F494493

General Info

Members Datasets Scaffolds Average Seq Length
1514 547 1360 217

Family's Representative Sequence

Representative Sequence 3300046648|Ga0495611_0035857|Ga0495611_0035857_921_1643
Length 240
Sequence MNTPYPVRLAGEELWLLPEKALYWPAQQALLIADVHFGKAAAYRSLGQPVPQGTTASNIAVIDRLLATLPCRQLIFLGDFLHGPGSHAAGTLGALAEWRARHAGLPMTLIRGNHDKRAGDPPAALNIRVVPEPLLLGPFALQHEPEPHPQRHVLAGHVHPVYRLHGKGRQSLRLACFRLGERISLMPAFGAFTGGYPVERDDCCKIFVIGDNQIWPVSRTAPQPCRSRACSRRRPPIHPG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2511231008 Pseudomonas sp. GM21 Isolate Nodule
4 2511231010 Pseudomonas sp. GM25 Isolate Nodule
5 2511231011 Pseudomonas sp. GM30 Isolate Nodule
6 2511231021 Pseudomonas sp. GM78 Isolate Nodule
7 2511231023 Pseudomonas sp. GM80 Isolate Nodule
8 2511231031 Pseudomonas sp. GM16 Isolate Nodule
9 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
10 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
11 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
12 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
13 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
14 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
15 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
16 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
17 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
18 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
19 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
20 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
21 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
22 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
23 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
24 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
25 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
26 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
27 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
28 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
29 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
30 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
31 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
32 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
33 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
34 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
35 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
36 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
37 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
38 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
39 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
40 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
41 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
42 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
43 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
44 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
45 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
46 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
47 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
48 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
49 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
50 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
51 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
52 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
53 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
54 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
55 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
56 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
57 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
58 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
59 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
60 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
61 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
62 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
63 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
64 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
65 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
66 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
67 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
68 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
69 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
70 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
71 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
72 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
73 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
74 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
75 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
76 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
77 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
78 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
79 2773857673 Pseudomonas sp. 443 Isolate Unclassified
80 2784132063 Pseudomonas sp. 424 Isolate Unclassified
81 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
82 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
83 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
84 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
85 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
86 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
87 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
88 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
89 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
90 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
91 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
92 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
93 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
94 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
95 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
96 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
97 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
98 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
99 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
100 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
101 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
102 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
103 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
104 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
105 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
106 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
107 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
108 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
109 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
110 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
111 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
112 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
113 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
114 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
115 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
116 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
117 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
118 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
119 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
120 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
121 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
122 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
123 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
124 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
125 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
126 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
127 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
128 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
129 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
130 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
131 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
132 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
133 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
134 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
135 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
136 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
137 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
138 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
139 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
140 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
141 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
142 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
143 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
144 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
145 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
146 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
147 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
148 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
149 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
150 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
151 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
152 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
153 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
154 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
155 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
156 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
157 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
158 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
159 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
160 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
161 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
162 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
163 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
164 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
165 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
166 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
167 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
168 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
169 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
170 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
171 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
172 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
173 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
174 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
175 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
176 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
177 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
178 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
179 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
180 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
181 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
182 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
183 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
184 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
185 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
186 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
187 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
188 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
189 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
190 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
191 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
192 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
193 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
194 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
195 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
196 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
197 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
198 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
199 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
200 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
201 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
202 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
203 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
204 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
205 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
206 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
207 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
208 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
209 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
210 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
211 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
212 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
213 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
214 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
215 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
216 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
217 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
218 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
219 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
220 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
221 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
222 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
223 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
224 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
225 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
226 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
227 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
228 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
229 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
230 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
231 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
232 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
233 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
234 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
235 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
236 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
237 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
238 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
239 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
240 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
241 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
242 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
243 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
244 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
245 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
246 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
247 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
248 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
249 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
250 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
251 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
252 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
253 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
254 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
255 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
262 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
264 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
265 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
266 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
267 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
269 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
271 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
323 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
327 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
328 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
331 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
332 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
335 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
336 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
337 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
338 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
339 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
340 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
341 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
342 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
343 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
344 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
345 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
346 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
347 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
348 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
349 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
350 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
351 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
352 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
353 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
354 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
355 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
356 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
357 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
358 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
359 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
360 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
361 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
362 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
363 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
364 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
365 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
366 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
367 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
368 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
369 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
370 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
371 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
372 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
373 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
374 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
375 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
376 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
377 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
378 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
379 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
380 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
381 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
382 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
383 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
384 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
385 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
386 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
387 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
388 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
389 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
390 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
391 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
392 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
393 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
394 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
395 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
396 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
397 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
398 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
399 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
400 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
401 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
402 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
403 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
404 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
405 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
406 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
407 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
408 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
409 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
410 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
411 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
412 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
413 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
414 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
415 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
416 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
417 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
418 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
419 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
420 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
421 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
422 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
423 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
424 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
425 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
426 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
427 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
428 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
429 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
430 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
431 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
432 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
433 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
434 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
435 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
436 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
437 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
438 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
439 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
440 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
441 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
442 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
443 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
444 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
445 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
446 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
447 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
448 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
449 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
450 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
451 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
452 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
453 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
454 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
455 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
456 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
457 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
458 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
459 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
460 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
461 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
462 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
463 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
464 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
465 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
466 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
467 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
468 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
469 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
470 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
471 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
472 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
473 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
474 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
475 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
476 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
477 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
478 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
479 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
480 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
481 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
482 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
483 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
484 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
485 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
486 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
487 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
488 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
489 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
490 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
491 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
492 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
493 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
494 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
495 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
496 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
497 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
498 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
499 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
500 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
501 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
502 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
503 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
504 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
505 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
506 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
507 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
509 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
510 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
511 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
512 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
513 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
514 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
515 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
516 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
517 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
518 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
519 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
520 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
521 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
522 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
523 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
524 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
525 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
526 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
527 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
528 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
529 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
530 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
531 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
532 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
533 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
534 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
535 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
536 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
537 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
538 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
539 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
540 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
541 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
542 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
543 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
544 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
545 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
546 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
547 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.83
Metatranscriptomes 0
Isolates 10.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0.86
Rhizoplane 4.16
Rhizosphere 83.16
Stem 0
Stem Tuber 0
Unclassified 8.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_724759 2162886012 Unclassified 1472
2 rootH1_10191044 3300003323 Bacteria 2003
3 Ga0055539_1000142 3300003752 Bacteria 73286
4 Ga0055533_1000146 3300003756 Bacteria 73286
5 Ga0055532_1000132 3300003758 Bacteria 73282
6 Ga0055525_1000701 3300003759 Bacteria 12158
7 Ga0055535_1004683 3300003761 Bacteria 3234
8 Ga0055526_1000326 3300003771 Bacteria 39597
9 Ga0055537_1000120 3300003773 Bacteria 59665
10 Ga0055537_1025941 3300003773 Bacteria 803
11 Ga0055524_1003126 3300003775 Bacteria 8168
12 Ga0055536_1003259 3300003781 Bacteria 8798
13 Ga0055536_1003356 3300003781 Bacteria 8644
14 Ga0055534_1000170 3300003784 Bacteria 48165
15 Ga0055528_1000249 3300003790 Bacteria 45543
16 Ga0055530_10000427 3300003791 Bacteria 37349
17 Ga0055530_10005369 3300003791 Bacteria 6124
18 Ga0055540_1000377 3300003792 Bacteria 37349
19 Ga0055540_1001027 3300003792 Bacteria 17928
20 Ga0055531_10001697 3300003794 Bacteria 15794
21 Ga0055541_1000096 3300003841 Bacteria 73286
22 Ga0065714_10002540 3300005288 Bacteria 29164
23 Ga0065714_10081144 3300005288 Bacteria 2380
24 Ga0065704_10086661 3300005289 Bacteria 3097
25 Ga0065712_10067808 3300005290 Bacteria 30719
26 Ga0065712_10106463 3300005290 Bacteria 1916
27 Ga0065715_10158627 3300005293 Bacteria 1651
28 Ga0065715_10221538 3300005293 Unclassified 1270
29 Ga0070658_10002003 3300005327 Bacteria 17133
30 Ga0070658_10002337 3300005327 Bacteria 15918
31 Ga0070658_10010041 3300005327 Bacteria 7603
32 Ga0070658_10214457 3300005327 Bacteria 1627
33 Ga0070658_10219679 3300005327 Bacteria 1607
34 Ga0070658_10237358 3300005327 Unclassified 1545
35 Ga0070658_10529575 3300005327 Bacteria 1019
36 Ga0070683_100101194 3300005329 Bacteria 2713
37 Ga0070683_100227775 3300005329 Bacteria 1772
38 Ga0070683_100314727 3300005329 Bacteria 1490
39 Ga0070683_100558223 3300005329 Bacteria 1095
40 Ga0070690_100130182 3300005330 Bacteria 1699
41 Ga0070690_100151414 3300005330 Bacteria 1583
42 Ga0070670_100001614 3300005331 Bacteria 18233
43 Ga0070670_100011386 3300005331 Bacteria 7605
44 Ga0070670_100619754 3300005331 Bacteria 969
45 Ga0070677_10093411 3300005333 Bacteria 1313
46 Ga0070680_100238971 3300005336 Bacteria 1535
47 Ga0070682_100437660 3300005337 Unclassified 998
48 Ga0070660_100083419 3300005339 Bacteria 2510
49 Ga0070689_100057953 3300005340 Bacteria 3008
50 Ga0070689_100253306 3300005340 Bacteria 1453
51 Ga0070687_100081250 3300005343 Bacteria 1769
52 Ga0070687_100114583 3300005343 Bacteria 1532
53 Ga0070661_100000306 3300005344 Bacteria 39537
54 Ga0070661_100047186 3300005344 Bacteria 3152
55 Ga0070661_100116314 3300005344 Bacteria 2000
56 Ga0070661_100463944 3300005344 Bacteria 1009
57 Ga0070692_10256666 3300005345 Bacteria 1049
58 Ga0070669_100001132 3300005353 Bacteria 19477
59 Ga0070669_100003812 3300005353 Bacteria 10889
60 Ga0070669_100065139 3300005353 Bacteria 2684
61 Ga0070675_100003576 3300005354 Bacteria 11816
62 Ga0070675_100006834 3300005354 Bacteria 8760
63 Ga0070675_100371391 3300005354 Unclassified 1272
64 Ga0070675_100740910 3300005354 Bacteria 896
65 Ga0070674_100529412 3300005356 Bacteria 986
66 Ga0070673_100065171 3300005364 Bacteria 2905
67 Ga0070688_100020147 3300005365 Bacteria 3874
68 Ga0070688_100285409 3300005365 Bacteria 1188
69 Ga0070659_100022802 3300005366 Bacteria 4783
70 Ga0070659_100116297 3300005366 Bacteria 2162
71 Ga0070659_100202776 3300005366 Bacteria 1633
72 Ga0070709_10070341 3300005434 Bacteria 2255
73 Ga0070714_100277874 3300005435 Bacteria 1555
74 Ga0070714_100589502 3300005435 Bacteria 1067
75 Ga0070714_100819524 3300005435 Bacteria 902
76 Ga0070713_100025322 3300005436 Unclassified 4637
77 Ga0070713_100145347 3300005436 Bacteria 2104
78 Ga0070710_10084079 3300005437 Unclassified 1864
79 Ga0070701_10457797 3300005438 Bacteria 820
80 Ga0070711_100186814 3300005439 Bacteria 1590
81 Ga0070708_101110947 3300005445 Bacteria 740
82 Ga0070678_100173169 3300005456 Bacteria 1760
83 Ga0070662_100012831 3300005457 Bacteria 5566
84 Ga0070662_100013505 3300005457 Bacteria 5434
85 Ga0070662_100409113 3300005457 Bacteria 1121
86 Ga0070681_10430719 3300005458 Bacteria 1231
87 Ga0070681_10464324 3300005458 Bacteria 1178
88 Ga0070681_10682515 3300005458 Bacteria 943
89 Ga0068867_100074499 3300005459 Bacteria 2544
90 Ga0068867_100390017 3300005459 Unclassified 1172
91 Ga0070685_10019177 3300005466 Bacteria 3688
92 Ga0070685_10104878 3300005466 Bacteria 1732
93 Ga0070699_100390068 3300005518 Bacteria 1258
94 Ga0070679_100148547 3300005530 Bacteria 2321
95 Ga0070679_100311581 3300005530 Bacteria 1524
96 Ga0070679_100352147 3300005530 Bacteria 1420
97 Ga0070679_100433095 3300005530 Unclassified 1260
98 Ga0070679_100524025 3300005530 Bacteria 1129
99 Ga0070684_100075551 3300005535 Bacteria 2972
100 Ga0070684_100084888 3300005535 Bacteria 2807
101 Ga0068853_100046284 3300005539 Bacteria 3730
102 Ga0068853_100805544 3300005539 Bacteria 900
103 Ga0070672_100023875 3300005543 Bacteria 4511
104 Ga0070672_100482229 3300005543 Bacteria 1071
105 Ga0070672_101024720 3300005543 Bacteria 732
106 Ga0070696_100558783 3300005546 Bacteria 918
107 Ga0070693_100012956 3300005547 Bacteria 4235
108 Ga0070665_100032507 3300005548 Bacteria 5251
109 Ga0070665_100187703 3300005548 Bacteria 2068
110 Ga0070665_100284167 3300005548 Bacteria 1657
111 Ga0070704_100665650 3300005549 Bacteria 920
112 Ga0068855_100022972 3300005563 Bacteria 7473
113 Ga0068855_100057597 3300005563 Bacteria 4554
114 Ga0068855_100118702 3300005563 Bacteria 3029
115 Ga0068855_100563072 3300005563 Bacteria 1233
116 Ga0070664_100002817 3300005564 Bacteria 14062
117 Ga0070664_100044836 3300005564 Bacteria 3734
118 Ga0070664_100050129 3300005564 Bacteria 3532
119 Ga0070664_100070306 3300005564 Unclassified 2997
120 Ga0070664_100080696 3300005564 Bacteria 2802
121 Ga0068856_100117884 3300005614 Bacteria 2656
122 Ga0070702_100539675 3300005615 Bacteria 864
123 Ga0068852_100007877 3300005616 Bacteria 7800
124 Ga0068852_100011195 3300005616 Bacteria 6739
125 Ga0068852_100520163 3300005616 Bacteria 1187
126 Ga0068852_100578165 3300005616 Bacteria 1126
127 Ga0068852_100715992 3300005616 Bacteria 1012
128 Ga0068859_100087040 3300005617 Bacteria 3171
129 Ga0068859_100329642 3300005617 Bacteria 1620
130 Ga0068861_100338631 3300005719 Bacteria 1316
131 Ga0068851_10000019 3300005834 Bacteria 135877
132 Ga0068851_10012777 3300005834 Bacteria 3966
133 Ga0068851_10044576 3300005834 Bacteria 2239
134 Ga0068870_10375623 3300005840 Bacteria 919
135 Ga0068858_100014610 3300005842 Bacteria 7396
136 Ga0068858_100095030 3300005842 Bacteria 2777
137 Ga0068858_100778181 3300005842 Unclassified 933
138 Ga0068860_100424090 3300005843 Bacteria 1319
139 Ga0068862_100152610 3300005844 Bacteria 2057
140 Ga0075364_10584333 3300006051 Bacteria 763
141 Ga0075432_10004232 3300006058 Bacteria 4884
142 Ga0075432_10023282 3300006058 Bacteria 2121
143 Ga0075432_10057720 3300006058 Bacteria 1377
144 Ga0070712_100152233 3300006175 Unclassified 1777
145 Ga0075367_10241562 3300006178 Bacteria 1132
146 Ga0075433_10328254 3300006852 Bacteria 1353
147 Ga0068865_100900971 3300006881 Unclassified 769
148 Ga0075436_100023166 3300006914 Bacteria 4266
149 Ga0075436_100211114 3300006914 Bacteria 1376
150 Ga0097620_100087035 3300006931 Bacteria 3171
151 Ga0097620_100329647 3300006931 Bacteria 1620
152 Ga0079104_1000484 3300006946 Bacteria 44056
153 Ga0079104_1014328 3300006946 Bacteria 2395
154 Ga0099826_10000372 3300006948 Bacteria 20776
155 Ga0075435_100314627 3300007076 Bacteria 1340
156 Ga0105251_10000123 3300009011 Bacteria 77428
157 Ga0105251_10002278 3300009011 Bacteria 15224
158 Ga0105251_10009978 3300009011 Bacteria 5555
159 Ga0105251_10011434 3300009011 Bacteria 5073
160 Ga0105251_10013533 3300009011 Bacteria 4560
161 Ga0105251_10021590 3300009011 Bacteria 3358
162 Ga0105251_10040886 3300009011 Bacteria 2259
163 Ga0105251_10069726 3300009011 Bacteria 1638
164 Ga0105251_10104669 3300009011 Bacteria 1292
165 Ga0105251_10118638 3300009011 Bacteria 1202
166 Ga0105244_10000147 3300009036 Bacteria 73676
167 Ga0105244_10004329 3300009036 Bacteria 9816
168 Ga0105244_10005248 3300009036 Bacteria 8644
169 Ga0105244_10008962 3300009036 Bacteria 6192
170 Ga0105244_10022226 3300009036 Bacteria 3493
171 Ga0105244_10027956 3300009036 Bacteria 3031
172 Ga0105244_10144410 3300009036 Bacteria 1143
173 Ga0105244_10192499 3300009036 Bacteria 964
174 Ga0105250_10000273 3300009092 Bacteria 41912
175 Ga0105250_10005841 3300009092 Bacteria 5460
176 Ga0105250_10012336 3300009092 Bacteria 3529
177 Ga0105250_10019081 3300009092 Bacteria 2773
178 Ga0105250_10019469 3300009092 Bacteria 2744
179 Ga0105250_10049089 3300009092 Bacteria 1692
180 Ga0105240_10018090 3300009093 Bacteria 9475
181 Ga0105240_10027403 3300009093 Bacteria 7458
182 Ga0105240_10242795 3300009093 Bacteria 2087
183 Ga0105240_10609028 3300009093 Unclassified 1202
184 Ga0111539_10021946 3300009094 Bacteria 7847
185 Ga0105245_10363743 3300009098 Bacteria 1436
186 Ga0105245_10364992 3300009098 Bacteria 1434
187 Ga0114129_10104749 3300009147 Bacteria 3909
188 Ga0105243_10009538 3300009148 Bacteria 7391
189 Ga0105243_10020117 3300009148 Bacteria 5060
190 Ga0105243_10061990 3300009148 Bacteria 2992
191 Ga0105243_11334669 3300009148 Bacteria 736
192 Ga0105241_10042988 3300009174 Bacteria 3421
193 Ga0105241_10256045 3300009174 Bacteria 1486
194 Ga0105242_10000354 3300009176 Bacteria 36812
195 Ga0105242_10001061 3300009176 Bacteria 21612
196 Ga0105242_10244554 3300009176 Bacteria 1614
197 Ga0105248_10015397 3300009177 Bacteria 8435
198 Ga0105248_10248667 3300009177 Bacteria 2002
199 Ga0105248_10859374 3300009177 Bacteria 1024
200 Ga0105237_10002041 3300009545 Bacteria 25677
201 Ga0105237_10401427 3300009545 Bacteria 1375
202 Ga0105238_10075257 3300009551 Bacteria 3368
203 Ga0105238_10077229 3300009551 Unclassified 3322
204 Ga0105238_10179676 3300009551 Bacteria 2093
205 Ga0105238_10598297 3300009551 Bacteria 1110
206 Ga0105249_10308195 3300009553 Bacteria 1590
207 Ga0105246_10011813 3300011119 Bacteria 5428
208 Ga0105246_10051018 3300011119 Bacteria 2839
209 Ga0157345_1000357 3300012498 Bacteria 5203
210 Ga0157373_10015897 3300013100 Bacteria 5493
211 Ga0157373_10018030 3300013100 Bacteria 5140
212 Ga0157373_10019641 3300013100 Bacteria 4915
213 Ga0157373_10020494 3300013100 Bacteria 4805
214 Ga0157373_10023822 3300013100 Bacteria 4436
215 Ga0157373_10031944 3300013100 Bacteria 3791
216 Ga0157373_10069298 3300013100 Bacteria 2494
217 Ga0157373_10136936 3300013100 Bacteria 1722
218 Ga0157373_10215047 3300013100 Bacteria 1356
219 Ga0157371_10008487 3300013102 Bacteria 8176
220 Ga0157371_10021929 3300013102 Bacteria 4688
221 Ga0157371_10098576 3300013102 Bacteria 2072
222 Ga0157371_10223760 3300013102 Bacteria 1352
223 Ga0157370_10119470 3300013104 Bacteria 2461
224 Ga0157370_10136127 3300013104 Bacteria 2289
225 Ga0157370_10190560 3300013104 Bacteria 1903
226 Ga0157370_10194858 3300013104 Bacteria 1881
227 Ga0157370_10288371 3300013104 Bacteria 1516
228 Ga0157370_10660029 3300013104 Bacteria 956
229 Ga0157369_10003688 3300013105 Bacteria 18200
230 Ga0157369_10015624 3300013105 Bacteria 8555
231 Ga0157369_10040753 3300013105 Bacteria 5069
232 Ga0157369_10041662 3300013105 Bacteria 5012
233 Ga0157369_10042473 3300013105 Bacteria 4960
234 Ga0157369_10043561 3300013105 Bacteria 4891
235 Ga0157369_10317087 3300013105 Bacteria 1621
236 Ga0157369_10574272 3300013105 Bacteria 1165
237 Ga0157378_10177006 3300013297 Bacteria 2004
238 Ga0163162_10009704 3300013306 Bacteria 9366
239 Ga0163162_10019587 3300013306 Bacteria 6642
240 Ga0163162_10051005 3300013306 Bacteria 4150
241 Ga0163162_10385839 3300013306 Bacteria 1534
242 Ga0157372_10001200 3300013307 Bacteria 28021
243 Ga0157372_10015645 3300013307 Bacteria 8135
244 Ga0157372_10045072 3300013307 Bacteria 4890
245 Ga0157372_11090212 3300013307 Bacteria 924
246 Ga0157375_10004998 3300013308 Bacteria 11528
247 Ga0157375_10006945 3300013308 Bacteria 9884
248 Ga0157375_10053642 3300013308 Bacteria 3968
249 Ga0157375_10064953 3300013308 Bacteria 3636
250 Ga0157375_10286552 3300013308 Bacteria 1810
251 Ga0157375_10981014 3300013308 Bacteria 985
252 Ga0157380_10794589 3300014326 Unclassified 963
253 Ga0182008_10007133 3300014497 Bacteria 6188
254 Ga0182008_10009885 3300014497 Bacteria 5128
255 Ga0182008_10012593 3300014497 Bacteria 4464
256 Ga0182008_10015398 3300014497 Bacteria 3990
257 Ga0182008_10038860 3300014497 Bacteria 2379
258 Ga0182008_10040890 3300014497 Bacteria 2313
259 Ga0182008_10064915 3300014497 Bacteria 1797
260 Ga0182008_10204663 3300014497 Bacteria 1005
261 Ga0182006_1006528 3300015261 Bacteria 5413
262 Ga0182006_1007762 3300015261 Bacteria 4893
263 Ga0182006_1008777 3300015261 Bacteria 4572
264 Ga0182006_1015161 3300015261 Bacteria 3307
265 Ga0182006_1026369 3300015261 Bacteria 2379
266 Ga0182006_1030903 3300015261 Bacteria 2161
267 Ga0182006_1047312 3300015261 Bacteria 1668
268 Ga0182006_1069099 3300015261 Bacteria 1314
269 Ga0182007_10005944 3300015262 Bacteria 5297
270 Ga0182007_10008158 3300015262 Bacteria 4321
271 Ga0182007_10133968 3300015262 Bacteria 835
272 Ga0182007_10197109 3300015262 Bacteria 703
273 Ga0182005_1004626 3300015265 Bacteria 4410
274 Ga0182005_1106462 3300015265 Bacteria 789
275 Ga0182005_1114830 3300015265 Bacteria 763
276 Ga0163161_10016623 3300017792 Bacteria 5139
277 Ga0163161_10026367 3300017792 Bacteria 4117
278 Ga0163161_10032761 3300017792 Bacteria 3712
279 Ga0163161_10048004 3300017792 Bacteria 3083
280 Ga0163161_10155930 3300017792 Bacteria 1738
281 Ga0163161_10163919 3300017792 Bacteria 1696
282 Ga0163161_10307907 3300017792 Bacteria 1249
283 Ga0163161_10501788 3300017792 Bacteria 988
284 Ga0209435_101438 3300025206 Bacteria 3013
285 Ga0209784_100015 3300025224 Bacteria 482117
286 Ga0209566_100012 3300025225 Bacteria 482281
287 Ga0209674_100027 3300025226 Bacteria 482281
288 Ga0209147_100019 3300025229 Bacteria 482139
289 Ga0209563_100031 3300025230 Bacteria 482281
290 Ga0209563_100795 3300025230 Bacteria 9503
291 Ga0209258_100824 3300025242 Bacteria 17348
292 Ga0209646_1000220 3300025246 Bacteria 61752
293 Ga0209677_100016 3300025253 Bacteria 482117
294 Ga0209759_1010377 3300025256 Bacteria 2735
295 Ga0209565_1000009 3300025263 Bacteria 751701
296 Ga0209565_1021679 3300025263 Bacteria 1339
297 Ga0209673_1000019 3300025273 Bacteria 449094
298 Ga0209675_1000013 3300025291 Bacteria 448220
299 Ga0209676_1000016 3300025292 Bacteria 655561
300 Ga0209676_1000033 3300025292 Bacteria 463236
301 Ga0209676_1010902 3300025292 Bacteria 3728
302 Ga0209564_1000058 3300025295 Bacteria 332955
303 Ga0209050_1000036 3300025298 Bacteria 423070
304 Ga0209050_1000187 3300025298 Bacteria 139437
305 Ga0209256_1000052 3300025299 Bacteria 299374
306 Ga0209051_1000131 3300025303 Bacteria 139437
307 Ga0209051_1001300 3300025303 Bacteria 21966
308 Ga0209257_1000173 3300025304 Bacteria 166678
309 Ga0207656_10000042 3300025321 Bacteria 53832
310 Ga0207656_10110180 3300025321 Bacteria 1271
311 Ga0207656_10131625 3300025321 Bacteria 1172
312 Ga0207696_1000083 3300025711 Bacteria 197352
313 Ga0207696_1000111 3300025711 Bacteria 155243
314 Ga0207696_1005338 3300025711 Bacteria 5348
315 Ga0207696_1008897 3300025711 Bacteria 3788
316 Ga0207696_1023408 3300025711 Bacteria 1948
317 Ga0207696_1026833 3300025711 Bacteria 1779
318 Ga0207655_1000844 3300025728 Bacteria 32918
319 Ga0207655_1000896 3300025728 Bacteria 31326
320 Ga0207655_1003971 3300025728 Bacteria 10699
321 Ga0207655_1011370 3300025728 Bacteria 5305
322 Ga0207655_1018979 3300025728 Bacteria 3620
323 Ga0207655_1020493 3300025728 Bacteria 3395
324 Ga0207655_1027786 3300025728 Bacteria 2685
325 Ga0207713_1000338 3300025735 Bacteria 51882
326 Ga0207713_1004803 3300025735 Bacteria 8675
327 Ga0207713_1007165 3300025735 Bacteria 6649
328 Ga0207713_1007166 3300025735 Bacteria 6649
329 Ga0207713_1010481 3300025735 Bacteria 5125
330 Ga0207713_1017092 3300025735 Bacteria 3653
331 Ga0207713_1046994 3300025735 Bacteria 1750
332 Ga0207713_1049396 3300025735 Bacteria 1687
333 Ga0207713_1150171 3300025735 Bacteria 753
334 Ga0207682_10100388 3300025893 Bacteria 1265
335 Ga0207699_10061392 3300025906 Bacteria 2261
336 Ga0207645_10146146 3300025907 Bacteria 1541
337 Ga0207643_10001672 3300025908 Bacteria 12447
338 Ga0207705_10004788 3300025909 Bacteria 10192
339 Ga0207705_10012286 3300025909 Bacteria 6187
340 Ga0207705_10199298 3300025909 Bacteria 1517
341 Ga0207705_10199678 3300025909 Bacteria 1515
342 Ga0207705_10557655 3300025909 Bacteria 891
343 Ga0207654_10178439 3300025911 Bacteria 1384
344 Ga0207707_10098500 3300025912 Bacteria 2555
345 Ga0207707_10369134 3300025912 Bacteria 1235
346 Ga0207707_10775764 3300025912 Bacteria 800
347 Ga0207695_10025938 3300025913 Bacteria 6549
348 Ga0207695_10131848 3300025913 Bacteria 2456
349 Ga0207695_10496165 3300025913 Bacteria 1103
350 Ga0207671_10000420 3300025914 Bacteria 58883
351 Ga0207662_10001814 3300025918 Bacteria 10487
352 Ga0207662_10262351 3300025918 Unclassified 1138
353 Ga0207657_10054964 3300025919 Bacteria 3441
354 Ga0207657_10230829 3300025919 Bacteria 1480
355 Ga0207649_10000002 3300025920 Bacteria 498633
356 Ga0207649_10110864 3300025920 Bacteria 1833
357 Ga0207649_10111184 3300025920 Bacteria 1830
358 Ga0207652_10387902 3300025921 Unclassified 1260
359 Ga0207652_10480703 3300025921 Bacteria 1119
360 Ga0207681_10000815 3300025923 Bacteria 20503
361 Ga0207681_10071739 3300025923 Bacteria 2416
362 Ga0207681_10099232 3300025923 Bacteria 2097
363 Ga0207681_10138322 3300025923 Bacteria 1810
364 Ga0207694_10000101 3300025924 Bacteria 94934
365 Ga0207694_10149370 3300025924 Bacteria 1882
366 Ga0207694_10222488 3300025924 Bacteria 1540
367 Ga0207694_10382268 3300025924 Bacteria 1169
368 Ga0207694_10496271 3300025924 Bacteria 1022
369 Ga0207650_10000385 3300025925 Bacteria 40899
370 Ga0207650_10000606 3300025925 Bacteria 28719
371 Ga0207659_10089363 3300025926 Bacteria 2297
372 Ga0207687_10500307 3300025927 Bacteria 1014
373 Ga0207700_10001824 3300025928 Bacteria 12093
374 Ga0207700_10066709 3300025928 Bacteria 2751
375 Ga0207664_10462293 3300025929 Bacteria 1133
376 Ga0207664_10487506 3300025929 Bacteria 1103
377 Ga0207644_10332974 3300025931 Bacteria 1230
378 Ga0207690_10047577 3300025932 Bacteria 2847
379 Ga0207690_10055191 3300025932 Bacteria 2675
380 Ga0207706_10000239 3300025933 Bacteria 60455
381 Ga0207706_10046401 3300025933 Bacteria 3847
382 Ga0207706_10058912 3300025933 Unclassified 3382
383 Ga0207686_10022071 3300025934 Bacteria 3661
384 Ga0207686_10052307 3300025934 Bacteria 2548
385 Ga0207686_10191660 3300025934 Bacteria 1458
386 Ga0207709_10000036 3300025935 Bacteria 292568
387 Ga0207709_10059963 3300025935 Bacteria 2370
388 Ga0207670_10053291 3300025936 Bacteria 2724
389 Ga0207691_10059305 3300025940 Bacteria 3480
390 Ga0207691_10194938 3300025940 Bacteria 1765
391 Ga0207711_10018680 3300025941 Bacteria 5764
392 Ga0207711_10146469 3300025941 Bacteria 2128
393 Ga0207661_10506930 3300025944 Unclassified 1103
394 Ga0207679_10000006 3300025945 Bacteria 498868
395 Ga0207679_10201377 3300025945 Bacteria 1663
396 Ga0207667_10063863 3300025949 Bacteria 3846
397 Ga0207651_10017066 3300025960 Bacteria 4276
398 Ga0207651_10311033 3300025960 Bacteria 1314
399 Ga0207712_10355325 3300025961 Bacteria 1219
400 Ga0207640_10002221 3300025981 Bacteria 10444
401 Ga0207703_10008467 3300026035 Bacteria 8128
402 Ga0207703_10069921 3300026035 Bacteria 2896
403 Ga0207639_10001932 3300026041 Bacteria 13918
404 Ga0207639_10029336 3300026041 Bacteria 4026
405 Ga0207639_10618373 3300026041 Unclassified 1000
406 Ga0207678_10488556 3300026067 Bacteria 1072
407 Ga0207708_10745897 3300026075 Unclassified 840
408 Ga0207641_10258593 3300026088 Bacteria 1629
409 Ga0207648_10055236 3300026089 Bacteria 3467
410 Ga0207648_10306790 3300026089 Bacteria 1424
411 Ga0207648_10315598 3300026089 Bacteria 1404
412 Ga0207676_10666641 3300026095 Bacteria 1005
413 Ga0207674_10012412 3300026116 Bacteria 9523
414 Ga0207674_10051136 3300026116 Bacteria 4217
415 Ga0207675_100303219 3300026118 Bacteria 1556
416 Ga0207683_10089945 3300026121 Bacteria 2733
417 Ga0207683_10243330 3300026121 Bacteria 1641
418 Ga0207683_10373534 3300026121 Bacteria 1310
419 Ga0207683_10399401 3300026121 Bacteria 1265
420 Ga0207698_10117293 3300026142 Bacteria 2245
421 Ga0207698_10306097 3300026142 Bacteria 1482
422 Ga0207698_10456018 3300026142 Bacteria 1235
423 Ga0209281_1000202 3300027111 Bacteria 135240
424 Ga0209281_1003560 3300027111 Bacteria 5077
425 Ga0209969_1001180 3300027360 Bacteria 3590
426 Ga0209995_1013445 3300027471 Bacteria 1341
427 Ga0209968_1027027 3300027526 Unclassified 949
428 Ga0209999_1025213 3300027543 Bacteria 1098
429 Ga0209282_1027977 3300027666 Bacteria 3498
430 Ga0209971_1008453 3300027682 Bacteria 2441
431 Ga0209998_10001534 3300027717 Bacteria 5550
432 Ga0209974_10025342 3300027876 Unclassified 1963
433 Ga0207428_10016966 3300027907 Bacteria 6257
434 Ga0207428_10077579 3300027907 Bacteria 2601
435 Ga0268266_10010436 3300028379 Bacteria 8116
436 Ga0268266_10034065 3300028379 Bacteria 4330
437 Ga0268266_10418569 3300028379 Bacteria 1269
438 Ga0268264_10403606 3300028381 Bacteria 1314
439 Ga0307517_10077023 3300028786 Bacteria 2904
440 Ga0316177_1107574 3300030731 Bacteria 4552
441 Ga0314311_1201496 3300030733 Bacteria 1917
442 Ga0316178_1003918 3300030735 Bacteria 11972
443 Ga0316183_1110934 3300030742 Bacteria 2917
444 Ga0307509_10601206 3300031507 Bacteria 772
445 Ga0307408_100005464 3300031548 Bacteria 8502
446 Ga0307408_100009729 3300031548 Bacteria 6335
447 Ga0307408_100016194 3300031548 Bacteria 4971
448 Ga0307408_100018800 3300031548 Bacteria 4643
449 Ga0307408_100085075 3300031548 Bacteria 2373
450 Ga0307408_100088147 3300031548 Bacteria 2336
451 Ga0307408_100118106 3300031548 Bacteria 2050
452 Ga0307408_100254338 3300031548 Bacteria 1450
453 Ga0307408_100615307 3300031548 Bacteria 967
454 Ga0307408_100771919 3300031548 Bacteria 870
455 Ga0307516_10139155 3300031730 Bacteria 2199
456 Ga0307405_10009112 3300031731 Bacteria 5074
457 Ga0307405_10067550 3300031731 Bacteria 2285
458 Ga0307405_10117103 3300031731 Unclassified 1816
459 Ga0307405_10326296 3300031731 Bacteria 1174
460 Ga0307405_10364383 3300031731 Bacteria 1119
461 Ga0307405_10624685 3300031731 Bacteria 882
462 Ga0307413_10015641 3300031824 Bacteria 3895
463 Ga0307413_10020105 3300031824 Bacteria 3543
464 Ga0307410_10203242 3300031852 Bacteria 1514
465 Ga0307406_10154472 3300031901 Bacteria 1641
466 Ga0307406_10172296 3300031901 Bacteria 1567
467 Ga0307406_10312505 3300031901 Bacteria 1212
468 Ga0307407_10074543 3300031903 Bacteria 2031
469 Ga0307407_10116155 3300031903 Bacteria 1688
470 Ga0307407_10323269 3300031903 Bacteria 1083
471 Ga0307412_10004492 3300031911 Bacteria 7775
472 Ga0307412_10011507 3300031911 Bacteria 5128
473 Ga0307412_10018306 3300031911 Bacteria 4212
474 Ga0307412_10028382 3300031911 Bacteria 3499
475 Ga0307412_10034390 3300031911 Bacteria 3230
476 Ga0307412_10094510 3300031911 Bacteria 2099
477 Ga0307412_10193442 3300031911 Bacteria 1539
478 Ga0307412_10468321 3300031911 Bacteria 1042
479 Ga0307412_10489365 3300031911 Bacteria 1022
480 Ga0307409_100017514 3300031995 Bacteria 4779
481 Ga0307409_100090975 3300031995 Bacteria 2499
482 Ga0307409_100387620 3300031995 Bacteria 1330
483 Ga0307416_100023257 3300032002 Bacteria 4493
484 Ga0307416_100452453 3300032002 Bacteria 1337
485 Ga0307416_101253032 3300032002 Bacteria 847
486 Ga0307414_10019025 3300032004 Bacteria 4246
487 Ga0307414_10092094 3300032004 Bacteria 2255
488 Ga0307414_10122462 3300032004 Bacteria 2002
489 Ga0307414_10149855 3300032004 Bacteria 1839
490 Ga0307411_10010681 3300032005 Bacteria 4908
491 Ga0307415_100646316 3300032126 Unclassified 947
492 Ga0307510_10039967 3300033180 Bacteria 5157
493 Ga0307510_10105823 3300033180 Bacteria 2580
494 Ga0373930_0044243 3300034816 Bacteria 956
495 Ga0373931_0035474 3300035691 Bacteria 2594
496 Ga0373931_0060277 3300035691 Bacteria 2042
497 Ga0373925_0105986 3300037068 Bacteria 2167
498 Ga0395899_0000028 3300037312 Bacteria 334378
499 Ga0395899_0030311 3300037312 Bacteria 4069
500 Ga0395905_0032994 3300037471 Bacteria 4868
501 Ga0395905_0675552 3300037471 Bacteria 935
502 Ga0395901_0006780 3300038443 Bacteria 11567
503 Ga0237819_02309 3300038705 Bacteria 3946
504 Ga0436365_0398219 3300039437 Bacteria 3023
505 Ga0439438_004222 3300041405 Bacteria 5583
506 Ga0439438_004945 3300041405 Bacteria 4984
507 Ga0439438_005072 3300041405 Bacteria 4909
508 Ga0439438_007305 3300041405 Bacteria 3787
509 Ga0439438_009367 3300041405 Bacteria 3173
510 Ga0439438_011211 3300041405 Bacteria 2801
511 Ga0439438_011994 3300041405 Bacteria 2675
512 Ga0439438_012582 3300041405 Bacteria 2590
513 Ga0439438_061044 3300041405 Bacteria 944
514 Ga0439439_0063897 3300041406 Bacteria 980
515 Ga0439447_002863 3300041407 Bacteria 6188
516 Ga0439447_004175 3300041407 Bacteria 5018
517 Ga0439447_004680 3300041407 Bacteria 4664
518 Ga0439447_013815 3300041407 Bacteria 2281
519 Ga0439447_017218 3300041407 Bacteria 1969
520 Ga0439447_020976 3300041407 Bacteria 1725
521 Ga0439447_032463 3300041407 Bacteria 1304
522 Ga0439447_051913 3300041407 Bacteria 977
523 Ga0439466_0019610 3300041411 Bacteria 2420
524 Ga0439466_0020149 3300041411 Bacteria 2380
525 Ga0439466_0035502 3300041411 Bacteria 1686
526 Ga0439466_0047975 3300041411 Bacteria 1406
527 Ga0451800_1297498 3300041459 Bacteria 651
528 Ga0439431_0002041 3300041997 Bacteria 4466
529 Ga0439442_061309 3300042002 Bacteria 797
530 Ga0439445_0013551 3300042004 Bacteria 1974
531 Ga0439445_0032387 3300042004 Bacteria 1362
532 Ga0439445_0043310 3300042004 Bacteria 1201
533 Ga0439445_0045289 3300042004 Bacteria 1177
534 Ga0439432_004482 3300042006 Bacteria 5099
535 Ga0439432_004634 3300042006 Bacteria 5007
536 Ga0439432_006924 3300042006 Bacteria 4033
537 Ga0439432_011191 3300042006 Bacteria 3092
538 Ga0439432_139507 3300042006 Bacteria 713
539 Ga0439451_001995 3300042009 Bacteria 4092
540 Ga0439451_002211 3300042009 Bacteria 3917
541 Ga0439452_001491 3300042010 Bacteria 9502
542 Ga0439452_001907 3300042010 Bacteria 8015
543 Ga0439452_002387 3300042010 Bacteria 6965
544 Ga0439452_003060 3300042010 Bacteria 5945
545 Ga0439452_032216 3300042010 Bacteria 1282
546 Ga0439456_004790 3300042013 Bacteria 2739
547 Ga0439456_005414 3300042013 Bacteria 2589
548 Ga0439456_005591 3300042013 Bacteria 2553
549 Ga0439456_016171 3300042013 Bacteria 1560
550 Ga0439456_021160 3300042013 Bacteria 1375
551 Ga0439456_021694 3300042013 Bacteria 1359
552 Ga0439456_027578 3300042013 Bacteria 1210
553 Ga0439463_001204 3300042016 Bacteria 6908
554 Ga0439463_003497 3300042016 Bacteria 3969
555 Ga0439463_003977 3300042016 Bacteria 3721
556 Ga0439463_004352 3300042016 Bacteria 3549
557 Ga0439463_018154 3300042016 Bacteria 1749
558 Ga0439463_030735 3300042016 Bacteria 1354
559 Ga0439463_046759 3300042016 Bacteria 1102
560 Ga0439463_074348 3300042016 Bacteria 871
561 Ga0450911_000236 3300042115 Bacteria 20967
562 Ga0450911_001300 3300042115 Bacteria 5921
563 Ga0450911_004917 3300042115 Bacteria 2133
564 Ga0450911_017699 3300042115 Bacteria 937
565 Ga0450888_007591 3300042126 Bacteria 1204
566 Ga0450894_007704 3300042131 Bacteria 1389
567 Ga0450899_011088 3300042135 Bacteria 1003
568 Ga0450900_003594 3300042136 Bacteria 1730
569 Ga0450902_001010 3300042137 Bacteria 3705
570 Ga0450902_002261 3300042137 Bacteria 2721
571 Ga0450902_005345 3300042137 Bacteria 1935
572 Ga0450902_005493 3300042137 Bacteria 1917
573 Ga0450902_007671 3300042137 Bacteria 1673
574 Ga0450903_002521 3300042138 Bacteria 3252
575 Ga0450903_011918 3300042138 Bacteria 1395
576 Ga0450903_014559 3300042138 Bacteria 1243
577 Ga0450904_007510 3300042139 Bacteria 1082
578 Ga0450904_011103 3300042139 Bacteria 890
579 Ga0450905_028387 3300042142 Bacteria 853
580 Ga0450889_008157 3300042144 Bacteria 1061
581 Ga0450906_000783 3300042145 Bacteria 6936
582 Ga0450906_002506 3300042145 Bacteria 4013
583 Ga0450910_002357 3300042147 Bacteria 2474
584 Ga0439446_0002986 3300042156 Bacteria 4140
585 Ga0439446_0030737 3300042156 Bacteria 1553
586 Ga0450909_001005 3300042185 Bacteria 3877
587 Ga0439459_0130893 3300042438 Bacteria 641
588 Ga0439464_0000743 3300042439 Bacteria 7067
589 Ga0439460_0003143 3300042461 Bacteria 3990
590 Ga0450893_0001733 3300042532 Bacteria 3354
591 Ga0450893_0010860 3300042532 Bacteria 1499
592 Ga0450901_000604 3300042533 Bacteria 4220
593 Ga0439440_0004378 3300042993 Bacteria 2772
594 Ga0453684_0639733 3300044712 Unclassified 1162
595 Ga0466959_0294689 3300045049 Bacteria 1112
596 Ga0451576_0576949 3300045051 Bacteria 1182
597 Ga0466958_0031632 3300045836 Bacteria 3146
598 Ga0495617_007086 3300046452 Bacteria 3910
599 Ga0495617_007896 3300046452 Bacteria 3681
600 Ga0495617_008048 3300046452 Bacteria 3641
601 Ga0495617_020373 3300046452 Bacteria 2241
602 Ga0495617_025423 3300046452 Bacteria 1996
603 Ga0495617_064999 3300046452 Bacteria 1203
604 Ga0495617_071470 3300046452 Bacteria 1141
605 Ga0495617_077117 3300046452 Bacteria 1093
606 Ga0495617_093795 3300046452 Bacteria 978
607 Ga0495617_104403 3300046452 Bacteria 919
608 Ga0495627_000495 3300046453 Bacteria 33051
609 Ga0495627_005216 3300046453 Bacteria 5277
610 Ga0495627_005681 3300046453 Bacteria 4983
611 Ga0495627_006644 3300046453 Bacteria 4510
612 Ga0495627_007386 3300046453 Bacteria 4213
613 Ga0495627_009195 3300046453 Bacteria 3646
614 Ga0495627_018562 3300046453 Bacteria 2343
615 Ga0495627_023960 3300046453 Bacteria 1994
616 Ga0495627_029856 3300046453 Bacteria 1730
617 Ga0495592_0082258 3300046454 Bacteria 2327
618 Ga0495603_0028741 3300046455 Bacteria 3355
619 Ga0495603_0225000 3300046455 Bacteria 1082
620 Ga0495590_0003798 3300046457 Bacteria 6149
621 Ga0495590_0004049 3300046457 Bacteria 5941
622 Ga0495590_0006479 3300046457 Bacteria 4568
623 Ga0495590_0017712 3300046457 Bacteria 2559
624 Ga0495590_0139573 3300046457 Bacteria 874
625 Ga0495591_003662 3300046458 Bacteria 7818
626 Ga0495591_004116 3300046458 Bacteria 7232
627 Ga0495591_004442 3300046458 Bacteria 6872
628 Ga0495591_004480 3300046458 Bacteria 6828
629 Ga0495591_006154 3300046458 Bacteria 5373
630 Ga0495591_006419 3300046458 Bacteria 5200
631 Ga0495591_006483 3300046458 Bacteria 5171
632 Ga0495591_006800 3300046458 Bacteria 4978
633 Ga0495591_007831 3300046458 Bacteria 4464
634 Ga0495591_008165 3300046458 Bacteria 4319
635 Ga0495591_008338 3300046458 Bacteria 4262
636 Ga0495591_012110 3300046458 Bacteria 3228
637 Ga0495591_014195 3300046458 Bacteria 2875
638 Ga0495591_014293 3300046458 Bacteria 2861
639 Ga0495591_019646 3300046458 Bacteria 2255
640 Ga0495591_020305 3300046458 Bacteria 2197
641 Ga0495591_023506 3300046458 Bacteria 1972
642 Ga0495591_078214 3300046458 Bacteria 847
643 Ga0495629_0005077 3300046459 Bacteria 9846
644 Ga0495629_0448597 3300046459 Bacteria 873
645 Ga0495629_0553097 3300046459 Bacteria 772
646 Ga0495638_0003207 3300046460 Bacteria 12931
647 Ga0495638_0010814 3300046460 Bacteria 6311
648 Ga0495638_0010929 3300046460 Bacteria 6276
649 Ga0495638_0013448 3300046460 Bacteria 5571
650 Ga0495638_0015458 3300046460 Bacteria 5123
651 Ga0495638_0021756 3300046460 Bacteria 4218
652 Ga0495638_0029545 3300046460 Bacteria 3534
653 Ga0495638_0044771 3300046460 Bacteria 2787
654 Ga0495638_0080854 3300046460 Bacteria 1973
655 Ga0495638_0120080 3300046460 Bacteria 1554
656 Ga0495638_0132240 3300046460 Bacteria 1464
657 Ga0495638_0142232 3300046460 Bacteria 1399
658 Ga0495638_0186866 3300046460 Bacteria 1178
659 Ga0495638_0234192 3300046460 Bacteria 1020
660 Ga0495653_0033552 3300046463 Bacteria 4065
661 Ga0495653_0085751 3300046463 Bacteria 2315
662 Ga0495653_0086061 3300046463 Bacteria 2310
663 Ga0495653_0260579 3300046463 Bacteria 1146
664 Ga0495650_0001566 3300046471 Bacteria 21553
665 Ga0495650_0008327 3300046471 Bacteria 6065
666 Ga0495650_0010428 3300046471 Bacteria 5183
667 Ga0495650_0014666 3300046471 Bacteria 4058
668 Ga0495650_0017520 3300046471 Bacteria 3589
669 Ga0495650_0017797 3300046471 Bacteria 3552
670 Ga0495650_0045018 3300046471 Bacteria 1860
671 Ga0495650_0064931 3300046471 Bacteria 1450
672 Ga0495580_0115515 3300046472 Bacteria 1864
673 Ga0495580_0282886 3300046472 Bacteria 1131
674 Ga0495582_0178365 3300046473 Bacteria 1210
675 Ga0495582_0330151 3300046473 Bacteria 878
676 Ga0495605_0003821 3300046474 Bacteria 8933
677 Ga0495605_0005419 3300046474 Bacteria 7430
678 Ga0495605_0010576 3300046474 Bacteria 5161
679 Ga0495605_0012908 3300046474 Bacteria 4622
680 Ga0495605_0014352 3300046474 Bacteria 4343
681 Ga0495605_0019059 3300046474 Bacteria 3672
682 Ga0495605_0022041 3300046474 Bacteria 3368
683 Ga0495605_0023168 3300046474 Bacteria 3269
684 Ga0495605_0030302 3300046474 Bacteria 2775
685 Ga0495605_0030731 3300046474 Bacteria 2751
686 Ga0495605_0075638 3300046474 Bacteria 1583
687 Ga0495605_0121685 3300046474 Bacteria 1182
688 Ga0495605_0136815 3300046474 Bacteria 1101
689 Ga0495605_0141437 3300046474 Bacteria 1079
690 Ga0495639_0061723 3300046475 Bacteria 1719
691 Ga0495584_0001192 3300046491 Bacteria 15972
692 Ga0495584_0003718 3300046491 Bacteria 8318
693 Ga0495584_0004136 3300046491 Bacteria 7832
694 Ga0495584_0006437 3300046491 Bacteria 6146
695 Ga0495584_0010293 3300046491 Bacteria 4805
696 Ga0495584_0011743 3300046491 Bacteria 4478
697 Ga0495584_0014343 3300046491 Bacteria 4037
698 Ga0495584_0020997 3300046491 Bacteria 3316
699 Ga0495584_0024248 3300046491 Bacteria 3076
700 Ga0495584_0047881 3300046491 Bacteria 2156
701 Ga0495584_0055036 3300046491 Bacteria 2002
702 Ga0495584_0060649 3300046491 Bacteria 1902
703 Ga0495584_0066474 3300046491 Bacteria 1813
704 Ga0495584_0069911 3300046491 Bacteria 1764
705 Ga0495584_0070811 3300046491 Bacteria 1752
706 Ga0495584_0313642 3300046491 Bacteria 796
707 Ga0495585_0000410 3300046492 Bacteria 41579
708 Ga0495585_0000739 3300046492 Bacteria 29079
709 Ga0495585_0009299 3300046492 Bacteria 5902
710 Ga0495585_0009717 3300046492 Bacteria 5757
711 Ga0495585_0010346 3300046492 Bacteria 5559
712 Ga0495585_0011832 3300046492 Bacteria 5154
713 Ga0495585_0011880 3300046492 Bacteria 5143
714 Ga0495585_0013950 3300046492 Bacteria 4693
715 Ga0495585_0031251 3300046492 Bacteria 3023
716 Ga0495585_0038365 3300046492 Bacteria 2696
717 Ga0495585_0048477 3300046492 Bacteria 2361
718 Ga0495585_0118369 3300046492 Bacteria 1403
719 Ga0495585_0213989 3300046492 Bacteria 975
720 Ga0495585_0268666 3300046492 Bacteria 846
721 Ga0495585_0279159 3300046492 Bacteria 826
722 Ga0495594_0136492 3300046499 Bacteria 1390
723 Ga0495594_0285417 3300046499 Bacteria 940
724 Ga0495596_0000390 3300046500 Bacteria 27952
725 Ga0495596_0002058 3300046500 Bacteria 11053
726 Ga0495596_0026561 3300046500 Bacteria 2332
727 Ga0495596_0033165 3300046500 Bacteria 2055
728 Ga0495596_0033356 3300046500 Bacteria 2048
729 Ga0495596_0035801 3300046500 Bacteria 1967
730 Ga0495596_0036748 3300046500 Bacteria 1939
731 Ga0495596_0141152 3300046500 Bacteria 935
732 Ga0495607_0001054 3300046501 Bacteria 25166
733 Ga0495607_0008126 3300046501 Bacteria 7199
734 Ga0495607_0010704 3300046501 Bacteria 6146
735 Ga0495607_0012113 3300046501 Bacteria 5704
736 Ga0495607_0012410 3300046501 Bacteria 5627
737 Ga0495607_0013476 3300046501 Bacteria 5356
738 Ga0495607_0014441 3300046501 Bacteria 5138
739 Ga0495607_0017305 3300046501 Bacteria 4629
740 Ga0495607_0017518 3300046501 Bacteria 4594
741 Ga0495607_0019092 3300046501 Bacteria 4358
742 Ga0495607_0020630 3300046501 Bacteria 4160
743 Ga0495607_0021335 3300046501 Bacteria 4076
744 Ga0495607_0022074 3300046501 Bacteria 4001
745 Ga0495607_0026976 3300046501 Bacteria 3558
746 Ga0495607_0034481 3300046501 Bacteria 3069
747 Ga0495607_0054664 3300046501 Bacteria 2300
748 Ga0495607_0063733 3300046501 Bacteria 2084
749 Ga0495607_0079442 3300046501 Bacteria 1807
750 Ga0495607_0085511 3300046501 Bacteria 1722
751 Ga0495607_0098673 3300046501 Bacteria 1568
752 Ga0495607_0115573 3300046501 Bacteria 1416
753 Ga0495607_0116250 3300046501 Bacteria 1411
754 Ga0495607_0172525 3300046501 Bacteria 1091
755 Ga0495607_0211439 3300046501 Bacteria 954
756 Ga0495583_0000068 3300046506 Bacteria 188922
757 Ga0495583_0000894 3300046506 Bacteria 35676
758 Ga0495583_0007443 3300046506 Bacteria 6875
759 Ga0495583_0011123 3300046506 Bacteria 5185
760 Ga0495583_0011440 3300046506 Bacteria 5094
761 Ga0495583_0012371 3300046506 Bacteria 4836
762 Ga0495583_0013768 3300046506 Bacteria 4492
763 Ga0495583_0019251 3300046506 Bacteria 3567
764 Ga0495583_0028700 3300046506 Bacteria 2732
765 Ga0495583_0036661 3300046506 Bacteria 2330
766 Ga0495583_0043155 3300046506 Bacteria 2101
767 Ga0495583_0056894 3300046506 Bacteria 1761
768 Ga0495606_0012494 3300046507 Bacteria 6801
769 Ga0495606_0013491 3300046507 Bacteria 6447
770 Ga0495606_0014224 3300046507 Bacteria 6226
771 Ga0495606_0016152 3300046507 Bacteria 5708
772 Ga0495606_0016576 3300046507 Bacteria 5610
773 Ga0495606_0020833 3300046507 Bacteria 4818
774 Ga0495606_0022690 3300046507 Bacteria 4562
775 Ga0495606_0022921 3300046507 Bacteria 4536
776 Ga0495606_0024588 3300046507 Bacteria 4336
777 Ga0495606_0029920 3300046507 Bacteria 3815
778 Ga0495606_0081661 3300046507 Bacteria 2009
779 Ga0495606_0202987 3300046507 Bacteria 1128
780 Ga0495610_0007789 3300046512 Bacteria 7062
781 Ga0495610_0012282 3300046512 Bacteria 5166
782 Ga0495610_0012445 3300046512 Bacteria 5121
783 Ga0495610_0012592 3300046512 Bacteria 5079
784 Ga0495610_0013289 3300046512 Bacteria 4898
785 Ga0495610_0013730 3300046512 Bacteria 4795
786 Ga0495610_0015913 3300046512 Bacteria 4350
787 Ga0495610_0027614 3300046512 Bacteria 3013
788 Ga0495610_0030992 3300046512 Bacteria 2794
789 Ga0495610_0031597 3300046512 Bacteria 2761
790 Ga0495610_0039822 3300046512 Bacteria 2373
791 Ga0495610_0048398 3300046512 Bacteria 2087
792 Ga0495610_0059743 3300046512 Bacteria 1818
793 Ga0495610_0061348 3300046512 Bacteria 1787
794 Ga0495610_0072371 3300046512 Bacteria 1604
795 Ga0495610_0092610 3300046512 Bacteria 1367
796 Ga0495610_0093523 3300046512 Bacteria 1358
797 Ga0495610_0183063 3300046512 Bacteria 870
798 Ga0495616_0003480 3300046513 Bacteria 10072
799 Ga0495616_0004648 3300046513 Bacteria 8620
800 Ga0495616_0008281 3300046513 Bacteria 6169
801 Ga0495616_0010556 3300046513 Bacteria 5340
802 Ga0495616_0010883 3300046513 Bacteria 5238
803 Ga0495616_0011601 3300046513 Bacteria 5041
804 Ga0495616_0012718 3300046513 Bacteria 4766
805 Ga0495616_0014962 3300046513 Bacteria 4326
806 Ga0495616_0017026 3300046513 Bacteria 4012
807 Ga0495616_0018749 3300046513 Bacteria 3790
808 Ga0495616_0033290 3300046513 Bacteria 2686
809 Ga0495616_0062572 3300046513 Bacteria 1822
810 Ga0495616_0062608 3300046513 Bacteria 1821
811 Ga0495616_0084242 3300046513 Bacteria 1515
812 Ga0495616_0090218 3300046513 Bacteria 1452
813 Ga0495616_0106551 3300046513 Bacteria 1307
814 Ga0495616_0126997 3300046513 Bacteria 1172
815 Ga0495620_0004148 3300046515 Bacteria 8218
816 Ga0495620_0005071 3300046515 Bacteria 7373
817 Ga0495620_0005301 3300046515 Bacteria 7212
818 Ga0495620_0006105 3300046515 Bacteria 6656
819 Ga0495620_0010474 3300046515 Bacteria 4891
820 Ga0495620_0011578 3300046515 Bacteria 4596
821 Ga0495620_0017752 3300046515 Bacteria 3539
822 Ga0495620_0030502 3300046515 Bacteria 2481
823 Ga0495620_0033895 3300046515 Bacteria 2312
824 Ga0495620_0035280 3300046515 Bacteria 2250
825 Ga0495620_0042959 3300046515 Bacteria 1971
826 Ga0495620_0056923 3300046515 Bacteria 1642
827 Ga0495620_0058542 3300046515 Bacteria 1612
828 Ga0495620_0072384 3300046515 Bacteria 1407
829 Ga0495630_0067219 3300046517 Bacteria 2694
830 Ga0495631_0003637 3300046518 Bacteria 8416
831 Ga0495631_0006304 3300046518 Bacteria 6137
832 Ga0495631_0006675 3300046518 Bacteria 5933
833 Ga0495631_0008435 3300046518 Bacteria 5195
834 Ga0495631_0011849 3300046518 Bacteria 4276
835 Ga0495631_0018100 3300046518 Bacteria 3320
836 Ga0495631_0037751 3300046518 Bacteria 2150
837 Ga0495631_0051951 3300046518 Bacteria 1790
838 Ga0495631_0067984 3300046518 Bacteria 1541
839 Ga0495632_0001087 3300046519 Bacteria 23308
840 Ga0495632_0004088 3300046519 Bacteria 10060
841 Ga0495632_0004661 3300046519 Bacteria 9260
842 Ga0495632_0009017 3300046519 Bacteria 6049
843 Ga0495632_0009759 3300046519 Bacteria 5754
844 Ga0495632_0011659 3300046519 Bacteria 5119
845 Ga0495632_0011755 3300046519 Bacteria 5095
846 Ga0495632_0011910 3300046519 Bacteria 5050
847 Ga0495632_0014103 3300046519 Bacteria 4534
848 Ga0495632_0023225 3300046519 Bacteria 3314
849 Ga0495632_0036478 3300046519 Bacteria 2500
850 Ga0495632_0040196 3300046519 Bacteria 2357
851 Ga0495632_0113810 3300046519 Bacteria 1268
852 Ga0495632_0116298 3300046519 Bacteria 1252
853 Ga0495632_0122979 3300046519 Bacteria 1211
854 Ga0495632_0230290 3300046519 Bacteria 836
855 Ga0495632_0290008 3300046519 Bacteria 727
856 Ga0495637_0000303 3300046520 Bacteria 38131
857 Ga0495637_0000319 3300046520 Bacteria 37329
858 Ga0495637_0005944 3300046520 Bacteria 6170
859 Ga0495637_0007762 3300046520 Bacteria 5301
860 Ga0495637_0008046 3300046520 Bacteria 5191
861 Ga0495637_0008931 3300046520 Bacteria 4904
862 Ga0495637_0009557 3300046520 Bacteria 4727
863 Ga0495637_0009917 3300046520 Bacteria 4633
864 Ga0495637_0009951 3300046520 Bacteria 4625
865 Ga0495637_0015037 3300046520 Bacteria 3638
866 Ga0495637_0015447 3300046520 Bacteria 3580
867 Ga0495637_0021142 3300046520 Bacteria 2985
868 Ga0495637_0048749 3300046520 Bacteria 1782
869 Ga0495637_0051433 3300046520 Bacteria 1724
870 Ga0495637_0057611 3300046520 Bacteria 1604
871 Ga0495637_0076569 3300046520 Bacteria 1340
872 Ga0495637_0076823 3300046520 Bacteria 1337
873 Ga0495643_0000511 3300046522 Bacteria 48399
874 Ga0495643_0011413 3300046522 Bacteria 5410
875 Ga0495643_0012218 3300046522 Bacteria 5186
876 Ga0495643_0013645 3300046522 Bacteria 4856
877 Ga0495643_0017383 3300046522 Bacteria 4204
878 Ga0495643_0023437 3300046522 Bacteria 3510
879 Ga0495643_0028577 3300046522 Bacteria 3124
880 Ga0495643_0051755 3300046522 Bacteria 2207
881 Ga0495643_0062259 3300046522 Bacteria 1976
882 Ga0495643_0088596 3300046522 Bacteria 1599
883 Ga0495643_0190982 3300046522 Bacteria 989
884 Ga0495643_0200359 3300046522 Bacteria 958
885 Ga0495644_0003496 3300046523 Bacteria 6210
886 Ga0495644_0003678 3300046523 Bacteria 6035
887 Ga0495644_0006029 3300046523 Bacteria 4722
888 Ga0495644_0012208 3300046523 Bacteria 3302
889 Ga0495644_0031926 3300046523 Bacteria 1990
890 Ga0495648_0014373 3300046524 Bacteria 5799
891 Ga0495648_0016278 3300046524 Bacteria 5365
892 Ga0495648_0018284 3300046524 Bacteria 4970
893 Ga0495648_0018977 3300046524 Bacteria 4850
894 Ga0495648_0024781 3300046524 Bacteria 4075
895 Ga0495648_0025436 3300046524 Bacteria 4007
896 Ga0495648_0054799 3300046524 Bacteria 2407
897 Ga0495648_0061587 3300046524 Bacteria 2227
898 Ga0495648_0096733 3300046524 Bacteria 1640
899 Ga0495648_0112741 3300046524 Bacteria 1476
900 Ga0495648_0163629 3300046524 Bacteria 1147
901 Ga0495648_0185247 3300046524 Bacteria 1054
902 Ga0495648_0195032 3300046524 Bacteria 1018
903 Ga0495648_0334962 3300046524 Bacteria 696
904 Ga0495648_0341234 3300046524 Bacteria 687
905 Ga0495663_0002550 3300046525 Bacteria 5448
906 Ga0495666_0001594 3300046526 Bacteria 11166
907 Ga0495666_0005452 3300046526 Bacteria 6410
908 Ga0495666_0033751 3300046526 Bacteria 2498
909 Ga0495666_0052168 3300046526 Bacteria 1963
910 Ga0495642_0007586 3300046528 Bacteria 4156
911 Ga0495642_0026367 3300046528 Bacteria 2308
912 Ga0495652_0139309 3300046529 Bacteria 1909
913 Ga0495652_0149465 3300046529 Bacteria 1827
914 Ga0495654_0009456 3300046530 Bacteria 5342
915 Ga0495654_0009932 3300046530 Bacteria 5202
916 Ga0495654_0011675 3300046530 Bacteria 4745
917 Ga0495654_0013372 3300046530 Bacteria 4393
918 Ga0495654_0018388 3300046530 Bacteria 3663
919 Ga0495654_0024744 3300046530 Bacteria 3098
920 Ga0495654_0032511 3300046530 Bacteria 2644
921 Ga0495654_0040766 3300046530 Bacteria 2312
922 Ga0495654_0041296 3300046530 Bacteria 2294
923 Ga0495654_0041857 3300046530 Bacteria 2276
924 Ga0495654_0047841 3300046530 Bacteria 2100
925 Ga0495654_0057254 3300046530 Bacteria 1883
926 Ga0495654_0065437 3300046530 Bacteria 1735
927 Ga0495654_0070709 3300046530 Bacteria 1654
928 Ga0495654_0082325 3300046530 Bacteria 1506
929 Ga0495654_0083374 3300046530 Bacteria 1494
930 Ga0495654_0092519 3300046530 Bacteria 1401
931 Ga0495654_0107452 3300046530 Bacteria 1276
932 Ga0495654_0152379 3300046530 Bacteria 1021
933 Ga0495654_0164305 3300046530 Bacteria 972
934 Ga0495665_0001902 3300046531 Bacteria 11266
935 Ga0495665_0117761 3300046531 Bacteria 1391
936 Ga0495587_0022578 3300046536 Bacteria 3873
937 Ga0495587_0069601 3300046536 Bacteria 2049
938 Ga0495587_0101474 3300046536 Bacteria 1657
939 Ga0495609_0000265 3300046538 Bacteria 49286
940 Ga0495609_0000273 3300046538 Bacteria 48181
941 Ga0495609_0006959 3300046538 Bacteria 5704
942 Ga0495609_0011783 3300046538 Bacteria 4156
943 Ga0495609_0018573 3300046538 Bacteria 3221
944 Ga0495609_0046408 3300046538 Bacteria 1945
945 Ga0495609_0065489 3300046538 Bacteria 1601
946 Ga0495609_0083930 3300046538 Bacteria 1390
947 Ga0495609_0087355 3300046538 Bacteria 1358
948 Ga0495609_0149812 3300046538 Bacteria 992
949 Ga0495621_0006366 3300046539 Bacteria 3442
950 Ga0495597_0007123 3300046542 Bacteria 5721
951 Ga0495597_0011747 3300046542 Bacteria 4240
952 Ga0495597_0017719 3300046542 Bacteria 3347
953 Ga0495597_0027276 3300046542 Bacteria 2619
954 Ga0495597_0028921 3300046542 Bacteria 2532
955 Ga0495597_0043949 3300046542 Bacteria 1987
956 Ga0495597_0059970 3300046542 Bacteria 1660
957 Ga0495597_0070214 3300046542 Bacteria 1510
958 Ga0495597_0071047 3300046542 Bacteria 1499
959 Ga0495597_0115806 3300046542 Bacteria 1120
960 Ga0495622_0010409 3300046557 Bacteria 4296
961 Ga0495622_0012811 3300046557 Bacteria 3888
962 Ga0495622_0059074 3300046557 Bacteria 1775
963 Ga0495622_0076119 3300046557 Bacteria 1546
964 Ga0495633_0002998 3300046558 Bacteria 11528
965 Ga0495633_0005077 3300046558 Bacteria 8187
966 Ga0495633_0007023 3300046558 Bacteria 6562
967 Ga0495633_0010036 3300046558 Bacteria 5194
968 Ga0495633_0015392 3300046558 Bacteria 3969
969 Ga0495633_0041861 3300046558 Bacteria 2177
970 Ga0495656_0089946 3300046615 Bacteria 1402
971 Ga0495656_0142824 3300046615 Bacteria 1150
972 Ga0495668_0005756 3300046616 Bacteria 8284
973 Ga0495668_0007072 3300046616 Bacteria 7224
974 Ga0495668_0008311 3300046616 Bacteria 6498
975 Ga0495668_0012122 3300046616 Bacteria 5126
976 Ga0495668_0022671 3300046616 Bacteria 3587
977 Ga0495668_0028223 3300046616 Bacteria 3175
978 Ga0495668_0033761 3300046616 Bacteria 2873
979 Ga0495668_0234776 3300046616 Bacteria 1004
980 Ga0495668_0257037 3300046616 Bacteria 956
981 Ga0495634_0010366 3300046642 Bacteria 6829
982 Ga0495634_0267534 3300046642 Bacteria 1041
983 Ga0495611_0000909 3300046648 Bacteria 16011
984 Ga0495611_0003735 3300046648 Bacteria 6646
985 Ga0495611_0004597 3300046648 Bacteria 5941
986 Ga0495611_0010094 3300046648 Bacteria 3997
987 Ga0495611_0014131 3300046648 Bacteria 3407
988 Ga0495611_0014519 3300046648 Bacteria 3365
989 Ga0495611_0017331 3300046648 Bacteria 3081
990 Ga0495611_0035857 3300046648 Bacteria 2199
991 Ga0495611_0036074 3300046648 Bacteria 2192
992 Ga0495611_0067150 3300046648 Bacteria 1636
993 Ga0495611_0071670 3300046648 Bacteria 1584
994 Ga0495625_0000076 3300046660 Bacteria 163580
995 Ga0495625_0012712 3300046660 Bacteria 6809
996 Ga0495625_0013277 3300046660 Bacteria 6626
997 Ga0495625_0019511 3300046660 Bacteria 5257
998 Ga0495625_0022267 3300046660 Bacteria 4862
999 Ga0495625_0050775 3300046660 Bacteria 2975
1000 Ga0495625_0100399 3300046660 Bacteria 1989
1001 Ga0495625_0108497 3300046660 Bacteria 1899
1002 Ga0495625_0141026 3300046660 Bacteria 1626
1003 Ga0495625_0170892 3300046660 Bacteria 1451
1004 Ga0495635_0021199 3300046663 Bacteria 4529
1005 Ga0495661_0000432 3300046665 Bacteria 44289
1006 Ga0495661_0000517 3300046665 Bacteria 40087
1007 Ga0495661_0002452 3300046665 Bacteria 14290
1008 Ga0495661_0005510 3300046665 Bacteria 8983
1009 Ga0495661_0014508 3300046665 Bacteria 5277
1010 Ga0495661_0017686 3300046665 Bacteria 4702
1011 Ga0495661_0035762 3300046665 Bacteria 3114
1012 Ga0495661_0039089 3300046665 Bacteria 2950
1013 Ga0495661_0046428 3300046665 Bacteria 2652
1014 Ga0495661_0052126 3300046665 Bacteria 2466
1015 Ga0495661_0059169 3300046665 Bacteria 2281
1016 Ga0495661_0061157 3300046665 Bacteria 2236
1017 Ga0495661_0085048 3300046665 Bacteria 1813
1018 Ga0495661_0090240 3300046665 Bacteria 1745
1019 Ga0495661_0207728 3300046665 Bacteria 1021
1020 Ga0495588_0045712 3300046674 Bacteria 2245
1021 Ga0495599_0212599 3300046678 Bacteria 1185
1022 Ga0495623_0019478 3300046679 Bacteria 4385
1023 Ga0495623_0262435 3300046679 Bacteria 967
1024 Ga0495646_0033092 3300046680 Bacteria 3215
1025 Ga0495646_0038083 3300046680 Bacteria 2971
1026 Ga0495646_0088898 3300046680 Bacteria 1788
1027 Ga0495669_0002471 3300046684 Bacteria 7546
1028 Ga0495613_0025372 3300046689 Bacteria 4416
1029 Ga0495613_0174288 3300046689 Bacteria 1525
1030 Ga0495624_0001085 3300046690 Bacteria 21505
1031 Ga0495624_0004873 3300046690 Bacteria 9753
1032 Ga0495670_0008092 3300046691 Bacteria 5167
1033 Ga0495670_0016442 3300046691 Bacteria 3635
1034 Ga0495670_0021486 3300046691 Bacteria 3183
1035 Ga0495670_0037492 3300046691 Bacteria 2416
1036 Ga0495670_0038116 3300046691 Bacteria 2396
1037 Ga0495670_0061438 3300046691 Bacteria 1889
1038 Ga0495670_0118565 3300046691 Bacteria 1374
1039 Ga0495670_0141647 3300046691 Bacteria 1257
1040 Ga0495671_0001004 3300046692 Bacteria 19649
1041 Ga0495671_0009355 3300046692 Bacteria 5471
1042 Ga0495671_0009977 3300046692 Bacteria 5285
1043 Ga0495671_0011411 3300046692 Bacteria 4890
1044 Ga0495671_0012303 3300046692 Bacteria 4677
1045 Ga0495671_0015119 3300046692 Bacteria 4143
1046 Ga0495671_0016651 3300046692 Bacteria 3921
1047 Ga0495671_0016688 3300046692 Bacteria 3916
1048 Ga0495671_0016720 3300046692 Bacteria 3910
1049 Ga0495671_0027253 3300046692 Bacteria 2952
1050 Ga0495671_0043438 3300046692 Bacteria 2255
1051 Ga0495671_0061076 3300046692 Bacteria 1859
1052 Ga0495671_0109747 3300046692 Bacteria 1347
1053 Ga0495671_0119092 3300046692 Bacteria 1288
1054 Ga0495671_0138243 3300046692 Bacteria 1187
1055 Ga0495671_0176610 3300046692 Bacteria 1037
1056 Ga0495671_0310202 3300046692 Bacteria 758
1057 Ga0495649_0006523 3300046694 Bacteria 7260
1058 Ga0495649_0011055 3300046694 Bacteria 5317
1059 Ga0495649_0011340 3300046694 Bacteria 5232
1060 Ga0495649_0015467 3300046694 Bacteria 4343
1061 Ga0495649_0016097 3300046694 Bacteria 4244
1062 Ga0495649_0016134 3300046694 Bacteria 4238
1063 Ga0495649_0029103 3300046694 Bacteria 3059
1064 Ga0495649_0031169 3300046694 Bacteria 2941
1065 Ga0495649_0040308 3300046694 Bacteria 2558
1066 Ga0495649_0082897 3300046694 Bacteria 1713
1067 Ga0495649_0162712 3300046694 Bacteria 1169
1068 Ga0495649_0164233 3300046694 Bacteria 1163
1069 Ga0495649_0164236 3300046694 Bacteria 1163
1070 Ga0495649_0367196 3300046694 Bacteria 725
1071 Ga0495589_0008794 3300046794 Bacteria 5255
1072 Ga0495589_0010880 3300046794 Bacteria 4727
1073 Ga0495589_0028825 3300046794 Bacteria 2800
1074 Ga0495589_0044487 3300046794 Bacteria 2208
1075 Ga0495589_0060542 3300046794 Bacteria 1859
1076 Ga0495589_0068641 3300046794 Bacteria 1734
1077 Ga0495589_0072158 3300046794 Bacteria 1686
1078 Ga0495589_0182112 3300046794 Bacteria 996
1079 Ga0495589_0254893 3300046794 Bacteria 819
1080 Ga0495600_0018529 3300046809 Bacteria 4435
1081 Ga0495660_0003517 3300046810 Bacteria 9662
1082 Ga0495660_0011492 3300046810 Bacteria 5135
1083 Ga0495660_0011900 3300046810 Bacteria 5047
1084 Ga0495660_0013599 3300046810 Bacteria 4719
1085 Ga0495660_0014665 3300046810 Bacteria 4532
1086 Ga0495660_0016956 3300046810 Bacteria 4194
1087 Ga0495660_0018430 3300046810 Bacteria 4013
1088 Ga0495660_0022157 3300046810 Bacteria 3630
1089 Ga0495660_0022207 3300046810 Bacteria 3626
1090 Ga0495660_0031714 3300046810 Bacteria 2971
1091 Ga0495660_0036266 3300046810 Bacteria 2751
1092 Ga0495660_0044446 3300046810 Bacteria 2443
1093 Ga0495660_0048106 3300046810 Bacteria 2333
1094 Ga0495660_0058739 3300046810 Bacteria 2070
1095 Ga0495660_0073676 3300046810 Bacteria 1805
1096 Ga0495660_0077541 3300046810 Bacteria 1748
1097 Ga0495660_0123279 3300046810 Bacteria 1308
1098 Ga0495660_0134277 3300046810 Bacteria 1238
1099 Ga0495660_0155358 3300046810 Bacteria 1126
1100 Ga0495660_0169489 3300046810 Bacteria 1064
1101 Ga0495660_0196731 3300046810 Bacteria 965
1102 Ga0495660_0214492 3300046810 Bacteria 911
1103 Ga0495581_0001131 3300047315 Bacteria 14600
1104 Ga0495581_0097722 3300047315 Bacteria 1705
1105 Ga0495604_0022227 3300047317 Bacteria 5063
1106 Ga0495604_0039835 3300047317 Bacteria 3691
1107 Ga0495604_0078969 3300047317 Bacteria 2468
1108 Ga0495604_0261298 3300047317 Bacteria 1176
1109 Ga0495674_0176205 3300047319 Bacteria 1782
1110 Ga0495672_0007121 3300047320 Bacteria 8471
1111 Ga0495672_0014208 3300047320 Bacteria 5461
1112 Ga0495672_0015219 3300047320 Bacteria 5232
1113 Ga0495672_0015995 3300047320 Bacteria 5077
1114 Ga0495672_0037377 3300047320 Bacteria 2971
1115 Ga0495672_0044072 3300047320 Bacteria 2678
1116 Ga0495672_0055394 3300047320 Bacteria 2314
1117 Ga0495672_0065157 3300047320 Bacteria 2083
1118 Ga0495672_0070155 3300047320 Bacteria 1986
1119 Ga0495672_0070678 3300047320 Bacteria 1977
1120 Ga0495672_0078020 3300047320 Bacteria 1854
1121 Ga0495672_0091005 3300047320 Bacteria 1675
1122 Ga0495672_0112154 3300047320 Bacteria 1462
1123 Ga0495676_0000016 3300047321 Bacteria 196310
1124 Ga0495676_0025694 3300047321 Bacteria 5080
1125 Ga0495676_0079666 3300047321 Bacteria 2489
1126 Ga0495676_0242785 3300047321 Bacteria 1232
1127 Ga0495680_0014686 3300047322 Bacteria 6774
1128 Ga0495680_0147454 3300047322 Bacteria 1717
1129 Ga0495683_0000035 3300047323 Bacteria 146394
1130 Ga0495683_0000910 3300047323 Bacteria 20890
1131 Ga0495683_0006291 3300047323 Bacteria 6496
1132 Ga0495683_0014905 3300047323 Bacteria 4048
1133 Ga0495683_0025594 3300047323 Bacteria 3024
1134 Ga0495683_0038668 3300047323 Bacteria 2415
1135 Ga0495683_0050714 3300047323 Bacteria 2076
1136 Ga0495683_0061878 3300047323 Bacteria 1853
1137 Ga0495683_0062523 3300047323 Bacteria 1841
1138 Ga0495687_000063 3300047443 Bacteria 169101
1139 Ga0495687_054463 3300047443 Bacteria 1679
1140 Ga0495675_0098292 3300047444 Bacteria 1833
1141 Ga0495675_0240224 3300047444 Bacteria 1090
1142 Ga0495675_0262472 3300047444 Bacteria 1034
1143 Ga0495677_0006492 3300047445 Bacteria 4420
1144 Ga0495677_0018976 3300047445 Bacteria 2494
1145 Ga0495679_001655 3300047446 Bacteria 12412
1146 Ga0495679_005511 3300047446 Bacteria 5598
1147 Ga0495679_006269 3300047446 Bacteria 5147
1148 Ga0495679_006525 3300047446 Bacteria 5000
1149 Ga0495679_006592 3300047446 Bacteria 4971
1150 Ga0495679_006882 3300047446 Bacteria 4826
1151 Ga0495679_007439 3300047446 Bacteria 4567
1152 Ga0495679_007544 3300047446 Bacteria 4521
1153 Ga0495679_007748 3300047446 Bacteria 4439
1154 Ga0495679_023233 3300047446 Bacteria 2105
1155 Ga0495679_035683 3300047446 Bacteria 1574
1156 Ga0495685_020297 3300047447 Bacteria 2283
1157 Ga0495673_0000472 3300047469 Bacteria 43659
1158 Ga0495673_0000586 3300047469 Bacteria 36563
1159 Ga0495673_0005060 3300047469 Bacteria 8071
1160 Ga0495673_0005065 3300047469 Bacteria 8068
1161 Ga0495673_0006701 3300047469 Bacteria 6742
1162 Ga0495673_0009595 3300047469 Bacteria 5344
1163 Ga0495673_0009750 3300047469 Bacteria 5285
1164 Ga0495673_0010126 3300047469 Bacteria 5155
1165 Ga0495673_0010485 3300047469 Bacteria 5034
1166 Ga0495673_0011365 3300047469 Bacteria 4789
1167 Ga0495673_0012606 3300047469 Bacteria 4472
1168 Ga0495673_0012628 3300047469 Bacteria 4468
1169 Ga0495673_0016751 3300047469 Bacteria 3738
1170 Ga0495673_0031283 3300047469 Bacteria 2492
1171 Ga0495673_0111653 3300047469 Bacteria 1092
1172 Ga0495673_0135693 3300047469 Bacteria 963
1173 Ga0495681_0008536 3300047470 Bacteria 6411
1174 Ga0495681_0009080 3300047470 Bacteria 6161
1175 Ga0495681_0010685 3300047470 Bacteria 5535
1176 Ga0495681_0010840 3300047470 Bacteria 5485
1177 Ga0495681_0011507 3300047470 Bacteria 5263
1178 Ga0495681_0012189 3300047470 Bacteria 5065
1179 Ga0495681_0012588 3300047470 Bacteria 4962
1180 Ga0495681_0013011 3300047470 Bacteria 4856
1181 Ga0495681_0014068 3300047470 Bacteria 4609
1182 Ga0495681_0014208 3300047470 Bacteria 4579
1183 Ga0495681_0023871 3300047470 Bacteria 3235
1184 Ga0495681_0029064 3300047470 Bacteria 2835
1185 Ga0495681_0029066 3300047470 Bacteria 2834
1186 Ga0495681_0034415 3300047470 Bacteria 2525
1187 Ga0495681_0040776 3300047470 Bacteria 2258
1188 Ga0495681_0043312 3300047470 Bacteria 2171
1189 Ga0495681_0045158 3300047470 Bacteria 2111
1190 Ga0495681_0045170 3300047470 Bacteria 2110
1191 Ga0495681_0056301 3300047470 Bacteria 1830
1192 Ga0495681_0057011 3300047470 Bacteria 1816
1193 Ga0495681_0075697 3300047470 Bacteria 1514
1194 Ga0495681_0101638 3300047470 Bacteria 1256
1195 Ga0495681_0109432 3300047470 Bacteria 1198
1196 Ga0495684_0208656 3300047471 Bacteria 1437
1197 Ga0495686_0014409 3300047472 Bacteria 5442
1198 Ga0495686_0015749 3300047472 Bacteria 5150
1199 Ga0495686_0028776 3300047472 Bacteria 3617
1200 Ga0495686_0056731 3300047472 Bacteria 2446
1201 Ga0495686_0116705 3300047472 Bacteria 1595
1202 Ga0495686_0243512 3300047472 Bacteria 1013
1203 Ga0495593_0006455 3300047673 Bacteria 6872
1204 Ga0495593_0047635 3300047673 Bacteria 2279
1205 Ga0495602_0015628 3300048088 Bacteria 7654
1206 Ga0495626_0000336 3300048091 Bacteria 49874
1207 Ga0495626_0001604 3300048091 Bacteria 17630
1208 Ga0495626_0001636 3300048091 Bacteria 17386
1209 Ga0495626_0002437 3300048091 Bacteria 12916
1210 Ga0495626_0004838 3300048091 Bacteria 8111
1211 Ga0495626_0009564 3300048091 Bacteria 5233
1212 Ga0495626_0012129 3300048091 Bacteria 4532
1213 Ga0495626_0013597 3300048091 Bacteria 4225
1214 Ga0495626_0014142 3300048091 Bacteria 4128
1215 Ga0495626_0014932 3300048091 Bacteria 3986
1216 Ga0495626_0247419 3300048091 Bacteria 716
1217 Ga0496100_0037926 3300048903 Bacteria 3050
1218 Ga0496101_0149688 3300048904 Bacteria 1784
1219 Ga0496102_0014410 3300048905 Bacteria 6869
1220 Ga0496103_0010266 3300048906 Bacteria 5537
1221 Ga0496104_0222828 3300048907 Bacteria 1798
1222 Ga0496109_0025285 3300048912 Bacteria 5289
1223 Ga0496109_0214025 3300048912 Bacteria 1812
1224 Ga0496110_0061055 3300048913 Bacteria 3326
1225 Ga0496110_0322613 3300048913 Bacteria 1407
1226 Ga0496111_0575440 3300048914 Bacteria 826
1227 Ga0496112_0004012 3300048915 Bacteria 12344
1228 Ga0496112_0579547 3300048915 Bacteria 1055
1229 Ga0496113_0001325 3300048916 Bacteria 13692
1230 Ga0496114_0100390 3300048917 Bacteria 2470
1231 Ga0496115_0029073 3300048918 Bacteria 4338
1232 Ga0496116_0013303 3300048919 Bacteria 6647
1233 Ga0496116_0019830 3300048919 Bacteria 5133
1234 Ga0496116_0022425 3300048919 Bacteria 4730
1235 Ga0496116_0141115 3300048919 Bacteria 1355
1236 Ga0496116_0318664 3300048919 Bacteria 729
1237 Ga0496117_0015146 3300048920 Bacteria 6598
1238 Ga0496117_0021079 3300048920 Bacteria 5290
1239 Ga0496117_0023515 3300048920 Bacteria 4905
1240 Ga0496117_0023921 3300048920 Bacteria 4850
1241 Ga0496117_0036229 3300048920 Bacteria 3694
1242 Ga0496117_0046628 3300048920 Bacteria 3115
1243 Ga0496117_0066137 3300048920 Bacteria 2453
1244 Ga0496117_0115985 3300048920 Bacteria 1656
1245 Ga0496117_0160369 3300048920 Bacteria 1318
1246 Ga0496117_0256482 3300048920 Bacteria 950
1247 Ga0496118_0019808 3300048921 Bacteria 6000
1248 Ga0496118_0023782 3300048921 Bacteria 5309
1249 Ga0496118_0033883 3300048921 Bacteria 4180
1250 Ga0496118_0038984 3300048921 Bacteria 3798
1251 Ga0496118_0057383 3300048921 Bacteria 2918
1252 Ga0496118_0062751 3300048921 Bacteria 2739
1253 Ga0496118_0113275 3300048921 Bacteria 1792
1254 Ga0496118_0269660 3300048921 Bacteria 954
1255 Ga0496119_0039155 3300048922 Bacteria 3049
1256 Ga0496119_0070197 3300048922 Bacteria 2055
1257 Ga0496120_0017308 3300048923 Bacteria 4679
1258 Ga0496120_0024016 3300048923 Bacteria 3808
1259 Ga0496120_0090202 3300048923 Bacteria 1639
1260 Ga0496120_0097729 3300048923 Bacteria 1557
1261 Ga0496121_0007389 3300048924 Bacteria 13277
1262 Ga0496121_0031975 3300048924 Bacteria 4795
1263 Ga0496121_0039886 3300048924 Bacteria 4129
1264 Ga0496121_0086656 3300048924 Bacteria 2460
1265 Ga0496121_0100663 3300048924 Bacteria 2230
1266 Ga0496121_0120396 3300048924 Bacteria 1983
1267 Ga0496121_0141531 3300048924 Bacteria 1783
1268 Ga0496121_0403450 3300048924 Bacteria 894
1269 Ga0496122_0000432 3300048925 Bacteria 87744
1270 Ga0496122_0001943 3300048925 Bacteria 31037
1271 Ga0496122_0037424 3300048925 Bacteria 3905
1272 Ga0496122_0037973 3300048925 Bacteria 3866
1273 Ga0496122_0061096 3300048925 Bacteria 2768
1274 Ga0496122_0077031 3300048925 Bacteria 2344
1275 Ga0496122_0109458 3300048925 Bacteria 1818
1276 Ga0496122_0147915 3300048925 Bacteria 1456
1277 Ga0496122_0189792 3300048925 Bacteria 1214
1278 Ga0496123_0001510 3300048926 Bacteria 32223
1279 Ga0496123_0001575 3300048926 Bacteria 31163
1280 Ga0496123_0019527 3300048926 Bacteria 5339
1281 Ga0496123_0020795 3300048926 Bacteria 5122
1282 Ga0496123_0022524 3300048926 Bacteria 4851
1283 Ga0496123_0031066 3300048926 Bacteria 3894
1284 Ga0496123_0061287 3300048926 Bacteria 2418
1285 Ga0496123_0086908 3300048926 Bacteria 1873
1286 Ga0496123_0101307 3300048926 Bacteria 1674
1287 Ga0496124_0001241 3300048927 Bacteria 39178
1288 Ga0496124_0011175 3300048927 Bacteria 9003
1289 Ga0496124_0016748 3300048927 Bacteria 6951
1290 Ga0496124_0027510 3300048927 Bacteria 5104
1291 Ga0496124_0029715 3300048927 Bacteria 4862
1292 Ga0496124_0061528 3300048927 Bacteria 3146
1293 Ga0496124_0068527 3300048927 Bacteria 2948
1294 Ga0496124_0141460 3300048927 Bacteria 1898
1295 Ga0496124_0156086 3300048927 Bacteria 1784
1296 Ga0496124_0196438 3300048927 Bacteria 1538
1297 Ga0496124_0326461 3300048927 Bacteria 1096
1298 Ga0496124_0411246 3300048927 Bacteria 935
1299 Ga0496125_0001804 3300048928 Bacteria 29576
1300 Ga0496125_0003339 3300048928 Bacteria 19557
1301 Ga0496125_0028069 3300048928 Bacteria 5089
1302 Ga0496125_0028432 3300048928 Bacteria 5050
1303 Ga0496125_0039308 3300048928 Bacteria 4076
1304 Ga0496125_0042368 3300048928 Bacteria 3878
1305 Ga0496125_0045403 3300048928 Bacteria 3697
1306 Ga0496125_0079501 3300048928 Bacteria 2515
1307 Ga0496125_0103726 3300048928 Bacteria 2085
1308 Ga0496126_0037952 3300048929 Bacteria 4485
1309 Ga0496126_0439070 3300048929 Bacteria 1052
1310 Ga0495678_000504 3300049459 Bacteria 38278
1311 Ga0495678_007305 3300049459 Bacteria 5745
1312 Ga0495678_008285 3300049459 Bacteria 5263
1313 Ga0495678_008732 3300049459 Bacteria 5079
1314 Ga0495678_009144 3300049459 Bacteria 4933
1315 Ga0495678_009483 3300049459 Bacteria 4812
1316 Ga0495678_011132 3300049459 Bacteria 4322
1317 Ga0495678_013161 3300049459 Bacteria 3895
1318 Ga0495678_016431 3300049459 Bacteria 3385
1319 Ga0495678_023698 3300049459 Bacteria 2663
1320 Ga0495678_035336 3300049459 Bacteria 2049
1321 Ga0495678_035859 3300049459 Bacteria 2029
1322 Ga0495678_038555 3300049459 Bacteria 1932
1323 Ga0495678_044061 3300049459 Bacteria 1767
1324 Ga0495678_072073 3300049459 Bacteria 1263
1325 Ga0495682_0000309 3300049460 Bacteria 36784
1326 Ga0495682_0005545 3300049460 Bacteria 5224
1327 Ga0495682_0007276 3300049460 Bacteria 4416
1328 Ga0495682_0008379 3300049460 Bacteria 4073
1329 Ga0495682_0038821 3300049460 Bacteria 1749
1330 Ga0501032_0211831 3300049569 Bacteria 1263
1331 Ga0501046_0285199 3300049580 Bacteria 1209
1332 Ga0501047_0019470 3300049581 Bacteria 6511
1333 Ga0501047_0191484 3300049581 Bacteria 1908
1334 Ga0501047_0604342 3300049581 Unclassified 918
1335 Ga0501067_0201582 3300049583 Bacteria 1108
1336 Ga0501068_0045278 3300049584 Bacteria 2651
1337 Ga0501069_0010938 3300049585 Bacteria 4810
1338 Ga0501072_0239437 3300049588 Bacteria 1445
1339 Ga0501073_0001265 3300049589 Bacteria 18548
1340 Ga0501074_0003972 3300049590 Bacteria 10539
1341 Ga0501222_003285 3300049662 Bacteria 2220
1342 Ga0501240_010432 3300049673 Bacteria 1234
1343 Ga0501079_0082325 3300049741 Bacteria 2489
1344 Ga0501080_0012243 3300049742 Bacteria 7861
1345 Ga0501080_0056734 3300049742 Bacteria 3646
1346 Ga0501083_0003920 3300049744 Bacteria 10449
1347 Ga0501241_001395 3300049758 Bacteria 4954
1348 Ga0501269_002151 3300049766 Bacteria 2461
1349 Ga0501270_006256 3300049767 Unclassified 1422
1350 Ga0501044_0102527 3300049823 Bacteria 2877
1351 nmdc:mga08y16_24746_c1 3300050511 Bacteria 6336
1352 nmdc:mga08x19_120980_c1 3300050514 Bacteria 1755
1353 Ga0500572_001987 3300053111 Bacteria 5106
1354 Ga0500568_0091626 3300053139 Bacteria 1146
1355 Ga0500573_0012177 3300053140 Bacteria 4828
1356 Ga0500577_0054242 3300053142 Bacteria 1518
1357 Ga0500586_029204 3300053145 Bacteria 1806
1358 Ga0500634_0010524 3300053161 Bacteria 4729
1359 Ga0501084_0211559 3300054114 Bacteria 1636
1360 Ga0501082_0408481 3300060353 Bacteria 1185

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 640427133 640488608 186
2 3300025924 Ga0207694_10149370 Ga0207694_101493702 190
3 3300026142 Ga0207698_10117293 Ga0207698_101172933 190
4 3300041459 Ga0451800_1297498 Ga0451800_1297498_62_640 190
5 3300046515 Ga0495620_0058542 Ga0495620_0058542_331_981 195
6 3300025321 Ga0207656_10110180 Ga0207656_101101802 197
7 3300042438 Ga0439459_0130893 Ga0439459_0130893_19_615 197
8 3300046524 Ga0495648_0334962 Ga0495648_0334962_92_685 197
9 3300046524 Ga0495648_0341234 Ga0495648_0341234_12_605 197
10 3300031731 Ga0307405_10117103 Ga0307405_101171032 198
11 3300031903 Ga0307407_10116155 Ga0307407_101161552 198
12 3300005327 Ga0070658_10010041 Ga0070658_100100415 199
13 3300005336 Ga0070680_100238971 Ga0070680_1002389712 199
14 3300005530 Ga0070679_100148547 Ga0070679_1001485473 199
15 3300025909 Ga0207705_10012286 Ga0207705_100122863 199
16 3300005290 Ga0065712_10067808 Ga0065712_1006780834 200
17 3300006051 Ga0075364_10584333 Ga0075364_105843331 200
18 3300032002 Ga0307416_101253032 Ga0307416_1012530322 201
19 3300045836 Ga0466958_0031632 Ga0466958_0031632_2471_3085 204
20 3300046810 Ga0495660_0196731 Ga0495660_0196731_82_711 204
21 3300048091 Ga0495626_0247419 Ga0495626_0247419_84_698 204
22 3300046518 Ga0495631_0006304 Ga0495631_0006304_5146_5763 205
23 3300046518 Ga0495631_0037751 Ga0495631_0037751_578_1219 205
24 3300046524 Ga0495648_0016278 Ga0495648_0016278_1273_1890 205
25 3300046530 Ga0495654_0047841 Ga0495654_0047841_230_847 205
26 3300046648 Ga0495611_0014131 Ga0495611_0014131_1101_1718 205
27 3300006058 Ga0075432_10023282 Ga0075432_100232822 206
28 3300042137 Ga0450902_002261 Ga0450902_002261_734_1399 206
29 3300042138 Ga0450903_011918 Ga0450903_011918_628_1293 206
30 3300046453 Ga0495627_018562 Ga0495627_018562_979_1638 206
31 3300046457 Ga0495590_0003798 Ga0495590_0003798_4514_5173 206
32 3300046458 Ga0495591_004442 Ga0495591_004442_1019_1678 206
33 3300046460 Ga0495638_0029545 Ga0495638_0029545_1164_1823 206
34 3300046460 Ga0495638_0120080 Ga0495638_0120080_467_1123 206
35 3300046471 Ga0495650_0010428 Ga0495650_0010428_1013_1672 206
36 3300046491 Ga0495584_0003718 Ga0495584_0003718_1014_1673 206
37 3300046500 Ga0495596_0000390 Ga0495596_0000390_1167_1826 206
38 3300046501 Ga0495607_0017305 Ga0495607_0017305_762_1427 206
39 3300046512 Ga0495610_0012592 Ga0495610_0012592_3510_4169 206
40 3300046512 Ga0495610_0061348 Ga0495610_0061348_785_1441 206
41 3300046513 Ga0495616_0004648 Ga0495616_0004648_1151_1810 206
42 3300046515 Ga0495620_0017752 Ga0495620_0017752_914_1573 206
43 3300046519 Ga0495632_0009759 Ga0495632_0009759_1158_1817 206
44 3300046520 Ga0495637_0007762 Ga0495637_0007762_1188_1847 206
45 3300046522 Ga0495643_0011413 Ga0495643_0011413_3732_4391 206
46 3300046522 Ga0495643_0051755 Ga0495643_0051755_827_1492 206
47 3300046523 Ga0495644_0031926 Ga0495644_0031926_973_1632 206
48 3300046530 Ga0495654_0011675 Ga0495654_0011675_1022_1681 206
49 3300046542 Ga0495597_0007123 Ga0495597_0007123_3892_4551 206
50 3300046542 Ga0495597_0115806 Ga0495597_0115806_333_998 206
51 3300046615 Ga0495656_0089946 Ga0495656_0089946_214_873 206
52 3300046616 Ga0495668_0007072 Ga0495668_0007072_1018_1677 206
53 3300046665 Ga0495661_0035762 Ga0495661_0035762_883_1542 206
54 3300046665 Ga0495661_0061157 Ga0495661_0061157_905_1570 206
55 3300046691 Ga0495670_0038116 Ga0495670_0038116_1345_2004 206
56 3300046692 Ga0495671_0109747 Ga0495671_0109747_359_1018 206
57 3300046694 Ga0495649_0006523 Ga0495649_0006523_5474_6133 206
58 3300046694 Ga0495649_0031169 Ga0495649_0031169_1347_2012 206
59 3300046810 Ga0495660_0073676 Ga0495660_0073676_447_1112 206
60 3300047320 Ga0495672_0070155 Ga0495672_0070155_488_1153 206
61 3300047323 Ga0495683_0050714 Ga0495683_0050714_831_1490 206
62 3300047446 Ga0495679_007748 Ga0495679_007748_3095_3745 206
63 3300047470 Ga0495681_0010685 Ga0495681_0010685_1022_1681 206
64 3300047470 Ga0495681_0011507 Ga0495681_0011507_3472_4128 206
65 3300047470 Ga0495681_0029066 Ga0495681_0029066_852_1517 206
66 3300048091 Ga0495626_0001636 Ga0495626_0001636_1182_1847 206
67 3300049459 Ga0495678_008732 Ga0495678_008732_3427_4092 206
68 3300049459 Ga0495678_035859 Ga0495678_035859_1012_1671 206
69 3300049460 Ga0495682_0038821 Ga0495682_0038821_1069_1728 206
70 3300041411 Ga0439466_0047975 Ga0439466_0047975_705_1364 207
71 3300042009 Ga0439451_002211 Ga0439451_002211_2392_3051 207
72 3300042013 Ga0439456_005414 Ga0439456_005414_532_1191 207
73 3300042016 Ga0439463_003977 Ga0439463_003977_970_1629 207
74 3300028786 Ga0307517_10077023 Ga0307517_100770232 208
75 3300031507 Ga0307509_10601206 Ga0307509_106012061 208
76 3300048925 Ga0496122_0037973 Ga0496122_0037973_535_1185 208
77 3300048926 Ga0496123_0031066 Ga0496123_0031066_548_1198 208
78 3300048928 Ga0496125_0028069 Ga0496125_0028069_1184_1834 208
79 iso_pu_bacteria 2908446538 2908448149 208
80 3300013308 Ga0157375_10981014 Ga0157375_109810142 209
81 3300046615 Ga0495656_0142824 Ga0495656_0142824_14_676 209
82 3300046810 Ga0495660_0214492 Ga0495660_0214492_70_732 209
83 3300005331 Ga0070670_100619754 Ga0070670_1006197541 210
84 3300026121 Ga0207683_10399401 Ga0207683_103994012 210
85 3300041405 Ga0439438_011994 Ga0439438_011994_839_1471 210
86 3300041405 Ga0439438_012582 Ga0439438_012582_1042_1674 210
87 3300041407 Ga0439447_020976 Ga0439447_020976_577_1209 210
88 3300042004 Ga0439445_0045289 Ga0439445_0045289_230_862 210
89 3300042013 Ga0439456_004790 Ga0439456_004790_876_1508 210
90 3300042115 Ga0450911_000236 Ga0450911_000236_1205_1837 210
91 3300042136 Ga0450900_003594 Ga0450900_003594_523_1155 210
92 3300042137 Ga0450902_005493 Ga0450902_005493_1211_1843 210
93 3300042145 Ga0450906_000783 Ga0450906_000783_1219_1851 210
94 3300046794 Ga0495589_0010880 Ga0495589_0010880_2911_3543 210
95 3300047446 Ga0495679_007544 Ga0495679_007544_2787_3419 210
96 iso_pu_bacteria 2842815866 2842820675 210
97 3300005842 Ga0068858_100778181 Ga0068858_1007781812 211
98 3300046507 Ga0495606_0029920 Ga0495606_0029920_2716_3351 211
99 3300046530 Ga0495654_0164305 Ga0495654_0164305_269_904 211
100 3300046694 Ga0495649_0016134 Ga0495649_0016134_3352_3987 211
101 3300047446 Ga0495679_035683 Ga0495679_035683_782_1417 211
102 3300048927 Ga0496124_0068527 Ga0496124_0068527_2069_2704 211
103 iso_pu_bacteria 2946027586 2946029491 211
104 3300005340 Ga0070689_100253306 Ga0070689_1002533062 212
105 3300006914 Ga0075436_100211114 Ga0075436_1002111142 212
106 3300009093 Ga0105240_10027403 Ga0105240_100274033 212
107 3300009176 Ga0105242_10244554 Ga0105242_102445542 212
108 3300013297 Ga0157378_10177006 Ga0157378_101770062 212
109 3300015261 Ga0182006_1006528 Ga0182006_10065283 212
110 3300025292 Ga0209676_1000033 Ga0209676_10000333 212
111 3300025913 Ga0207695_10025938 Ga0207695_100259383 212
112 3300025934 Ga0207686_10191660 Ga0207686_101916602 212
113 3300026089 Ga0207648_10306790 Ga0207648_103067902 212
114 3300030735 Ga0316178_1003918 Ga0316178_10039182 212
115 3300041405 Ga0439438_061044 Ga0439438_061044_237_890 212
116 3300041407 Ga0439447_051913 Ga0439447_051913_135_788 212
117 3300042016 Ga0439463_003497 Ga0439463_003497_295_948 212
118 3300042137 Ga0450902_007671 Ga0450902_007671_811_1464 212
119 3300042138 Ga0450903_002521 Ga0450903_002521_1585_2238 212
120 3300042139 Ga0450904_011103 Ga0450904_011103_155_808 212
121 3300046458 Ga0495591_006483 Ga0495591_006483_3559_4212 212
122 3300046460 Ga0495638_0132240 Ga0495638_0132240_266_919 212
123 3300046460 Ga0495638_0234192 Ga0495638_0234192_312_965 212
124 3300046491 Ga0495584_0047881 Ga0495584_0047881_566_1219 212
125 3300046492 Ga0495585_0011832 Ga0495585_0011832_3270_3923 212
126 3300046501 Ga0495607_0211439 Ga0495607_0211439_206_859 212
127 3300046506 Ga0495583_0000068 Ga0495583_0000068_76948_77595 212
128 3300046512 Ga0495610_0013730 Ga0495610_0013730_1243_1896 212
129 3300046519 Ga0495632_0036478 Ga0495632_0036478_1189_1842 212
130 3300046524 Ga0495648_0024781 Ga0495648_0024781_531_1184 212
131 3300046539 Ga0495621_0006366 Ga0495621_0006366_1446_2096 212
132 3300046616 Ga0495668_0012122 Ga0495668_0012122_3256_3909 212
133 3300046660 Ga0495625_0170892 Ga0495625_0170892_142_795 212
134 3300046694 Ga0495649_0016097 Ga0495649_0016097_2987_3640 212
135 3300046794 Ga0495589_0182112 Ga0495589_0182112_130_783 212
136 3300046810 Ga0495660_0013599 Ga0495660_0013599_3252_3905 212
137 3300047446 Ga0495679_007439 Ga0495679_007439_927_1580 212
138 3300048091 Ga0495626_0012129 Ga0495626_0012129_3072_3725 212
139 3300048091 Ga0495626_0013597 Ga0495626_0013597_554_1207 212
140 3300049459 Ga0495678_044061 Ga0495678_044061_479_1132 212
141 3300049459 Ga0495678_072073 Ga0495678_072073_501_1154 212
142 3300049673 Ga0501240_010432 Ga0501240_010432_429_1067 212
143 iso_pu_bacteria 2511231021 2511357254 212
144 iso_pu_bacteria 2511231023 2511370285 212
145 iso_pu_bacteria 2597489888 2597862564 212
146 iso_pu_bacteria 2597489889 2597868409 212
147 iso_pu_bacteria 2599185167 2599396844 212
148 iso_pu_bacteria 2599185179 2599448822 212
149 iso_pu_bacteria 2599185189 2599507794 212
150 iso_pu_bacteria 2599185190 2599511419 212
151 iso_pu_bacteria 2599185191 2599517641 212
152 iso_pu_bacteria 2599185288 2599879875 212
153 iso_pu_bacteria 2599185290 2599890793 212
154 iso_pu_bacteria 2599185303 2599948383 212
155 iso_pu_bacteria 2600255296 2601691152 212
156 iso_pu_bacteria 2643221571 2643873216 212
157 iso_pu_bacteria 2643221713 2644624245 212
158 iso_pu_bacteria 2675903420 2677897712 212
159 iso_pu_bacteria 2721755607 2723247448 212
160 iso_pu_bacteria 2738541294 2738809338 212
161 iso_pu_bacteria 2738541309 2738896698 212
162 iso_pu_bacteria 2808606385 2808975485 212
163 iso_pu_bacteria 2808606388 2808990876 212
164 iso_pu_bacteria 2808606445 2809216008 212
165 iso_pu_bacteria 2834028612 2834029241 212
166 iso_pu_bacteria 2842826826 2842828944 212
167 iso_pu_bacteria 2842837860 2842839855 212
168 iso_pu_bacteria 2852612431 2852615280 212
169 iso_pu_bacteria 2852667396 2852670248 212
170 iso_pu_bacteria 2929189879 2929191267 212
171 iso_pu_bacteria 2931390751 2931392257 212
172 iso_pu_bacteria 2945928738 2945929316 212
173 iso_pu_bacteria 2946006987 2946011589 212
174 iso_pu_bacteria 2947233263 2947236080 212
175 iso_pu_bacteria 2988728565 2988733092 212
176 iso_pu_bacteria 3007511990 3007512613 212
177 iso_pu_bacteria 3007614139 3007615007 212
178 iso_pu_bacteria 8054285046 8054285569 212
179 iso_pu_bacteria 8054347763 8054348310 212
180 iso_pu_bacteria 8055817908 8055819276 212
181 iso_pu_bacteria 8056131705 8056133195 212
182 iso_pu_bacteria 8056148874 8056149442 212
183 iso_pu_bacteria 8056161164 8056164604 212
184 3300003323 rootH1_10191044 rootH1_101910442 213
185 3300003752 Ga0055539_1000142 Ga0055539_100014210 213
186 3300003756 Ga0055533_1000146 Ga0055533_100014610 213
187 3300003758 Ga0055532_1000132 Ga0055532_100013210 213
188 3300003759 Ga0055525_1000701 Ga0055525_100070110 213
189 3300003761 Ga0055535_1004683 Ga0055535_10046832 213
190 3300003781 Ga0055536_1003259 Ga0055536_10032597 213
191 3300003781 Ga0055536_1003356 Ga0055536_10033567 213
192 3300003791 Ga0055530_10000427 Ga0055530_100004273 213
193 3300003791 Ga0055530_10005369 Ga0055530_100053694 213
194 3300003792 Ga0055540_1000377 Ga0055540_10003773 213
195 3300003792 Ga0055540_1001027 Ga0055540_10010274 213
196 3300003794 Ga0055531_10001697 Ga0055531_100016979 213
197 3300003841 Ga0055541_1000096 Ga0055541_100009657 213
198 3300005288 Ga0065714_10002540 Ga0065714_1000254028 213
199 3300005288 Ga0065714_10081144 Ga0065714_100811442 213
200 3300005289 Ga0065704_10086661 Ga0065704_100866614 213
201 3300005290 Ga0065712_10106463 Ga0065712_101064631 213
202 3300005329 Ga0070683_100227775 Ga0070683_1002277752 213
203 3300005330 Ga0070690_100151414 Ga0070690_1001514142 213
204 3300005331 Ga0070670_100001614 Ga0070670_10000161417 213
205 3300005331 Ga0070670_100011386 Ga0070670_1000113866 213
206 3300005337 Ga0070682_100437660 Ga0070682_1004376601 213
207 3300005343 Ga0070687_100081250 Ga0070687_1000812502 213
208 3300005344 Ga0070661_100000306 Ga0070661_10000030611 213
209 3300005344 Ga0070661_100116314 Ga0070661_1001163143 213
210 3300005353 Ga0070669_100001132 Ga0070669_10000113215 213
211 3300005353 Ga0070669_100065139 Ga0070669_1000651393 213
212 3300005366 Ga0070659_100022802 Ga0070659_1000228023 213
213 3300005435 Ga0070714_100819524 Ga0070714_1008195241 213
214 3300005436 Ga0070713_100145347 Ga0070713_1001453472 213
215 3300005457 Ga0070662_100012831 Ga0070662_1000128314 213
216 3300005457 Ga0070662_100013505 Ga0070662_1000135054 213
217 3300005458 Ga0070681_10464324 Ga0070681_104643242 213
218 3300005518 Ga0070699_100390068 Ga0070699_1003900682 213
219 3300005530 Ga0070679_100311581 Ga0070679_1003115811 213
220 3300005539 Ga0068853_100046284 Ga0068853_1000462843 213
221 3300005547 Ga0070693_100012956 Ga0070693_1000129561 213
222 3300005548 Ga0070665_100032507 Ga0070665_1000325073 213
223 3300005548 Ga0070665_100284167 Ga0070665_1002841673 213
224 3300005563 Ga0068855_100022972 Ga0068855_1000229723 213
225 3300005564 Ga0070664_100002817 Ga0070664_10000281710 213
226 3300005615 Ga0070702_100539675 Ga0070702_1005396751 213
227 3300005616 Ga0068852_100011195 Ga0068852_1000111956 213
228 3300005617 Ga0068859_100087040 Ga0068859_1000870402 213
229 3300005719 Ga0068861_100338631 Ga0068861_1003386311 213
230 3300005834 Ga0068851_10000019 Ga0068851_1000001943 213
231 3300005842 Ga0068858_100095030 Ga0068858_1000950303 213
232 3300005843 Ga0068860_100424090 Ga0068860_1004240902 213
233 3300006058 Ga0075432_10057720 Ga0075432_100577202 213
234 3300006178 Ga0075367_10241562 Ga0075367_102415621 213
235 3300006931 Ga0097620_100087035 Ga0097620_1000870352 213
236 3300006946 Ga0079104_1000484 Ga0079104_100048444 213
237 3300006946 Ga0079104_1014328 Ga0079104_10143282 213
238 3300006948 Ga0099826_10000372 Ga0099826_100003729 213
239 3300007076 Ga0075435_100314627 Ga0075435_1003146273 213
240 3300009011 Ga0105251_10000123 Ga0105251_1000012312 213
241 3300009011 Ga0105251_10009978 Ga0105251_100099784 213
242 3300009011 Ga0105251_10011434 Ga0105251_100114344 213
243 3300009011 Ga0105251_10013533 Ga0105251_100135332 213
244 3300009011 Ga0105251_10021590 Ga0105251_100215902 213
245 3300009011 Ga0105251_10040886 Ga0105251_100408862 213
246 3300009011 Ga0105251_10069726 Ga0105251_100697261 213
247 3300009011 Ga0105251_10104669 Ga0105251_101046692 213
248 3300009011 Ga0105251_10118638 Ga0105251_101186382 213
249 3300009036 Ga0105244_10004329 Ga0105244_100043298 213
250 3300009036 Ga0105244_10005248 Ga0105244_100052487 213
251 3300009036 Ga0105244_10008962 Ga0105244_100089622 213
252 3300009036 Ga0105244_10022226 Ga0105244_100222262 213
253 3300009036 Ga0105244_10027956 Ga0105244_100279562 213
254 3300009036 Ga0105244_10144410 Ga0105244_101444102 213
255 3300009092 Ga0105250_10000273 Ga0105250_100002733 213
256 3300009092 Ga0105250_10005841 Ga0105250_100058413 213
257 3300009092 Ga0105250_10012336 Ga0105250_100123362 213
258 3300009092 Ga0105250_10019081 Ga0105250_100190812 213
259 3300009092 Ga0105250_10019469 Ga0105250_100194692 213
260 3300009092 Ga0105250_10049089 Ga0105250_100490892 213
261 3300009093 Ga0105240_10018090 Ga0105240_100180902 213
262 3300009093 Ga0105240_10609028 Ga0105240_106090282 213
263 3300009094 Ga0111539_10021946 Ga0111539_100219462 213
264 3300009148 Ga0105243_10009538 Ga0105243_100095383 213
265 3300009148 Ga0105243_11334669 Ga0105243_113346691 213
266 3300009174 Ga0105241_10256045 Ga0105241_102560453 213
267 3300009176 Ga0105242_10001061 Ga0105242_1000106113 213
268 3300009545 Ga0105237_10002041 Ga0105237_1000204110 213
269 3300009545 Ga0105237_10401427 Ga0105237_104014272 213
270 3300009551 Ga0105238_10077229 Ga0105238_100772294 213
271 3300009551 Ga0105238_10179676 Ga0105238_101796762 213
272 3300011119 Ga0105246_10011813 Ga0105246_100118133 213
273 3300012498 Ga0157345_1000357 Ga0157345_10003573 213
274 3300013100 Ga0157373_10015897 Ga0157373_100158973 213
275 3300013100 Ga0157373_10018030 Ga0157373_100180303 213
276 3300013100 Ga0157373_10019641 Ga0157373_100196413 213
277 3300013100 Ga0157373_10020494 Ga0157373_100204943 213
278 3300013100 Ga0157373_10031944 Ga0157373_100319442 213
279 3300013100 Ga0157373_10069298 Ga0157373_100692983 213
280 3300013100 Ga0157373_10136936 Ga0157373_101369362 213
281 3300013100 Ga0157373_10215047 Ga0157373_102150473 213
282 3300013102 Ga0157371_10008487 Ga0157371_100084877 213
283 3300013102 Ga0157371_10021929 Ga0157371_100219293 213
284 3300013102 Ga0157371_10098576 Ga0157371_100985762 213
285 3300013104 Ga0157370_10136127 Ga0157370_101361273 213
286 3300013104 Ga0157370_10194858 Ga0157370_101948581 213
287 3300013104 Ga0157370_10288371 Ga0157370_102883712 213
288 3300013105 Ga0157369_10003688 Ga0157369_1000368810 213
289 3300013105 Ga0157369_10015624 Ga0157369_100156243 213
290 3300013105 Ga0157369_10040753 Ga0157369_100407533 213
291 3300013105 Ga0157369_10041662 Ga0157369_100416623 213
292 3300013105 Ga0157369_10042473 Ga0157369_100424733 213
293 3300013105 Ga0157369_10043561 Ga0157369_100435612 213
294 3300013105 Ga0157369_10574272 Ga0157369_105742722 213
295 3300013306 Ga0163162_10019587 Ga0163162_100195873 213
296 3300013306 Ga0163162_10051005 Ga0163162_100510052 213
297 3300013306 Ga0163162_10385839 Ga0163162_103858392 213
298 3300013307 Ga0157372_10001200 Ga0157372_1000120011 213
299 3300013307 Ga0157372_10045072 Ga0157372_100450723 213
300 3300013308 Ga0157375_10006945 Ga0157375_100069458 213
301 3300013308 Ga0157375_10053642 Ga0157375_100536422 213
302 3300013308 Ga0157375_10286552 Ga0157375_102865523 213
303 3300014497 Ga0182008_10007133 Ga0182008_100071333 213
304 3300014497 Ga0182008_10009885 Ga0182008_100098853 213
305 3300014497 Ga0182008_10012593 Ga0182008_100125933 213
306 3300014497 Ga0182008_10015398 Ga0182008_100153983 213
307 3300014497 Ga0182008_10038860 Ga0182008_100388603 213
308 3300014497 Ga0182008_10040890 Ga0182008_100408902 213
309 3300014497 Ga0182008_10064915 Ga0182008_100649152 213
310 3300014497 Ga0182008_10204663 Ga0182008_102046632 213
311 3300015261 Ga0182006_1007762 Ga0182006_10077623 213
312 3300015261 Ga0182006_1008777 Ga0182006_10087773 213
313 3300015261 Ga0182006_1015161 Ga0182006_10151612 213
314 3300015261 Ga0182006_1026369 Ga0182006_10263692 213
315 3300015261 Ga0182006_1030903 Ga0182006_10309033 213
316 3300015261 Ga0182006_1047312 Ga0182006_10473122 213
317 3300015261 Ga0182006_1069099 Ga0182006_10690992 213
318 3300015262 Ga0182007_10005944 Ga0182007_100059444 213
319 3300015262 Ga0182007_10008158 Ga0182007_100081583 213
320 3300015262 Ga0182007_10133968 Ga0182007_101339681 213
321 3300015262 Ga0182007_10197109 Ga0182007_101971091 213
322 3300015265 Ga0182005_1004626 Ga0182005_10046262 213
323 3300015265 Ga0182005_1106462 Ga0182005_11064621 213
324 3300015265 Ga0182005_1114830 Ga0182005_11148301 213
325 3300017792 Ga0163161_10016623 Ga0163161_100166233 213
326 3300017792 Ga0163161_10026367 Ga0163161_100263673 213
327 3300017792 Ga0163161_10032761 Ga0163161_100327613 213
328 3300017792 Ga0163161_10155930 Ga0163161_101559302 213
329 3300017792 Ga0163161_10163919 Ga0163161_101639193 213
330 3300017792 Ga0163161_10307907 Ga0163161_103079072 213
331 3300017792 Ga0163161_10501788 Ga0163161_105017882 213
332 3300025206 Ga0209435_101438 Ga0209435_1014381 213
333 3300025224 Ga0209784_100015 Ga0209784_100015191 213
334 3300025225 Ga0209566_100012 Ga0209566_100012191 213
335 3300025226 Ga0209674_100027 Ga0209674_100027191 213
336 3300025229 Ga0209147_100019 Ga0209147_100019191 213
337 3300025230 Ga0209563_100031 Ga0209563_100031191 213
338 3300025230 Ga0209563_100795 Ga0209563_1007958 213
339 3300025242 Ga0209258_100824 Ga0209258_10082417 213
340 3300025246 Ga0209646_1000220 Ga0209646_100022035 213
341 3300025253 Ga0209677_100016 Ga0209677_100016191 213
342 3300025256 Ga0209759_1010377 Ga0209759_10103772 213
343 3300025263 Ga0209565_1021679 Ga0209565_10216793 213
344 3300025292 Ga0209676_1000016 Ga0209676_1000016158 213
345 3300025292 Ga0209676_1010902 Ga0209676_10109023 213
346 3300025298 Ga0209050_1000036 Ga0209050_1000036399 213
347 3300025298 Ga0209050_1000187 Ga0209050_10001873 213
348 3300025303 Ga0209051_1000131 Ga0209051_10001313 213
349 3300025303 Ga0209051_1001300 Ga0209051_100130022 213
350 3300025304 Ga0209257_1000173 Ga0209257_10001733 213
351 3300025321 Ga0207656_10000042 Ga0207656_1000004220 213
352 3300025711 Ga0207696_1000083 Ga0207696_10000834 213
353 3300025711 Ga0207696_1000111 Ga0207696_10001113 213
354 3300025711 Ga0207696_1005338 Ga0207696_10053383 213
355 3300025711 Ga0207696_1008897 Ga0207696_10088972 213
356 3300025711 Ga0207696_1023408 Ga0207696_10234081 213
357 3300025711 Ga0207696_1026833 Ga0207696_10268332 213
358 3300025728 Ga0207655_1000844 Ga0207655_10008443 213
359 3300025728 Ga0207655_1000896 Ga0207655_100089630 213
360 3300025728 Ga0207655_1011370 Ga0207655_10113703 213
361 3300025728 Ga0207655_1018979 Ga0207655_10189794 213
362 3300025728 Ga0207655_1020493 Ga0207655_10204932 213
363 3300025735 Ga0207713_1000338 Ga0207713_100033817 213
364 3300025735 Ga0207713_1004803 Ga0207713_10048037 213
365 3300025735 Ga0207713_1007165 Ga0207713_10071656 213
366 3300025735 Ga0207713_1007166 Ga0207713_10071666 213
367 3300025735 Ga0207713_1010481 Ga0207713_10104814 213
368 3300025735 Ga0207713_1017092 Ga0207713_10170922 213
369 3300025735 Ga0207713_1046994 Ga0207713_10469942 213
370 3300025735 Ga0207713_1049396 Ga0207713_10493963 213
371 3300025911 Ga0207654_10178439 Ga0207654_101784392 213
372 3300025912 Ga0207707_10098500 Ga0207707_100985002 213
373 3300025913 Ga0207695_10131848 Ga0207695_101318482 213
374 3300025914 Ga0207671_10000420 Ga0207671_1000042047 213
375 3300025918 Ga0207662_10262351 Ga0207662_102623512 213
376 3300025919 Ga0207657_10230829 Ga0207657_102308291 213
377 3300025920 Ga0207649_10000002 Ga0207649_10000002358 213
378 3300025920 Ga0207649_10110864 Ga0207649_101108642 213
379 3300025921 Ga0207652_10480703 Ga0207652_104807031 213
380 3300025923 Ga0207681_10000815 Ga0207681_1000081515 213
381 3300025923 Ga0207681_10071739 Ga0207681_100717392 213
382 3300025924 Ga0207694_10382268 Ga0207694_103822682 213
383 3300025924 Ga0207694_10496271 Ga0207694_104962711 213
384 3300025925 Ga0207650_10000385 Ga0207650_100003854 213
385 3300025925 Ga0207650_10000606 Ga0207650_100006069 213
386 3300025928 Ga0207700_10066709 Ga0207700_100667092 213
387 3300025929 Ga0207664_10487506 Ga0207664_104875062 213
388 3300025932 Ga0207690_10055191 Ga0207690_100551912 213
389 3300025933 Ga0207706_10000239 Ga0207706_100002394 213
390 3300025933 Ga0207706_10046401 Ga0207706_100464013 213
391 3300025934 Ga0207686_10022071 Ga0207686_100220712 213
392 3300025935 Ga0207709_10000036 Ga0207709_1000003611 213
393 3300025945 Ga0207679_10000006 Ga0207679_10000006133 213
394 3300025949 Ga0207667_10063863 Ga0207667_100638632 213
395 3300025981 Ga0207640_10002221 Ga0207640_100022218 213
396 3300026035 Ga0207703_10069921 Ga0207703_100699213 213
397 3300026041 Ga0207639_10001932 Ga0207639_1000193210 213
398 3300026041 Ga0207639_10618373 Ga0207639_106183731 213
399 3300026118 Ga0207675_100303219 Ga0207675_1003032192 213
400 3300026121 Ga0207683_10373534 Ga0207683_103735342 213
401 3300027111 Ga0209281_1000202 Ga0209281_1000202128 213
402 3300027111 Ga0209281_1003560 Ga0209281_10035603 213
403 3300027666 Ga0209282_1027977 Ga0209282_10279772 213
404 3300027907 Ga0207428_10016966 Ga0207428_100169664 213
405 3300028379 Ga0268266_10010436 Ga0268266_100104364 213
406 3300028379 Ga0268266_10418569 Ga0268266_104185692 213
407 3300028381 Ga0268264_10403606 Ga0268264_104036062 213
408 3300030731 Ga0316177_1107574 Ga0316177_11075746 213
409 3300030733 Ga0314311_1201496 Ga0314311_12014962 213
410 3300030742 Ga0316183_1110934 Ga0316183_11109343 213
411 3300031548 Ga0307408_100005464 Ga0307408_1000054643 213
412 3300031548 Ga0307408_100009729 Ga0307408_1000097293 213
413 3300031548 Ga0307408_100016194 Ga0307408_1000161943 213
414 3300031548 Ga0307408_100018800 Ga0307408_1000188004 213
415 3300031548 Ga0307408_100085075 Ga0307408_1000850752 213
416 3300031548 Ga0307408_100088147 Ga0307408_1000881472 213
417 3300031548 Ga0307408_100254338 Ga0307408_1002543382 213
418 3300031730 Ga0307516_10139155 Ga0307516_101391551 213
419 3300031731 Ga0307405_10009112 Ga0307405_100091123 213
420 3300031731 Ga0307405_10067550 Ga0307405_100675503 213
421 3300031731 Ga0307405_10326296 Ga0307405_103262962 213
422 3300031731 Ga0307405_10364383 Ga0307405_103643832 213
423 3300031824 Ga0307413_10015641 Ga0307413_100156412 213
424 3300031824 Ga0307413_10020105 Ga0307413_100201052 213
425 3300031901 Ga0307406_10154472 Ga0307406_101544721 213
426 3300031901 Ga0307406_10172296 Ga0307406_101722963 213
427 3300031901 Ga0307406_10312505 Ga0307406_103125052 213
428 3300031903 Ga0307407_10074543 Ga0307407_100745432 213
429 3300031911 Ga0307412_10004492 Ga0307412_100044923 213
430 3300031911 Ga0307412_10011507 Ga0307412_100115073 213
431 3300031911 Ga0307412_10018306 Ga0307412_100183063 213
432 3300031911 Ga0307412_10028382 Ga0307412_100283822 213
433 3300031911 Ga0307412_10034390 Ga0307412_100343903 213
434 3300031911 Ga0307412_10094510 Ga0307412_100945102 213
435 3300031911 Ga0307412_10193442 Ga0307412_101934422 213
436 3300031911 Ga0307412_10468321 Ga0307412_104683211 213
437 3300031995 Ga0307409_100017514 Ga0307409_1000175143 213
438 3300031995 Ga0307409_100090975 Ga0307409_1000909751 213
439 3300032002 Ga0307416_100023257 Ga0307416_1000232573 213
440 3300032002 Ga0307416_100452453 Ga0307416_1004524532 213
441 3300032004 Ga0307414_10019025 Ga0307414_100190252 213
442 3300032004 Ga0307414_10092094 Ga0307414_100920943 213
443 3300032004 Ga0307414_10122462 Ga0307414_101224622 213
444 3300032005 Ga0307411_10010681 Ga0307411_100106813 213
445 3300033180 Ga0307510_10039967 Ga0307510_100399673 213
446 3300033180 Ga0307510_10105823 Ga0307510_101058232 213
447 3300035691 Ga0373931_0035474 Ga0373931_0035474_1859_2500 213
448 3300038705 Ga0237819_02309 Ga0237819_02309_3191_3847 213
449 3300041405 Ga0439438_004222 Ga0439438_004222_3799_4455 213
450 3300041405 Ga0439438_004945 Ga0439438_004945_511_1152 213
451 3300041405 Ga0439438_005072 Ga0439438_005072_3126_3782 213
452 3300041405 Ga0439438_007305 Ga0439438_007305_882_1538 213
453 3300041405 Ga0439438_011211 Ga0439438_011211_1717_2373 213
454 3300041407 Ga0439447_002863 Ga0439447_002863_1263_1922 213
455 3300041407 Ga0439447_004175 Ga0439447_004175_956_1612 213
456 3300041407 Ga0439447_004680 Ga0439447_004680_3541_4182 213
457 3300041407 Ga0439447_013815 Ga0439447_013815_635_1291 213
458 3300041407 Ga0439447_017218 Ga0439447_017218_952_1605 213
459 3300041407 Ga0439447_032463 Ga0439447_032463_228_884 213
460 3300041411 Ga0439466_0020149 Ga0439466_0020149_1019_1660 213
461 3300041411 Ga0439466_0035502 Ga0439466_0035502_433_1089 213
462 3300041997 Ga0439431_0002041 Ga0439431_0002041_830_1486 213
463 3300042002 Ga0439442_061309 Ga0439442_061309_21_677 213
464 3300042004 Ga0439445_0013551 Ga0439445_0013551_261_914 213
465 3300042004 Ga0439445_0032387 Ga0439445_0032387_168_824 213
466 3300042004 Ga0439445_0043310 Ga0439445_0043310_430_1086 213
467 3300042006 Ga0439432_004482 Ga0439432_004482_3280_3930 213
468 3300042006 Ga0439432_004634 Ga0439432_004634_3144_3800 213
469 3300042006 Ga0439432_006924 Ga0439432_006924_885_1541 213
470 3300042006 Ga0439432_011191 Ga0439432_011191_1221_1874 213
471 3300042006 Ga0439432_139507 Ga0439432_139507_34_693 213
472 3300042009 Ga0439451_001995 Ga0439451_001995_3020_3676 213
473 3300042010 Ga0439452_001491 Ga0439452_001491_1234_1887 213
474 3300042010 Ga0439452_002387 Ga0439452_002387_1245_1904 213
475 3300042010 Ga0439452_003060 Ga0439452_003060_4548_5204 213
476 3300042010 Ga0439452_032216 Ga0439452_032216_323_964 213
477 3300042013 Ga0439456_005591 Ga0439456_005591_1313_1969 213
478 3300042013 Ga0439456_016171 Ga0439456_016171_512_1171 213
479 3300042013 Ga0439456_021160 Ga0439456_021160_480_1136 213
480 3300042013 Ga0439456_021694 Ga0439456_021694_652_1305 213
481 3300042013 Ga0439456_027578 Ga0439456_027578_273_929 213
482 3300042016 Ga0439463_004352 Ga0439463_004352_257_913 213
483 3300042016 Ga0439463_018154 Ga0439463_018154_1071_1721 213
484 3300042016 Ga0439463_074348 Ga0439463_074348_171_827 213
485 3300042115 Ga0450911_004917 Ga0450911_004917_262_918 213
486 3300042115 Ga0450911_017699 Ga0450911_017699_99_749 213
487 3300042126 Ga0450888_007591 Ga0450888_007591_348_992 213
488 3300042131 Ga0450894_007704 Ga0450894_007704_118_768 213
489 3300042135 Ga0450899_011088 Ga0450899_011088_224_874 213
490 3300042137 Ga0450902_001010 Ga0450902_001010_408_1064 213
491 3300042137 Ga0450902_005345 Ga0450902_005345_589_1245 213
492 3300042138 Ga0450903_014559 Ga0450903_014559_228_884 213
493 3300042139 Ga0450904_007510 Ga0450904_007510_232_888 213
494 3300042144 Ga0450889_008157 Ga0450889_008157_392_1048 213
495 3300042145 Ga0450906_002506 Ga0450906_002506_3127_3783 213
496 3300042147 Ga0450910_002357 Ga0450910_002357_461_1117 213
497 3300042156 Ga0439446_0002986 Ga0439446_0002986_1434_2090 213
498 3300042185 Ga0450909_001005 Ga0450909_001005_2826_3482 213
499 3300042461 Ga0439460_0003143 Ga0439460_0003143_482_1138 213
500 3300042532 Ga0450893_0001733 Ga0450893_0001733_2608_3264 213
501 3300042532 Ga0450893_0010860 Ga0450893_0010860_161_817 213
502 3300042533 Ga0450901_000604 Ga0450901_000604_626_1282 213
503 3300042993 Ga0439440_0004378 Ga0439440_0004378_1588_2244 213
504 3300046452 Ga0495617_007086 Ga0495617_007086_640_1296 213
505 3300046452 Ga0495617_007896 Ga0495617_007896_2962_3618 213
506 3300046452 Ga0495617_008048 Ga0495617_008048_1247_1903 213
507 3300046452 Ga0495617_020373 Ga0495617_020373_844_1500 213
508 3300046452 Ga0495617_064999 Ga0495617_064999_268_924 213
509 3300046452 Ga0495617_071470 Ga0495617_071470_422_1078 213
510 3300046452 Ga0495617_093795 Ga0495617_093795_160_816 213
511 3300046452 Ga0495617_104403 Ga0495617_104403_195_851 213
512 3300046453 Ga0495627_005216 Ga0495627_005216_1105_1761 213
513 3300046453 Ga0495627_006644 Ga0495627_006644_2683_3339 213
514 3300046453 Ga0495627_007386 Ga0495627_007386_3293_3949 213
515 3300046453 Ga0495627_009195 Ga0495627_009195_203_871 213
516 3300046453 Ga0495627_023960 Ga0495627_023960_190_846 213
517 3300046453 Ga0495627_029856 Ga0495627_029856_810_1466 213
518 3300046454 Ga0495592_0082258 Ga0495592_0082258_635_1291 213
519 3300046455 Ga0495603_0225000 Ga0495603_0225000_227_877 213
520 3300046457 Ga0495590_0006479 Ga0495590_0006479_765_1421 213
521 3300046457 Ga0495590_0017712 Ga0495590_0017712_1083_1739 213
522 3300046457 Ga0495590_0139573 Ga0495590_0139573_178_834 213
523 3300046458 Ga0495591_003662 Ga0495591_003662_5906_6562 213
524 3300046458 Ga0495591_006154 Ga0495591_006154_1283_1939 213
525 3300046458 Ga0495591_006419 Ga0495591_006419_1224_1880 213
526 3300046458 Ga0495591_006800 Ga0495591_006800_1150_1806 213
527 3300046458 Ga0495591_007831 Ga0495591_007831_3485_4141 213
528 3300046458 Ga0495591_012110 Ga0495591_012110_1529_2185 213
529 3300046458 Ga0495591_019646 Ga0495591_019646_79_735 213
530 3300046458 Ga0495591_020305 Ga0495591_020305_1285_1941 213
531 3300046458 Ga0495591_023506 Ga0495591_023506_325_981 213
532 3300046458 Ga0495591_078214 Ga0495591_078214_55_705 213
533 3300046459 Ga0495629_0005077 Ga0495629_0005077_7393_8043 213
534 3300046459 Ga0495629_0553097 Ga0495629_0553097_69_725 213
535 3300046460 Ga0495638_0010929 Ga0495638_0010929_690_1346 213
536 3300046460 Ga0495638_0015458 Ga0495638_0015458_1227_1883 213
537 3300046460 Ga0495638_0021756 Ga0495638_0021756_473_1129 213
538 3300046460 Ga0495638_0044771 Ga0495638_0044771_1724_2392 213
539 3300046460 Ga0495638_0080854 Ga0495638_0080854_1222_1878 213
540 3300046460 Ga0495638_0142232 Ga0495638_0142232_477_1133 213
541 3300046460 Ga0495638_0186866 Ga0495638_0186866_274_936 213
542 3300046463 Ga0495653_0033552 Ga0495653_0033552_2798_3448 213
543 3300046463 Ga0495653_0085751 Ga0495653_0085751_1530_2186 213
544 3300046463 Ga0495653_0086061 Ga0495653_0086061_786_1442 213
545 3300046463 Ga0495653_0260579 Ga0495653_0260579_312_968 213
546 3300046471 Ga0495650_0008327 Ga0495650_0008327_4657_5313 213
547 3300046471 Ga0495650_0014666 Ga0495650_0014666_1243_1899 213
548 3300046471 Ga0495650_0017520 Ga0495650_0017520_1901_2557 213
549 3300046471 Ga0495650_0045018 Ga0495650_0045018_40_696 213
550 3300046472 Ga0495580_0115515 Ga0495580_0115515_439_1089 213
551 3300046472 Ga0495580_0282886 Ga0495580_0282886_81_731 213
552 3300046473 Ga0495582_0178365 Ga0495582_0178365_550_1200 213
553 3300046473 Ga0495582_0330151 Ga0495582_0330151_208_858 213
554 3300046474 Ga0495605_0010576 Ga0495605_0010576_3421_4077 213
555 3300046474 Ga0495605_0022041 Ga0495605_0022041_2350_3006 213
556 3300046474 Ga0495605_0030302 Ga0495605_0030302_599_1255 213
557 3300046474 Ga0495605_0030731 Ga0495605_0030731_298_954 213
558 3300046474 Ga0495605_0136815 Ga0495605_0136815_426_1082 213
559 3300046475 Ga0495639_0061723 Ga0495639_0061723_448_1098 213
560 3300046491 Ga0495584_0004136 Ga0495584_0004136_1197_1853 213
561 3300046491 Ga0495584_0006437 Ga0495584_0006437_4140_4796 213
562 3300046491 Ga0495584_0010293 Ga0495584_0010293_3087_3743 213
563 3300046491 Ga0495584_0011743 Ga0495584_0011743_3164_3820 213
564 3300046491 Ga0495584_0020997 Ga0495584_0020997_324_980 213
565 3300046491 Ga0495584_0055036 Ga0495584_0055036_1011_1667 213
566 3300046491 Ga0495584_0060649 Ga0495584_0060649_1195_1845 213
567 3300046491 Ga0495584_0066474 Ga0495584_0066474_779_1435 213
568 3300046492 Ga0495585_0009299 Ga0495585_0009299_4037_4693 213
569 3300046492 Ga0495585_0010346 Ga0495585_0010346_4622_5278 213
570 3300046492 Ga0495585_0011880 Ga0495585_0011880_3223_3879 213
571 3300046492 Ga0495585_0013950 Ga0495585_0013950_682_1338 213
572 3300046492 Ga0495585_0031251 Ga0495585_0031251_1871_2527 213
573 3300046492 Ga0495585_0038365 Ga0495585_0038365_1011_1667 213
574 3300046492 Ga0495585_0268666 Ga0495585_0268666_76_732 213
575 3300046492 Ga0495585_0279159 Ga0495585_0279159_120_776 213
576 3300046499 Ga0495594_0136492 Ga0495594_0136492_500_1150 213
577 3300046499 Ga0495594_0285417 Ga0495594_0285417_218_874 213
578 3300046500 Ga0495596_0026561 Ga0495596_0026561_1407_2063 213
579 3300046500 Ga0495596_0033165 Ga0495596_0033165_763_1419 213
580 3300046500 Ga0495596_0036748 Ga0495596_0036748_1037_1693 213
581 3300046501 Ga0495607_0008126 Ga0495607_0008126_1204_1860 213
582 3300046501 Ga0495607_0010704 Ga0495607_0010704_4649_5305 213
583 3300046501 Ga0495607_0017518 Ga0495607_0017518_3187_3843 213
584 3300046501 Ga0495607_0019092 Ga0495607_0019092_888_1541 213
585 3300046501 Ga0495607_0020630 Ga0495607_0020630_205_861 213
586 3300046501 Ga0495607_0022074 Ga0495607_0022074_232_888 213
587 3300046501 Ga0495607_0026976 Ga0495607_0026976_743_1399 213
588 3300046501 Ga0495607_0079442 Ga0495607_0079442_499_1155 213
589 3300046501 Ga0495607_0085511 Ga0495607_0085511_862_1518 213
590 3300046501 Ga0495607_0098673 Ga0495607_0098673_711_1367 213
591 3300046501 Ga0495607_0115573 Ga0495607_0115573_424_1080 213
592 3300046501 Ga0495607_0172525 Ga0495607_0172525_69_722 213
593 3300046506 Ga0495583_0011123 Ga0495583_0011123_1169_1819 213
594 3300046506 Ga0495583_0012371 Ga0495583_0012371_1735_2391 213
595 3300046506 Ga0495583_0036661 Ga0495583_0036661_454_1110 213
596 3300046506 Ga0495583_0056894 Ga0495583_0056894_1014_1670 213
597 3300046507 Ga0495606_0012494 Ga0495606_0012494_688_1344 213
598 3300046507 Ga0495606_0014224 Ga0495606_0014224_3783_4439 213
599 3300046507 Ga0495606_0016152 Ga0495606_0016152_4692_5348 213
600 3300046507 Ga0495606_0016576 Ga0495606_0016576_1147_1803 213
601 3300046507 Ga0495606_0020833 Ga0495606_0020833_931_1587 213
602 3300046507 Ga0495606_0022921 Ga0495606_0022921_1196_1852 213
603 3300046507 Ga0495606_0024588 Ga0495606_0024588_3320_3976 213
604 3300046507 Ga0495606_0081661 Ga0495606_0081661_413_1063 213
605 3300046512 Ga0495610_0012282 Ga0495610_0012282_1225_1881 213
606 3300046512 Ga0495610_0012445 Ga0495610_0012445_951_1607 213
607 3300046512 Ga0495610_0013289 Ga0495610_0013289_1184_1837 213
608 3300046512 Ga0495610_0015913 Ga0495610_0015913_3321_3977 213
609 3300046512 Ga0495610_0027614 Ga0495610_0027614_545_1195 213
610 3300046512 Ga0495610_0030992 Ga0495610_0030992_1686_2342 213
611 3300046512 Ga0495610_0039822 Ga0495610_0039822_560_1216 213
612 3300046512 Ga0495610_0059743 Ga0495610_0059743_786_1442 213
613 3300046512 Ga0495610_0072371 Ga0495610_0072371_379_1035 213
614 3300046512 Ga0495610_0093523 Ga0495610_0093523_588_1244 213
615 3300046512 Ga0495610_0183063 Ga0495610_0183063_83_733 213
616 3300046513 Ga0495616_0008281 Ga0495616_0008281_4682_5338 213
617 3300046513 Ga0495616_0010556 Ga0495616_0010556_1265_1921 213
618 3300046513 Ga0495616_0011601 Ga0495616_0011601_1207_1863 213
619 3300046513 Ga0495616_0017026 Ga0495616_0017026_781_1437 213
620 3300046513 Ga0495616_0033290 Ga0495616_0033290_960_1616 213
621 3300046513 Ga0495616_0062572 Ga0495616_0062572_934_1590 213
622 3300046513 Ga0495616_0062608 Ga0495616_0062608_243_899 213
623 3300046513 Ga0495616_0106551 Ga0495616_0106551_389_1045 213
624 3300046515 Ga0495620_0004148 Ga0495620_0004148_6407_7063 213
625 3300046515 Ga0495620_0005301 Ga0495620_0005301_5555_6211 213
626 3300046515 Ga0495620_0006105 Ga0495620_0006105_4742_5398 213
627 3300046515 Ga0495620_0010474 Ga0495620_0010474_3306_3962 213
628 3300046515 Ga0495620_0030502 Ga0495620_0030502_1016_1672 213
629 3300046515 Ga0495620_0033895 Ga0495620_0033895_355_1011 213
630 3300046515 Ga0495620_0035280 Ga0495620_0035280_1148_1804 213
631 3300046515 Ga0495620_0042959 Ga0495620_0042959_265_921 213
632 3300046515 Ga0495620_0072384 Ga0495620_0072384_665_1321 213
633 3300046518 Ga0495631_0003637 Ga0495631_0003637_1220_1876 213
634 3300046518 Ga0495631_0008435 Ga0495631_0008435_1220_1876 213
635 3300046518 Ga0495631_0011849 Ga0495631_0011849_2807_3457 213
636 3300046518 Ga0495631_0051951 Ga0495631_0051951_781_1437 213
637 3300046518 Ga0495631_0067984 Ga0495631_0067984_866_1522 213
638 3300046519 Ga0495632_0011659 Ga0495632_0011659_3288_3944 213
639 3300046519 Ga0495632_0011755 Ga0495632_0011755_1125_1781 213
640 3300046519 Ga0495632_0011910 Ga0495632_0011910_782_1438 213
641 3300046519 Ga0495632_0014103 Ga0495632_0014103_2732_3388 213
642 3300046519 Ga0495632_0040196 Ga0495632_0040196_596_1252 213
643 3300046519 Ga0495632_0113810 Ga0495632_0113810_521_1177 213
644 3300046519 Ga0495632_0116298 Ga0495632_0116298_455_1111 213
645 3300046519 Ga0495632_0230290 Ga0495632_0230290_93_758 213
646 3300046519 Ga0495632_0290008 Ga0495632_0290008_13_669 213
647 3300046520 Ga0495637_0008046 Ga0495637_0008046_3295_3951 213
648 3300046520 Ga0495637_0008931 Ga0495637_0008931_1065_1721 213
649 3300046520 Ga0495637_0009557 Ga0495637_0009557_2929_3585 213
650 3300046520 Ga0495637_0009951 Ga0495637_0009951_783_1439 213
651 3300046520 Ga0495637_0015037 Ga0495637_0015037_866_1522 213
652 3300046520 Ga0495637_0048749 Ga0495637_0048749_361_1017 213
653 3300046520 Ga0495637_0051433 Ga0495637_0051433_692_1342 213
654 3300046520 Ga0495637_0057611 Ga0495637_0057611_853_1509 213
655 3300046520 Ga0495637_0076569 Ga0495637_0076569_662_1318 213
656 3300046520 Ga0495637_0076823 Ga0495637_0076823_361_1017 213
657 3300046522 Ga0495643_0000511 Ga0495643_0000511_21186_21845 213
658 3300046522 Ga0495643_0012218 Ga0495643_0012218_1257_1913 213
659 3300046522 Ga0495643_0013645 Ga0495643_0013645_3301_3957 213
660 3300046522 Ga0495643_0028577 Ga0495643_0028577_2131_2787 213
661 3300046522 Ga0495643_0062259 Ga0495643_0062259_836_1492 213
662 3300046522 Ga0495643_0190982 Ga0495643_0190982_300_956 213
663 3300046522 Ga0495643_0200359 Ga0495643_0200359_265_921 213
664 3300046523 Ga0495644_0012208 Ga0495644_0012208_1169_1825 213
665 3300046524 Ga0495648_0018284 Ga0495648_0018284_3050_3706 213
666 3300046524 Ga0495648_0018977 Ga0495648_0018977_3196_3852 213
667 3300046524 Ga0495648_0025436 Ga0495648_0025436_1193_1849 213
668 3300046524 Ga0495648_0054799 Ga0495648_0054799_575_1231 213
669 3300046524 Ga0495648_0061587 Ga0495648_0061587_396_1052 213
670 3300046524 Ga0495648_0112741 Ga0495648_0112741_672_1322 213
671 3300046524 Ga0495648_0185247 Ga0495648_0185247_316_972 213
672 3300046526 Ga0495666_0001594 Ga0495666_0001594_2186_2836 213
673 3300046526 Ga0495666_0005452 Ga0495666_0005452_2396_3046 213
674 3300046526 Ga0495666_0033751 Ga0495666_0033751_661_1317 213
675 3300046526 Ga0495666_0052168 Ga0495666_0052168_56_706 213
676 3300046529 Ga0495652_0149465 Ga0495652_0149465_446_1096 213
677 3300046530 Ga0495654_0009456 Ga0495654_0009456_1265_1921 213
678 3300046530 Ga0495654_0009932 Ga0495654_0009932_3369_4019 213
679 3300046530 Ga0495654_0013372 Ga0495654_0013372_2990_3643 213
680 3300046530 Ga0495654_0018388 Ga0495654_0018388_2743_3399 213
681 3300046530 Ga0495654_0024744 Ga0495654_0024744_265_921 213
682 3300046530 Ga0495654_0040766 Ga0495654_0040766_1314_1967 213
683 3300046530 Ga0495654_0041857 Ga0495654_0041857_964_1620 213
684 3300046530 Ga0495654_0057254 Ga0495654_0057254_760_1416 213
685 3300046530 Ga0495654_0070709 Ga0495654_0070709_86_742 213
686 3300046530 Ga0495654_0082325 Ga0495654_0082325_834_1490 213
687 3300046530 Ga0495654_0092519 Ga0495654_0092519_160_816 213
688 3300046530 Ga0495654_0107452 Ga0495654_0107452_469_1125 213
689 3300046530 Ga0495654_0152379 Ga0495654_0152379_293_949 213
690 3300046531 Ga0495665_0001902 Ga0495665_0001902_7430_8080 213
691 3300046531 Ga0495665_0117761 Ga0495665_0117761_364_1014 213
692 3300046536 Ga0495587_0022578 Ga0495587_0022578_2008_2664 213
693 3300046536 Ga0495587_0069601 Ga0495587_0069601_375_1025 213
694 3300046536 Ga0495587_0101474 Ga0495587_0101474_254_904 213
695 3300046538 Ga0495609_0006959 Ga0495609_0006959_4751_5407 213
696 3300046538 Ga0495609_0011783 Ga0495609_0011783_249_905 213
697 3300046538 Ga0495609_0046408 Ga0495609_0046408_992_1648 213
698 3300046538 Ga0495609_0065489 Ga0495609_0065489_289_945 213
699 3300046538 Ga0495609_0083930 Ga0495609_0083930_632_1288 213
700 3300046538 Ga0495609_0149812 Ga0495609_0149812_160_816 213
701 3300046542 Ga0495597_0011747 Ga0495597_0011747_265_921 213
702 3300046542 Ga0495597_0017719 Ga0495597_0017719_2007_2663 213
703 3300046542 Ga0495597_0070214 Ga0495597_0070214_590_1246 213
704 3300046557 Ga0495622_0010409 Ga0495622_0010409_1250_1906 213
705 3300046557 Ga0495622_0012811 Ga0495622_0012811_1987_2637 213
706 3300046557 Ga0495622_0059074 Ga0495622_0059074_1063_1713 213
707 3300046558 Ga0495633_0010036 Ga0495633_0010036_1209_1865 213
708 3300046558 Ga0495633_0015392 Ga0495633_0015392_2124_2780 213
709 3300046558 Ga0495633_0041861 Ga0495633_0041861_47_703 213
710 3300046616 Ga0495668_0033761 Ga0495668_0033761_1009_1665 213
711 3300046616 Ga0495668_0234776 Ga0495668_0234776_30_686 213
712 3300046616 Ga0495668_0257037 Ga0495668_0257037_147_809 213
713 3300046642 Ga0495634_0010366 Ga0495634_0010366_1192_1848 213
714 3300046642 Ga0495634_0267534 Ga0495634_0267534_166_816 213
715 3300046648 Ga0495611_0003735 Ga0495611_0003735_4735_5391 213
716 3300046648 Ga0495611_0010094 Ga0495611_0010094_2684_3340 213
717 3300046648 Ga0495611_0017331 Ga0495611_0017331_2052_2708 213
718 3300046648 Ga0495611_0071670 Ga0495611_0071670_672_1328 213
719 3300046660 Ga0495625_0012712 Ga0495625_0012712_3589_4239 213
720 3300046660 Ga0495625_0013277 Ga0495625_0013277_4730_5386 213
721 3300046660 Ga0495625_0019511 Ga0495625_0019511_3357_4013 213
722 3300046660 Ga0495625_0022267 Ga0495625_0022267_3284_3940 213
723 3300046660 Ga0495625_0050775 Ga0495625_0050775_1736_2392 213
724 3300046660 Ga0495625_0100399 Ga0495625_0100399_422_1078 213
725 3300046663 Ga0495635_0021199 Ga0495635_0021199_737_1393 213
726 3300046665 Ga0495661_0002452 Ga0495661_0002452_3638_4306 213
727 3300046665 Ga0495661_0005510 Ga0495661_0005510_1199_1855 213
728 3300046665 Ga0495661_0014508 Ga0495661_0014508_4018_4674 213
729 3300046665 Ga0495661_0017686 Ga0495661_0017686_2862_3512 213
730 3300046665 Ga0495661_0052126 Ga0495661_0052126_1038_1694 213
731 3300046665 Ga0495661_0059169 Ga0495661_0059169_1125_1781 213
732 3300046665 Ga0495661_0207728 Ga0495661_0207728_84_740 213
733 3300046674 Ga0495588_0045712 Ga0495588_0045712_224_874 213
734 3300046678 Ga0495599_0212599 Ga0495599_0212599_266_922 213
735 3300046679 Ga0495623_0019478 Ga0495623_0019478_815_1471 213
736 3300046679 Ga0495623_0262435 Ga0495623_0262435_149_799 213
737 3300046680 Ga0495646_0033092 Ga0495646_0033092_2023_2673 213
738 3300046680 Ga0495646_0038083 Ga0495646_0038083_1107_1763 213
739 3300046680 Ga0495646_0088898 Ga0495646_0088898_754_1410 213
740 3300046689 Ga0495613_0025372 Ga0495613_0025372_3030_3686 213
741 3300046689 Ga0495613_0174288 Ga0495613_0174288_488_1138 213
742 3300046690 Ga0495624_0001085 Ga0495624_0001085_19696_20352 213
743 3300046690 Ga0495624_0004873 Ga0495624_0004873_2502_3152 213
744 3300046691 Ga0495670_0008092 Ga0495670_0008092_1235_1891 213
745 3300046691 Ga0495670_0061438 Ga0495670_0061438_219_875 213
746 3300046691 Ga0495670_0118565 Ga0495670_0118565_449_1105 213
747 3300046691 Ga0495670_0141647 Ga0495670_0141647_247_903 213
748 3300046692 Ga0495671_0001004 Ga0495671_0001004_16246_16905 213
749 3300046692 Ga0495671_0009977 Ga0495671_0009977_3368_4024 213
750 3300046692 Ga0495671_0011411 Ga0495671_0011411_962_1618 213
751 3300046692 Ga0495671_0016651 Ga0495671_0016651_965_1621 213
752 3300046692 Ga0495671_0016688 Ga0495671_0016688_2034_2690 213
753 3300046692 Ga0495671_0027253 Ga0495671_0027253_609_1265 213
754 3300046692 Ga0495671_0119092 Ga0495671_0119092_111_767 213
755 3300046692 Ga0495671_0176610 Ga0495671_0176610_181_837 213
756 3300046692 Ga0495671_0310202 Ga0495671_0310202_10_666 213
757 3300046694 Ga0495649_0011055 Ga0495649_0011055_3399_4055 213
758 3300046694 Ga0495649_0029103 Ga0495649_0029103_1723_2379 213
759 3300046694 Ga0495649_0040308 Ga0495649_0040308_860_1516 213
760 3300046694 Ga0495649_0162712 Ga0495649_0162712_379_1035 213
761 3300046694 Ga0495649_0164233 Ga0495649_0164233_182_838 213
762 3300046694 Ga0495649_0164236 Ga0495649_0164236_326_982 213
763 3300046694 Ga0495649_0367196 Ga0495649_0367196_19_675 213
764 3300046794 Ga0495589_0008794 Ga0495589_0008794_1301_1957 213
765 3300046794 Ga0495589_0028825 Ga0495589_0028825_1547_2203 213
766 3300046794 Ga0495589_0060542 Ga0495589_0060542_76_732 213
767 3300046794 Ga0495589_0254893 Ga0495589_0254893_105_761 213
768 3300046809 Ga0495600_0018529 Ga0495600_0018529_166_816 213
769 3300046810 Ga0495660_0011492 Ga0495660_0011492_1065_1721 213
770 3300046810 Ga0495660_0011900 Ga0495660_0011900_3305_3961 213
771 3300046810 Ga0495660_0016956 Ga0495660_0016956_265_921 213
772 3300046810 Ga0495660_0018430 Ga0495660_0018430_225_881 213
773 3300046810 Ga0495660_0036266 Ga0495660_0036266_424_1080 213
774 3300046810 Ga0495660_0044446 Ga0495660_0044446_1669_2319 213
775 3300046810 Ga0495660_0048106 Ga0495660_0048106_489_1145 213
776 3300046810 Ga0495660_0058739 Ga0495660_0058739_146_802 213
777 3300046810 Ga0495660_0077541 Ga0495660_0077541_71_727 213
778 3300046810 Ga0495660_0123279 Ga0495660_0123279_275_931 213
779 3300046810 Ga0495660_0134277 Ga0495660_0134277_533_1189 213
780 3300046810 Ga0495660_0155358 Ga0495660_0155358_63_719 213
781 3300046810 Ga0495660_0169489 Ga0495660_0169489_237_893 213
782 3300047315 Ga0495581_0001131 Ga0495581_0001131_11254_11904 213
783 3300047315 Ga0495581_0097722 Ga0495581_0097722_170_820 213
784 3300047317 Ga0495604_0022227 Ga0495604_0022227_1426_2076 213
785 3300047317 Ga0495604_0039835 Ga0495604_0039835_743_1399 213
786 3300047317 Ga0495604_0078969 Ga0495604_0078969_602_1258 213
787 3300047317 Ga0495604_0261298 Ga0495604_0261298_503_1153 213
788 3300047319 Ga0495674_0176205 Ga0495674_0176205_951_1601 213
789 3300047320 Ga0495672_0007121 Ga0495672_0007121_891_1547 213
790 3300047320 Ga0495672_0037377 Ga0495672_0037377_1248_1904 213
791 3300047320 Ga0495672_0044072 Ga0495672_0044072_1694_2350 213
792 3300047320 Ga0495672_0070678 Ga0495672_0070678_392_1042 213
793 3300047320 Ga0495672_0078020 Ga0495672_0078020_1153_1809 213
794 3300047320 Ga0495672_0091005 Ga0495672_0091005_360_1016 213
795 3300047321 Ga0495676_0025694 Ga0495676_0025694_3202_3858 213
796 3300047321 Ga0495676_0079666 Ga0495676_0079666_1049_1705 213
797 3300047321 Ga0495676_0242785 Ga0495676_0242785_511_1161 213
798 3300047322 Ga0495680_0014686 Ga0495680_0014686_1129_1785 213
799 3300047322 Ga0495680_0147454 Ga0495680_0147454_437_1093 213
800 3300047323 Ga0495683_0000910 Ga0495683_0000910_1179_1835 213
801 3300047323 Ga0495683_0025594 Ga0495683_0025594_1176_1832 213
802 3300047323 Ga0495683_0061878 Ga0495683_0061878_146_802 213
803 3300047323 Ga0495683_0062523 Ga0495683_0062523_1049_1705 213
804 3300047443 Ga0495687_000063 Ga0495687_000063_27580_28236 213
805 3300047444 Ga0495675_0098292 Ga0495675_0098292_902_1558 213
806 3300047444 Ga0495675_0240224 Ga0495675_0240224_63_713 213
807 3300047444 Ga0495675_0262472 Ga0495675_0262472_293_949 213
808 3300047446 Ga0495679_005511 Ga0495679_005511_1236_1892 213
809 3300047446 Ga0495679_006525 Ga0495679_006525_3120_3776 213
810 3300047446 Ga0495679_006592 Ga0495679_006592_3116_3766 213
811 3300047446 Ga0495679_006882 Ga0495679_006882_647_1303 213
812 3300047469 Ga0495673_0000472 Ga0495673_0000472_41821_42477 213
813 3300047469 Ga0495673_0005060 Ga0495673_0005060_6129_6785 213
814 3300047469 Ga0495673_0009595 Ga0495673_0009595_3427_4083 213
815 3300047469 Ga0495673_0009750 Ga0495673_0009750_3738_4394 213
816 3300047469 Ga0495673_0010126 Ga0495673_0010126_3275_3931 213
817 3300047469 Ga0495673_0011365 Ga0495673_0011365_3462_4118 213
818 3300047469 Ga0495673_0111653 Ga0495673_0111653_73_729 213
819 3300047469 Ga0495673_0135693 Ga0495673_0135693_185_841 213
820 3300047470 Ga0495681_0009080 Ga0495681_0009080_842_1498 213
821 3300047470 Ga0495681_0012189 Ga0495681_0012189_1071_1727 213
822 3300047470 Ga0495681_0012588 Ga0495681_0012588_3312_3968 213
823 3300047470 Ga0495681_0013011 Ga0495681_0013011_996_1652 213
824 3300047470 Ga0495681_0014208 Ga0495681_0014208_1121_1777 213
825 3300047470 Ga0495681_0029064 Ga0495681_0029064_494_1150 213
826 3300047470 Ga0495681_0040776 Ga0495681_0040776_1103_1759 213
827 3300047470 Ga0495681_0045158 Ga0495681_0045158_1333_1992 213
828 3300047470 Ga0495681_0045170 Ga0495681_0045170_265_921 213
829 3300047470 Ga0495681_0056301 Ga0495681_0056301_596_1252 213
830 3300047470 Ga0495681_0057011 Ga0495681_0057011_294_950 213
831 3300047470 Ga0495681_0109432 Ga0495681_0109432_82_738 213
832 3300047471 Ga0495684_0208656 Ga0495684_0208656_17_673 213
833 3300047472 Ga0495686_0015749 Ga0495686_0015749_1194_1850 213
834 3300047472 Ga0495686_0028776 Ga0495686_0028776_342_998 213
835 3300047472 Ga0495686_0116705 Ga0495686_0116705_391_1047 213
836 3300047472 Ga0495686_0243512 Ga0495686_0243512_246_902 213
837 3300047673 Ga0495593_0006455 Ga0495593_0006455_1696_2346 213
838 3300047673 Ga0495593_0047635 Ga0495593_0047635_750_1406 213
839 3300048088 Ga0495602_0015628 Ga0495602_0015628_1743_2393 213
840 3300048091 Ga0495626_0001604 Ga0495626_0001604_988_1644 213
841 3300048091 Ga0495626_0002437 Ga0495626_0002437_6550_7206 213
842 3300048091 Ga0495626_0009564 Ga0495626_0009564_1251_1907 213
843 3300048091 Ga0495626_0014142 Ga0495626_0014142_822_1478 213
844 3300048091 Ga0495626_0014932 Ga0495626_0014932_3053_3709 213
845 3300048903 Ga0496100_0037926 Ga0496100_0037926_1062_1730 213
846 3300048904 Ga0496101_0149688 Ga0496101_0149688_1062_1730 213
847 3300048905 Ga0496102_0014410 Ga0496102_0014410_5006_5662 213
848 3300048906 Ga0496103_0010266 Ga0496103_0010266_710_1366 213
849 3300048912 Ga0496109_0025285 Ga0496109_0025285_2796_3464 213
850 3300048914 Ga0496111_0575440 Ga0496111_0575440_101_757 213
851 3300048916 Ga0496113_0001325 Ga0496113_0001325_9328_9996 213
852 3300048918 Ga0496115_0029073 Ga0496115_0029073_2549_3211 213
853 3300048919 Ga0496116_0013303 Ga0496116_0013303_1250_1906 213
854 3300048919 Ga0496116_0019830 Ga0496116_0019830_3701_4357 213
855 3300048919 Ga0496116_0022425 Ga0496116_0022425_3209_3865 213
856 3300048919 Ga0496116_0141115 Ga0496116_0141115_363_1019 213
857 3300048919 Ga0496116_0318664 Ga0496116_0318664_47_703 213
858 3300048920 Ga0496117_0015146 Ga0496117_0015146_5056_5712 213
859 3300048920 Ga0496117_0021079 Ga0496117_0021079_3841_4497 213
860 3300048920 Ga0496117_0023515 Ga0496117_0023515_1208_1864 213
861 3300048920 Ga0496117_0023921 Ga0496117_0023921_877_1533 213
862 3300048920 Ga0496117_0036229 Ga0496117_0036229_2643_3293 213
863 3300048920 Ga0496117_0046628 Ga0496117_0046628_1701_2357 213
864 3300048920 Ga0496117_0066137 Ga0496117_0066137_341_991 213
865 3300048920 Ga0496117_0115985 Ga0496117_0115985_283_939 213
866 3300048920 Ga0496117_0160369 Ga0496117_0160369_348_998 213
867 3300048920 Ga0496117_0256482 Ga0496117_0256482_144_800 213
868 3300048921 Ga0496118_0019808 Ga0496118_0019808_4775_5431 213
869 3300048921 Ga0496118_0023782 Ga0496118_0023782_4003_4659 213
870 3300048921 Ga0496118_0033883 Ga0496118_0033883_887_1537 213
871 3300048921 Ga0496118_0038984 Ga0496118_0038984_2696_3346 213
872 3300048921 Ga0496118_0057383 Ga0496118_0057383_1341_1991 213
873 3300048921 Ga0496118_0062751 Ga0496118_0062751_913_1569 213
874 3300048921 Ga0496118_0113275 Ga0496118_0113275_278_934 213
875 3300048921 Ga0496118_0269660 Ga0496118_0269660_176_832 213
876 3300048922 Ga0496119_0039155 Ga0496119_0039155_1912_2562 213
877 3300048922 Ga0496119_0070197 Ga0496119_0070197_1137_1793 213
878 3300048923 Ga0496120_0017308 Ga0496120_0017308_1194_1850 213
879 3300048923 Ga0496120_0024016 Ga0496120_0024016_503_1153 213
880 3300048923 Ga0496120_0090202 Ga0496120_0090202_842_1498 213
881 3300048923 Ga0496120_0097729 Ga0496120_0097729_571_1221 213
882 3300048924 Ga0496121_0031975 Ga0496121_0031975_903_1559 213
883 3300048924 Ga0496121_0039886 Ga0496121_0039886_440_1090 213
884 3300048924 Ga0496121_0086656 Ga0496121_0086656_768_1418 213
885 3300048924 Ga0496121_0100663 Ga0496121_0100663_653_1309 213
886 3300048924 Ga0496121_0120396 Ga0496121_0120396_861_1517 213
887 3300048924 Ga0496121_0141531 Ga0496121_0141531_846_1502 213
888 3300048924 Ga0496121_0403450 Ga0496121_0403450_116_772 213
889 3300048925 Ga0496122_0000432 Ga0496122_0000432_31891_32559 213
890 3300048925 Ga0496122_0037424 Ga0496122_0037424_963_1619 213
891 3300048925 Ga0496122_0061096 Ga0496122_0061096_1418_2068 213
892 3300048925 Ga0496122_0077031 Ga0496122_0077031_1433_2083 213
893 3300048925 Ga0496122_0109458 Ga0496122_0109458_775_1425 213
894 3300048925 Ga0496122_0147915 Ga0496122_0147915_629_1285 213
895 3300048925 Ga0496122_0189792 Ga0496122_0189792_89_745 213
896 3300048926 Ga0496123_0001510 Ga0496123_0001510_10279_10947 213
897 3300048926 Ga0496123_0019527 Ga0496123_0019527_3889_4545 213
898 3300048926 Ga0496123_0022524 Ga0496123_0022524_3014_3664 213
899 3300048926 Ga0496123_0061287 Ga0496123_0061287_1566_2216 213
900 3300048926 Ga0496123_0086908 Ga0496123_0086908_971_1627 213
901 3300048926 Ga0496123_0101307 Ga0496123_0101307_470_1126 213
902 3300048927 Ga0496124_0029715 Ga0496124_0029715_3003_3659 213
903 3300048927 Ga0496124_0061528 Ga0496124_0061528_1162_1812 213
904 3300048927 Ga0496124_0141460 Ga0496124_0141460_818_1471 213
905 3300048927 Ga0496124_0156086 Ga0496124_0156086_659_1315 213
906 3300048927 Ga0496124_0196438 Ga0496124_0196438_798_1448 213
907 3300048927 Ga0496124_0326461 Ga0496124_0326461_152_808 213
908 3300048927 Ga0496124_0411246 Ga0496124_0411246_59_715 213
909 3300048928 Ga0496125_0001804 Ga0496125_0001804_1212_1868 213
910 3300048928 Ga0496125_0003339 Ga0496125_0003339_9029_9697 213
911 3300048928 Ga0496125_0028432 Ga0496125_0028432_3259_3915 213
912 3300048928 Ga0496125_0039308 Ga0496125_0039308_398_1048 213
913 3300048928 Ga0496125_0042368 Ga0496125_0042368_598_1248 213
914 3300048928 Ga0496125_0045403 Ga0496125_0045403_430_1080 213
915 3300048928 Ga0496125_0079501 Ga0496125_0079501_884_1534 213
916 3300048928 Ga0496125_0103726 Ga0496125_0103726_542_1192 213
917 3300048929 Ga0496126_0037952 Ga0496126_0037952_949_1599 213
918 3300048929 Ga0496126_0439070 Ga0496126_0439070_100_756 213
919 3300049459 Ga0495678_007305 Ga0495678_007305_4729_5385 213
920 3300049459 Ga0495678_008285 Ga0495678_008285_1265_1921 213
921 3300049459 Ga0495678_009483 Ga0495678_009483_1058_1714 213
922 3300049459 Ga0495678_011132 Ga0495678_011132_361_1017 213
923 3300049459 Ga0495678_013161 Ga0495678_013161_2664_3320 213
924 3300049459 Ga0495678_016431 Ga0495678_016431_2392_3048 213
925 3300049459 Ga0495678_023698 Ga0495678_023698_729_1385 213
926 3300049459 Ga0495678_035336 Ga0495678_035336_922_1578 213
927 3300049460 Ga0495682_0005545 Ga0495682_0005545_1244_1900 213
928 3300049460 Ga0495682_0007276 Ga0495682_0007276_652_1308 213
929 3300049662 Ga0501222_003285 Ga0501222_003285_190_846 213
930 3300049758 Ga0501241_001395 Ga0501241_001395_1188_1844 213
931 3300049766 Ga0501269_002151 Ga0501269_002151_645_1301 213
932 3300050511 nmdc:mga08y16_24746_c1 nmdc:mga08y16_24746_c1_1009_1653 213
933 3300053111 Ga0500572_001987 Ga0500572_001987_3223_3879 213
934 3300053145 Ga0500586_029204 Ga0500586_029204_493_1149 213
935 3300053161 Ga0500634_0010524 Ga0500634_0010524_2876_3526 213
936 iso_pu_bacteria 2510065055 2510293897 213
937 iso_pu_bacteria 2511231008 2511279046 213
938 iso_pu_bacteria 2511231010 2511290178 213
939 iso_pu_bacteria 2511231011 2511294047 213
940 iso_pu_bacteria 2511231031 2511415688 213
941 iso_pu_bacteria 2599185188 2599501328 213
942 iso_pu_bacteria 2599185212 2599616864 213
943 iso_pu_bacteria 2599185248 2599770603 213
944 iso_pu_bacteria 2599185289 2599886485 213
945 iso_pu_bacteria 2599185291 2599896850 213
946 iso_pu_bacteria 2599185300 2599931629 213
947 iso_pu_bacteria 2599185302 2599945636 213
948 iso_pu_bacteria 2599185304 2599957389 213
949 iso_pu_bacteria 2599185305 2599959615 213
950 iso_pu_bacteria 2599185306 2599966122 213
951 iso_pu_bacteria 2599185308 2599980763 213
952 iso_pu_bacteria 2599185309 2599986551 213
953 iso_pu_bacteria 2599185310 2599987072 213
954 iso_pu_bacteria 2599185311 2599996405 213
955 iso_pu_bacteria 2599185312 2600002636 213
956 iso_pu_bacteria 2599185313 2600006461 213
957 iso_pu_bacteria 2599185314 2600014674 213
958 iso_pu_bacteria 2599185315 2600016809 213
959 iso_pu_bacteria 2599185316 2600024155 213
960 iso_pu_bacteria 2599185317 2600031182 213
961 iso_pu_bacteria 2599185318 2600035338 213
962 iso_pu_bacteria 2599185319 2600042686 213
963 iso_pu_bacteria 2599185320 2600050577 213
964 iso_pu_bacteria 2599185321 2600053704 213
965 iso_pu_bacteria 2599185322 2600058291 213
966 iso_pu_bacteria 2599185323 2600064033 213
967 iso_pu_bacteria 2599185324 2600074677 213
968 iso_pu_bacteria 2599185325 2600078481 213
969 iso_pu_bacteria 2600254930 2600360129 213
970 iso_pu_bacteria 2600255318 2601800283 213
971 iso_pu_bacteria 2603880185 2606074451 213
972 iso_pu_bacteria 2603880199 2606127314 213
973 iso_pu_bacteria 2623620443 2624479035 213
974 iso_pu_bacteria 2643221650 2644282286 213
975 iso_pu_bacteria 2651869719 2652547340 213
976 iso_pu_bacteria 2667528170 2671092206 213
977 iso_pu_bacteria 2667528176 2671127569 213
978 iso_pu_bacteria 2675903515 2678261749 213
979 iso_pu_bacteria 2713897148 2715752943 213
980 iso_pu_bacteria 2713897149 2715758756 213
981 iso_pu_bacteria 2718217725 2718632921 213
982 iso_pu_bacteria 2728369097 2729147506 213
983 iso_pu_bacteria 2738543020 2739285219 213
984 iso_pu_bacteria 2738543021 2739290533 213
985 iso_pu_bacteria 2738543025 2739312997 213
986 iso_pu_bacteria 2744054620 2745008098 213
987 iso_pu_bacteria 2773857672 2774128356 213
988 iso_pu_bacteria 2773857673 2774136169 213
989 iso_pu_bacteria 2784132063 2784260245 213
990 iso_pu_bacteria 2791355520 2794594556 213
991 iso_pu_bacteria 2808606361 2808856465 213
992 iso_pu_bacteria 2808606376 2808924551 213
993 iso_pu_bacteria 2808606378 2808936387 213
994 iso_pu_bacteria 2808606380 2808946616 213
995 iso_pu_bacteria 2808606383 2808964808 213
996 iso_pu_bacteria 2808606389 2808999700 213
997 iso_pu_bacteria 2818991456 2819658586 213
998 iso_pu_bacteria 2825651385 2825653524 213
999 iso_pu_bacteria 2842832357 2842833133 213
1000 iso_pu_bacteria 2842843487 2842847245 213
1001 iso_pu_bacteria 2842854478 2842857074 213
1002 iso_pu_bacteria 2852657418 2852658531 213
1003 iso_pu_bacteria 2860339153 2860340455 213
1004 iso_pu_bacteria 2878029506 2878030993 213
1005 iso_pu_bacteria 2880230671 2880231911 213
1006 iso_pu_bacteria 2904518522 2904520949 213
1007 iso_pu_bacteria 2919063839 2919064493 213
1008 iso_pu_bacteria 2919385768 2919386034 213
1009 iso_pu_bacteria 2919456309 2919458113 213
1010 iso_pu_bacteria 2919481497 2919483010 213
1011 iso_pu_bacteria 2919487758 2919490827 213
1012 iso_pu_bacteria 2923586266 2923590780 213
1013 iso_pu_bacteria 2929144301 2929145541 213
1014 iso_pu_bacteria 2931369376 2931371124 213
1015 iso_pu_bacteria 2931396565 2931399641 213
1016 iso_pu_bacteria 2945961074 2945961504 213
1017 iso_pu_bacteria 2969304461 2969305820 213
1018 iso_pu_bacteria 2974289157 2974292564 213
1019 iso_pu_bacteria 2998139840 2998141243 213
1020 iso_pu_bacteria 3007718800 3007720977 213
1021 iso_pu_bacteria 3007855910 3007860330 213
1022 iso_pu_bacteria 3007861166 3007863524 213
1023 iso_pu_bacteria 3007866637 3007871594 213
1024 iso_pu_bacteria 8029995093 8029999504 213
1025 iso_pu_bacteria 8054503363 8054504831 213
1026 iso_pu_bacteria 8056143049 8056147728 213
1027 iso_pu_bacteria 8056166840 8056169814 213
1028 iso_pu_bacteria 8056569372 8056569903 213
1029 3300005327 Ga0070658_10002337 Ga0070658_100023373 214
1030 3300005327 Ga0070658_10219679 Ga0070658_102196792 214
1031 3300005333 Ga0070677_10093411 Ga0070677_100934112 214
1032 3300005345 Ga0070692_10256666 Ga0070692_102566661 214
1033 3300005354 Ga0070675_100003576 Ga0070675_1000035762 214
1034 3300005354 Ga0070675_100371391 Ga0070675_1003713912 214
1035 3300005356 Ga0070674_100529412 Ga0070674_1005294122 214
1036 3300005365 Ga0070688_100285409 Ga0070688_1002854092 214
1037 3300005434 Ga0070709_10070341 Ga0070709_100703411 214
1038 3300005435 Ga0070714_100277874 Ga0070714_1002778742 214
1039 3300005435 Ga0070714_100589502 Ga0070714_1005895022 214
1040 3300005436 Ga0070713_100025322 Ga0070713_1000253222 214
1041 3300005437 Ga0070710_10084079 Ga0070710_100840792 214
1042 3300005438 Ga0070701_10457797 Ga0070701_104577971 214
1043 3300005439 Ga0070711_100186814 Ga0070711_1001868142 214
1044 3300005445 Ga0070708_101110947 Ga0070708_1011109471 214
1045 3300005456 Ga0070678_100173169 Ga0070678_1001731692 214
1046 3300005458 Ga0070681_10430719 Ga0070681_104307192 214
1047 3300005458 Ga0070681_10682515 Ga0070681_106825151 214
1048 3300005459 Ga0068867_100074499 Ga0068867_1000744993 214
1049 3300005459 Ga0068867_100390017 Ga0068867_1003900172 214
1050 3300005466 Ga0070685_10104878 Ga0070685_101048781 214
1051 3300005530 Ga0070679_100352147 Ga0070679_1003521472 214
1052 3300005530 Ga0070679_100524025 Ga0070679_1005240251 214
1053 3300005539 Ga0068853_100805544 Ga0068853_1008055441 214
1054 3300005543 Ga0070672_101024720 Ga0070672_1010247201 214
1055 3300005546 Ga0070696_100558783 Ga0070696_1005587831 214
1056 3300005548 Ga0070665_100187703 Ga0070665_1001877033 214
1057 3300005549 Ga0070704_100665650 Ga0070704_1006656501 214
1058 3300005563 Ga0068855_100057597 Ga0068855_1000575972 214
1059 3300005563 Ga0068855_100118702 Ga0068855_1001187023 214
1060 3300005563 Ga0068855_100563072 Ga0068855_1005630722 214
1061 3300005564 Ga0070664_100080696 Ga0070664_1000806961 214
1062 3300005614 Ga0068856_100117884 Ga0068856_1001178842 214
1063 3300005616 Ga0068852_100007877 Ga0068852_1000078777 214
1064 3300005616 Ga0068852_100578165 Ga0068852_1005781652 214
1065 3300005616 Ga0068852_100715992 Ga0068852_1007159922 214
1066 3300005834 Ga0068851_10012777 Ga0068851_100127774 214
1067 3300005840 Ga0068870_10375623 Ga0068870_103756231 214
1068 3300005842 Ga0068858_100014610 Ga0068858_1000146107 214
1069 3300006058 Ga0075432_10004232 Ga0075432_100042323 214
1070 3300006175 Ga0070712_100152233 Ga0070712_1001522331 214
1071 3300006852 Ga0075433_10328254 Ga0075433_103282542 214
1072 3300006881 Ga0068865_100900971 Ga0068865_1009009711 214
1073 3300006914 Ga0075436_100023166 Ga0075436_1000231663 214
1074 3300009011 Ga0105251_10002278 Ga0105251_1000227811 214
1075 3300009036 Ga0105244_10000147 Ga0105244_1000014759 214
1076 3300009036 Ga0105244_10192499 Ga0105244_101924992 214
1077 3300009093 Ga0105240_10242795 Ga0105240_102427952 214
1078 3300009098 Ga0105245_10363743 Ga0105245_103637432 214
1079 3300009098 Ga0105245_10364992 Ga0105245_103649922 214
1080 3300009147 Ga0114129_10104749 Ga0114129_101047493 214
1081 3300009148 Ga0105243_10020117 Ga0105243_100201174 214
1082 3300009148 Ga0105243_10061990 Ga0105243_100619902 214
1083 3300009174 Ga0105241_10042988 Ga0105241_100429883 214
1084 3300009176 Ga0105242_10000354 Ga0105242_100003549 214
1085 3300009177 Ga0105248_10015397 Ga0105248_100153975 214
1086 3300009177 Ga0105248_10248667 Ga0105248_102486673 214
1087 3300009177 Ga0105248_10859374 Ga0105248_108593742 214
1088 3300009551 Ga0105238_10075257 Ga0105238_100752572 214
1089 3300009551 Ga0105238_10598297 Ga0105238_105982972 214
1090 3300009553 Ga0105249_10308195 Ga0105249_103081952 214
1091 3300011119 Ga0105246_10051018 Ga0105246_100510184 214
1092 3300013100 Ga0157373_10023822 Ga0157373_100238223 214
1093 3300013104 Ga0157370_10119470 Ga0157370_101194702 214
1094 3300013104 Ga0157370_10190560 Ga0157370_101905602 214
1095 3300013104 Ga0157370_10660029 Ga0157370_106600292 214
1096 3300013105 Ga0157369_10317087 Ga0157369_103170871 214
1097 3300013306 Ga0163162_10009704 Ga0163162_100097046 214
1098 3300013307 Ga0157372_10015645 Ga0157372_100156453 214
1099 3300013307 Ga0157372_11090212 Ga0157372_110902122 214
1100 3300014326 Ga0157380_10794589 Ga0157380_107945891 214
1101 3300017792 Ga0163161_10048004 Ga0163161_100480042 214
1102 3300025321 Ga0207656_10131625 Ga0207656_101316252 214
1103 3300025728 Ga0207655_1003971 Ga0207655_10039719 214
1104 3300025728 Ga0207655_1027786 Ga0207655_10277862 214
1105 3300025735 Ga0207713_1150171 Ga0207713_11501711 214
1106 3300025893 Ga0207682_10100388 Ga0207682_101003883 214
1107 3300025906 Ga0207699_10061392 Ga0207699_100613921 214
1108 3300025907 Ga0207645_10146146 Ga0207645_101461462 214
1109 3300025909 Ga0207705_10004788 Ga0207705_100047884 214
1110 3300025909 Ga0207705_10199298 Ga0207705_101992982 214
1111 3300025909 Ga0207705_10557655 Ga0207705_105576552 214
1112 3300025912 Ga0207707_10369134 Ga0207707_103691342 214
1113 3300025912 Ga0207707_10775764 Ga0207707_107757641 214
1114 3300025913 Ga0207695_10496165 Ga0207695_104961652 214
1115 3300025923 Ga0207681_10099232 Ga0207681_100992322 214
1116 3300025924 Ga0207694_10222488 Ga0207694_102224883 214
1117 3300025926 Ga0207659_10089363 Ga0207659_100893632 214
1118 3300025927 Ga0207687_10500307 Ga0207687_105003071 214
1119 3300025928 Ga0207700_10001824 Ga0207700_1000182412 214
1120 3300025929 Ga0207664_10462293 Ga0207664_104622932 214
1121 3300025934 Ga0207686_10052307 Ga0207686_100523072 214
1122 3300025935 Ga0207709_10059963 Ga0207709_100599632 214
1123 3300025940 Ga0207691_10059305 Ga0207691_100593053 214
1124 3300025941 Ga0207711_10018680 Ga0207711_100186804 214
1125 3300025941 Ga0207711_10146469 Ga0207711_101464692 214
1126 3300025960 Ga0207651_10311033 Ga0207651_103110332 214
1127 3300025961 Ga0207712_10355325 Ga0207712_103553252 214
1128 3300026035 Ga0207703_10008467 Ga0207703_100084676 214
1129 3300026041 Ga0207639_10029336 Ga0207639_100293362 214
1130 3300026075 Ga0207708_10745897 Ga0207708_107458971 214
1131 3300026088 Ga0207641_10258593 Ga0207641_102585933 214
1132 3300026089 Ga0207648_10055236 Ga0207648_100552364 214
1133 3300026089 Ga0207648_10315598 Ga0207648_103155981 214
1134 3300026116 Ga0207674_10051136 Ga0207674_100511362 214
1135 3300026121 Ga0207683_10089945 Ga0207683_100899452 214
1136 3300026121 Ga0207683_10243330 Ga0207683_102433303 214
1137 3300026142 Ga0207698_10306097 Ga0207698_103060972 214
1138 3300026142 Ga0207698_10456018 Ga0207698_104560182 214
1139 3300027682 Ga0209971_1008453 Ga0209971_10084532 214
1140 3300027907 Ga0207428_10077579 Ga0207428_100775791 214
1141 3300028379 Ga0268266_10034065 Ga0268266_100340652 214
1142 3300031548 Ga0307408_100615307 Ga0307408_1006153072 214
1143 3300031548 Ga0307408_100771919 Ga0307408_1007719192 214
1144 3300031731 Ga0307405_10624685 Ga0307405_106246852 214
1145 3300031911 Ga0307412_10489365 Ga0307412_104893652 214
1146 3300032004 Ga0307414_10149855 Ga0307414_101498551 214
1147 3300034816 Ga0373930_0044243 Ga0373930_0044243_251_901 214
1148 3300035691 Ga0373931_0060277 Ga0373931_0060277_246_896 214
1149 3300037068 Ga0373925_0105986 Ga0373925_0105986_1147_1794 214
1150 3300037312 Ga0395899_0030311 Ga0395899_0030311_1721_2371 214
1151 3300037471 Ga0395905_0032994 Ga0395905_0032994_1354_2004 214
1152 3300038443 Ga0395901_0006780 Ga0395901_0006780_4889_5539 214
1153 3300039437 Ga0436365_0398219 Ga0436365_0398219_128_775 214
1154 3300041405 Ga0439438_009367 Ga0439438_009367_832_1491 214
1155 3300041411 Ga0439466_0019610 Ga0439466_0019610_816_1472 214
1156 3300042010 Ga0439452_001907 Ga0439452_001907_5973_6632 214
1157 3300042016 Ga0439463_001204 Ga0439463_001204_4908_5564 214
1158 3300042016 Ga0439463_030735 Ga0439463_030735_531_1187 214
1159 3300042016 Ga0439463_046759 Ga0439463_046759_312_992 214
1160 3300042115 Ga0450911_001300 Ga0450911_001300_4636_5295 214
1161 3300042142 Ga0450905_028387 Ga0450905_028387_87_743 214
1162 3300045049 Ga0466959_0294689 Ga0466959_0294689_29_676 214
1163 3300046452 Ga0495617_025423 Ga0495617_025423_521_1177 214
1164 3300046452 Ga0495617_077117 Ga0495617_077117_353_1012 214
1165 3300046453 Ga0495627_000495 Ga0495627_000495_1349_2005 214
1166 3300046453 Ga0495627_005681 Ga0495627_005681_800_1459 214
1167 3300046457 Ga0495590_0004049 Ga0495590_0004049_4410_5069 214
1168 3300046458 Ga0495591_004116 Ga0495591_004116_5385_6041 214
1169 3300046458 Ga0495591_004480 Ga0495591_004480_4903_5559 214
1170 3300046458 Ga0495591_008165 Ga0495591_008165_3580_4236 214
1171 3300046458 Ga0495591_008338 Ga0495591_008338_65_724 214
1172 3300046458 Ga0495591_014195 Ga0495591_014195_1746_2405 214
1173 3300046458 Ga0495591_014293 Ga0495591_014293_1280_1936 214
1174 3300046460 Ga0495638_0010814 Ga0495638_0010814_4610_5269 214
1175 3300046460 Ga0495638_0013448 Ga0495638_0013448_4667_5326 214
1176 3300046471 Ga0495650_0001566 Ga0495650_0001566_852_1508 214
1177 3300046471 Ga0495650_0017797 Ga0495650_0017797_963_1619 214
1178 3300046471 Ga0495650_0064931 Ga0495650_0064931_442_1128 214
1179 3300046474 Ga0495605_0003821 Ga0495605_0003821_1190_1846 214
1180 3300046474 Ga0495605_0012908 Ga0495605_0012908_1277_1933 214
1181 3300046474 Ga0495605_0014352 Ga0495605_0014352_316_975 214
1182 3300046474 Ga0495605_0019059 Ga0495605_0019059_997_1653 214
1183 3300046474 Ga0495605_0023168 Ga0495605_0023168_1331_1987 214
1184 3300046474 Ga0495605_0075638 Ga0495605_0075638_199_855 214
1185 3300046474 Ga0495605_0121685 Ga0495605_0121685_355_1011 214
1186 3300046491 Ga0495584_0014343 Ga0495584_0014343_482_1141 214
1187 3300046491 Ga0495584_0069911 Ga0495584_0069911_431_1090 214
1188 3300046491 Ga0495584_0070811 Ga0495584_0070811_22_681 214
1189 3300046492 Ga0495585_0009717 Ga0495585_0009717_1148_1807 214
1190 3300046500 Ga0495596_0033356 Ga0495596_0033356_1328_1984 214
1191 3300046501 Ga0495607_0001054 Ga0495607_0001054_674_1330 214
1192 3300046501 Ga0495607_0012113 Ga0495607_0012113_572_1231 214
1193 3300046501 Ga0495607_0012410 Ga0495607_0012410_3732_4388 214
1194 3300046501 Ga0495607_0014441 Ga0495607_0014441_3409_4065 214
1195 3300046501 Ga0495607_0021335 Ga0495607_0021335_986_1642 214
1196 3300046501 Ga0495607_0034481 Ga0495607_0034481_1287_1943 214
1197 3300046501 Ga0495607_0054664 Ga0495607_0054664_1342_1998 214
1198 3300046501 Ga0495607_0116250 Ga0495607_0116250_311_967 214
1199 3300046506 Ga0495583_0000894 Ga0495583_0000894_33754_34410 214
1200 3300046506 Ga0495583_0007443 Ga0495583_0007443_1253_1909 214
1201 3300046506 Ga0495583_0011440 Ga0495583_0011440_1277_1933 214
1202 3300046506 Ga0495583_0013768 Ga0495583_0013768_2629_3285 214
1203 3300046506 Ga0495583_0043155 Ga0495583_0043155_198_854 214
1204 3300046507 Ga0495606_0022690 Ga0495606_0022690_1296_1952 214
1205 3300046507 Ga0495606_0202987 Ga0495606_0202987_282_938 214
1206 3300046512 Ga0495610_0007789 Ga0495610_0007789_1117_1776 214
1207 3300046512 Ga0495610_0031597 Ga0495610_0031597_103_789 214
1208 3300046512 Ga0495610_0048398 Ga0495610_0048398_855_1511 214
1209 3300046512 Ga0495610_0092610 Ga0495610_0092610_533_1192 214
1210 3300046513 Ga0495616_0010883 Ga0495616_0010883_3035_3691 214
1211 3300046513 Ga0495616_0012718 Ga0495616_0012718_758_1417 214
1212 3300046513 Ga0495616_0014962 Ga0495616_0014962_2788_3447 214
1213 3300046513 Ga0495616_0090218 Ga0495616_0090218_656_1315 214
1214 3300046513 Ga0495616_0126997 Ga0495616_0126997_50_709 214
1215 3300046515 Ga0495620_0005071 Ga0495620_0005071_518_1174 214
1216 3300046515 Ga0495620_0011578 Ga0495620_0011578_1340_1996 214
1217 3300046515 Ga0495620_0056923 Ga0495620_0056923_706_1362 214
1218 3300046518 Ga0495631_0018100 Ga0495631_0018100_1327_1983 214
1219 3300046519 Ga0495632_0001087 Ga0495632_0001087_1252_1908 214
1220 3300046519 Ga0495632_0004088 Ga0495632_0004088_1276_1932 214
1221 3300046519 Ga0495632_0009017 Ga0495632_0009017_846_1505 214
1222 3300046519 Ga0495632_0023225 Ga0495632_0023225_2428_3087 214
1223 3300046519 Ga0495632_0122979 Ga0495632_0122979_194_850 214
1224 3300046520 Ga0495637_0000303 Ga0495637_0000303_1200_1856 214
1225 3300046520 Ga0495637_0000319 Ga0495637_0000319_35472_36128 214
1226 3300046520 Ga0495637_0009917 Ga0495637_0009917_937_1593 214
1227 3300046520 Ga0495637_0015447 Ga0495637_0015447_110_769 214
1228 3300046522 Ga0495643_0017383 Ga0495643_0017383_417_1073 214
1229 3300046522 Ga0495643_0088596 Ga0495643_0088596_573_1229 214
1230 3300046523 Ga0495644_0003496 Ga0495644_0003496_4534_5193 214
1231 3300046523 Ga0495644_0003678 Ga0495644_0003678_5342_6001 214
1232 3300046523 Ga0495644_0006029 Ga0495644_0006029_1322_1978 214
1233 3300046524 Ga0495648_0014373 Ga0495648_0014373_4844_5500 214
1234 3300046524 Ga0495648_0096733 Ga0495648_0096733_104_763 214
1235 3300046524 Ga0495648_0163629 Ga0495648_0163629_375_1031 214
1236 3300046524 Ga0495648_0195032 Ga0495648_0195032_298_954 214
1237 3300046530 Ga0495654_0032511 Ga0495654_0032511_1338_1994 214
1238 3300046530 Ga0495654_0041296 Ga0495654_0041296_601_1260 214
1239 3300046530 Ga0495654_0065437 Ga0495654_0065437_383_1039 214
1240 3300046530 Ga0495654_0083374 Ga0495654_0083374_552_1208 214
1241 3300046538 Ga0495609_0000265 Ga0495609_0000265_1285_1941 214
1242 3300046538 Ga0495609_0000273 Ga0495609_0000273_46249_46905 214
1243 3300046538 Ga0495609_0087355 Ga0495609_0087355_122_778 214
1244 3300046542 Ga0495597_0027276 Ga0495597_0027276_1285_1944 214
1245 3300046542 Ga0495597_0059970 Ga0495597_0059970_522_1181 214
1246 3300046542 Ga0495597_0071047 Ga0495597_0071047_436_1095 214
1247 3300046557 Ga0495622_0076119 Ga0495622_0076119_799_1455 214
1248 3300046616 Ga0495668_0008311 Ga0495668_0008311_4520_5176 214
1249 3300046616 Ga0495668_0022671 Ga0495668_0022671_2581_3237 214
1250 3300046616 Ga0495668_0028223 Ga0495668_0028223_1694_2350 214
1251 3300046648 Ga0495611_0004597 Ga0495611_0004597_3952_4608 214
1252 3300046648 Ga0495611_0067150 Ga0495611_0067150_717_1376 214
1253 3300046660 Ga0495625_0000076 Ga0495625_0000076_1332_1988 214
1254 3300046660 Ga0495625_0108497 Ga0495625_0108497_1205_1864 214
1255 3300046660 Ga0495625_0141026 Ga0495625_0141026_205_864 214
1256 3300046665 Ga0495661_0000432 Ga0495661_0000432_42297_42953 214
1257 3300046665 Ga0495661_0000517 Ga0495661_0000517_38097_38753 214
1258 3300046665 Ga0495661_0039089 Ga0495661_0039089_499_1155 214
1259 3300046665 Ga0495661_0090240 Ga0495661_0090240_837_1496 214
1260 3300046692 Ga0495671_0009355 Ga0495671_0009355_3980_4639 214
1261 3300046692 Ga0495671_0012303 Ga0495671_0012303_1236_1895 214
1262 3300046692 Ga0495671_0016720 Ga0495671_0016720_1276_1932 214
1263 3300046692 Ga0495671_0043438 Ga0495671_0043438_268_924 214
1264 3300046692 Ga0495671_0061076 Ga0495671_0061076_601_1260 214
1265 3300046692 Ga0495671_0138243 Ga0495671_0138243_245_901 214
1266 3300046694 Ga0495649_0011340 Ga0495649_0011340_619_1278 214
1267 3300046694 Ga0495649_0015467 Ga0495649_0015467_2360_3016 214
1268 3300046694 Ga0495649_0082897 Ga0495649_0082897_428_1087 214
1269 3300046810 Ga0495660_0003517 Ga0495660_0003517_1313_1969 214
1270 3300046810 Ga0495660_0014665 Ga0495660_0014665_655_1311 214
1271 3300046810 Ga0495660_0022157 Ga0495660_0022157_405_1061 214
1272 3300046810 Ga0495660_0022207 Ga0495660_0022207_540_1196 214
1273 3300046810 Ga0495660_0031714 Ga0495660_0031714_1039_1698 214
1274 3300047320 Ga0495672_0014208 Ga0495672_0014208_1169_1828 214
1275 3300047320 Ga0495672_0015219 Ga0495672_0015219_3661_4320 214
1276 3300047320 Ga0495672_0015995 Ga0495672_0015995_3325_3981 214
1277 3300047320 Ga0495672_0055394 Ga0495672_0055394_1286_1942 214
1278 3300047320 Ga0495672_0065157 Ga0495672_0065157_209_868 214
1279 3300047320 Ga0495672_0112154 Ga0495672_0112154_442_1098 214
1280 3300047321 Ga0495676_0000016 Ga0495676_0000016_1332_1988 214
1281 3300047323 Ga0495683_0006291 Ga0495683_0006291_1208_1867 214
1282 3300047323 Ga0495683_0014905 Ga0495683_0014905_991_1650 214
1283 3300047445 Ga0495677_0018976 Ga0495677_0018976_1007_1666 214
1284 3300047446 Ga0495679_001655 Ga0495679_001655_1328_1984 214
1285 3300047446 Ga0495679_006269 Ga0495679_006269_3305_3967 214
1286 3300047446 Ga0495679_023233 Ga0495679_023233_1187_1843 214
1287 3300047469 Ga0495673_0000586 Ga0495673_0000586_1291_1947 214
1288 3300047469 Ga0495673_0005065 Ga0495673_0005065_1196_1852 214
1289 3300047469 Ga0495673_0006701 Ga0495673_0006701_908_1567 214
1290 3300047469 Ga0495673_0010485 Ga0495673_0010485_1048_1704 214
1291 3300047469 Ga0495673_0012606 Ga0495673_0012606_2732_3388 214
1292 3300047469 Ga0495673_0012628 Ga0495673_0012628_1283_1939 214
1293 3300047469 Ga0495673_0016751 Ga0495673_0016751_456_1112 214
1294 3300047469 Ga0495673_0031283 Ga0495673_0031283_926_1582 214
1295 3300047470 Ga0495681_0008536 Ga0495681_0008536_4507_5166 214
1296 3300047470 Ga0495681_0010840 Ga0495681_0010840_3594_4280 214
1297 3300047470 Ga0495681_0014068 Ga0495681_0014068_1327_1983 214
1298 3300047470 Ga0495681_0023871 Ga0495681_0023871_1117_1776 214
1299 3300047470 Ga0495681_0101638 Ga0495681_0101638_43_702 214
1300 3300047472 Ga0495686_0014409 Ga0495686_0014409_3652_4311 214
1301 3300047472 Ga0495686_0056731 Ga0495686_0056731_1613_2269 214
1302 3300048091 Ga0495626_0000336 Ga0495626_0000336_1326_1982 214
1303 3300048907 Ga0496104_0222828 Ga0496104_0222828_1049_1696 214
1304 3300048913 Ga0496110_0061055 Ga0496110_0061055_121_780 214
1305 3300048913 Ga0496110_0322613 Ga0496110_0322613_632_1279 214
1306 3300048924 Ga0496121_0007389 Ga0496121_0007389_1251_1907 214
1307 3300048925 Ga0496122_0001943 Ga0496122_0001943_10894_11550 214
1308 3300048926 Ga0496123_0001575 Ga0496123_0001575_19470_20126 214
1309 3300048926 Ga0496123_0020795 Ga0496123_0020795_3409_4065 214
1310 3300048927 Ga0496124_0001241 Ga0496124_0001241_37193_37849 214
1311 3300048927 Ga0496124_0011175 Ga0496124_0011175_1220_1876 214
1312 3300048927 Ga0496124_0016748 Ga0496124_0016748_5430_6089 214
1313 3300048927 Ga0496124_0027510 Ga0496124_0027510_3088_3744 214
1314 3300049459 Ga0495678_000504 Ga0495678_000504_36298_36954 214
1315 3300049459 Ga0495678_009144 Ga0495678_009144_811_1467 214
1316 3300049459 Ga0495678_038555 Ga0495678_038555_367_1026 214
1317 3300049460 Ga0495682_0000309 Ga0495682_0000309_34810_35466 214
1318 3300049569 Ga0501032_0211831 Ga0501032_0211831_387_1034 214
1319 3300049580 Ga0501046_0285199 Ga0501046_0285199_189_836 214
1320 3300049581 Ga0501047_0019470 Ga0501047_0019470_3900_4547 214
1321 3300049581 Ga0501047_0604342 Ga0501047_0604342_227_874 214
1322 3300049583 Ga0501067_0201582 Ga0501067_0201582_421_1068 214
1323 3300049584 Ga0501068_0045278 Ga0501068_0045278_770_1417 214
1324 3300049585 Ga0501069_0010938 Ga0501069_0010938_68_715 214
1325 3300049588 Ga0501072_0239437 Ga0501072_0239437_593_1240 214
1326 3300049589 Ga0501073_0001265 Ga0501073_0001265_17778_18425 214
1327 3300049590 Ga0501074_0003972 Ga0501074_0003972_5629_6276 214
1328 3300049741 Ga0501079_0082325 Ga0501079_0082325_1317_1964 214
1329 3300049742 Ga0501080_0012243 Ga0501080_0012243_1311_1958 214
1330 3300049742 Ga0501080_0056734 Ga0501080_0056734_2433_3080 214
1331 3300049744 Ga0501083_0003920 Ga0501083_0003920_4984_5631 214
1332 3300049823 Ga0501044_0102527 Ga0501044_0102527_281_928 214
1333 3300050514 nmdc:mga08x19_120980_c1 nmdc:mga08x19_120980_c1_595_1254 214
1334 3300053139 Ga0500568_0091626 Ga0500568_0091626_42_701 214
1335 3300053140 Ga0500573_0012177 Ga0500573_0012177_1343_1999 214
1336 3300053142 Ga0500577_0054242 Ga0500577_0054242_31_687 214
1337 3300054114 Ga0501084_0211559 Ga0501084_0211559_211_858 214
1338 3300060353 Ga0501082_0408481 Ga0501082_0408481_496_1143 214
1339 iso_pu_bacteria 2599185155 2599330165 214
1340 iso_pu_bacteria 2599185307 2599974986 214
1341 iso_pu_bacteria 2600255283 2601625666 214
1342 iso_pu_bacteria 2643221565 2643845345 214
1343 iso_pu_bacteria 2738541271 2738691484 214
1344 iso_pu_bacteria 2738543016 2739267259 214
1345 iso_pu_bacteria 2808606377 2808929426 214
1346 iso_pu_bacteria 2808606381 2808951466 214
1347 iso_pu_bacteria 2826581358 2826585815 214
1348 iso_pu_bacteria 2842849001 2842853294 214
1349 iso_pu_bacteria 3007619802 3007623085 214
1350 iso_pu_bacteria 8056177738 8056180367 214
1351 3300003771 Ga0055526_1000326 Ga0055526_100032629 215
1352 3300003773 Ga0055537_1000120 Ga0055537_100012018 215
1353 3300003773 Ga0055537_1025941 Ga0055537_10259411 215
1354 3300003775 Ga0055524_1003126 Ga0055524_10031262 215
1355 3300003784 Ga0055534_1000170 Ga0055534_100017037 215
1356 3300003790 Ga0055528_1000249 Ga0055528_10002494 215
1357 3300005327 Ga0070658_10002003 Ga0070658_100020032 215
1358 3300005327 Ga0070658_10214457 Ga0070658_102144571 215
1359 3300005329 Ga0070683_100101194 Ga0070683_1001011942 215
1360 3300005329 Ga0070683_100558223 Ga0070683_1005582231 215
1361 3300005339 Ga0070660_100083419 Ga0070660_1000834192 215
1362 3300005344 Ga0070661_100047186 Ga0070661_1000471862 215
1363 3300005344 Ga0070661_100463944 Ga0070661_1004639441 215
1364 3300005535 Ga0070684_100075551 Ga0070684_1000755512 215
1365 3300005535 Ga0070684_100084888 Ga0070684_1000848882 215
1366 3300005543 Ga0070672_100482229 Ga0070672_1004822292 215
1367 3300005564 Ga0070664_100050129 Ga0070664_1000501293 215
1368 3300005834 Ga0068851_10044576 Ga0068851_100445762 215
1369 3300013102 Ga0157371_10223760 Ga0157371_102237602 215
1370 3300013308 Ga0157375_10064953 Ga0157375_100649532 215
1371 3300025263 Ga0209565_1000009 Ga0209565_1000009311 215
1372 3300025273 Ga0209673_1000019 Ga0209673_100001971 215
1373 3300025291 Ga0209675_1000013 Ga0209675_1000013371 215
1374 3300025295 Ga0209564_1000058 Ga0209564_10000589 215
1375 3300025299 Ga0209256_1000052 Ga0209256_1000052145 215
1376 3300025909 Ga0207705_10199678 Ga0207705_101996782 215
1377 3300025919 Ga0207657_10054964 Ga0207657_100549642 215
1378 3300025920 Ga0207649_10111184 Ga0207649_101111842 215
1379 3300025931 Ga0207644_10332974 Ga0207644_103329742 215
1380 3300026095 Ga0207676_10666641 Ga0207676_106666412 215
1381 3300027360 Ga0209969_1001180 Ga0209969_10011801 215
1382 3300027471 Ga0209995_1013445 Ga0209995_10134452 215
1383 3300027526 Ga0209968_1027027 Ga0209968_10270271 215
1384 3300027543 Ga0209999_1025213 Ga0209999_10252132 215
1385 3300027717 Ga0209998_10001534 Ga0209998_100015342 215
1386 3300027876 Ga0209974_10025342 Ga0209974_100253421 215
1387 3300037471 Ga0395905_0675552 Ga0395905_0675552_41_715 215
1388 3300041406 Ga0439439_0063897 Ga0439439_0063897_209_859 215
1389 3300042156 Ga0439446_0030737 Ga0439446_0030737_799_1449 215
1390 3300044712 Ga0453684_0639733 Ga0453684_0639733_190_861 215
1391 3300046455 Ga0495603_0028741 Ga0495603_0028741_2424_3107 215
1392 3300046459 Ga0495629_0448597 Ga0495629_0448597_164_841 215
1393 3300046474 Ga0495605_0005419 Ga0495605_0005419_795_1454 215
1394 3300046501 Ga0495607_0013476 Ga0495607_0013476_3367_4026 215
1395 3300046507 Ga0495606_0013491 Ga0495606_0013491_804_1463 215
1396 3300046517 Ga0495630_0067219 Ga0495630_0067219_699_1376 215
1397 3300048912 Ga0496109_0214025 Ga0496109_0214025_738_1424 215
1398 3300048915 Ga0496112_0004012 Ga0496112_0004012_1384_2070 215
1399 3300048917 Ga0496114_0100390 Ga0496114_0100390_489_1157 215
1400 3300025924 Ga0207694_10000101 Ga0207694_1000010150 216
1401 3300037312 Ga0395899_0000028 Ga0395899_0000028_94858_95520 216
1402 3300042439 Ga0439464_0000743 Ga0439464_0000743_2409_3083 216
1403 3300045051 Ga0451576_0576949 Ga0451576_0576949_206_874 216
1404 3300046460 Ga0495638_0003207 Ga0495638_0003207_5074_5736 216
1405 3300046474 Ga0495605_0141437 Ga0495605_0141437_229_891 216
1406 3300046491 Ga0495584_0001192 Ga0495584_0001192_5827_6489 216
1407 3300046491 Ga0495584_0024248 Ga0495584_0024248_1038_1700 216
1408 3300046491 Ga0495584_0313642 Ga0495584_0313642_65_727 216
1409 3300046492 Ga0495585_0000410 Ga0495585_0000410_5920_6600 216
1410 3300046492 Ga0495585_0000739 Ga0495585_0000739_3187_3849 216
1411 3300046492 Ga0495585_0048477 Ga0495585_0048477_1311_1973 216
1412 3300046492 Ga0495585_0118369 Ga0495585_0118369_37_699 216
1413 3300046492 Ga0495585_0213989 Ga0495585_0213989_41_703 216
1414 3300046500 Ga0495596_0002058 Ga0495596_0002058_8673_9335 216
1415 3300046500 Ga0495596_0035801 Ga0495596_0035801_207_869 216
1416 3300046500 Ga0495596_0141152 Ga0495596_0141152_244_906 216
1417 3300046501 Ga0495607_0063733 Ga0495607_0063733_121_783 216
1418 3300046506 Ga0495583_0019251 Ga0495583_0019251_1535_2197 216
1419 3300046506 Ga0495583_0028700 Ga0495583_0028700_1371_2033 216
1420 3300046513 Ga0495616_0003480 Ga0495616_0003480_9182_9844 216
1421 3300046513 Ga0495616_0018749 Ga0495616_0018749_2606_3268 216
1422 3300046513 Ga0495616_0084242 Ga0495616_0084242_305_967 216
1423 3300046518 Ga0495631_0006675 Ga0495631_0006675_699_1361 216
1424 3300046519 Ga0495632_0004661 Ga0495632_0004661_860_1522 216
1425 3300046520 Ga0495637_0005944 Ga0495637_0005944_4515_5180 216
1426 3300046520 Ga0495637_0021142 Ga0495637_0021142_1433_2098 216
1427 3300046522 Ga0495643_0023437 Ga0495643_0023437_371_1036 216
1428 3300046525 Ga0495663_0002550 Ga0495663_0002550_1137_1799 216
1429 3300046528 Ga0495642_0007586 Ga0495642_0007586_580_1242 216
1430 3300046528 Ga0495642_0026367 Ga0495642_0026367_1319_1987 216
1431 3300046538 Ga0495609_0018573 Ga0495609_0018573_1586_2248 216
1432 3300046542 Ga0495597_0028921 Ga0495597_0028921_623_1285 216
1433 3300046542 Ga0495597_0043949 Ga0495597_0043949_456_1118 216
1434 3300046558 Ga0495633_0002998 Ga0495633_0002998_5822_6484 216
1435 3300046558 Ga0495633_0005077 Ga0495633_0005077_135_797 216
1436 3300046558 Ga0495633_0007023 Ga0495633_0007023_737_1399 216
1437 3300046616 Ga0495668_0005756 Ga0495668_0005756_389_1051 216
1438 3300046648 Ga0495611_0000909 Ga0495611_0000909_1726_2388 216
1439 3300046648 Ga0495611_0014519 Ga0495611_0014519_189_851 216
1440 3300046648 Ga0495611_0035857 Ga0495611_0035857_921_1643 216
1441 3300046648 Ga0495611_0036074 Ga0495611_0036074_1221_1883 216
1442 3300046665 Ga0495661_0046428 Ga0495661_0046428_645_1307 216
1443 3300046665 Ga0495661_0085048 Ga0495661_0085048_1051_1713 216
1444 3300046684 Ga0495669_0002471 Ga0495669_0002471_522_1184 216
1445 3300046691 Ga0495670_0016442 Ga0495670_0016442_2833_3495 216
1446 3300046691 Ga0495670_0021486 Ga0495670_0021486_274_936 216
1447 3300046691 Ga0495670_0037492 Ga0495670_0037492_755_1417 216
1448 3300046692 Ga0495671_0015119 Ga0495671_0015119_1314_1976 216
1449 3300046794 Ga0495589_0044487 Ga0495589_0044487_457_1119 216
1450 3300046794 Ga0495589_0068641 Ga0495589_0068641_1000_1662 216
1451 3300046794 Ga0495589_0072158 Ga0495589_0072158_191_856 216
1452 3300047323 Ga0495683_0000035 Ga0495683_0000035_30593_31255 216
1453 3300047323 Ga0495683_0038668 Ga0495683_0038668_1449_2111 216
1454 3300047443 Ga0495687_054463 Ga0495687_054463_22_684 216
1455 3300047445 Ga0495677_0006492 Ga0495677_0006492_3622_4284 216
1456 3300047470 Ga0495681_0034415 Ga0495681_0034415_799_1461 216
1457 3300047470 Ga0495681_0043312 Ga0495681_0043312_926_1588 216
1458 3300047470 Ga0495681_0075697 Ga0495681_0075697_785_1447 216
1459 3300048091 Ga0495626_0004838 Ga0495626_0004838_6094_6756 216
1460 3300048915 Ga0496112_0579547 Ga0496112_0579547_21_701 216
1461 3300049460 Ga0495682_0008379 Ga0495682_0008379_2649_3311 216
1462 iso_pu_bacteria 2811994881 2812368295 216
1463 iso_pu_bacteria 2823421272 2823423686 216
1464 iso_pu_bacteria 2923519811 2923522349 216
1465 2162886012 MBSR1b_contig_724759 MBSR1b_0299.00005900 217
1466 3300005293 Ga0065715_10158627 Ga0065715_101586271 217
1467 3300005293 Ga0065715_10221538 Ga0065715_102215382 217
1468 3300005327 Ga0070658_10237358 Ga0070658_102373582 217
1469 3300005327 Ga0070658_10529575 Ga0070658_105295751 217
1470 3300005329 Ga0070683_100314727 Ga0070683_1003147272 217
1471 3300005330 Ga0070690_100130182 Ga0070690_1001301822 217
1472 3300005340 Ga0070689_100057953 Ga0070689_1000579533 217
1473 3300005343 Ga0070687_100114583 Ga0070687_1001145832 217
1474 3300005353 Ga0070669_100003812 Ga0070669_1000038123 217
1475 3300005354 Ga0070675_100006834 Ga0070675_1000068343 217
1476 3300005354 Ga0070675_100740910 Ga0070675_1007409101 217
1477 3300005364 Ga0070673_100065171 Ga0070673_1000651712 217
1478 3300005365 Ga0070688_100020147 Ga0070688_1000201471 217
1479 3300005366 Ga0070659_100116297 Ga0070659_1001162972 217
1480 3300005366 Ga0070659_100202776 Ga0070659_1002027761 217
1481 3300005457 Ga0070662_100409113 Ga0070662_1004091131 217
1482 3300005466 Ga0070685_10019177 Ga0070685_100191772 217
1483 3300005530 Ga0070679_100433095 Ga0070679_1004330952 217
1484 3300005543 Ga0070672_100023875 Ga0070672_1000238752 217
1485 3300005564 Ga0070664_100044836 Ga0070664_1000448362 217
1486 3300005564 Ga0070664_100070306 Ga0070664_1000703064 217
1487 3300005616 Ga0068852_100520163 Ga0068852_1005201631 217
1488 3300005617 Ga0068859_100329642 Ga0068859_1003296422 217
1489 3300005844 Ga0068862_100152610 Ga0068862_1001526103 217
1490 3300006931 Ga0097620_100329647 Ga0097620_1003296472 217
1491 3300013308 Ga0157375_10004998 Ga0157375_100049982 217
1492 3300025908 Ga0207643_10001672 Ga0207643_100016729 217
1493 3300025918 Ga0207662_10001814 Ga0207662_100018145 217
1494 3300025921 Ga0207652_10387902 Ga0207652_103879022 217
1495 3300025923 Ga0207681_10138322 Ga0207681_101383222 217
1496 3300025932 Ga0207690_10047577 Ga0207690_100475772 217
1497 3300025933 Ga0207706_10058912 Ga0207706_100589123 217
1498 3300025936 Ga0207670_10053291 Ga0207670_100532913 217
1499 3300025940 Ga0207691_10194938 Ga0207691_101949382 217
1500 3300025944 Ga0207661_10506930 Ga0207661_105069302 217
1501 3300025945 Ga0207679_10201377 Ga0207679_102013772 217
1502 3300025960 Ga0207651_10017066 Ga0207651_100170663 217
1503 3300026067 Ga0207678_10488556 Ga0207678_104885562 217
1504 3300026116 Ga0207674_10012412 Ga0207674_100124122 217
1505 3300031548 Ga0307408_100118106 Ga0307408_1001181062 217
1506 3300031852 Ga0307410_10203242 Ga0307410_102032422 217
1507 3300031903 Ga0307407_10323269 Ga0307407_103232692 217
1508 3300031995 Ga0307409_100387620 Ga0307409_1003876201 217
1509 3300032126 Ga0307415_100646316 Ga0307415_1006463161 217
1510 3300046529 Ga0495652_0139309 Ga0495652_0139309_832_1515 217
1511 3300047447 Ga0495685_020297 Ga0495685_020297_884_1573 217
1512 3300049581 Ga0501047_0191484 Ga0501047_0191484_1160_1894 217
1513 3300049767 Ga0501270_006256 Ga0501270_006256_697_1362 217
1514 iso_pu_bacteria 651053060 651176656 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

28

167

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nvo-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.9588 1 213
6nvp-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.9469 1 213
6nvo-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.9449 1 213
6nvp-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.933 1 213
3vgd-assembly1.cif.gz_A ctystal structure of glycosyltrehalose trehalohydrolase (d252e) 0.6745 51 107
ID Description Score Start End Superfamily
af_Q12212_310_573_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7277 25 111 3.60.21.10
af_Q60344_23_147_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7128 27 146 3.60.21.10
af_Q8T198_66_325_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6861 25 122 3.60.21.10
af_Q60344_23_147_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6729 27 146 3.60.21.10
3m07A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.6725 55 107 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A6J4EB06-F1-model_v4 DEAD/DEAH box helicase 0.989 1 214 GO:0004386
AF-A0A6C2YVW3-F1-model_v4 Dead deah box helicase: ICC-like phosphoesterase-like protein 0.9871 1 214 GO:0004386
AF-S6HHA8-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.987 1 214 GO:0016787
AF-S5THN5-F1-model_v4 Metallophosphoesterase 0.9862 1 214 GO:0016787
AF-A0A2G0Z706-F1-model_v4 deleted 0.9861 1 214

Feature Viewer

pLDDT pTM Quality
92.45 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map