
846 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
847 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
848 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
849 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
850 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
851 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
852 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
853 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
854 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
855 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
856 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
857 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
858 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
859 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
860 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
861 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
862 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
863 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
864 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
865 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
866 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
867 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
868 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
869 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
870 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
871 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
872 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
873 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
874 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
875 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
876 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
877 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
878 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
879 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
880 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
881 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
882 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
883 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
884 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
885 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
886 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
887 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
888 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
889 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
890 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
891 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
892 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
893 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
894 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
895 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
896 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
897 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
898 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
899 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
900 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
901 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
902 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
903 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
904 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
905 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
906 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
907 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
908 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
909 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
910 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
911 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
912 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
913 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
914 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
915 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
916 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
917 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
918 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
919 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
920 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
921 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
922 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
923 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
924 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
925 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
926 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
927 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
928 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
929 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
930 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
931 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
932 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
933 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
934 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
935 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
936 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
937 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
938 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
939 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
940 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
941 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
942 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
943 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
944 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
945 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
946 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
947 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
948 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
949 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
950 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
951 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
952 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
953 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
954 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
955 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
956 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
957 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
958 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
959 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
960 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
961 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
962 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
963 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
964 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
965 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
966 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
967 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
968 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
969 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
970 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
971 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
972 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
973 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
974 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
975 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
976 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
977 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
978 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
979 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
980 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
981 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
982 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
983 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
984 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
985 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
986 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
987 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
988 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
989 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
990 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
991 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
992 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
993 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
994 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
995 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
996 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
997 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
998 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
999 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
1000 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
1001 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
1002 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
1003 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
1004 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
1005 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
1006 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
1007 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
1008 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
1009 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
1010 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
1011 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
1012 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
1013 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
1014 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
1015 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
1016 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
1017 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
1018 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
1019 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
1020 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
1021 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
1022 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
1023 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
1024 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
1025 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
1026 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
1027 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
1028 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
1029 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
1030 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
1031 2996887358 Rhizobium sp. R711 Isolate Nodule
1032 2996893221 Rhizobium sp. R635 Isolate Nodule
1033 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
1034 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
1035 3004167301 Mesorhizobium loti 582 Isolate Unclassified
1036 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
1037 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
1038 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
1039 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
1040 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
1041 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
1042 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
1043 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
1044 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
1045 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
1046 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
1047 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
1048 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
1049 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1050 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1051 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1052 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1053 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1054 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
1055 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1056 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1057 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1058 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1059 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1060 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1061 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1062 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1063 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1064 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1065 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1066 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1067 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1068 8005258706 Rhizobium sp. R693 Isolate Nodule
1069 8005275841 Rhizobium sp. N4311 Isolate Nodule
1070 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1071 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1072 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1073 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1074 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1075 8005321885 Rhizobium sp. R72 Isolate Nodule
1076 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1077 8005382845 Rhizobium sp. R634 Isolate Nodule
1078 8005395548 Rhizobium sp. R339 Isolate Nodule
1079 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1080 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1081 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1082 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1083 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1084 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1085 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1086 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1087 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1088 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1089 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1090 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1091 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1092 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1093 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1094 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1095 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1096 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1097 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1098 8018176218 Rhizobium sp. N122 Isolate Nodule
1099 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1100 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1101 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1102 8024501048 Rhizobium sp. H4 Isolate Nodule
1103 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1104 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1105 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1106 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1107 8056382006 Rhizobium croatiense 13T Isolate Nodule
1108 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1109 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1110 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 49.24
Metatranscriptomes 0.07
Isolates 50.69

Biome Distribution

Category Percentage (%)
Aerial Root 0.33
Bulb 0
Endosphere 14.08
Nodule 40.12
Rhizoplane 1.72
Rhizosphere 30.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500555_003659 3300053103 Bacteria 4376
2 JGI24740J21852_10000001 3300001979 Bacteria 168537
3 JGI25155J39150_1000011 3300002704 Bacteria 207685
4 JGI25156J39149_1000027 3300002705 Bacteria 127396
5 JGI25156J39149_1000030 3300002705 Bacteria 126029
6 JGI25156J39149_1011404 3300002705 Bacteria 2014
7 JGI25162J39368_1000351 3300002737 Bacteria 39572
8 JGI25162J39368_1001364 3300002737 Bacteria 13458
9 JGI25162J39368_1002538 3300002737 Bacteria 6971
10 JGI25154J39366_1000057 3300002738 Bacteria 110584
11 JGI25158J39367_1000245 3300002739 Bacteria 12465
12 JGI25158J39367_1009771 3300002739 Bacteria 1308
13 JGI25157J39369_1000010 3300002741 Bacteria 207685
14 JGI25157J39369_1000604 3300002741 Bacteria 20770
15 JGI25152J39213_1000288 3300002773 Bacteria 33211
16 JGI25152J39213_1000724 3300002773 Bacteria 16980
17 JGI25152J39213_1002131 3300002773 Bacteria 7762
18 JGI25152J39213_1003666 3300002773 Bacteria 5162
19 JGI25152J39213_1011614 3300002773 Bacteria 1939
20 JGI25150J39212_1000010 3300002774 Bacteria 236260
21 JGI25159J45721_1000006 3300002987 Bacteria 188201
22 JGI25159J45721_1000683 3300002987 Bacteria 14907
23 JGI25151J46595_10000026 3300003187 Bacteria 211045
24 JGI25151J46595_10000238 3300003187 Bacteria 64884
25 JGI25151J46595_10007967 3300003187 Bacteria 5137
26 JGI25151J46595_10038293 3300003187 Bacteria 1786
27 JGI25406J46586_10009023 3300003203 Bacteria 4482
28 JGI25406J46586_10027468 3300003203 Bacteria 2182
29 JGI25165J46597_1000033 3300003214 Bacteria 293030
30 JGI25165J46597_1000189 3300003214 Bacteria 91790
31 JGI25165J46597_1000777 3300003214 Bacteria 24294
32 JGI25153J46596_10003069 3300003215 Bacteria 9430
33 JGI25153J46596_10028474 3300003215 Bacteria 1936
34 JGI25153J46596_10028476 3300003215 Bacteria 1936
35 JGI25153J46596_10044121 3300003215 Bacteria 1343
36 rootL2_10135068 3300003322 Bacteria 3541
37 JGI25160J50197_1000004 3300003354 Bacteria 419797
38 JGI25160J50197_1000019 3300003354 Bacteria 233980
39 JGI25160J50197_1001596 3300003354 Bacteria 11167
40 JGI25161J50226_1000003 3300003374 Bacteria 413345
41 JGI25161J50226_1000330 3300003374 Bacteria 25735
42 JGI25161J50226_1001454 3300003374 Bacteria 7115
43 JGI25161J50226_1005034 3300003374 Bacteria 2649
44 Ga0055539_1004539 3300003752 Bacteria 1845
45 Ga0055526_1000382 3300003771 Bacteria 35903
46 Ga0055526_1000565 3300003771 Bacteria 29180
47 Ga0055526_1000669 3300003771 Bacteria 26309
48 Ga0055526_1004202 3300003771 Bacteria 8745
49 Ga0055524_1003035 3300003775 Bacteria 8307
50 Ga0055524_1004474 3300003775 Bacteria 6452
51 Ga0055524_1004820 3300003775 Bacteria 6149
52 Ga0055524_1007966 3300003775 Bacteria 4447
53 Ga0055524_1010914 3300003775 Bacteria 3582
54 Ga0055536_1000212 3300003781 Bacteria 47611
55 Ga0055536_1005870 3300003781 Bacteria 5891
56 Ga0055536_1012344 3300003781 Bacteria 3178
57 Ga0055528_1000918 3300003790 Bacteria 19824
58 Ga0055528_1003069 3300003790 Bacteria 8582
59 Ga0055528_1005988 3300003790 Bacteria 5570
60 Ga0055528_1006131 3300003790 Bacteria 5490
61 Ga0055528_1006493 3300003790 Bacteria 5300
62 Ga0055528_1006683 3300003790 Bacteria 5204
63 Ga0055528_1019407 3300003790 Bacteria 2254
64 Ga0055530_10000740 3300003791 Bacteria 27171
65 Ga0055530_10007317 3300003791 Bacteria 4680
66 Ga0055530_10016645 3300003791 Bacteria 2337
67 Ga0055540_1000285 3300003792 Bacteria 45310
68 Ga0055540_1001884 3300003792 Bacteria 11760
69 Ga0055540_1002932 3300003792 Bacteria 8600
70 Ga0055540_1014240 3300003792 Bacteria 2380
71 Ga0055531_10001165 3300003794 Bacteria 20245
72 Ga0055531_10004924 3300003794 Bacteria 7938
73 Ga0058692_1002385 3300003856 Bacteria 6306
74 Ga0055543_1000001 3300004625 Bacteria 419949
75 Ga0055543_1000019 3300004625 Bacteria 161035
76 Ga0055543_1000147 3300004625 Bacteria 58621
77 Ga0055543_1000808 3300004625 Bacteria 15443
78 Ga0065165_1000049 3300005262 Bacteria 195588
79 Ga0065165_1000180 3300005262 Bacteria 111768
80 Ga0065165_1000277 3300005262 Bacteria 87540
81 Ga0065165_1005991 3300005262 Bacteria 6559
82 Ga0070658_10065948 3300005327 Bacteria 2956
83 Ga0070658_10080578 3300005327 Bacteria 2674
84 Ga0070676_10034424 3300005328 Bacteria 2909
85 Ga0070670_100001443 3300005331 Bacteria 19089
86 Ga0070680_100085741 3300005336 Bacteria 2602
87 Ga0070660_100057146 3300005339 Bacteria 3021
88 Ga0070660_100095551 3300005339 Bacteria 2349
89 Ga0070689_100083799 3300005340 Bacteria 2505
90 Ga0070691_10000580 3300005341 Bacteria 14004
91 Ga0070668_100005749 3300005347 Bacteria 9200
92 Ga0070668_100016044 3300005347 Bacteria 5604
93 Ga0070668_100022821 3300005347 Bacteria 4731
94 Ga0070668_100088881 3300005347 Bacteria 2433
95 Ga0070671_100010443 3300005355 Bacteria 7449
96 Ga0070671_100030699 3300005355 Bacteria 4435
97 Ga0070671_100368037 3300005355 Bacteria 1227
98 Ga0070673_100038873 3300005364 Bacteria 3637
99 Ga0070688_100168247 3300005365 Bacteria 1511
100 Ga0070659_100000206 3300005366 Bacteria 45867
101 Ga0070659_100007044 3300005366 Bacteria 8143
102 Ga0070659_100221241 3300005366 Bacteria 1562
103 Ga0070667_100036538 3300005367 Bacteria 4118
104 Ga0070667_100043831 3300005367 Bacteria 3755
105 Ga0070711_100036164 3300005439 Bacteria 3308
106 Ga0070663_100171843 3300005455 Bacteria 1676
107 Ga0070681_10015949 3300005458 Bacteria 7492
108 Ga0070681_10091580 3300005458 Bacteria 2991
109 Ga0070707_100033261 3300005468 Bacteria 4916
110 Ga0070679_100077472 3300005530 Bacteria 3313
111 Ga0070684_100073150 3300005535 Bacteria 3020
112 Ga0068853_100374454 3300005539 Bacteria 1329
113 Ga0070696_100046383 3300005546 Bacteria 3013
114 Ga0070665_100000116 3300005548 Bacteria 150141
115 Ga0070665_100058585 3300005548 Bacteria 3861
116 Ga0070665_100118304 3300005548 Bacteria 2652
117 Ga0070665_100263157 3300005548 Bacteria 1726
118 Ga0068855_100024601 3300005563 Bacteria 7204
119 Ga0068855_100154427 3300005563 Bacteria 2608
120 Ga0068855_100155438 3300005563 Bacteria 2599
121 Ga0068855_100209386 3300005563 Bacteria 2192
122 Ga0070664_100093010 3300005564 Bacteria 2612
123 Ga0068857_100121917 3300005577 Bacteria 2348
124 Ga0068854_100034387 3300005578 Bacteria 3540
125 Ga0068854_100107903 3300005578 Bacteria 2096
126 Ga0068856_100042875 3300005614 Bacteria 4453
127 Ga0068852_100195717 3300005616 Bacteria 1910
128 Ga0068859_100008475 3300005617 Bacteria 10403
129 Ga0068859_100102241 3300005617 Bacteria 2923
130 Ga0068859_100421453 3300005617 Bacteria 1431
131 Ga0068864_100091486 3300005618 Bacteria 2684
132 Ga0068864_100097380 3300005618 Bacteria 2604
133 Ga0068864_100114133 3300005618 Bacteria 2409
134 Ga0068861_100184759 3300005719 Bacteria 1738
135 Ga0068863_100068534 3300005841 Bacteria 3356
136 Ga0068863_100090185 3300005841 Bacteria 2907
137 Ga0068860_100000145 3300005843 Bacteria 115830
138 Ga0068860_100005851 3300005843 Bacteria 12380
139 Ga0068862_100013415 3300005844 Bacteria 6780
140 Ga0068862_100015461 3300005844 Bacteria 6338
141 Ga0068862_100372155 3300005844 Bacteria 1330
142 Ga0081538_10002190 3300005981 Bacteria 19382
143 Ga0081540_1008246 3300005983 Bacteria 7299
144 Ga0081540_1012786 3300005983 Bacteria 5495
145 Ga0081539_10001354 3300005985 Bacteria 42654
146 Ga0070717_10131058 3300006028 Bacteria 2156
147 Ga0070717_10307172 3300006028 Bacteria 1411
148 Ga0075365_10005577 3300006038 Bacteria 6804
149 Ga0075365_10013397 3300006038 Bacteria 4901
150 Ga0075365_10016756 3300006038 Bacteria 4467
151 Ga0075365_10017898 3300006038 Bacteria 4348
152 Ga0075365_10145404 3300006038 Bacteria 1647
153 Ga0075363_100008477 3300006048 Bacteria 4789
154 Ga0075364_10031424 3300006051 Bacteria 3411
155 Ga0070712_100303606 3300006175 Bacteria 1293
156 Ga0075362_10004704 3300006177 Bacteria 4927
157 Ga0075362_10020925 3300006177 Bacteria 2738
158 Ga0075362_10059651 3300006177 Bacteria 1723
159 Ga0075367_10003238 3300006178 Bacteria 7700
160 Ga0075367_10041909 3300006178 Bacteria 2677
161 Ga0075369_10080883 3300006186 Bacteria 1441
162 Ga0075366_10001654 3300006195 Bacteria 11197
163 Ga0075366_10008896 3300006195 Bacteria 5594
164 Ga0075366_10137519 3300006195 Bacteria 1476
165 Ga0075428_100001218 3300006844 Bacteria 27549
166 Ga0075428_100129102 3300006844 Bacteria 2750
167 Ga0075430_100044128 3300006846 Bacteria 3770
168 Ga0075431_100000613 3300006847 Bacteria 30137
169 Ga0075431_100017312 3300006847 Bacteria 7324
170 Ga0075431_100018072 3300006847 Bacteria 7172
171 Ga0075431_100208114 3300006847 Bacteria 1999
172 Ga0075434_100011257 3300006871 Bacteria 8426
173 Ga0075429_100013425 3300006880 Bacteria 7103
174 Ga0068865_100001650 3300006881 Bacteria 13080
175 Ga0097620_100008475 3300006931 Bacteria 10403
176 Ga0097620_100102253 3300006931 Bacteria 2923
177 Ga0097620_100421511 3300006931 Bacteria 1431
178 Ga0079104_1000187 3300006946 Bacteria 86957
179 Ga0079104_1001924 3300006946 Bacteria 12460
180 Ga0105240_10000005 3300009093 Bacteria 702630
181 Ga0105240_10015964 3300009093 Bacteria 10180
182 Ga0105240_10027898 3300009093 Bacteria 7386
183 Ga0105240_10066214 3300009093 Bacteria 4483
184 Ga0105240_10544402 3300009093 Bacteria 1285
185 Ga0111539_10203844 3300009094 Bacteria 2306
186 Ga0111539_10375644 3300009094 Bacteria 1655
187 Ga0105247_10008257 3300009101 Bacteria 6354
188 Ga0114129_10004627 3300009147 Bacteria 19421
189 Ga0114129_10064420 3300009147 Bacteria 5115
190 Ga0105248_10000154 3300009177 Bacteria 80081
191 Ga0105237_10000708 3300009545 Bacteria 46177
192 Ga0105237_10025668 3300009545 Bacteria 6023
193 Ga0105237_10169520 3300009545 Bacteria 2183
194 Ga0105238_10017778 3300009551 Bacteria 7229
195 Ga0105238_10104877 3300009551 Bacteria 2808
196 Ga0105238_10174121 3300009551 Bacteria 2128
197 Ga0105238_10291902 3300009551 Bacteria 1613
198 Ga0105249_10002692 3300009553 Bacteria 15360
199 Ga0123341_1000001 3300009765 Bacteria 314908
200 Ga0123342_1008195 3300009766 Bacteria 13325
201 Ga0123342_1034638 3300009766 Bacteria 2210
202 Ga0105239_10000739 3300010375 Bacteria 46483
203 Ga0105239_10028635 3300010375 Bacteria 6125
204 Ga0105239_10130617 3300010375 Bacteria 2793
205 Ga0105239_10312229 3300010375 Bacteria 1772
206 Ga0105246_10280664 3300011119 Bacteria 1336
207 Ga0157371_10005765 3300013102 Bacteria 10378
208 Ga0157370_10000284 3300013104 Bacteria 64323
209 Ga0157370_10105632 3300013104 Bacteria 2635
210 Ga0157369_10182886 3300013105 Bacteria 2205
211 Ga0171463_1011 3300013249 Bacteria 230603
212 Ga0163163_10135021 3300014325 Bacteria 2508
213 Ga0163163_10197852 3300014325 Bacteria 2058
214 Ga0182008_10021177 3300014497 Bacteria 3341
215 Ga0157377_10008119 3300014745 Bacteria 5103
216 Ga0182006_1043239 3300015261 Bacteria 1761
217 Ga0182005_1006504 3300015265 Bacteria 3563
218 Ga0183363_1111 3300015690 Bacteria 22277
219 Ga0214542_1000015 3300021321 Bacteria 227912
220 Ga0214542_1019302 3300021321 Bacteria 5418
221 Ga0214543_1000011 3300021327 Bacteria 344093
222 Ga0214543_1000032 3300021327 Bacteria 200766
223 Ga0213876_10024578 3300021384 Bacteria 3181
224 Ga0213876_10041739 3300021384 Bacteria 2424
225 Ga0228711_1000012 3300022739 Bacteria 132594
226 Ga0228710_1000006 3300022740 Bacteria 209134
227 Ga0209435_100022 3300025206 Bacteria 207766
228 Ga0209436_100038 3300025208 Bacteria 76733
229 Ga0209436_100837 3300025208 Bacteria 12443
230 Ga0209437_100160 3300025233 Bacteria 149451
231 Ga0209437_100310 3300025233 Bacteria 65905
232 Ga0207425_1000010 3300025245 Bacteria 572898
233 Ga0207425_1001758 3300025245 Bacteria 8456
234 Ga0209646_1000078 3300025246 Bacteria 207766
235 Ga0209026_1000002 3300025250 Bacteria 1136158
236 Ga0209026_1000065 3300025250 Bacteria 207766
237 Ga0209026_1012621 3300025250 Bacteria 1466
238 Ga0209677_101256 3300025253 Bacteria 11408
239 Ga0209148_1000570 3300025254 Bacteria 34441
240 Ga0209759_1000055 3300025256 Bacteria 207766
241 Ga0209759_1000119 3300025256 Bacteria 141051
242 Ga0209129_1000099 3300025258 Bacteria 162471
243 Ga0209129_1000432 3300025258 Bacteria 31411
244 Ga0209129_1000442 3300025258 Bacteria 30980
245 Ga0209129_1001010 3300025258 Bacteria 16767
246 Ga0209129_1001971 3300025258 Bacteria 10704
247 Ga0209129_1002862 3300025258 Bacteria 7972
248 Ga0209233_1000027 3300025261 Bacteria 652089
249 Ga0209233_1000168 3300025261 Bacteria 149312
250 Ga0209233_1000269 3300025261 Bacteria 74071
251 Ga0209233_1000303 3300025261 Bacteria 59138
252 Ga0209455_1000204 3300025272 Bacteria 85420
253 Ga0209673_1000068 3300025273 Bacteria 245891
254 Ga0209673_1000139 3300025273 Bacteria 157765
255 Ga0209673_1001538 3300025273 Bacteria 20946
256 Ga0209673_1001716 3300025273 Bacteria 18528
257 Ga0209673_1002227 3300025273 Bacteria 14064
258 Ga0209673_1002802 3300025273 Bacteria 11286
259 Ga0209673_1005579 3300025273 Bacteria 6290
260 Ga0209673_1035943 3300025273 Bacteria 1477
261 Ga0209130_1000007 3300025284 Bacteria 591584
262 Ga0209130_1000012 3300025284 Bacteria 421329
263 Ga0209130_1000097 3300025284 Bacteria 143750
264 Ga0209676_1000399 3300025292 Bacteria 79312
265 Ga0209676_1006026 3300025292 Bacteria 6116
266 Ga0209025_1000022 3300025294 Bacteria 574487
267 Ga0209025_1000237 3300025294 Bacteria 128553
268 Ga0209025_1000358 3300025294 Bacteria 97655
269 Ga0209025_1000729 3300025294 Bacteria 55773
270 Ga0209025_1000923 3300025294 Bacteria 45012
271 Ga0209025_1000949 3300025294 Bacteria 43938
272 Ga0209025_1004865 3300025294 Bacteria 11329
273 Ga0209025_1014684 3300025294 Bacteria 4792
274 Ga0209025_1021924 3300025294 Bacteria 3413
275 Ga0209025_1024577 3300025294 Bacteria 3103
276 Ga0209025_1026821 3300025294 Bacteria 2877
277 Ga0209564_1000140 3300025295 Bacteria 179856
278 Ga0209564_1000794 3300025295 Bacteria 43506
279 Ga0209564_1000802 3300025295 Bacteria 43078
280 Ga0209564_1000868 3300025295 Bacteria 40261
281 Ga0209564_1001618 3300025295 Bacteria 21851
282 Ga0209564_1005687 3300025295 Bacteria 6993
283 Ga0209564_1029829 3300025295 Bacteria 1705
284 Ga0209564_1032595 3300025295 Bacteria 1566
285 Ga0209758_1000086 3300025297 Bacteria 254778
286 Ga0209758_1000155 3300025297 Bacteria 160455
287 Ga0209758_1000545 3300025297 Bacteria 59830
288 Ga0209758_1000587 3300025297 Bacteria 56803
289 Ga0209758_1001100 3300025297 Bacteria 34985
290 Ga0209758_1002445 3300025297 Bacteria 18964
291 Ga0209758_1009072 3300025297 Bacteria 6274
292 Ga0209758_1026976 3300025297 Bacteria 2469
293 Ga0209758_1050684 3300025297 Bacteria 1453
294 Ga0209050_1000200 3300025298 Bacteria 134115
295 Ga0209050_1000650 3300025298 Bacteria 53753
296 Ga0209050_1005095 3300025298 Bacteria 8471
297 Ga0209050_1012900 3300025298 Bacteria 3780
298 Ga0209256_1000557 3300025299 Bacteria 53444
299 Ga0209256_1000687 3300025299 Bacteria 45327
300 Ga0209256_1001048 3300025299 Bacteria 32169
301 Ga0209256_1001371 3300025299 Bacteria 25602
302 Ga0209256_1004371 3300025299 Bacteria 8941
303 Ga0209256_1007616 3300025299 Bacteria 5278
304 Ga0209256_1008484 3300025299 Bacteria 4754
305 Ga0209256_1031180 3300025299 Bacteria 1461
306 Ga0207426_1000003 3300025302 Bacteria 1063212
307 Ga0207426_1000010 3300025302 Bacteria 796003
308 Ga0207426_1000111 3300025302 Bacteria 234032
309 Ga0207426_1001840 3300025302 Bacteria 15628
310 Ga0207426_1002511 3300025302 Bacteria 11539
311 Ga0209051_1000095 3300025303 Bacteria 167840
312 Ga0209051_1001031 3300025303 Bacteria 26450
313 Ga0209051_1001191 3300025303 Bacteria 23500
314 Ga0209051_1003503 3300025303 Bacteria 10260
315 Ga0209051_1007144 3300025303 Bacteria 6154
316 Ga0209051_1018527 3300025303 Bacteria 3076
317 Ga0209257_1000225 3300025304 Bacteria 134023
318 Ga0209257_1001135 3300025304 Bacteria 34110
319 Ga0209257_1001962 3300025304 Bacteria 22185
320 Ga0209257_1002482 3300025304 Bacteria 18242
321 Ga0209257_1003296 3300025304 Bacteria 14065
322 Ga0207647_10009171 3300025904 Bacteria 7038
323 Ga0207645_10047975 3300025907 Bacteria 2727
324 Ga0207705_10002109 3300025909 Bacteria 15460
325 Ga0207684_10044863 3300025910 Bacteria 3749
326 Ga0207707_10043776 3300025912 Bacteria 3903
327 Ga0207695_10000011 3300025913 Bacteria 910221
328 Ga0207695_10001670 3300025913 Bacteria 35733
329 Ga0207695_10001727 3300025913 Bacteria 34901
330 Ga0207695_10032467 3300025913 Bacteria 5712
331 Ga0207695_10040997 3300025913 Bacteria 4957
332 Ga0207695_10109166 3300025913 Bacteria 2749
333 Ga0207671_10000544 3300025914 Bacteria 50912
334 Ga0207663_10056508 3300025916 Bacteria 2468
335 Ga0207660_10024849 3300025917 Bacteria 4059
336 Ga0207660_10229845 3300025917 Bacteria 1458
337 Ga0207657_10009919 3300025919 Bacteria 9531
338 Ga0207657_10011260 3300025919 Bacteria 8888
339 Ga0207657_10031173 3300025919 Bacteria 4833
340 Ga0207652_10099157 3300025921 Bacteria 2570
341 Ga0207646_10009642 3300025922 Bacteria 9521
342 Ga0207646_10203736 3300025922 Bacteria 1787
343 Ga0207694_10043945 3300025924 Bacteria 3449
344 Ga0207650_10002090 3300025925 Bacteria 13962
345 Ga0207650_10034339 3300025925 Bacteria 3678
346 Ga0207650_10043564 3300025925 Bacteria 3295
347 Ga0207687_10135206 3300025927 Bacteria 1864
348 Ga0207687_10208249 3300025927 Bacteria 1533
349 Ga0207644_10019674 3300025931 Bacteria 4584
350 Ga0207690_10000129 3300025932 Bacteria 62350
351 Ga0207690_10069496 3300025932 Bacteria 2423
352 Ga0207670_10076286 3300025936 Bacteria 2332
353 Ga0207711_10003316 3300025941 Bacteria 13965
354 Ga0207689_10037734 3300025942 Bacteria 4005
355 Ga0207679_10209322 3300025945 Bacteria 1634
356 Ga0207667_10012057 3300025949 Bacteria 9997
357 Ga0207667_10076819 3300025949 Bacteria 3465
358 Ga0207667_10094113 3300025949 Bacteria 3094
359 Ga0207651_10001247 3300025960 Bacteria 11446
360 Ga0207651_10153666 3300025960 Bacteria 1795
361 Ga0207712_10003857 3300025961 Bacteria 9469
362 Ga0207668_10005551 3300025972 Bacteria 7437
363 Ga0207668_10019991 3300025972 Bacteria 4246
364 Ga0207668_10097082 3300025972 Bacteria 2180
365 Ga0207640_10184906 3300025981 Bacteria 1566
366 Ga0207658_10014480 3300025986 Bacteria 5401
367 Ga0207658_10030279 3300025986 Bacteria 3830
368 Ga0207703_10155370 3300026035 Bacteria 1999
369 Ga0207639_10012996 3300026041 Bacteria 5812
370 Ga0207678_10196436 3300026067 Bacteria 1724
371 Ga0207678_10238197 3300026067 Bacteria 1559
372 Ga0207702_10306121 3300026078 Bacteria 1509
373 Ga0207641_10080568 3300026088 Bacteria 2825
374 Ga0207641_10196921 3300026088 Bacteria 1855
375 Ga0207648_10280931 3300026089 Bacteria 1489
376 Ga0207676_10092246 3300026095 Bacteria 2490
377 Ga0207676_10157549 3300026095 Bacteria 1963
378 Ga0207674_10037025 3300026116 Bacteria 5077
379 Ga0207674_10313778 3300026116 Bacteria 1517
380 Ga0207675_100088449 3300026118 Bacteria 2909
381 Ga0207675_100106878 3300026118 Bacteria 2639
382 Ga0207698_10032339 3300026142 Bacteria 3789
383 Ga0207698_10156809 3300026142 Bacteria 1985
384 Ga0209281_1000310 3300027111 Bacteria 87212
385 Ga0209281_1000334 3300027111 Bacteria 81109
386 Ga0209281_1000361 3300027111 Bacteria 74287
387 Ga0209371_1000021 3300027312 Bacteria 555864
388 Ga0209371_1000469 3300027312 Bacteria 39757
389 Ga0209371_1001465 3300027312 Bacteria 15917
390 Ga0209981_1001336 3300027378 Bacteria 3119
391 Ga0209282_1000073 3300027666 Bacteria 81125
392 Ga0207428_10143703 3300027907 Bacteria 1819
393 Ga0268266_10000064 3300028379 Bacteria 249533
394 Ga0268266_10096180 3300028379 Bacteria 2602
395 Ga0268266_10118022 3300028379 Bacteria 2358
396 Ga0268265_10296647 3300028380 Bacteria 1453
397 Ga0268264_10000046 3300028381 Bacteria 364597
398 Ga0268264_10008753 3300028381 Bacteria 8402
399 Ga0307517_10012250 3300028786 Bacteria 11791
400 Ga0307515_10000844 3300028794 Bacteria 70375
401 Ga0307515_10004389 3300028794 Bacteria 29220
402 Ga0307515_10013773 3300028794 Bacteria 15073
403 Ga0307515_10020621 3300028794 Bacteria 11742
404 Ga0307515_10136352 3300028794 Bacteria 2666
405 Ga0265338_10102967 3300028800 Bacteria 2320
406 Ga0268256_1000020 3300030500 Bacteria 557873
407 Ga0268256_1001794 3300030500 Bacteria 12086
408 Ga0268256_1005314 3300030500 Bacteria 5095
409 Ga0307511_10020348 3300030521 Bacteria 6286
410 Ga0316181_1029502 3300030744 Bacteria 1646
411 Ga0265332_10002681 3300031238 Bacteria 8915
412 Ga0265340_10004410 3300031247 Bacteria 7873
413 Ga0265340_10007323 3300031247 Bacteria 5996
414 Ga0265340_10045900 3300031247 Bacteria 2132
415 Ga0265340_10058938 3300031247 Bacteria 1842
416 Ga0265339_10005244 3300031249 Bacteria 8652
417 Ga0265331_10076144 3300031250 Bacteria 1564
418 Ga0265327_10010519 3300031251 Bacteria 6494
419 Ga0265316_10019975 3300031344 Bacteria 5714
420 Ga0265316_10144053 3300031344 Bacteria 1788
421 Ga0265316_10153431 3300031344 Bacteria 1725
422 Ga0265316_10174053 3300031344 Bacteria 1605
423 Ga0307513_10001153 3300031456 Bacteria 38347
424 Ga0307513_10002223 3300031456 Bacteria 27113
425 Ga0307513_10126591 3300031456 Bacteria 2509
426 Ga0307513_10131453 3300031456 Bacteria 2448
427 Ga0307513_10246589 3300031456 Bacteria 1586
428 Ga0307408_100044283 3300031548 Bacteria 3171
429 Ga0307408_100106122 3300031548 Bacteria 2149
430 Ga0265313_10000115 3300031595 Bacteria 81365
431 Ga0265313_10005411 3300031595 Bacteria 9409
432 Ga0265342_10000291 3300031712 Bacteria 56828
433 Ga0265342_10004760 3300031712 Bacteria 10550
434 Ga0307405_10000865 3300031731 Bacteria 11966
435 Ga0315914_1000008 3300031967 Bacteria 209133
436 Ga0307409_100090327 3300031995 Bacteria 2507
437 Ga0307415_100156003 3300032126 Bacteria 1763
438 Ga0307510_10215800 3300033180 Bacteria 1435
439 Ga0315913_1000688 3300033430 Bacteria 32300
440 Ga0315915_1000014 3300033464 Bacteria 171068
441 Ga0373936_0001078 3300035113 Bacteria 9771
442 Ga0373955_0006909 3300035172 Bacteria 5189
443 Ga0373935_0180676 3300035692 Bacteria 1449
444 Ga0373947_0103714 3300035725 Bacteria 1790
445 Ga0373937_0003965 3300036401 Bacteria 12517
446 Ga0316582_0178570 3300036647 Bacteria 1444
447 Ga0395900_0105421 3300037418 Bacteria 2896
448 Ga0395900_0148717 3300037418 Bacteria 2394
449 Ga0395898_0129795 3300037466 Bacteria 2414
450 Ga0395905_0000325 3300037471 Bacteria 68813
451 Ga0395905_0013938 3300037471 Bacteria 7688
452 Ga0395905_0018905 3300037471 Bacteria 6534
453 Ga0395905_0036384 3300037471 Bacteria 4623
454 Ga0395905_0084322 3300037471 Bacteria 2977
455 Ga0395905_0118398 3300037471 Bacteria 2489
456 Ga0395905_0151442 3300037471 Bacteria 2182
457 Ga0395905_0203822 3300037471 Bacteria 1854
458 Ga0395905_0362075 3300037471 Bacteria 1343
459 Ga0395901_0034892 3300038443 Bacteria 5196
460 Ga0395901_0080149 3300038443 Bacteria 3408
461 Ga0436365_1022390 3300039437 Bacteria 9083
462 Ga0436365_1373120 3300039437 Bacteria 3307
463 Ga0436365_1821915 3300039437 Bacteria 4592
464 Ga0436360_1164335 3300039438 Bacteria 2240
465 Ga0439436_0005547 3300041404 Bacteria 3865
466 Ga0439447_014419 3300041407 Bacteria 2218
467 Ga0439465_0002132 3300041413 Bacteria 6507
468 Ga0439465_0008511 3300041413 Bacteria 3236
469 Ga0439465_0009217 3300041413 Bacteria 3110
470 Ga0439449_0016399 3300042007 Bacteria 2784
471 Ga0439462_0020296 3300042015 Bacteria 1732
472 Ga0439434_0006059 3300042435 Bacteria 3528
473 Ga0450918_004111 3300042531 Bacteria 2668
474 Ga0439440_0026012 3300042993 Bacteria 1351
475 Ga0466972_0016538 3300044658 Bacteria 3688
476 Ga0466957_0006564 3300044842 Bacteria 6574
477 Ga0451576_0255328 3300045051 Bacteria 1832
478 Ga0495638_0000335 3300046460 Bacteria 59334
479 Ga0495638_0070997 3300046460 Bacteria 2130
480 Ga0495605_0008898 3300046474 Bacteria 5661
481 Ga0495585_0085021 3300046492 Bacteria 1710
482 Ga0495583_0040752 3300046506 Bacteria 2179
483 Ga0495606_0001859 3300046507 Bacteria 26548
484 Ga0495610_0006199 3300046512 Bacteria 8308
485 Ga0495616_0072333 3300046513 Bacteria 1665
486 Ga0495620_0011481 3300046515 Bacteria 4620
487 Ga0495620_0037347 3300046515 Bacteria 2164
488 Ga0495628_0096660 3300046516 Bacteria 2282
489 Ga0495631_0044543 3300046518 Bacteria 1954
490 Ga0495632_0007829 3300046519 Bacteria 6650
491 Ga0495632_0016533 3300046519 Bacteria 4100
492 Ga0495632_0054495 3300046519 Bacteria 1960
493 Ga0495643_0017640 3300046522 Bacteria 4168
494 Ga0495643_0019594 3300046522 Bacteria 3912
495 Ga0495648_0078720 3300046524 Bacteria 1884
496 Ga0495642_0003747 3300046528 Bacteria 5949
497 Ga0495652_0145320 3300046529 Bacteria 1860
498 Ga0495654_0006825 3300046530 Bacteria 6442
499 Ga0495609_0047737 3300046538 Bacteria 1915
500 Ga0495597_0037496 3300046542 Bacteria 2176
501 Ga0495597_0051685 3300046542 Bacteria 1811
502 Ga0495622_0023852 3300046557 Bacteria 2854
503 Ga0495656_0013990 3300046615 Bacteria 2999
504 Ga0495668_0026182 3300046616 Bacteria 3311
505 Ga0495668_0036672 3300046616 Bacteria 2747
506 Ga0495668_0044359 3300046616 Bacteria 2471
507 Ga0495634_0102449 3300046642 Bacteria 1849
508 Ga0495625_0003150 3300046660 Bacteria 16795
509 Ga0495625_0022163 3300046660 Bacteria 4874
510 Ga0495625_0121613 3300046660 Bacteria 1776
511 Ga0495588_0001585 3300046674 Bacteria 9715
512 Ga0495657_0041914 3300046675 Bacteria 3129
513 Ga0495623_0135070 3300046679 Bacteria 1473
514 Ga0495669_0020443 3300046684 Bacteria 2866
515 Ga0495613_0004373 3300046689 Bacteria 10572
516 Ga0495671_0072418 3300046692 Bacteria 1692
517 Ga0495600_0083742 3300046809 Bacteria 2081
518 Ga0495681_0002954 3300047470 Bacteria 11989
519 Ga0495686_0004865 3300047472 Bacteria 10832
520 Ga0495686_0023724 3300047472 Bacteria 4040
521 Ga0495686_0032058 3300047472 Bacteria 3403
522 Ga0495686_0075994 3300047472 Bacteria 2058
523 Ga0495686_0149061 3300047472 Bacteria 1375
524 Ga0495602_0125809 3300048088 Bacteria 2054
525 Ga0496100_0139285 3300048903 Bacteria 1717
526 Ga0496101_0077391 3300048904 Bacteria 2451
527 Ga0496102_0187894 3300048905 Bacteria 1947
528 Ga0496103_0211605 3300048906 Bacteria 1247
529 Ga0496105_0127464 3300048908 Bacteria 2098
530 Ga0496105_0151629 3300048908 Bacteria 1905
531 Ga0496105_0288371 3300048908 Bacteria 1322
532 Ga0496106_0004921 3300048909 Bacteria 9886
533 Ga0496107_0141570 3300048910 Bacteria 1778
534 Ga0496110_0151666 3300048913 Bacteria 2099
535 Ga0496111_0001499 3300048914 Bacteria 13379
536 Ga0496112_0033343 3300048915 Bacteria 5006
537 Ga0496112_0050254 3300048915 Bacteria 4088
538 Ga0496112_0161662 3300048915 Bacteria 2206
539 Ga0496112_0176656 3300048915 Bacteria 2100
540 Ga0496114_0305178 3300048917 Bacteria 1406
541 Ga0496115_0000598 3300048918 Bacteria 27622
542 Ga0496115_0013865 3300048918 Bacteria 6104
543 Ga0496116_0000043 3300048919 Bacteria 328085
544 Ga0496116_0005367 3300048919 Bacteria 11929
545 Ga0496116_0008089 3300048919 Bacteria 9192
546 Ga0496116_0009102 3300048919 Bacteria 8512
547 Ga0496116_0089980 3300048919 Bacteria 1870
548 Ga0496117_0000338 3300048920 Bacteria 82688
549 Ga0496117_0018243 3300048920 Bacteria 5823
550 Ga0496117_0053521 3300048920 Bacteria 2835
551 Ga0496117_0074710 3300048920 Bacteria 2255
552 Ga0496117_0112688 3300048920 Bacteria 1691
553 Ga0496118_0000958 3300048921 Bacteria 45054
554 Ga0496118_0012461 3300048921 Bacteria 8161
555 Ga0496118_0058725 3300048921 Bacteria 2871
556 Ga0496119_0000407 3300048922 Bacteria 59063
557 Ga0496119_0020566 3300048922 Bacteria 4811
558 Ga0496119_0118030 3300048922 Bacteria 1462
559 Ga0496120_0000589 3300048923 Bacteria 55133
560 Ga0496120_0001472 3300048923 Bacteria 28063
561 Ga0496120_0039468 3300048923 Bacteria 2784
562 Ga0496121_0000003 3300048924 Bacteria 1191431
563 Ga0496121_0002723 3300048924 Bacteria 26365
564 Ga0496121_0009941 3300048924 Bacteria 10830
565 Ga0496121_0015230 3300048924 Bacteria 8079
566 Ga0496121_0021685 3300048924 Bacteria 6279
567 Ga0496121_0243555 3300048924 Bacteria 1251
568 Ga0496122_0000025 3300048925 Bacteria 362915
569 Ga0496122_0001020 3300048925 Bacteria 49521
570 Ga0496122_0011791 3300048925 Bacteria 8798
571 Ga0496122_0016499 3300048925 Bacteria 6981
572 Ga0496122_0045297 3300048925 Bacteria 3420
573 Ga0496122_0060685 3300048925 Bacteria 2782
574 Ga0496122_0066491 3300048925 Bacteria 2604
575 Ga0496122_0080187 3300048925 Bacteria 2277
576 Ga0496123_0000032 3300048926 Bacteria 285282
577 Ga0496123_0000043 3300048926 Bacteria 253752
578 Ga0496123_0005929 3300048926 Bacteria 12038
579 Ga0496123_0033060 3300048926 Bacteria 3729
580 Ga0496123_0034781 3300048926 Bacteria 3602
581 Ga0496124_0004564 3300048927 Bacteria 16090
582 Ga0496124_0009370 3300048927 Bacteria 10090
583 Ga0496124_0017870 3300048927 Bacteria 6667
584 Ga0496124_0023770 3300048927 Bacteria 5586
585 Ga0496124_0043644 3300048927 Bacteria 3853
586 Ga0496124_0057788 3300048927 Bacteria 3267
587 Ga0496124_0116299 3300048927 Bacteria 2144
588 Ga0496124_0122643 3300048927 Bacteria 2074
589 Ga0496124_0164845 3300048927 Bacteria 1723
590 Ga0496125_0000141 3300048928 Bacteria 158991
591 Ga0496125_0000946 3300048928 Bacteria 45578
592 Ga0496125_0047515 3300048928 Bacteria 3588
593 Ga0496125_0076177 3300048928 Bacteria 2591
594 Ga0496125_0091985 3300048928 Bacteria 2270
595 Ga0496126_0000362 3300048929 Bacteria 94734
596 Ga0496126_0001471 3300048929 Bacteria 36655
597 Ga0496126_0094112 3300048929 Bacteria 2630
598 Ga0496126_0282256 3300048929 Bacteria 1375
599 Ga0501031_0000095 3300049568 Bacteria 47538
600 Ga0501032_0000084 3300049569 Bacteria 82148
601 Ga0501032_0018154 3300049569 Bacteria 4929
602 Ga0501033_0000102 3300049570 Bacteria 81583
603 Ga0501033_0002401 3300049570 Bacteria 15945
604 Ga0501033_0109595 3300049570 Bacteria 2010
605 Ga0501033_0216347 3300049570 Bacteria 1365
606 Ga0501034_0001404 3300049571 Bacteria 32372
607 Ga0501034_0002050 3300049571 Bacteria 25291
608 Ga0501034_0051983 3300049571 Bacteria 4130
609 Ga0501034_0063545 3300049571 Bacteria 3705
610 Ga0501034_0070355 3300049571 Bacteria 3510
611 Ga0501034_0114321 3300049571 Bacteria 2688
612 Ga0501034_0119062 3300049571 Bacteria 2627
613 Ga0501034_0146432 3300049571 Bacteria 2339
614 Ga0501034_0221666 3300049571 Bacteria 1843
615 Ga0501034_0269726 3300049571 Bacteria 1643
616 Ga0501036_0000040 3300049572 Bacteria 81588
617 Ga0501036_0099353 3300049572 Bacteria 2461
618 Ga0501036_0133787 3300049572 Bacteria 2092
619 Ga0501037_0000098 3300049573 Bacteria 81588
620 Ga0501037_0116670 3300049573 Bacteria 1921
621 Ga0501037_0127251 3300049573 Bacteria 1828
622 Ga0501038_0000002 3300049574 Bacteria 330446
623 Ga0501038_0041862 3300049574 Bacteria 3993
624 Ga0501038_0079363 3300049574 Bacteria 2768
625 Ga0501038_0087687 3300049574 Bacteria 2613
626 Ga0501038_0204517 3300049574 Bacteria 1583
627 Ga0501039_0000002 3300049575 Bacteria 375152
628 Ga0501039_0070611 3300049575 Bacteria 2713
629 Ga0501039_0123771 3300049575 Bacteria 2027
630 Ga0501040_0018811 3300049576 Bacteria 4589
631 Ga0501040_0087537 3300049576 Bacteria 2163
632 Ga0501041_0085751 3300049577 Bacteria 1942
633 Ga0501043_0006479 3300049579 Bacteria 9399
634 Ga0501043_0091348 3300049579 Bacteria 2394
635 Ga0501046_0040082 3300049580 Bacteria 3745
636 Ga0501046_0040474 3300049580 Bacteria 3724
637 Ga0501046_0097247 3300049580 Bacteria 2262
638 Ga0501047_0002237 3300049581 Bacteria 18521
639 Ga0501047_0009623 3300049581 Bacteria 9138
640 Ga0501047_0039107 3300049581 Bacteria 4589
641 Ga0501047_0152057 3300049581 Bacteria 2190
642 Ga0501047_0207448 3300049581 Bacteria 1819
643 Ga0501067_0027657 3300049583 Bacteria 3143
644 Ga0501067_0103293 3300049583 Bacteria 1584
645 Ga0501070_0001215 3300049586 Bacteria 23032
646 Ga0501070_0007158 3300049586 Bacteria 9480
647 Ga0501070_0012619 3300049586 Bacteria 7127
648 Ga0501070_0100753 3300049586 Bacteria 2390
649 Ga0501070_0130711 3300049586 Bacteria 2074
650 Ga0501070_0134744 3300049586 Bacteria 2039
651 Ga0501070_0161841 3300049586 Bacteria 1845
652 Ga0501073_0021969 3300049589 Bacteria 4597
653 Ga0501073_0068421 3300049589 Bacteria 2475
654 Ga0501073_0102510 3300049589 Bacteria 1987
655 Ga0501074_0078145 3300049590 Bacteria 2375
656 Ga0501074_0122459 3300049590 Bacteria 1860
657 Ga0501074_0156517 3300049590 Bacteria 1628
658 Ga0501075_0053150 3300049591 Bacteria 3046
659 Ga0501077_0008398 3300049593 Bacteria 6394
660 Ga0501077_0061769 3300049593 Bacteria 2378
661 Ga0501079_0016684 3300049741 Bacteria 5608
662 Ga0501079_0189767 3300049741 Bacteria 1604
663 Ga0501080_0115959 3300049742 Bacteria 2483
664 Ga0501080_0116216 3300049742 Bacteria 2480
665 Ga0501081_0002292 3300049743 Bacteria 12049
666 Ga0501083_0008060 3300049744 Bacteria 7452
667 Ga0501083_0087908 3300049744 Bacteria 2055
668 Ga0501083_0122816 3300049744 Bacteria 1703
669 Ga0501280_001402 3300049776 Bacteria 4488
670 Ga0501035_0000163 3300049822 Bacteria 81898
671 Ga0501035_0000636 3300049822 Bacteria 38713
672 Ga0501035_0006001 3300049822 Bacteria 11439
673 Ga0501035_0053793 3300049822 Bacteria 3599
674 Ga0501035_0100213 3300049822 Bacteria 2543
675 Ga0501035_0119403 3300049822 Bacteria 2306
676 Ga0501035_0158231 3300049822 Bacteria 1962
677 Ga0501044_0000002 3300049823 Bacteria 375152
678 Ga0501044_0008237 3300049823 Bacteria 11434
679 Ga0501044_0101028 3300049823 Bacteria 2902
680 Ga0501044_0122644 3300049823 Bacteria 2598
681 Ga0501044_0129502 3300049823 Bacteria 2518
682 Ga0501044_0171180 3300049823 Bacteria 2143
683 nmdc:mga00v17_115039_c1 3300050491 Bacteria 1709
684 nmdc:mga0yw44_22286_c1 3300050492 Bacteria 3550
685 nmdc:mga0yw44_2486_c2 3300050492 Bacteria 7320
686 nmdc:mga0k408_85117_c1 3300050493 Bacteria 1856
687 nmdc:mga06z11_11767_c1 3300050494 Bacteria 3783
688 nmdc:mga05p37_3347_c1 3300050507 Bacteria 18694
689 nmdc:mga05p37_51639_c1 3300050507 Bacteria 5055
690 nmdc:mga06r32_173970_c1 3300050510 Bacteria 2137
691 nmdc:mga06r32_397_c1 3300050510 Bacteria 36835
692 nmdc:mga06r32_4570_c1 3300050510 Bacteria 12407
693 nmdc:mga06r32_65217_c1 3300050510 Bacteria 3512
694 nmdc:mga08y16_125660_c1 3300050511 Bacteria 2668
695 nmdc:mga08y16_184_c1 3300050511 Bacteria 55479
696 nmdc:mga08y16_317269_c1 3300050511 Bacteria 1605
697 nmdc:mga08y16_341208_c1 3300050511 Bacteria 1540
698 nmdc:mga0n895_34584_c1 3300050512 Bacteria 4865
699 nmdc:mga0n895_83347_c1 3300050512 Bacteria 3188
700 nmdc:mga0rr50_112960_c1 3300050513 Bacteria 2152
701 nmdc:mga0a205_189122_c1 3300050515 Bacteria 1951
702 nmdc:mga0sz30_40695_c1 3300050516 Bacteria 1954
703 Ga0495601_0026160 3300053077 Bacteria 3601
704 Ga0495601_0051134 3300053077 Bacteria 2608
705 Ga0500610_0068381 3300053079 Bacteria 1852
706 Ga0500610_0104760 3300053079 Bacteria 1460
707 Ga0495595_0004834 3300053084 Bacteria 5426
708 Ga0495619_0084124 3300053085 Bacteria 2147
709 Ga0495619_0132219 3300053085 Bacteria 1715
710 Ga0495619_0196040 3300053085 Bacteria 1398
711 Ga0500578_0059011 3300053086 Bacteria 2452
712 Ga0500643_029906 3300053087 Bacteria 1672
713 Ga0500643_040753 3300053087 Bacteria 1367
714 Ga0500556_0000048 3300053104 Bacteria 123558
715 Ga0500557_000677 3300053105 Bacteria 4745
716 Ga0500560_035252 3300053107 Bacteria 1539
717 Ga0500569_038673 3300053109 Bacteria 1386
718 Ga0500572_017220 3300053111 Bacteria 1854
719 Ga0500595_010690 3300053119 Bacteria 3634
720 Ga0500618_001230 3300053125 Bacteria 11999
721 Ga0500618_001417 3300053125 Bacteria 10714
722 Ga0500652_000002 3300053131 Bacteria 273315
723 Ga0500658_0001009 3300053134 Bacteria 11474
724 Ga0500568_0005268 3300053139 Bacteria 6725
725 Ga0500568_0007791 3300053139 Bacteria 5217
726 Ga0500573_0005547 3300053140 Bacteria 6763
727 Ga0500573_0052004 3300053140 Bacteria 2355
728 Ga0500604_0015719 3300053151 Bacteria 2076
729 Ga0500604_0023625 3300053151 Bacteria 1755
730 Ga0500616_0000417 3300053153 Bacteria 57047
731 Ga0500616_0003179 3300053153 Bacteria 12786
732 Ga0500616_0008458 3300053153 Bacteria 6387
733 Ga0500616_0050895 3300053153 Bacteria 2185
734 Ga0500620_000455 3300053155 Bacteria 7365
735 Ga0500620_025179 3300053155 Bacteria 1828
736 Ga0500622_0002220 3300053156 Bacteria 14314
737 Ga0500622_0002307 3300053156 Bacteria 13947
738 Ga0500624_000439 3300053157 Bacteria 12586
739 Ga0500634_0105582 3300053161 Bacteria 1401
740 Ga0500636_0000065 3300053177 Bacteria 51565
741 Ga0500636_0007738 3300053177 Bacteria 6214
742 Ga0500645_004747 3300053730 Bacteria 5147
743 Ga0587090_002011 3300059510 Bacteria 2171
744 Ga0501082_0001446 3300060353 Bacteria 20856
745 Ga0530510_0041490 3300061734 Bacteria 3323
746 Ga0530510_0117563 3300061734 Bacteria 1950
747 2503202580 2503198000 Bacteria 6884444
748 2509107866 2508501122 Bacteria 6292184
749 2509114387 2508501123 Bacteria 6283661
750 2509373176 2509276018 Bacteria 6910194
751 2509376263 2509276019 Bacteria 6802256
752 2509387053 2509276021 Bacteria 7634384
753 2509397094 2509276022 Bacteria 6200534
754 2509442549 2509276033 Bacteria 7180565
755 2510132910 2510065019 Bacteria 6903379
756 2510307048 2510065057 Bacteria 6649661
757 2510317137 2510065059 Bacteria 6847884
758 2510894282 2510461076 Bacteria 8618824
759 2510899307 2510461076 Bacteria 8618824
760 2511133714 2510917022 Bacteria 6504556
761 2511175907 2510917026 Bacteria 7046020
762 2511183665 2510917028 Bacteria 6185411
763 2511198275 2510917030 Bacteria 7460662
764 2511501367 2511231052 Bacteria 6974333
765 2512532786 2512047086 Bacteria 6850303
766 2512930643 2512875016 Bacteria 6529530
767 2512958390 2512875024 Bacteria 7195110
768 2512971882 2512875026 Bacteria 6861065
769 2513570003 2513237084 Bacteria 7231967
770 2513575258 2513237085 Bacteria 7695351
771 2513587778 2513237086 Bacteria 7265287
772 2513592683 2513237087 Bacteria 5817514
773 2513598983 2513237088 Bacteria 6927906
774 2513606284 2513237089 Bacteria 6553624
775 2513614329 2513237090 Bacteria 7096802
776 2513617802 2513237091 Bacteria 6900273
777 2513633054 2513237093 Bacteria 7545552
778 2513710225 2513237103 Bacteria 7647401
779 2513869377 2513237138 Bacteria 7368160
780 2513886247 2513237140 Bacteria 7076289
781 2513906302 2513237143 Bacteria 6664116
782 2513909796 2513237144 Bacteria 7530820
783 2513926565 2513237146 Bacteria 7166346
784 2513987423 2513237156 Bacteria 6402557
785 2514000276 2513237159 Bacteria 6810126
786 2514005433 2513237160 Bacteria 6650282
787 2514019905 2513237162 Bacteria 7468464
788 2514038355 2513237164 Bacteria 7563725
789 2515111862 2515075009 Bacteria 7288508
790 2515611495 2515154107 Bacteria 6795637
791 2515633647 2515154113 Bacteria 7807172
792 2515642190 2515154114 Bacteria 7848616
793 2515656245 2515154116 Bacteria 7552979
794 2515738956 2515154134 Bacteria 7220242
795 2516209241 2516143018 Bacteria 6951533
796 2516892645 2516653046 Bacteria 6989037
797 2517035580 2516653077 Bacteria 7555578
798 2517076039 2516653085 Bacteria 7346596
799 2517094779 2517093000 Bacteria 7412387
800 2517406406 2517287029 Bacteria 6905599
801 2517569460 2517487022 Bacteria 7227575
802 2520376175 2519899620 Bacteria 6499161
803 2523470300 2523231067 Bacteria 5230452
804 2524452873 2524023207 Bacteria 6813453
805 2524460395 2524023209 Bacteria 6679728
806 2530645162 2529292951 Bacteria 6916614
807 2535516179 2534681796 Bacteria 7146037
808 2537874643 2537561587 Bacteria 5425293
809 2551682279 2551306084 Bacteria 8942552
810 2551684602 2551306085 Bacteria 7347181
811 2551693591 2551306086 Bacteria 6843938
812 2551703232 2551306087 Bacteria 7351905
813 2551708983 2551306089 Bacteria 7162724
814 2551719087 2551306090 Bacteria 7953713
815 2551730633 2551306091 Bacteria 7086830
816 2551736439 2551306092 Bacteria 6992595
817 2551740115 2551306093 Bacteria 7064773
818 2558863131 2558860100 Bacteria 8458965
819 2561466540 2558860983 Bacteria 4133860
820 2585168293 2582581283 Bacteria 6030556
821 2585199899 2582581294 Bacteria 6626667
822 2585225873 2582581298 Bacteria 7315509
823 2585268920 2582581306 Bacteria 6450535
824 2585270604 2582581307 Bacteria 6597605
825 2585276951 2582581308 Bacteria 7413247
826 2585324049 2582581315 Bacteria 7318924
827 2585333558 2582581316 Bacteria 7774528
828 2585389445 2582581865 Bacteria 6644329
829 2585393944 2582581866 Bacteria 6859583
830 2585400737 2582581867 Bacteria 7184437
831 2585528181 2585427526 Bacteria 7258840
832 2585534743 2585427527 Bacteria 7273426
833 2585540389 2585427528 Bacteria 6842387
834 2585546833 2585427529 Bacteria 7395659
835 2585551812 2585427530 Bacteria 7383882
836 2585558309 2585427531 Bacteria 6992870
837 2585819703 2585427590 Bacteria 6824633
838 2585838588 2585427593 Bacteria 7141551
839 2585845802 2585427594 Bacteria 6180594
840 2585897701 2585427608 Bacteria 6544331
841 2585904703 2585427609 Bacteria 6667127
842 2585995665 2585427633 Bacteria 6413184
843 2586000233 2585427634 Bacteria 6455027
844 2587980181 2585428125 Bacteria 6662905
845 2588516292 2588253730 Bacteria 6881675
846 2599333423 2599185156 Bacteria 5403036
847 2599418004 2599185170 Bacteria 7295545
848 2599602210 2599185210 Bacteria 5624189
849 2599721195 2599185236 Bacteria 6875203
850 2599939613 2599185301 Bacteria 6161860
851 2600192322 2599185352 Bacteria 7228948
852 2600374450 2600254933 Bacteria 4750527
853 2616292789 2615840624 Bacteria 6557588
854 2616308324 2615840626 Bacteria 7921970
855 2616556616 2615840698 Bacteria 7319877
856 2617381674 2617270742 Bacteria 6808054
857 2643772816 2643221550 Bacteria 4619371
858 2643775645 2643221551 Bacteria 3750538
859 2643794092 2643221555 Bacteria 3749717
860 2643808403 2643221557 Bacteria 7184309
861 2643811848 2643221558 Bacteria 5460675
862 2643855518 2643221568 Bacteria 5187270
863 2643919146 2643221582 Bacteria 5804683
864 2643987151 2643221595 Bacteria 6565519
865 2644000218 2643221598 Bacteria 4578346
866 2644005861 2643221599 Bacteria 6292121
867 2644049569 2643221607 Bacteria 6314006
868 2644066503 2643221610 Bacteria 7480339
869 2644109535 2643221618 Bacteria 7717186
870 2644132117 2643221623 Bacteria 5239945
871 2644145219 2643221626 Bacteria 8069654
872 2644155702 2643221627 Bacteria 6761570
873 2644204023 2643221636 Bacteria 6583769
874 2644207611 2643221637 Bacteria 5345260
875 2644300411 2643221653 Bacteria 4569637
876 2644307800 2643221655 Bacteria 7722067
877 2644332576 2643221659 Bacteria 7890716
878 2644378092 2643221668 Bacteria 7306521
879 2644415284 2643221675 Bacteria 7473456
880 2644450315 2643221680 Bacteria 7473610
881 2644482603 2643221686 Bacteria 6310811
882 2644494720 2643221688 Bacteria 5260751
883 2644499104 2643221689 Bacteria 6042950
884 2644544322 2643221698 Bacteria 7756764
885 2644613889 2643221712 Bacteria 7729434
886 2644654582 2643221718 Bacteria 5345506
887 2644658635 2643221719 Bacteria 4568197
888 2644677898 2643221723 Bacteria 7095460
889 2644687867 2643221726 Bacteria 7455827
890 2657683709 2657244999 Bacteria 5946535
891 2671115720 2667528174 Bacteria 6435400
892 2688599139 2687453392 Bacteria 6880454
893 2692316437 2690316117 Bacteria 6800650
894 2694631984 2693429783 Bacteria 7019804
895 2694634595 2693429784 Bacteria 7241525
896 2719180800 2718217882 Bacteria 6556348
897 2719385439 2718217927 Bacteria 6972593
898 2719665266 2718217997 Bacteria 6740740
899 2719731549 2718218009 Bacteria 6478651
900 2720491686 2718218199 Bacteria 6740745
901 2720612940 2718218232 Bacteria 6720332
902 2720619799 2718218233 Bacteria 6662049
903 2720631230 2718218235 Bacteria 6630699
904 2720774957 2718218269 Bacteria 6906114
905 2721146894 2718218363 Bacteria 6524337
906 2721158421 2718218365 Bacteria 6274507
907 2721163773 2718218366 Bacteria 6425255
908 2721399188 2718218423 Bacteria 6438183
909 2722839943 2721755514 Bacteria 6424414
910 2723026594 2721755556 Bacteria 6745503
911 2723560198 2721755684 Bacteria 6859907
912 2723566777 2721755685 Bacteria 6704835
913 2724038001 2721755809 Bacteria 6438790
914 2724044305 2721755810 Bacteria 6479005
915 2724089564 2721755819 Bacteria 6906405
916 2724104042 2721755822 Bacteria 6726041
917 2724109858 2721755823 Bacteria 6752556
918 2725952354 2724679232 Bacteria 7646494
919 2730107530 2728369352 Bacteria 6745171
920 2730164037 2728369365 Bacteria 6555560
921 2730298053 2728369397 Bacteria 6274511
922 2738799237 2738541293 Bacteria 7065685
923 2738945516 2738541317 Bacteria 5340176
924 2739038314 2738541333 Bacteria 7106503
925 2739307930 2738543024 Bacteria 5603683
926 2739350337 2738543031 Bacteria 5769731
927 2756676985 2756170246 Bacteria 7451806
928 2766067891 2765235942 Bacteria 7445910
929 2776913336 2775507049 Bacteria 6284736
930 2778176461 2775507266 Bacteria 7392367
931 2792581201 2791355082 Bacteria 5973319
932 2792623209 2791355091 Bacteria 6135441
933 2792626973 2791355092 Bacteria 6248105
934 2792642491 2791355094 Bacteria 7011481
935 2793279470 2791355253 Bacteria 5171699
936 2793299210 2791355256 Bacteria 6798008
937 2793313847 2791355259 Bacteria 7254731
938 2793321223 2791355260 Bacteria 6598818
939 2793326362 2791355261 Bacteria 6661293
940 2793336947 2791355262 Bacteria 6774204
941 2793344838 2791355263 Bacteria 6872478
942 2793347742 2791355264 Bacteria 6429314
943 2793352296 2791355265 Bacteria 6539969
944 2793360358 2791355266 Bacteria 7116587
945 2793366434 2791355267 Bacteria 7222458
946 2802718878 2802428858 Bacteria 6636079
947 2802726489 2802428859 Bacteria 6667919
948 2802733781 2802428860 Bacteria 6525526
949 2802738387 2802428861 Bacteria 6534206
950 2802744719 2802428862 Bacteria 6633353
951 2802751075 2802428863 Bacteria 6410669
952 2804751854 2802429268 Bacteria 6094027
953 2805927623 2802429605 Bacteria 6875453
954 2805936099 2802429606 Bacteria 6346811
955 2806045510 2802429633 Bacteria 7341974
956 2806051685 2802429634 Bacteria 7083200
957 2806061729 2802429635 Bacteria 7650140
958 2806067910 2802429636 Bacteria 7597525
959 2806072738 2802429637 Bacteria 7067217
960 2819241971 2818991272 Bacteria 4622173
961 2819559991 2818991439 Bacteria 6907412
962 2819610425 2818991448 Bacteria 6772224
963 2819638160 2818991453 Bacteria 7181617
964 2819687401 2818991461 Bacteria 7026071
965 2821127714 2821123053 Bacteria 7836056
966 2828309734 2828305725 Bacteria 4916900
967 2837653802 2837651117 Bacteria 3772164
968 2837679465 2837678835 Bacteria 5252418
969 2837682943 2837678835 Bacteria 5252418
970 2838018794 2838016132 Bacteria 6577831
971 2838025500 2838022645 Bacteria 6494267
972 2838034617 2838029111 Bacteria 6603031
973 2838040942 2838035591 Bacteria 7166484
974 2838043101 2838042994 Bacteria 6046894
975 2838052134 2838048938 Bacteria 6044578
976 2838067255 2838061910 Bacteria 6794874
977 2838071361 2838068647 Bacteria 6208656
978 2838079320 2838074704 Bacteria 6785777
979 2838666212 2838661181 Bacteria 7385261
980 2838670065 2838668709 Bacteria 6671819
981 2838676409 2838675328 Bacteria 4909118
982 2838689112 2838686498 Bacteria 7807632
983 2838697164 2838694306 Bacteria 6853137
984 2838702437 2838701080 Bacteria 6669771
985 2838715292 2838714209 Bacteria 5525906
986 2838720908 2838719591 Bacteria 5523910
987 2838726050 2838724970 Bacteria 4908691
988 2838730447 2838729681 Bacteria 7400765
989 2838738137 2838736955 Bacteria 5760694
990 2838743388 2838742623 Bacteria 7396178
991 2841841494 2841840854 Bacteria 5761912
992 2841847837 2841846520 Bacteria 5345850
993 2841854925 2841851746 Bacteria 7532261
994 2841859625 2841859092 Bacteria 5436171
995 2841864923 2841864319 Bacteria 6742987
996 2842077769 2842077413 Bacteria 6508645
997 2842110902 2842110456 Bacteria 7656360
998 2842119722 2842118031 Bacteria 7033875
999 2842126133 2842124991 Bacteria 5346824
1000 2842131303 2842130223 Bacteria 4909145
1001 2842141272 2842140634 Bacteria 5759631
1002 2842147018 2842146304 Bacteria 5957337
1003 2842153527 2842152218 Bacteria 4908957
1004 2842157787 2842156927 Bacteria 6894975
1005 2842165000 2842163707 Bacteria 6916235
1006 2842171535 2842170452 Bacteria 5525737
1007 2842177147 2842175837 Bacteria 4908771
1008 2842180629 2842180545 Bacteria 6888678
1009 2842188400 2842187318 Bacteria 5524014
1010 2842197013 2842192696 Bacteria 6147454
1011 2842201069 2842198810 Bacteria 6608673
1012 2842206416 2842205361 Bacteria 6340321
1013 2842212711 2842211629 Bacteria 5523832
1014 2842220607 2842217011 Bacteria 7497767
1015 2842225670 2842224351 Bacteria 5524473
1016 2842231320 2842229732 Bacteria 7475766
1017 2842244566 2842243621 Bacteria 7421798
1018 2842252083 2842250916 Bacteria 6579627
1019 2842258379 2842257432 Bacteria 7401195
1020 2842267532 2842264693 Bacteria 6472963
1021 2842273132 2842271015 Bacteria 7807131
1022 2842279873 2842278818 Bacteria 6340002
1023 2842287506 2842285085 Bacteria 6011953
1024 2842291431 2842291075 Bacteria 7076806
1025 2842301852 2842298080 Bacteria 6123127
1026 2842309385 2842304105 Bacteria 7023636
1027 2842315418 2842311132 Bacteria 6616990
1028 2842318264 2842317721 Bacteria 6793725
1029 2842347161 2842341865 Bacteria 7003929
1030 2842362350 2842357229 Bacteria 6485165
1031 2842366749 2842363717 Bacteria 6844742
1032 2842373160 2842370503 Bacteria 7038661
1033 2842377827 2842377471 Bacteria 7140707
1034 2842386232 2842384541 Bacteria 7057858
1035 2842397286 2842395702 Bacteria 6780583
1036 2842404965 2842402390 Bacteria 6681310
1037 2842411547 2842409023 Bacteria 6687331
1038 2842418002 2842415677 Bacteria 6596907
1039 2842424982 2842422224 Bacteria 6239196
1040 2842431890 2842428310 Bacteria 6767288
1041 2842438003 2842434925 Bacteria 6502746
1042 2842444817 2842441272 Bacteria 6769273
1043 2842451733 2842447887 Bacteria 6754142
1044 2842465806 2842462802 Bacteria 6588055
1045 2842472620 2842469257 Bacteria 6752936
1046 2842481364 2842475841 Bacteria 6603183
1047 2842487148 2842482326 Bacteria 7212537
1048 2842492755 2842489311 Bacteria 6620893
1049 2842496535 2842495871 Bacteria 6820686
1050 2842508264 2842502639 Bacteria 6604161
1051 2842516410 2842515876 Bacteria 5436280
1052 2842525945 2842521101 Bacteria 6569494
1053 2842695565 2842694124 Bacteria 4063419
1054 2842925169 2842922631 Bacteria 5824079
1055 2844006713 2844002411 Bacteria 7168230
1056 2844014318 2844009547 Bacteria 6728125
1057 2844170412 2844163670 Bacteria 7266046
1058 2844459534 2844454524 Bacteria 7952546
1059 2847418496 2847417321 Bacteria 6913799
1060 2847670862 2847670302 Bacteria 6165597
1061 2847686996 2847686936 Bacteria 6278406
1062 2848993473 2848992105 Bacteria 6810864
1063 2850080797 2850079185 Bacteria 6848280
1064 2852389605 2852387548 Bacteria 8025568
1065 2854899082 2854896431 Bacteria 5869725
1066 2854916970 2854916844 Bacteria 5725939
1067 2855825458 2855825444 Bacteria 6785811
1068 2855840835 2855839649 Bacteria 7135830
1069 2855873342 2855872281 Bacteria 6964271
1070 2856316319 2856314179 Bacteria 6477897
1071 2856323621 2856320880 Bacteria 7263508
1072 2856329088 2856328259 Bacteria 6528202
1073 2856335899 2856334872 Bacteria 7037011
1074 2856353283 2856349417 Bacteria 6230045
1075 2856369070 2856364286 Bacteria 6939991
1076 2857355662 2857349434 Bacteria 7926032
1077 2857373750 2857367948 Bacteria 6965560
1078 2857523704 2857516855 Bacteria 7787325
1079 2857534623 2857531043 Bacteria 6754041
1080 2858801380 2858800743 Bacteria 6603254
1081 2869175655 2869169390 Bacteria 6659796
1082 2869241456 2869234852 Bacteria 6654993
1083 2869245802 2869242130 Bacteria 6609239
1084 2869251100 2869249662 Bacteria 6868783
1085 2869266794 2869264136 Bacteria 6880765
1086 2869275703 2869271264 Bacteria 6908218
1087 2869278883 2869278585 Bacteria 7077053
1088 2869291588 2869285874 Bacteria 6901219
1089 2871433888 2871429161 Bacteria 6547891
1090 2871440971 2871435913 Bacteria 6880295
1091 2871456114 2871451962 Bacteria 7336357
1092 2871462055 2871459585 Bacteria 6866887
1093 2871485119 2871481445 Bacteria 6700002
1094 2874107932 2874102143 Bacteria 6342645
1095 2874119861 2874116593 Bacteria 6674494
1096 2874125779 2874123672 Bacteria 7238285
1097 2874136061 2874131515 Bacteria 6820270
1098 2874145475 2874139085 Bacteria 7021506
1099 2874153447 2874146452 Bacteria 7533118
1100 2874160711 2874155637 Bacteria 6724144
1101 2874167882 2874162495 Bacteria 6174670
1102 2876368010 2876363079 Bacteria 6544991
1103 2876374000 2876369609 Bacteria 6807521
1104 2876385409 2876377896 Bacteria 6565995
1105 2876387860 2876386047 Bacteria 6698674
1106 2876395185 2876392853 Bacteria 6660880
1107 2876403324 2876399893 Bacteria 6927900
1108 2876412278 2876406927 Bacteria 6191900
1109 2876419737 2876413966 Bacteria 6831344
1110 2876422663 2876420981 Bacteria 6687741
1111 2878041642 2878035449 Bacteria 6555736
1112 2878731552 2878730984 Bacteria 6380721
1113 2878743778 2878738818 Bacteria 7136951
1114 2878751500 2878745973 Bacteria 6867388
1115 2878778506 2878774303 Bacteria 6108671
1116 2878787073 2878781027 Bacteria 6834456
1117 2881152633 2881147464 Bacteria 7779814
1118 2881156192 2881155292 Bacteria 6461656
1119 2881168553 2881161766 Bacteria 7127907
1120 2881860816 2881853255 Bacteria 6698367
1121 2882633141 2882632389 Bacteria 8154593
1122 2885310601 2885305155 Bacteria 7348390
1123 2885317364 2885312484 Bacteria 6415165
1124 2885334053 2885326080 Bacteria 7134805
1125 2885339891 2885334103 Bacteria 7216818
1126 2885346062 2885342637 Bacteria 7011821
1127 2885356795 2885350715 Bacteria 6787678
1128 2889011865 2889010040 Bacteria 6749192
1129 2889023206 2889016732 Bacteria 6700763
1130 2891375567 2891373044 Bacteria 5202277
1131 2896386986 2896384573 Bacteria 7700774
1132 2899796382 2899792073 Bacteria 4926588
1133 2899808938 2899803654 Bacteria 5577784
1134 2903449771 2903448605 Bacteria 7357801
1135 2903505492 2903492973 Bacteria 13473544
1136 2903527006 2903521522 Bacteria 6525694
1137 2903533233 2903528002 Bacteria 6586099
1138 2904661816 2904659560 Bacteria 6685615
1139 2906313398 2906308376 Bacteria 6841989
1140 2906326107 2906321335 Bacteria 6579571
1141 2906328431 2906328253 Bacteria 6585166
1142 2906357557 2906354277 Bacteria 6991324
1143 2906376910 2906370794 Bacteria 6881062
1144 2906382533 2906378014 Bacteria 6911440
1145 2906392870 2906386501 Bacteria 5977019
1146 2906397996 2906393657 Bacteria 6790866
1147 2906402766 2906401398 Bacteria 6693206
1148 2906414370 2906408224 Bacteria 6162342
1149 2906416456 2906414383 Bacteria 6580790
1150 2913300409 2913295892 Bacteria 6333755
1151 2913310222 2913308742 Bacteria 5350706
1152 2915651817 2915650412 Bacteria 4288180
1153 2915985201 2915980308 Bacteria 6624279
1154 2915987807 2915986958 Bacteria 6739310
1155 2915997479 2915993759 Bacteria 7016183
1156 2916003914 2916000859 Bacteria 6865702
1157 2916014449 2916007675 Bacteria 6898660
1158 2916015346 2916014648 Bacteria 6946486
1159 2916028373 2916021584 Bacteria 6854472
1160 2916034853 2916028427 Bacteria 6748433
1161 2916041168 2916035215 Bacteria 6755766
1162 2916046296 2916041962 Bacteria 6820487
1163 2916051076 2916048683 Bacteria 6543552
1164 2916060614 2916055098 Bacteria 6758838
1165 2916067392 2916061851 Bacteria 6737736
1166 2916070780 2916068649 Bacteria 6943657
1167 2916078612 2916076590 Bacteria 6596108
1168 2917555526 2917554339 Bacteria 4987857
1169 2919107799 2919100787 Bacteria 7710546
1170 2919115385 2919114240 Bacteria 5700270
1171 2919167721 2919166419 Bacteria 4952238
1172 2919175328 2919171160 Bacteria 6499771
1173 2919409774 2919408235 Bacteria 6149349
1174 2920765571 2920760137 Bacteria 7427611
1175 2920824208 2920822456 Bacteria 6897201
1176 2921207792 2921201388 Bacteria 6926299
1177 2921210220 2921208531 Bacteria 6745326
1178 2921243784 2921237296 Bacteria 6876710
1179 2921250332 2921244191 Bacteria 6568419
1180 2921253042 2921250672 Bacteria 6677771
1181 2921260466 2921257292 Bacteria 6808382
1182 2921270423 2921263974 Bacteria 6864552
1183 2921289132 2921282425 Bacteria 6826397
1184 2921293500 2921289301 Bacteria 7316391
1185 2921304693 2921296804 Bacteria 7176999
1186 2922153783 2922151315 Bacteria 6902399
1187 2922165485 2922158528 Bacteria 6573167
1188 2922172416 2922172374 Bacteria 6167644
1189 2922193182 2922185730 Bacteria 7113964
1190 2923558141 2923556063 Bacteria 6793593
1191 2924147587 2924144063 Bacteria 6883928
1192 2924156407 2924150972 Bacteria 7169444
1193 2924165141 2924158325 Bacteria 7188855
1194 2924172834 2924165586 Bacteria 7260590
1195 2924179343 2924172951 Bacteria 6749356
1196 2924183014 2924179722 Bacteria 6843264
1197 2924192768 2924186466 Bacteria 6876637
1198 2924197849 2924193448 Bacteria 6955718
1199 2924206433 2924200457 Bacteria 6757188
1200 2924211544 2924207177 Bacteria 6917007
1201 2924215551 2924214083 Bacteria 7080103
1202 2924223354 2924221636 Bacteria 7113495
1203 2924234673 2924228884 Bacteria 6633132
1204 2924724939 2924718760 Bacteria 6331356
1205 2924726775 2924726620 Bacteria 6271473
1206 2924734645 2924733363 Bacteria 7574837
1207 2924745663 2924741084 Bacteria 6661321
1208 2924749306 2924748358 Bacteria 6154725
1209 2924763906 2924762789 Bacteria 6561353
1210 2924781591 2924776078 Bacteria 7492003
1211 2926756435 2926754445 Bacteria 5964435
1212 2929140609 2929138655 Bacteria 5810547
1213 2933008171 2933006813 Bacteria 4912075
1214 2933012950 2933011516 Bacteria 5439334
1215 2933575842 2933570622 Bacteria 7023390
1216 2933586927 2933586486 Bacteria 7667493
1217 2933602160 2933599457 Bacteria 5858799
1218 2935904835 2935901341 Bacteria 7341747
1219 2936373131 2936367885 Bacteria 7324495
1220 2936381276 2936375103 Bacteria 6652732
1221 2936384548 2936381700 Bacteria 7006523
1222 2936997725 2936996657 Bacteria 6298727
1223 2937007263 2937002841 Bacteria 6934057
1224 2937012432 2937009748 Bacteria 6746052
1225 2937022582 2937016420 Bacteria 6782579
1226 2937029207 2937023124 Bacteria 6815156
1227 2937031176 2937029754 Bacteria 6424026
1228 2937040878 2937036028 Bacteria 6846469
1229 2937049689 2937042894 Bacteria 6741576
1230 2937050085 2937049772 Bacteria 6757901
1231 2937059644 2937056579 Bacteria 7107896
1232 2937071207 2937063883 Bacteria 7199456
1233 2937075653 2937071275 Bacteria 6984483
1234 2937079970 2937078374 Bacteria 6610289
1235 2937086615 2937084907 Bacteria 6618516
1236 2937092275 2937091812 Bacteria 6979387
1237 2937105865 2937098957 Bacteria 7249374
1238 2937113125 2937106411 Bacteria 6947143
1239 2937117273 2937113482 Bacteria 6505872
1240 2937125322 2937119839 Bacteria 6597547
1241 2937130388 2937126314 Bacteria 6771275
1242 2937820452 2937813078 Bacteria 7783518
1243 2937827015 2937822353 Bacteria 7290551
1244 2937877058 2937868953 Bacteria 6639878
1245 2937879244 2937877337 Bacteria 7246526
1246 2937895067 2937891427 Bacteria 6357007
1247 2937975023 2937972304 Bacteria 7532020
1248 2937987121 2937980651 Bacteria 6517427
1249 2938016194 2938014810 Bacteria 6700592
1250 2939670875 2939669807 Bacteria 5028511
1251 2941499834 2941499720 Bacteria 7599444
1252 2957380848 2957375807 Bacteria 6425588
1253 2957388045 2957382221 Bacteria 6737050
1254 2957394237 2957388812 Bacteria 6778072
1255 2957399335 2957395598 Bacteria 6822399
1256 2957407900 2957402308 Bacteria 6741770
1257 2957412570 2957408893 Bacteria 6558585
1258 2957416076 2957415311 Bacteria 6991633
1259 2957422947 2957422303 Bacteria 7172205
1260 2957436773 2957430029 Bacteria 7022557
1261 2957439173 2957437181 Bacteria 6568994
1262 2957450059 2957443900 Bacteria 6869977
1263 2957456754 2957450854 Bacteria 6765715
1264 2957464632 2957457609 Bacteria 6967680
1265 2957470652 2957464669 Bacteria 6568877
1266 2957472321 2957471148 Bacteria 6797643
1267 2957483509 2957478035 Bacteria 6756658
1268 2957491516 2957484790 Bacteria 6703082
1269 2957494963 2957491536 Bacteria 6695180
1270 2957505071 2957498199 Bacteria 7126688
1271 2957505858 2957505466 Bacteria 7253085
1272 2958034998 2958034702 Bacteria 6989922
1273 2958042872 2958041894 Bacteria 13082850
1274 2958067198 2958064165 Bacteria 7158582
1275 2958086419 2958084443 Bacteria 7312792
1276 2958103293 2958100919 Bacteria 6800575
1277 2958111326 2958108152 Bacteria 6681128
1278 2958122566 2958115193 Bacteria 6923548
1279 2958123327 2958122699 Bacteria 7280457
1280 2958135989 2958130278 Bacteria 6897202
1281 2958139657 2958137437 Bacteria 6050276
1282 2958162786 2958158011 Bacteria 6058449
1283 2958174763 2958172287 Bacteria 6716688
1284 2958185455 2958179912 Bacteria 6874908
1285 2960590904 2960584000 Bacteria 6864594
1286 2960596136 2960591022 Bacteria 6622873
1287 2960602836 2960597568 Bacteria 6550735
1288 2960607246 2960603979 Bacteria 6898737
1289 2960614981 2960610863 Bacteria 6691244
1290 2960623209 2960617483 Bacteria 6727748
1291 2960626148 2960624210 Bacteria 6875384
1292 2960634634 2960631154 Bacteria 6732508
1293 2960639212 2960637947 Bacteria 7296468
1294 2960652682 2960645483 Bacteria 7211087
1295 2960666733 2960660292 Bacteria 7041660
1296 2960673335 2960667422 Bacteria 6763020
1297 2960680454 2960674078 Bacteria 6609048
1298 2960686832 2960680706 Bacteria 6624464
1299 2960693817 2960687367 Bacteria 6535474
1300 2960699783 2960693952 Bacteria 6749742
1301 2961083723 2961077736 Bacteria 7079850
1302 2961116969 2961114664 Bacteria 6680456
1303 2961131861 2961127735 Bacteria 7196641
1304 2961143269 2961136820 Bacteria 6775228
1305 2961187963 2961183825 Bacteria 6688536
1306 2963648583 2963644680 Bacteria 6530403
1307 2964611139 2964607997 Bacteria 7101408
1308 2964620759 2964615318 Bacteria 6809089
1309 2964628854 2964621998 Bacteria 6834995
1310 2964635924 2964628898 Bacteria 7083044
1311 2964637900 2964636051 Bacteria 7091832
1312 2964649144 2964643177 Bacteria 6820887
1313 2964655808 2964649959 Bacteria 6675118
1314 2964660213 2964656573 Bacteria 7100150
1315 2964666185 2964663802 Bacteria 7019362
1316 2964678088 2964670856 Bacteria 6851364
1317 2964679323 2964678106 Bacteria 6792020
1318 2964685372 2964685014 Bacteria 6839111
1319 2964698660 2964691889 Bacteria 6802758
1320 2964702081 2964698721 Bacteria 6765331
1321 2964709236 2964705432 Bacteria 7114648
1322 2964713771 2964712639 Bacteria 6695970
1323 2964719622 2964719344 Bacteria 7286602
1324 2965029242 2965025482 Bacteria 6532201
1325 2965036374 2965032056 Bacteria 6887443
1326 2965045730 2965040258 Bacteria 6855979
1327 2965052021 2965047637 Bacteria 6623551
1328 2965066304 2965062239 Bacteria 7412989
1329 2965093561 2965089291 Bacteria 6866420
1330 2965111352 2965110997 Bacteria 6693150
1331 2965121030 2965119406 Bacteria 6956431
1332 2967668635 2967664464 Bacteria 6948836
1333 2967674557 2967671571 Bacteria 7021409
1334 2967685642 2967678726 Bacteria 7264382
1335 2967688758 2967686174 Bacteria 6678622
1336 2967699141 2967693043 Bacteria 6804451
1337 2967699998 2967699805 Bacteria 6854538
1338 2967714348 2967706974 Bacteria 7186053
1339 2967720573 2967714385 Bacteria 7000047
1340 2967728166 2967721400 Bacteria 7073753
1341 2967734273 2967728569 Bacteria 6641507
1342 2967741289 2967735183 Bacteria 6827012
1343 2967753381 2967748971 Bacteria 6733771
1344 2967758003 2967755722 Bacteria 6814706
1345 2967769178 2967762386 Bacteria 6923502
1346 2967775278 2967769361 Bacteria 6587838
1347 2967782808 2967775926 Bacteria 6738189
1348 2968017538 2968016561 Bacteria 7022047
1349 2968083811 2968083720 Bacteria 7351627
1350 2968092434 2968091066 Bacteria 6052692
1351 2968100504 2968097103 Bacteria 6107094
1352 2968112877 2968110612 Bacteria 6814636
1353 2968122891 2968117919 Bacteria 6536078
1354 2968128836 2968128360 Bacteria 6270294
1355 2968143228 2968138860 Bacteria 6605449
1356 2970026393 2970019648 Bacteria 7072033
1357 2970032689 2970026789 Bacteria 6785236
1358 2970038229 2970033650 Bacteria 7118744
1359 2970041715 2970040964 Bacteria 6731123
1360 2970054893 2970047711 Bacteria 7088379
1361 2970060857 2970054988 Bacteria 6611507
1362 2970061919 2970061556 Bacteria 7099761
1363 2970075925 2970068827 Bacteria 7123112
1364 2970081099 2970076120 Bacteria 6697332
1365 2970084816 2970082768 Bacteria 6183754
1366 2970095255 2970088815 Bacteria 6933825
1367 2970099396 2970095765 Bacteria 6936963
1368 2970103658 2970102677 Bacteria 6812532
1369 2970112182 2970109326 Bacteria 6863976
1370 2970121827 2970116247 Bacteria 6501857
1371 2970127053 2970122695 Bacteria 6625855
1372 2970135106 2970129317 Bacteria 6806560
1373 2970136596 2970136068 Bacteria 7207982
1374 2970145546 2970143518 Bacteria 6446480
1375 2970155269 2970149975 Bacteria 6779706
1376 2970158385 2970156795 Bacteria 7168044
1377 2970168124 2970164137 Bacteria 6861252
1378 2970174827 2970170962 Bacteria 6876229
1379 2970181732 2970177841 Bacteria 6768001
1380 2970187945 2970184632 Bacteria 7054431
1381 2970193539 2970191845 Bacteria 7032787
1382 2970472286 2970469710 Bacteria 6969209
1383 2970489789 2970489779 Bacteria 6517260
1384 2970517946 2970510686 Bacteria 7006402
1385 2970538617 2970532167 Bacteria 6553173
1386 2970551932 2970547951 Bacteria 6931819
1387 2970593478 2970593180 Bacteria 7073582
1388 2970623570 2970619444 Bacteria 6986144
1389 2970632255 2970627176 Bacteria 6680862
1390 2977520720 2977516862 Bacteria 6940108
1391 2977524401 2977523885 Bacteria 6960446
1392 2977533833 2977530762 Bacteria 6951399
1393 2977542214 2977537788 Bacteria 6929320
1394 2977547234 2977544691 Bacteria 6875412
1395 2977557408 2977551784 Bacteria 7125765
1396 2977565875 2977558990 Bacteria 6863948
1397 2977571966 2977565890 Bacteria 6901543
1398 2977579124 2977572785 Bacteria 6763888
1399 2977585329 2977579622 Bacteria 6772100
1400 2977848752 2977843712 Bacteria 6753583
1401 2977860986 2977858184 Bacteria 6215359
1402 2977872035 2977864932 Bacteria 7534097
1403 2977879624 2977872689 Bacteria 7270173
1404 2977906562 2977898635 Bacteria 6675551
1405 2977911461 2977907340 Bacteria 6577984
1406 2977918666 2977915119 Bacteria 6829656
1407 2977937525 2977935797 Bacteria 6252826
1408 2977946127 2977942078 Bacteria 7570577
1409 2977954012 2977950692 Bacteria 6893264
1410 2977958592 2977957713 Bacteria 6877875
1411 2977976383 2977971508 Bacteria 7472917
1412 2978974176 2978969890 Bacteria 5400756
1413 2979106075 2979100975 Bacteria 5423623
1414 2979713993 2979710463 Bacteria 6785254
1415 2979775257 2979772303 Bacteria 6618277
1416 2979779950 2979779861 Bacteria 6219781
1417 2984512136 2984509177 Bacteria 5274802
1418 2984521503 2984518228 Bacteria 5277463
1419 2984540797 2984537506 Bacteria 5277481
1420 2984589504 2984587000 Bacteria 5263363
1421 2984603064 2984601300 Bacteria 5455244
1422 2987640796 2987636660 Bacteria 8088555
1423 2987645728 2987645492 Bacteria 6117018
1424 2987656479 2987652177 Bacteria 6969023
1425 2987670374 2987666974 Bacteria 6509233
1426 2987680961 2987673487 Bacteria 6884027
1427 2989352916 2989349275 Bacteria 6349068
1428 2989773707 2989771324 Bacteria 5605128
1429 2989778755 2989776772 Bacteria 4843317
1430 2996341813 2996336353 Bacteria 5511628
1431 2996348852 2996341866 Bacteria 6643098
1432 2996351157 2996348954 Bacteria 7239054
1433 2996388322 2996386984 Bacteria 6978667
1434 2996892439 2996887358 Bacteria 5795980
1435 2996898451 2996893221 Bacteria 5823108
1436 3000136251 3000135777 Bacteria 6891109
1437 3003933386 3003930520 Bacteria 5667563
1438 3004170109 3004167301 Bacteria 8330599
1439 3004202782 3004195979 Bacteria 6776956
1440 3004208993 3004203850 Bacteria 7307914
1441 3004238452 3004232784 Bacteria 6662140
1442 3004246039 3004239961 Bacteria 6892290
1443 3004254527 3004248173 Bacteria 6563236
1444 3004269797 3004268573 Bacteria 7043476
1445 3004277855 3004275668 Bacteria 7114440
1446 3004291749 3004289098 Bacteria 6135450
1447 3004340332 3004334049 Bacteria 8449246
1448 3005409646 3005409236 Bacteria 7188837
1449 3005420363 3005416602 Bacteria 7064308
1450 3005447248 3005445848 Bacteria 6906074
1451 3005453957 3005452660 Bacteria 5889319
1452 637073634 637000159 Bacteria 7596297
1453 639648140 639633055 Bacteria 7751309
1454 643825501 643692032 Bacteria 6891900
1455 648740132 648276728 Bacteria 6968865
1456 649873570 649633066 Bacteria 6690028
1457 8001848689 8001845381 Bacteria 5804942
1458 8002286145 8002285264 Bacteria 6717907
1459 8003570898 8003570095 Bacteria 5747666
1460 8003993333 8003992118 Bacteria 7266902
1461 8004000589 8003999396 Bacteria 7063185
1462 8004306595 8004300914 Bacteria 6132239
1463 8004313773 8004312739 Bacteria 7444653
1464 8004364202 8004361976 Bacteria 6858373
1465 8004393856 8004387939 Bacteria 7049250
1466 8004450054 8004445564 Bacteria 6322258
1467 8004643190 8004640170 Bacteria 6723001
1468 8004714526 8004703790 Bacteria 8006957
1469 8004719652 8004714634 Bacteria 6776161
1470 8005248307 8005246636 Bacteria 4933972
1471 8005259721 8005258706 Bacteria 6184835
1472 8005280210 8005275841 Bacteria 6929066
1473 8005288277 8005282627 Bacteria 6675747
1474 8005294803 8005289223 Bacteria 6634003
1475 8005307038 8005301065 Bacteria 6614431
1476 8005314553 8005307578 Bacteria 7395396
1477 8005317314 8005314921 Bacteria 7072929
1478 8005326966 8005321885 Bacteria 5795980
1479 8005378789 8005376324 Bacteria 6590079
1480 8005388011 8005382845 Bacteria 6732062
1481 8005397034 8005395548 Bacteria 6806915
1482 8005433241 8005430974 Bacteria 6689030
1483 8005462522 8005460587 Bacteria 7157962
1484 8005486622 8005484373 Bacteria 6297373
1485 8005499900 8005497431 Bacteria 6477605
1486 8005544877 8005542996 Bacteria 7077758
1487 8005558109 8005556819 Bacteria 6908598
1488 8005569287 8005563573 Bacteria 7153261
1489 8005575436 8005570704 Bacteria 6957481
1490 8005621267 8005619151 Bacteria 7030230
1491 8005631433 8005626139 Bacteria 6534237
1492 8005646236 8005645114 Bacteria 6950293
1493 8005659423 8005658619 Bacteria 4500593
1494 8005671318 8005668836 Bacteria 6953162
1495 8005686370 8005682033 Bacteria 6726518
1496 8005694952 8005688590 Bacteria 6610080
1497 8005696152 8005695170 Bacteria 6912330
1498 8018129562 8018127388 Bacteria 7351159
1499 8018155608 8018150411 Bacteria 5549903
1500 8018168103 8018163183 Bacteria 7277977
1501 8018177899 8018176218 Bacteria 6896178
1502 8023680977 8023680758 Bacteria 7729763
1503 8024485753 8024479707 Bacteria 6954785
1504 8024492570 8024486573 Bacteria 6540512
1505 8024505219 8024501048 Bacteria 6427847
1506 8046770330 8046767195 Bacteria 7547379
1507 8049294388 8049293176 Bacteria 6128433
1508 8055435053 8055431914 Bacteria 4551896
1509 8056380146 8056375014 Bacteria 7006639
1510 8056387549 8056382006 Bacteria 6408074
1511 8056876763 8056875544 Bacteria 4355797
1512 8057578260 8057575449 Bacteria 7367519
1513 8057875492 8057874678 Bacteria 7494653
1514 Ga0500555_003659
1515 JGI24740J21852_10000001
1516 JGI25155J39150_1000011
1517 JGI25156J39149_1000027
1518 JGI25156J39149_1000030
1519 JGI25156J39149_1011404
1520 JGI25162J39368_1000351
1521 JGI25162J39368_1001364
1522 JGI25162J39368_1002538
1523 JGI25154J39366_1000057
1524 JGI25158J39367_1000245
1525 JGI25158J39367_1009771
1526 JGI25157J39369_1000010
1527 JGI25157J39369_1000604
1528 JGI25152J39213_1000288
1529 JGI25152J39213_1000724
1530 JGI25152J39213_1002131
1531 JGI25152J39213_1003666
1532 JGI25152J39213_1011614
1533 JGI25150J39212_1000010
1534 JGI25159J45721_1000006
1535 JGI25159J45721_1000683
1536 JGI25151J46595_10000026
1537 JGI25151J46595_10000238
1538 JGI25151J46595_10007967
1539 JGI25151J46595_10038293
1540 JGI25406J46586_10009023
1541 JGI25406J46586_10027468
1542 JGI25165J46597_1000033
1543 JGI25165J46597_1000189
1544 JGI25165J46597_1000777
1545 JGI25153J46596_10003069
1546 JGI25153J46596_10028474
1547 JGI25153J46596_10028476
1548 JGI25153J46596_10044121
1549 rootL2_10135068
1550 JGI25160J50197_1000004
1551 JGI25160J50197_1000019
1552 JGI25160J50197_1001596
1553 JGI25161J50226_1000003
1554 JGI25161J50226_1000330
1555 JGI25161J50226_1001454
1556 JGI25161J50226_1005034
1557 Ga0055539_1004539
1558 Ga0055526_1000382
1559 Ga0055526_1000565
1560 Ga0055526_1000669
1561 Ga0055526_1004202
1562 Ga0055524_1003035
1563 Ga0055524_1004474
1564 Ga0055524_1004820
1565 Ga0055524_1007966
1566 Ga0055524_1010914
1567 Ga0055536_1000212
1568 Ga0055536_1005870
1569 Ga0055536_1012344
1570 Ga0055528_1000918
1571 Ga0055528_1003069
1572 Ga0055528_1005988
1573 Ga0055528_1006131
1574 Ga0055528_1006493
1575 Ga0055528_1006683
1576 Ga0055528_1019407
1577 Ga0055530_10000740
1578 Ga0055530_10007317
1579 Ga0055530_10016645
1580 Ga0055540_1000285
1581 Ga0055540_1001884
1582 Ga0055540_1002932
1583 Ga0055540_1014240
1584 Ga0055531_10001165
1585 Ga0055531_10004924
1586 Ga0058692_1002385
1587 Ga0055543_1000001
1588 Ga0055543_1000019
1589 Ga0055543_1000147
1590 Ga0055543_1000808
1591 Ga0065165_1000049
1592 Ga0065165_1000180
1593 Ga0065165_1000277
1594 Ga0065165_1005991
1595 Ga0070658_10065948
1596 Ga0070658_10080578
1597 Ga0070676_10034424
1598 Ga0070670_100001443
1599 Ga0070680_100085741
1600 Ga0070660_100057146
1601 Ga0070660_100095551
1602 Ga0070689_100083799
1603 Ga0070691_10000580
1604 Ga0070668_100005749
1605 Ga0070668_100016044
1606 Ga0070668_100022821
1607 Ga0070668_100088881
1608 Ga0070671_100010443
1609 Ga0070671_100030699
1610 Ga0070671_100368037
1611 Ga0070673_100038873
1612 Ga0070688_100168247
1613 Ga0070659_100000206
1614 Ga0070659_100007044
1615 Ga0070659_100221241
1616 Ga0070667_100036538
1617 Ga0070667_100043831
1618 Ga0070711_100036164
1619 Ga0070663_100171843
1620 Ga0070681_10015949
1621 Ga0070681_10091580
1622 Ga0070707_100033261
1623 Ga0070679_100077472
1624 Ga0070684_100073150
1625 Ga0068853_100374454
1626 Ga0070696_100046383
1627 Ga0070665_100000116
1628 Ga0070665_100058585
1629 Ga0070665_100118304
1630 Ga0070665_100263157
1631 Ga0068855_100024601
1632 Ga0068855_100154427
1633 Ga0068855_100155438
1634 Ga0068855_100209386
1635 Ga0070664_100093010
1636 Ga0068857_100121917
1637 Ga0068854_100034387
1638 Ga0068854_100107903
1639 Ga0068856_100042875
1640 Ga0068852_100195717
1641 Ga0068859_100008475
1642 Ga0068859_100102241
1643 Ga0068859_100421453
1644 Ga0068864_100091486
1645 Ga0068864_100097380
1646 Ga0068864_100114133
1647 Ga0068861_100184759
1648 Ga0068863_100068534
1649 Ga0068863_100090185
1650 Ga0068860_100000145
1651 Ga0068860_100005851
1652 Ga0068862_100013415
1653 Ga0068862_100015461
1654 Ga0068862_100372155
1655 Ga0081538_10002190
1656 Ga0081540_1008246
1657 Ga0081540_1012786
1658 Ga0081539_10001354
1659 Ga0070717_10131058
1660 Ga0070717_10307172
1661 Ga0075365_10005577
1662 Ga0075365_10013397
1663 Ga0075365_10016756
1664 Ga0075365_10017898
1665 Ga0075365_10145404
1666 Ga0075363_100008477
1667 Ga0075364_10031424
1668 Ga0070712_100303606
1669 Ga0075362_10004704
1670 Ga0075362_10020925
1671 Ga0075362_10059651
1672 Ga0075367_10003238
1673 Ga0075367_10041909
1674 Ga0075369_10080883
1675 Ga0075366_10001654
1676 Ga0075366_10008896
1677 Ga0075366_10137519
1678 Ga0075428_100001218
1679 Ga0075428_100129102
1680 Ga0075430_100044128
1681 Ga0075431_100000613
1682 Ga0075431_100017312
1683 Ga0075431_100018072
1684 Ga0075431_100208114
1685 Ga0075434_100011257
1686 Ga0075429_100013425
1687 Ga0068865_100001650
1688 Ga0097620_100008475
1689 Ga0097620_100102253
1690 Ga0097620_100421511
1691 Ga0079104_1000187
1692 Ga0079104_1001924
1693 Ga0105240_10000005
1694 Ga0105240_10015964
1695 Ga0105240_10027898
1696 Ga0105240_10066214
1697 Ga0105240_10544402
1698 Ga0111539_10203844
1699 Ga0111539_10375644
1700 Ga0105247_10008257
1701 Ga0114129_10004627
1702 Ga0114129_10064420
1703 Ga0105248_10000154
1704 Ga0105237_10000708
1705 Ga0105237_10025668
1706 Ga0105237_10169520
1707 Ga0105238_10017778
1708 Ga0105238_10104877
1709 Ga0105238_10174121
1710 Ga0105238_10291902
1711 Ga0105249_10002692
1712 Ga0123341_1000001
1713 Ga0123342_1008195
1714 Ga0123342_1034638
1715 Ga0105239_10000739
1716 Ga0105239_10028635
1717 Ga0105239_10130617
1718 Ga0105239_10312229
1719 Ga0105246_10280664
1720 Ga0157371_10005765
1721 Ga0157370_10000284
1722 Ga0157370_10105632
1723 Ga0157369_10182886
1724 Ga0171463_1011
1725 Ga0163163_10135021
1726 Ga0163163_10197852
1727 Ga0182008_10021177
1728 Ga0157377_10008119
1729 Ga0182006_1043239
1730 Ga0182005_1006504
1731 Ga0183363_1111
1732 Ga0214542_1000015
1733 Ga0214542_1019302
1734 Ga0214543_1000011
1735 Ga0214543_1000032
1736 Ga0213876_10024578
1737 Ga0213876_10041739
1738 Ga0228711_1000012
1739 Ga0228710_1000006
1740 Ga0209435_100022
1741 Ga0209436_100038
1742 Ga0209436_100837
1743 Ga0209437_100160
1744 Ga0209437_100310
1745 Ga0207425_1000010
1746 Ga0207425_1001758
1747 Ga0209646_1000078
1748 Ga0209026_1000002
1749 Ga0209026_1000065
1750 Ga0209026_1012621
1751 Ga0209677_101256
1752 Ga0209148_1000570
1753 Ga0209759_1000055
1754 Ga0209759_1000119
1755 Ga0209129_1000099
1756 Ga0209129_1000432
1757 Ga0209129_1000442
1758 Ga0209129_1001010
1759 Ga0209129_1001971
1760 Ga0209129_1002862
1761 Ga0209233_1000027
1762 Ga0209233_1000168
1763 Ga0209233_1000269
1764 Ga0209233_1000303
1765 Ga0209455_1000204
1766 Ga0209673_1000068
1767 Ga0209673_1000139
1768 Ga0209673_1001538
1769 Ga0209673_1001716
1770 Ga0209673_1002227
1771 Ga0209673_1002802
1772 Ga0209673_1005579
1773 Ga0209673_1035943
1774 Ga0209130_1000007
1775 Ga0209130_1000012
1776 Ga0209130_1000097
1777 Ga0209676_1000399
1778 Ga0209676_1006026
1779 Ga0209025_1000022
1780 Ga0209025_1000237
1781 Ga0209025_1000358
1782 Ga0209025_1000729
1783 Ga0209025_1000923
1784 Ga0209025_1000949
1785 Ga0209025_1004865
1786 Ga0209025_1014684
1787 Ga0209025_1021924
1788 Ga0209025_1024577
1789 Ga0209025_1026821
1790 Ga0209564_1000140
1791 Ga0209564_1000794
1792 Ga0209564_1000802
1793 Ga0209564_1000868
1794 Ga0209564_1001618
1795 Ga0209564_1005687
1796 Ga0209564_1029829
1797 Ga0209564_1032595
1798 Ga0209758_1000086
1799 Ga0209758_1000155
1800 Ga0209758_1000545
1801 Ga0209758_1000587
1802 Ga0209758_1001100
1803 Ga0209758_1002445
1804 Ga0209758_1009072
1805 Ga0209758_1026976
1806 Ga0209758_1050684
1807 Ga0209050_1000200
1808 Ga0209050_1000650
1809 Ga0209050_1005095
1810 Ga0209050_1012900
1811 Ga0209256_1000557
1812 Ga0209256_1000687
1813 Ga0209256_1001048
1814 Ga0209256_1001371
1815 Ga0209256_1004371
1816 Ga0209256_1007616
1817 Ga0209256_1008484
1818 Ga0209256_1031180
1819 Ga0207426_1000003
1820 Ga0207426_1000010
1821 Ga0207426_1000111
1822 Ga0207426_1001840
1823 Ga0207426_1002511
1824 Ga0209051_1000095
1825 Ga0209051_1001031
1826 Ga0209051_1001191
1827 Ga0209051_1003503
1828 Ga0209051_1007144
1829 Ga0209051_1018527
1830 Ga0209257_1000225
1831 Ga0209257_1001135
1832 Ga0209257_1001962
1833 Ga0209257_1002482
1834 Ga0209257_1003296
1835 Ga0207647_10009171
1836 Ga0207645_10047975
1837 Ga0207705_10002109
1838 Ga0207684_10044863
1839 Ga0207707_10043776
1840 Ga0207695_10000011
1841 Ga0207695_10001670
1842 Ga0207695_10001727
1843 Ga0207695_10032467
1844 Ga0207695_10040997
1845 Ga0207695_10109166
1846 Ga0207671_10000544
1847 Ga0207663_10056508
1848 Ga0207660_10024849
1849 Ga0207660_10229845
1850 Ga0207657_10009919
1851 Ga0207657_10011260
1852 Ga0207657_10031173
1853 Ga0207652_10099157
1854 Ga0207646_10009642
1855 Ga0207646_10203736
1856 Ga0207694_10043945
1857 Ga0207650_10002090
1858 Ga0207650_10034339
1859 Ga0207650_10043564
1860 Ga0207687_10135206
1861 Ga0207687_10208249
1862 Ga0207644_10019674
1863 Ga0207690_10000129
1864 Ga0207690_10069496
1865 Ga0207670_10076286
1866 Ga0207711_10003316
1867 Ga0207689_10037734
1868 Ga0207679_10209322
1869 Ga0207667_10012057
1870 Ga0207667_10076819
1871 Ga0207667_10094113
1872 Ga0207651_10001247
1873 Ga0207651_10153666
1874 Ga0207712_10003857
1875 Ga0207668_10005551
1876 Ga0207668_10019991
1877 Ga0207668_10097082
1878 Ga0207640_10184906
1879 Ga0207658_10014480
1880 Ga0207658_10030279
1881 Ga0207703_10155370
1882 Ga0207639_10012996
1883 Ga0207678_10196436
1884 Ga0207678_10238197
1885 Ga0207702_10306121
1886 Ga0207641_10080568
1887 Ga0207641_10196921
1888 Ga0207648_10280931
1889 Ga0207676_10092246
1890 Ga0207676_10157549
1891 Ga0207674_10037025
1892 Ga0207674_10313778
1893 Ga0207675_100088449
1894 Ga0207675_100106878
1895 Ga0207698_10032339
1896 Ga0207698_10156809
1897 Ga0209281_1000310
1898 Ga0209281_1000334
1899 Ga0209281_1000361
1900 Ga0209371_1000021
1901 Ga0209371_1000469
1902 Ga0209371_1001465
1903 Ga0209981_1001336
1904 Ga0209282_1000073
1905 Ga0207428_10143703
1906 Ga0268266_10000064
1907 Ga0268266_10096180
1908 Ga0268266_10118022
1909 Ga0268265_10296647
1910 Ga0268264_10000046
1911 Ga0268264_10008753
1912 Ga0307517_10012250
1913 Ga0307515_10000844
1914 Ga0307515_10004389
1915 Ga0307515_10013773
1916 Ga0307515_10020621
1917 Ga0307515_10136352
1918 Ga0265338_10102967
1919 Ga0268256_1000020
1920 Ga0268256_1001794
1921 Ga0268256_1005314
1922 Ga0307511_10020348
1923 Ga0316181_1029502
1924 Ga0265332_10002681
1925 Ga0265340_10004410
1926 Ga0265340_10007323
1927 Ga0265340_10045900
1928 Ga0265340_10058938
1929 Ga0265339_10005244
1930 Ga0265331_10076144
1931 Ga0265327_10010519
1932 Ga0265316_10019975
1933 Ga0265316_10144053
1934 Ga0265316_10153431
1935 Ga0265316_10174053
1936 Ga0307513_10001153
1937 Ga0307513_10002223
1938 Ga0307513_10126591
1939 Ga0307513_10131453
1940 Ga0307513_10246589
1941 Ga0307408_100044283
1942 Ga0307408_100106122
1943 Ga0265313_10000115
1944 Ga0265313_10005411
1945 Ga0265342_10000291
1946 Ga0265342_10004760
1947 Ga0307405_10000865
1948 Ga0315914_1000008
1949 Ga0307409_100090327
1950 Ga0307415_100156003
1951 Ga0307510_10215800
1952 Ga0315913_1000688
1953 Ga0315915_1000014
1954 Ga0373936_0001078
1955 Ga0373955_0006909
1956 Ga0373935_0180676
1957 Ga0373947_0103714
1958 Ga0373937_0003965
1959 Ga0316582_0178570
1960 Ga0395900_0105421
1961 Ga0395900_0148717
1962 Ga0395898_0129795
1963 Ga0395905_0000325
1964 Ga0395905_0013938
1965 Ga0395905_0018905
1966 Ga0395905_0036384
1967 Ga0395905_0084322
1968 Ga0395905_0118398
1969 Ga0395905_0151442
1970 Ga0395905_0203822
1971 Ga0395905_0362075
1972 Ga0395901_0034892
1973 Ga0395901_0080149
1974 Ga0436365_1022390
1975 Ga0436365_1373120
1976 Ga0436365_1821915
1977 Ga0436360_1164335
1978 Ga0439436_0005547
1979 Ga0439447_014419
1980 Ga0439465_0002132
1981 Ga0439465_0008511
1982 Ga0439465_0009217
1983 Ga0439449_0016399
1984 Ga0439462_0020296
1985 Ga0439434_0006059
1986 Ga0450918_004111
1987 Ga0439440_0026012
1988 Ga0466972_0016538
1989 Ga0466957_0006564
1990 Ga0451576_0255328
1991 Ga0495638_0000335
1992 Ga0495638_0070997
1993 Ga0495605_0008898
1994 Ga0495585_0085021
1995 Ga0495583_0040752
1996 Ga0495606_0001859
1997 Ga0495610_0006199
1998 Ga0495616_0072333
1999 Ga0495620_0011481
2000 Ga0495620_0037347
2001 Ga0495628_0096660
2002 Ga0495631_0044543
2003 Ga0495632_0007829
2004 Ga0495632_0016533
2005 Ga0495632_0054495
2006 Ga0495643_0017640
2007 Ga0495643_0019594
2008 Ga0495648_0078720
2009 Ga0495642_0003747
2010 Ga0495652_0145320
2011 Ga0495654_0006825
2012 Ga0495609_0047737
2013 Ga0495597_0037496
2014 Ga0495597_0051685
2015 Ga0495622_0023852
2016 Ga0495656_0013990
2017 Ga0495668_0026182
2018 Ga0495668_0036672
2019 Ga0495668_0044359
2020 Ga0495634_0102449
2021 Ga0495625_0003150
2022 Ga0495625_0022163
2023 Ga0495625_0121613
2024 Ga0495588_0001585
2025 Ga0495657_0041914
2026 Ga0495623_0135070
2027 Ga0495669_0020443
2028 Ga0495613_0004373
2029 Ga0495671_0072418
2030 Ga0495600_0083742
2031 Ga0495681_0002954
2032 Ga0495686_0004865
2033 Ga0495686_0023724
2034 Ga0495686_0032058
2035 Ga0495686_0075994
2036 Ga0495686_0149061
2037 Ga0495602_0125809
2038 Ga0496100_0139285
2039 Ga0496101_0077391
2040 Ga0496102_0187894
2041 Ga0496103_0211605
2042 Ga0496105_0127464
2043 Ga0496105_0151629
2044 Ga0496105_0288371
2045 Ga0496106_0004921
2046 Ga0496107_0141570
2047 Ga0496110_0151666
2048 Ga0496111_0001499
2049 Ga0496112_0033343
2050 Ga0496112_0050254
2051 Ga0496112_0161662
2052 Ga0496112_0176656
2053 Ga0496114_0305178
2054 Ga0496115_0000598
2055 Ga0496115_0013865
2056 Ga0496116_0000043
2057 Ga0496116_0005367
2058 Ga0496116_0008089
2059 Ga0496116_0009102
2060 Ga0496116_0089980
2061 Ga0496117_0000338
2062 Ga0496117_0018243
2063 Ga0496117_0053521
2064 Ga0496117_0074710
2065 Ga0496117_0112688
2066 Ga0496118_0000958
2067 Ga0496118_0012461
2068 Ga0496118_0058725
2069 Ga0496119_0000407
2070 Ga0496119_0020566
2071 Ga0496119_0118030
2072 Ga0496120_0000589
2073 Ga0496120_0001472
2074 Ga0496120_0039468
2075 Ga0496121_0000003
2076 Ga0496121_0002723
2077 Ga0496121_0009941
2078 Ga0496121_0015230
2079 Ga0496121_0021685
2080 Ga0496121_0243555
2081 Ga0496122_0000025
2082 Ga0496122_0001020
2083 Ga0496122_0011791
2084 Ga0496122_0016499
2085 Ga0496122_0045297
2086 Ga0496122_0060685
2087 Ga0496122_0066491
2088 Ga0496122_0080187
2089 Ga0496123_0000032
2090 Ga0496123_0000043
2091 Ga0496123_0005929
2092 Ga0496123_0033060
2093 Ga0496123_0034781
2094 Ga0496124_0004564
2095 Ga0496124_0009370
2096 Ga0496124_0017870
2097 Ga0496124_0023770
2098 Ga0496124_0043644
2099 Ga0496124_0057788
2100 Ga0496124_0116299
2101 Ga0496124_0122643
2102 Ga0496124_0164845
2103 Ga0496125_0000141
2104 Ga0496125_0000946
2105 Ga0496125_0047515
2106 Ga0496125_0076177
2107 Ga0496125_0091985
2108 Ga0496126_0000362
2109 Ga0496126_0001471
2110 Ga0496126_0094112
2111 Ga0496126_0282256
2112 Ga0501031_0000095
2113 Ga0501032_0000084
2114 Ga0501032_0018154
2115 Ga0501033_0000102
2116 Ga0501033_0002401
2117 Ga0501033_0109595
2118 Ga0501033_0216347
2119 Ga0501034_0001404
2120 Ga0501034_0002050
2121 Ga0501034_0051983
2122 Ga0501034_0063545
2123 Ga0501034_0070355
2124 Ga0501034_0114321
2125 Ga0501034_0119062
2126 Ga0501034_0146432
2127 Ga0501034_0221666
2128 Ga0501034_0269726
2129 Ga0501036_0000040
2130 Ga0501036_0099353
2131 Ga0501036_0133787
2132 Ga0501037_0000098
2133 Ga0501037_0116670
2134 Ga0501037_0127251
2135 Ga0501038_0000002
2136 Ga0501038_0041862
2137 Ga0501038_0079363
2138 Ga0501038_0087687
2139 Ga0501038_0204517
2140 Ga0501039_0000002
2141 Ga0501039_0070611
2142 Ga0501039_0123771
2143 Ga0501040_0018811
2144 Ga0501040_0087537
2145 Ga0501041_0085751
2146 Ga0501043_0006479
2147 Ga0501043_0091348
2148 Ga0501046_0040082
2149 Ga0501046_0040474
2150 Ga0501046_0097247
2151 Ga0501047_0002237
2152 Ga0501047_0009623
2153 Ga0501047_0039107
2154 Ga0501047_0152057
2155 Ga0501047_0207448
2156 Ga0501067_0027657
2157 Ga0501067_0103293
2158 Ga0501070_0001215
2159 Ga0501070_0007158
2160 Ga0501070_0012619
2161 Ga0501070_0100753
2162 Ga0501070_0130711
2163 Ga0501070_0134744
2164 Ga0501070_0161841
2165 Ga0501073_0021969
2166 Ga0501073_0068421
2167 Ga0501073_0102510
2168 Ga0501074_0078145
2169 Ga0501074_0122459
2170 Ga0501074_0156517
2171 Ga0501075_0053150
2172 Ga0501077_0008398
2173 Ga0501077_0061769
2174 Ga0501079_0016684
2175 Ga0501079_0189767
2176 Ga0501080_0115959
2177 Ga0501080_0116216
2178 Ga0501081_0002292
2179 Ga0501083_0008060
2180 Ga0501083_0087908
2181 Ga0501083_0122816
2182 Ga0501280_001402
2183 Ga0501035_0000163
2184 Ga0501035_0000636
2185 Ga0501035_0006001
2186 Ga0501035_0053793
2187 Ga0501035_0100213
2188 Ga0501035_0119403
2189 Ga0501035_0158231
2190 Ga0501044_0000002
2191 Ga0501044_0008237
2192 Ga0501044_0101028
2193 Ga0501044_0122644
2194 Ga0501044_0129502
2195 Ga0501044_0171180
2196 nmdc:mga00v17_115039_c1
2197 nmdc:mga0yw44_22286_c1
2198 nmdc:mga0yw44_2486_c2
2199 nmdc:mga0k408_85117_c1
2200 nmdc:mga06z11_11767_c1
2201 nmdc:mga05p37_3347_c1
2202 nmdc:mga05p37_51639_c1
2203 nmdc:mga06r32_173970_c1
2204 nmdc:mga06r32_397_c1
2205 nmdc:mga06r32_4570_c1
2206 nmdc:mga06r32_65217_c1
2207 nmdc:mga08y16_125660_c1
2208 nmdc:mga08y16_184_c1
2209 nmdc:mga08y16_317269_c1
2210 nmdc:mga08y16_341208_c1
2211 nmdc:mga0n895_34584_c1
2212 nmdc:mga0n895_83347_c1
2213 nmdc:mga0rr50_112960_c1
2214 nmdc:mga0a205_189122_c1
2215 nmdc:mga0sz30_40695_c1
2216 Ga0495601_0026160
2217 Ga0495601_0051134
2218 Ga0500610_0068381
2219 Ga0500610_0104760
2220 Ga0495595_0004834
2221 Ga0495619_0084124
2222 Ga0495619_0132219
2223 Ga0495619_0196040
2224 Ga0500578_0059011
2225 Ga0500643_029906
2226 Ga0500643_040753
2227 Ga0500556_0000048
2228 Ga0500557_000677
2229 Ga0500560_035252
2230 Ga0500569_038673
2231 Ga0500572_017220
2232 Ga0500595_010690
2233 Ga0500618_001230
2234 Ga0500618_001417
2235 Ga0500652_000002
2236 Ga0500658_0001009
2237 Ga0500568_0005268
2238 Ga0500568_0007791
2239 Ga0500573_0005547
2240 Ga0500573_0052004
2241 Ga0500604_0015719
2242 Ga0500604_0023625
2243 Ga0500616_0000417
2244 Ga0500616_0003179
2245 Ga0500616_0008458
2246 Ga0500616_0050895
2247 Ga0500620_000455
2248 Ga0500620_025179
2249 Ga0500622_0002220
2250 Ga0500622_0002307
2251 Ga0500624_000439
2252 Ga0500634_0105582
2253 Ga0500636_0000065
2254 Ga0500636_0007738
2255 Ga0500645_004747
2256 Ga0587090_002011
2257 Ga0501082_0001446
2258 Ga0530510_0041490
2259 Ga0530510_0117563
2260 2503202580
2261 2509107866
2262 2509114387
2263 2509373176
2264 2509376263
2265 2509387053
2266 2509397094
2267 2509442549
2268 2510132910
2269 2510307048
2270 2510317137
2271 2510894282
2272 2510899307
2273 2511133714
2274 2511175907
2275 2511183665
2276 2511198275
2277 2511501367
2278 2512532786
2279 2512930643
2280 2512958390
2281 2512971882
2282 2513570003
2283 2513575258
2284 2513587778
2285 2513592683
2286 2513598983
2287 2513606284
2288 2513614329
2289 2513617802
2290 2513633054
2291 2513710225
2292 2513869377
2293 2513886247
2294 2513906302
2295 2513909796
2296 2513926565
2297 2513987423
2298 2514000276
2299 2514005433
2300 2514019905
2301 2514038355
2302 2515111862
2303 2515611495
2304 2515633647
2305 2515642190
2306 2515656245
2307 2515738956
2308 2516209241
2309 2516892645
2310 2517035580
2311 2517076039
2312 2517094779
2313 2517406406
2314 2517569460
2315 2520376175
2316 2523470300
2317 2524452873
2318 2524460395
2319 2530645162
2320 2535516179
2321 2537874643
2322 2551682279
2323 2551684602
2324 2551693591
2325 2551703232
2326 2551708983
2327 2551719087
2328 2551730633
2329 2551736439
2330 2551740115
2331 2558863131
2332 2561466540
2333 2585168293
2334 2585199899
2335 2585225873
2336 2585268920
2337 2585270604
2338 2585276951
2339 2585324049
2340 2585333558
2341 2585389445
2342 2585393944
2343 2585400737
2344 2585528181
2345 2585534743
2346 2585540389
2347 2585546833
2348 2585551812
2349 2585558309
2350 2585819703
2351 2585838588
2352 2585845802
2353 2585897701
2354 2585904703
2355 2585995665
2356 2586000233
2357 2587980181
2358 2588516292
2359 2599333423
2360 2599418004
2361 2599602210
2362 2599721195
2363 2599939613
2364 2600192322
2365 2600374450
2366 2616292789
2367 2616308324
2368 2616556616
2369 2617381674
2370 2643772816
2371 2643775645
2372 2643794092
2373 2643808403
2374 2643811848
2375 2643855518
2376 2643919146
2377 2643987151
2378 2644000218
2379 2644005861
2380 2644049569
2381 2644066503
2382 2644109535
2383 2644132117
2384 2644145219
2385 2644155702
2386 2644204023
2387 2644207611
2388 2644300411
2389 2644307800
2390 2644332576
2391 2644378092
2392 2644415284
2393 2644450315
2394 2644482603
2395 2644494720
2396 2644499104
2397 2644544322
2398 2644613889
2399 2644654582
2400 2644658635
2401 2644677898
2402 2644687867
2403 2657683709
2404 2671115720
2405 2688599139
2406 2692316437
2407 2694631984
2408 2694634595
2409 2719180800
2410 2719385439
2411 2719665266
2412 2719731549
2413 2720491686
2414 2720612940
2415 2720619799
2416 2720631230
2417 2720774957
2418 2721146894
2419 2721158421
2420 2721163773
2421 2721399188
2422 2722839943
2423 2723026594
2424 2723560198
2425 2723566777
2426 2724038001
2427 2724044305
2428 2724089564
2429 2724104042
2430 2724109858
2431 2725952354
2432 2730107530
2433 2730164037
2434 2730298053
2435 2738799237
2436 2738945516
2437 2739038314
2438 2739307930
2439 2739350337
2440 2756676985
2441 2766067891
2442 2776913336
2443 2778176461
2444 2792581201
2445 2792623209
2446 2792626973
2447 2792642491
2448 2793279470
2449 2793299210
2450 2793313847
2451 2793321223
2452 2793326362
2453 2793336947
2454 2793344838
2455 2793347742
2456 2793352296
2457 2793360358
2458 2793366434
2459 2802718878
2460 2802726489
2461 2802733781
2462 2802738387
2463 2802744719
2464 2802751075
2465 2804751854
2466 2805927623
2467 2805936099
2468 2806045510
2469 2806051685
2470 2806061729
2471 2806067910
2472 2806072738
2473 2819241971
2474 2819559991
2475 2819610425
2476 2819638160
2477 2819687401
2478 2821127714
2479 2828309734
2480 2837653802
2481 2837679465
2482 2837682943
2483 2838018794
2484 2838025500
2485 2838034617
2486 2838040942
2487 2838043101
2488 2838052134
2489 2838067255
2490 2838071361
2491 2838079320
2492 2838666212
2493 2838670065
2494 2838676409
2495 2838689112
2496 2838697164
2497 2838702437
2498 2838715292
2499 2838720908
2500 2838726050
2501 2838730447
2502 2838738137
2503 2838743388
2504 2841841494
2505 2841847837
2506 2841854925
2507 2841859625
2508 2841864923
2509 2842077769
2510 2842110902
2511 2842119722
2512 2842126133
2513 2842131303
2514 2842141272
2515 2842147018
2516 2842153527
2517 2842157787
2518 2842165000
2519 2842171535
2520 2842177147
2521 2842180629
2522 2842188400
2523 2842197013
2524 2842201069
2525 2842206416
2526 2842212711
2527 2842220607
2528 2842225670
2529 2842231320
2530 2842244566
2531 2842252083
2532 2842258379
2533 2842267532
2534 2842273132
2535 2842279873
2536 2842287506
2537 2842291431
2538 2842301852
2539 2842309385
2540 2842315418
2541 2842318264
2542 2842347161
2543 2842362350
2544 2842366749
2545 2842373160
2546 2842377827
2547 2842386232
2548 2842397286
2549 2842404965
2550 2842411547
2551 2842418002
2552 2842424982
2553 2842431890
2554 2842438003
2555 2842444817
2556 2842451733
2557 2842465806
2558 2842472620
2559 2842481364
2560 2842487148
2561 2842492755
2562 2842496535
2563 2842508264
2564 2842516410
2565 2842525945
2566 2842695565
2567 2842925169
2568 2844006713
2569 2844014318
2570 2844170412
2571 2844459534
2572 2847418496
2573 2847670862
2574 2847686996
2575 2848993473
2576 2850080797
2577 2852389605
2578 2854899082
2579 2854916970
2580 2855825458
2581 2855840835
2582 2855873342
2583 2856316319
2584 2856323621
2585 2856329088
2586 2856335899
2587 2856353283
2588 2856369070
2589 2857355662
2590 2857373750
2591 2857523704
2592 2857534623
2593 2858801380
2594 2869175655
2595 2869241456
2596 2869245802
2597 2869251100
2598 2869266794
2599 2869275703
2600 2869278883
2601 2869291588
2602 2871433888
2603 2871440971
2604 2871456114
2605 2871462055
2606 2871485119
2607 2874107932
2608 2874119861
2609 2874125779
2610 2874136061
2611 2874145475
2612 2874153447
2613 2874160711
2614 2874167882
2615 2876368010
2616 2876374000
2617 2876385409
2618 2876387860
2619 2876395185
2620 2876403324
2621 2876412278
2622 2876419737
2623 2876422663
2624 2878041642
2625 2878731552
2626 2878743778
2627 2878751500
2628 2878778506
2629 2878787073
2630 2881152633
2631 2881156192
2632 2881168553
2633 2881860816
2634 2882633141
2635 2885310601
2636 2885317364
2637 2885334053
2638 2885339891
2639 2885346062
2640 2885356795
2641 2889011865
2642 2889023206
2643 2891375567
2644 2896386986
2645 2899796382
2646 2899808938
2647 2903449771
2648 2903505492
2649 2903527006
2650 2903533233
2651 2904661816
2652 2906313398
2653 2906326107
2654 2906328431
2655 2906357557
2656 2906376910
2657 2906382533
2658 2906392870
2659 2906397996
2660 2906402766
2661 2906414370
2662 2906416456
2663 2913300409
2664 2913310222
2665 2915651817
2666 2915985201
2667 2915987807
2668 2915997479
2669 2916003914
2670 2916014449
2671 2916015346
2672 2916028373
2673 2916034853
2674 2916041168
2675 2916046296
2676 2916051076
2677 2916060614
2678 2916067392
2679 2916070780
2680 2916078612
2681 2917555526
2682 2919107799
2683 2919115385
2684 2919167721
2685 2919175328
2686 2919409774
2687 2920765571
2688 2920824208
2689 2921207792
2690 2921210220
2691 2921243784
2692 2921250332
2693 2921253042
2694 2921260466
2695 2921270423
2696 2921289132
2697 2921293500
2698 2921304693
2699 2922153783
2700 2922165485
2701 2922172416
2702 2922193182
2703 2923558141
2704 2924147587
2705 2924156407
2706 2924165141
2707 2924172834
2708 2924179343
2709 2924183014
2710 2924192768
2711 2924197849
2712 2924206433
2713 2924211544
2714 2924215551
2715 2924223354
2716 2924234673
2717 2924724939
2718 2924726775
2719 2924734645
2720 2924745663
2721 2924749306
2722 2924763906
2723 2924781591
2724 2926756435
2725 2929140609
2726 2933008171
2727 2933012950
2728 2933575842
2729 2933586927
2730 2933602160
2731 2935904835
2732 2936373131
2733 2936381276
2734 2936384548
2735 2936997725
2736 2937007263
2737 2937012432
2738 2937022582
2739 2937029207
2740 2937031176
2741 2937040878
2742 2937049689
2743 2937050085
2744 2937059644
2745 2937071207
2746 2937075653
2747 2937079970
2748 2937086615
2749 2937092275
2750 2937105865
2751 2937113125
2752 2937117273
2753 2937125322
2754 2937130388
2755 2937820452
2756 2937827015
2757 2937877058
2758 2937879244
2759 2937895067
2760 2937975023
2761 2937987121
2762 2938016194
2763 2939670875
2764 2941499834
2765 2957380848
2766 2957388045
2767 2957394237
2768 2957399335
2769 2957407900
2770 2957412570
2771 2957416076
2772 2957422947
2773 2957436773
2774 2957439173
2775 2957450059
2776 2957456754
2777 2957464632
2778 2957470652
2779 2957472321
2780 2957483509
2781 2957491516
2782 2957494963
2783 2957505071
2784 2957505858
2785 2958034998
2786 2958042872
2787 2958067198
2788 2958086419
2789 2958103293
2790 2958111326
2791 2958122566
2792 2958123327
2793 2958135989
2794 2958139657
2795 2958162786
2796 2958174763
2797 2958185455
2798 2960590904
2799 2960596136
2800 2960602836
2801 2960607246
2802 2960614981
2803 2960623209
2804 2960626148
2805 2960634634
2806 2960639212
2807 2960652682
2808 2960666733
2809 2960673335
2810 2960680454
2811 2960686832
2812 2960693817
2813 2960699783
2814 2961083723
2815 2961116969
2816 2961131861
2817 2961143269
2818 2961187963
2819 2963648583
2820 2964611139
2821 2964620759
2822 2964628854
2823 2964635924
2824 2964637900
2825 2964649144
2826 2964655808
2827 2964660213
2828 2964666185
2829 2964678088
2830 2964679323
2831 2964685372
2832 2964698660
2833 2964702081
2834 2964709236
2835 2964713771
2836 2964719622
2837 2965029242
2838 2965036374
2839 2965045730
2840 2965052021
2841 2965066304
2842 2965093561
2843 2965111352
2844 2965121030
2845 2967668635
2846 2967674557
2847 2967685642
2848 2967688758
2849 2967699141
2850 2967699998
2851 2967714348
2852 2967720573
2853 2967728166
2854 2967734273
2855 2967741289
2856 2967753381
2857 2967758003
2858 2967769178
2859 2967775278
2860 2967782808
2861 2968017538
2862 2968083811
2863 2968092434
2864 2968100504
2865 2968112877
2866 2968122891
2867 2968128836
2868 2968143228
2869 2970026393
2870 2970032689
2871 2970038229
2872 2970041715
2873 2970054893
2874 2970060857
2875 2970061919
2876 2970075925
2877 2970081099
2878 2970084816
2879 2970095255
2880 2970099396
2881 2970103658
2882 2970112182
2883 2970121827
2884 2970127053
2885 2970135106
2886 2970136596
2887 2970145546
2888 2970155269
2889 2970158385
2890 2970168124
2891 2970174827
2892 2970181732
2893 2970187945
2894 2970193539
2895 2970472286
2896 2970489789
2897 2970517946
2898 2970538617
2899 2970551932
2900 2970593478
2901 2970623570
2902 2970632255
2903 2977520720
2904 2977524401
2905 2977533833
2906 2977542214
2907 2977547234
2908 2977557408
2909 2977565875
2910 2977571966
2911 2977579124
2912 2977585329
2913 2977848752
2914 2977860986
2915 2977872035
2916 2977879624
2917 2977906562
2918 2977911461
2919 2977918666
2920 2977937525
2921 2977946127
2922 2977954012
2923 2977958592
2924 2977976383
2925 2978974176
2926 2979106075
2927 2979713993
2928 2979775257
2929 2979779950
2930 2984512136
2931 2984521503
2932 2984540797
2933 2984589504
2934 2984603064
2935 2987640796
2936 2987645728
2937 2987656479
2938 2987670374
2939 2987680961
2940 2989352916
2941 2989773707
2942 2989778755
2943 2996341813
2944 2996348852
2945 2996351157
2946 2996388322
2947 2996892439
2948 2996898451
2949 3000136251
2950 3003933386
2951 3004170109
2952 3004202782
2953 3004208993
2954 3004238452
2955 3004246039
2956 3004254527
2957 3004269797
2958 3004277855
2959 3004291749
2960 3004340332
2961 3005409646
2962 3005420363
2963 3005447248
2964 3005453957
2965 637073634
2966 639648140
2967 643825501
2968 648740132
2969 649873570
2970 8001848689
2971 8002286145
2972 8003570898
2973 8003993333
2974 8004000589
2975 8004306595
2976 8004313773
2977 8004364202
2978 8004393856
2979 8004450054
2980 8004643190
2981 8004714526
2982 8004719652
2983 8005248307
2984 8005259721
2985 8005280210
2986 8005288277
2987 8005294803
2988 8005307038
2989 8005314553
2990 8005317314
2991 8005326966
2992 8005378789
2993 8005388011
2994 8005397034
2995 8005433241
2996 8005462522
2997 8005486622
2998 8005499900
2999 8005544877
3000 8005558109
3001 8005569287
3002 8005575436
3003 8005621267
3004 8005631433
3005 8005646236
3006 8005659423
3007 8005671318
3008 8005686370
3009 8005694952
3010 8005696152
3011 8018129562
3012 8018155608
3013 8018168103
3014 8018177899
3015 8023680977
3016 8024485753
3017 8024492570
3018 8024505219
3019 8046770330
3020 8049294388
3021 8055435053
3022 8056380146
3023 8056387549
3024 8056876763
3025 8057578260
3026 8057875492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00512

HisKA

His Kinase A (phospho-acceptor) domain

139

202

0.91

PF00989

PAS

PAS fold

15

120

0.8

PF13188

PAS_8

PAS domain

15

79

0.79

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

244

366

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a0w-assembly2.cif.gz_B catalytic domain of histidine kinase thka (tm1359) for mad phasing (nucleotide free form 2, orthorombic) 0.8771 208 365
3a0y-assembly1.cif.gz_A catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 3: 1,2-propanediol, orthorombic) 0.8753 208 365
6blk-assembly3.cif.gz_A mycobacterial sensor histidine kinase mprb 0.874 208 365
3a0z-assembly1.cif.gz_A catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 4: isopropanol, orthorombic) 0.8739 208 365
8dx0-assembly2.cif.gz_B vansc ca domain 0.873 209 366
ID Description Score Start End Superfamily
af_Q06067_453_606_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.9267 208 365 3.30.565.10
af_P0AFB5_191_349_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.9254 205 366 3.30.565.10
af_P14377_310_462_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.9105 208 366 3.30.565.10
af_P0AFB5_191_349_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.9088 205 366 3.30.565.10
4q20B02 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.9023 206 365 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A7C3C2B2-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9547 258 368 GO:0000155
GO:0005524
AF-A0A355T5V6-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9535 129 366 GO:0000155
GO:0005737
GO:0009399
GO:0016787
AF-A0A843CHX9-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9503 300 367 GO:0000155
GO:0005524
GO:0005886
GO:0009927
AF-A0A6I1F7R3-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9378 231 365 GO:0000160
GO:0005524
GO:0016301
AF-A0A366JHS1-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9292 231 365 GO:0000160
GO:0005524
GO:0016301

Map