F494499
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1515 | 719 | 3030 | 374 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10000279|Ga0157371_100002797 |
| Length | 422 |
| Sequence | MAWRRAWTLGRWTFHALKTGWHGPCSAQSLKFVVPTKKTQEQHLMSQTFYRKGFLALAVASALSVSSFAQADIKIGVAGPMTGANASFGEQYMKGAQAAADAINKAGGVNGENIVLVAGDDACEPKQAVAVANRLVDQDKVVGVVGHFCSSSTIPASEVYADAGVIVITPGSTNPAVTERGLSDVFRMCGRDDQQGVVAGDYIVDVLKAKKVAVIHDKDTYGQGLADATKAQLEKRGVKPVLYEGLTRGEKDFSALVTKIRSTGAEVVYFGGLHPEAGPLVRQLREQGLKDVRFMSDDGIVTDELVTTAGGAQYVDGVYMTFGADPRALPDSKAVVDEFRKSGYEPEGYTLYAYASVQALAAGFNGAKSNKGDAASKWLKANPVKTVMGEKSWDTKGDLKVSDYVVYQWNKEGKYTQLEKQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 17 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 32 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 37 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 62 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 63 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 64 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 85 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 87 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 88 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 89 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 92 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 140 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 141 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 143 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 147 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 148 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 153 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 154 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 155 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 156 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 157 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 158 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 159 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 160 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 161 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 162 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 163 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 164 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 165 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 166 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 167 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 168 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 169 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 170 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 171 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 172 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 173 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 174 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 175 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 176 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 177 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 178 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 179 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 180 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 181 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 182 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 183 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 184 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 185 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 186 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 187 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 188 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 189 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 190 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 191 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 274 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 275 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 276 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 277 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 278 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 279 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 280 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 281 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 282 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 291 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 292 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 295 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 296 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 297 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 298 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 299 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 300 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 301 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 302 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 303 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 304 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 305 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 306 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 307 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 308 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 309 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 310 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 311 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 312 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 313 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 314 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 315 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 316 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 317 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 318 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 319 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 320 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 321 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 322 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 323 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 324 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 325 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 326 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 327 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 328 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 329 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 330 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 331 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 332 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 333 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 334 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 335 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 336 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 337 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 338 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 339 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 340 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 341 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 342 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 343 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 344 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 345 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 346 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 347 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 348 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 349 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 350 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 351 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 352 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 353 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 354 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 355 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 356 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 357 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 358 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 359 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 360 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 361 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 362 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 363 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 364 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 365 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 366 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 367 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 368 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 369 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 370 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 371 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 372 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 373 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 374 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 375 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 376 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 377 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 378 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 379 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 380 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 381 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 382 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 383 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 384 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 385 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 386 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 387 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 388 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 389 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 390 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 391 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 392 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 393 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 394 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 395 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 396 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 397 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 398 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 399 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 400 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 401 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 402 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 403 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 404 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 405 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 406 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 407 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 408 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 409 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 410 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 411 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 412 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 413 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 414 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 415 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 416 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 417 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 418 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 419 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 420 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 421 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 422 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 423 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 424 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 425 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 426 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 427 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 428 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 429 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 430 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 431 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 432 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 433 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 434 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 435 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 436 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 437 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 438 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 439 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 440 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 441 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 442 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 443 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 444 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 445 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 446 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 447 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 448 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 449 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 450 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 451 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 452 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 453 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 454 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 455 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 456 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 457 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 458 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 459 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 460 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 461 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 462 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 463 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 464 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 465 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 466 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 467 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 468 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 469 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 470 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 471 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 472 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 473 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 474 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 475 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 476 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 477 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 478 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 479 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 480 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 481 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 482 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 483 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 484 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 485 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 486 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 487 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 488 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 489 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 490 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 491 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 492 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 493 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 494 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 495 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 496 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 497 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 498 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 499 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 500 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 501 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 502 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 503 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 504 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 505 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 506 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 507 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 508 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 509 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 510 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 511 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 512 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 513 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 514 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 515 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 516 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 517 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 518 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 519 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 520 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 521 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 522 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 523 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 524 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 525 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 526 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 527 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 528 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 529 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 530 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 531 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 532 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 533 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 534 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 535 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 536 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 537 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 538 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 539 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 540 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 541 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 542 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 543 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 544 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 545 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 546 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 547 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 548 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 549 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 550 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 551 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 552 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 553 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 554 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 555 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 556 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 557 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 558 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 559 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 560 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 561 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 562 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 563 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 564 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 565 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 566 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 567 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 568 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 569 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 570 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 571 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 572 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 573 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 574 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 575 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 576 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 577 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 578 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 579 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 580 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 581 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 582 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 583 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 584 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 585 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 586 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 587 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 588 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 589 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 590 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 591 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 592 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 593 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 594 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 595 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 596 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 597 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 598 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 599 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 600 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 601 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 602 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 603 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 604 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 605 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 606 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 607 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 608 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 609 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 610 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 611 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 612 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 613 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 614 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 615 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 616 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 617 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 618 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 619 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 620 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 621 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 622 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 623 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 624 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 625 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 626 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 627 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 628 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 629 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 630 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 631 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 632 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 633 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 634 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 635 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 636 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 637 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 638 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 639 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 640 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 641 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 642 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 643 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 644 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 645 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 646 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 647 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 648 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 649 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 650 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 651 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 652 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 653 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 654 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 655 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 656 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 657 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 658 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 659 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 660 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 661 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 662 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 663 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 664 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 665 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 666 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 667 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 668 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 669 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 670 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 671 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 672 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 673 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 674 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 675 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 676 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 677 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 678 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 679 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 680 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 681 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 682 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 683 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 684 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 685 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 686 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 687 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 688 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 689 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 690 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 691 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 692 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 693 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 694 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 695 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 696 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 697 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 698 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 699 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 700 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 701 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 702 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 703 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 704 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 705 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 706 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 707 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 708 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 709 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 710 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 711 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 712 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 713 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 714 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 715 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 716 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 717 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 718 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
| 719 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.28 |
| Metatranscriptomes | 0.07 |
| Isolates | 27.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.26 |
| Bulb | 0 |
| Endosphere | 10.3 |
| Nodule | 5.35 |
| Rhizoplane | 8.18 |
| Rhizosphere | 60.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157371_10000279 | 3300013102 | Bacteria | 69160 |
| 2 | MRS2a_Contig_17 | 2124908027 | Bacteria | 60592 |
| 3 | SwRhRL2b_contig_119184 | 2162886007 | Bacteria | 2019 |
| 4 | SwRhRL2b_contig_1308625 | 2162886007 | Bacteria | 4723 |
| 5 | SwRhRL2b_contig_805411 | 2162886007 | Bacteria | 8621 |
| 6 | SwRhRL2b_contig_979588 | 2162886007 | Bacteria | 1213 |
| 7 | JGI24741J21665_1001405 | 3300001915 | Bacteria | 6915 |
| 8 | JGI25162J39368_1000090 | 3300002737 | Bacteria | 102905 |
| 9 | JGI25162J39368_1000096 | 3300002737 | Bacteria | 97855 |
| 10 | JGI25162J39368_1000291 | 3300002737 | Bacteria | 46437 |
| 11 | JGI25163J39215_1000070 | 3300002771 | Bacteria | 46438 |
| 12 | JGI25163J39215_1000085 | 3300002771 | Bacteria | 40659 |
| 13 | JGI25163J39215_1001614 | 3300002771 | Bacteria | 3377 |
| 14 | JGI25164J39214_1000070 | 3300002772 | Bacteria | 102905 |
| 15 | JGI25164J39214_1000074 | 3300002772 | Bacteria | 97855 |
| 16 | JGI25164J39214_1000218 | 3300002772 | Bacteria | 46437 |
| 17 | JGI25159J45721_1000043 | 3300002987 | Bacteria | 63751 |
| 18 | JGI25159J45721_1012276 | 3300002987 | Bacteria | 2050 |
| 19 | JGI25151J46595_10000071 | 3300003187 | Bacteria | 138433 |
| 20 | JGI25151J46595_10000429 | 3300003187 | Bacteria | 41718 |
| 21 | JGI25151J46595_10003884 | 3300003187 | Bacteria | 8072 |
| 22 | JGI25151J46595_10004422 | 3300003187 | Bacteria | 7442 |
| 23 | JGI25165J46597_1000170 | 3300003214 | Bacteria | 102905 |
| 24 | JGI25165J46597_1000177 | 3300003214 | Bacteria | 97855 |
| 25 | JGI25153J46596_10033024 | 3300003215 | Bacteria | 1715 |
| 26 | rootH2_10068894 | 3300003320 | Bacteria | 17138 |
| 27 | rootL2_10004729 | 3300003322 | Bacteria | 1584 |
| 28 | JGI25160J50197_1000144 | 3300003354 | Bacteria | 63751 |
| 29 | JGI25160J50197_1001782 | 3300003354 | Bacteria | 10424 |
| 30 | JGI25160J50197_1002007 | 3300003354 | Bacteria | 9711 |
| 31 | JGI25160J50197_1019317 | 3300003354 | Bacteria | 2093 |
| 32 | JGI25160J50197_1024053 | 3300003354 | Bacteria | 1738 |
| 33 | JGI25161J50226_1000932 | 3300003374 | Bacteria | 10470 |
| 34 | JGI25161J50226_1001484 | 3300003374 | Bacteria | 7004 |
| 35 | Ga0006562J51391_1007340 | 3300003578 | Bacteria | 5410 |
| 36 | Ga0055538_1000044 | 3300003751 | Bacteria | 139501 |
| 37 | Ga0055538_1000154 | 3300003751 | Bacteria | 46437 |
| 38 | Ga0055539_1000063 | 3300003752 | Bacteria | 139484 |
| 39 | Ga0055539_1000204 | 3300003752 | Bacteria | 46437 |
| 40 | Ga0055533_1000065 | 3300003756 | Bacteria | 166911 |
| 41 | Ga0055533_1000206 | 3300003756 | Bacteria | 46437 |
| 42 | Ga0055532_1000067 | 3300003758 | Bacteria | 139497 |
| 43 | Ga0055525_1000083 | 3300003759 | Bacteria | 157373 |
| 44 | Ga0055525_1000102 | 3300003759 | Bacteria | 134908 |
| 45 | Ga0055525_1000283 | 3300003759 | Bacteria | 46437 |
| 46 | Ga0055535_1004784 | 3300003761 | Bacteria | 3168 |
| 47 | Ga0055526_1000888 | 3300003771 | Bacteria | 22243 |
| 48 | Ga0055524_1004021 | 3300003775 | Bacteria | 6932 |
| 49 | Ga0055536_1000101 | 3300003781 | Bacteria | 73884 |
| 50 | Ga0055536_1028124 | 3300003781 | Bacteria | 1538 |
| 51 | Ga0055536_1028415 | 3300003781 | Bacteria | 1524 |
| 52 | Ga0055528_1002804 | 3300003790 | Bacteria | 9113 |
| 53 | Ga0055530_10000097 | 3300003791 | Bacteria | 73884 |
| 54 | Ga0055530_10000216 | 3300003791 | Bacteria | 51438 |
| 55 | Ga0055530_10001211 | 3300003791 | Bacteria | 19954 |
| 56 | Ga0055540_1000098 | 3300003792 | Bacteria | 96649 |
| 57 | Ga0055540_1000108 | 3300003792 | Bacteria | 89907 |
| 58 | Ga0055540_1000232 | 3300003792 | Bacteria | 51558 |
| 59 | Ga0055540_1000837 | 3300003792 | Bacteria | 20668 |
| 60 | Ga0055531_10000811 | 3300003794 | Bacteria | 25894 |
| 61 | Ga0055541_1000040 | 3300003841 | Bacteria | 166911 |
| 62 | Ga0055541_1000132 | 3300003841 | Bacteria | 46437 |
| 63 | Ga0058692_1000431 | 3300003856 | Bacteria | 19221 |
| 64 | Ga0058692_1000887 | 3300003856 | Bacteria | 11780 |
| 65 | Ga0058692_1001196 | 3300003856 | Bacteria | 9947 |
| 66 | Ga0058692_1006599 | 3300003856 | Bacteria | 3162 |
| 67 | Ga0058692_1009102 | 3300003856 | Bacteria | 2524 |
| 68 | Ga0058692_1018727 | 3300003856 | Bacteria | 1490 |
| 69 | Ga0058692_1019180 | 3300003856 | Bacteria | 1463 |
| 70 | Ga0055543_1000806 | 3300004625 | Bacteria | 15450 |
| 71 | Ga0055543_1000841 | 3300004625 | Bacteria | 14907 |
| 72 | Ga0065165_1000461 | 3300005262 | Bacteria | 63722 |
| 73 | Ga0065165_1013706 | 3300005262 | Bacteria | 3202 |
| 74 | Ga0065714_10000570 | 3300005288 | Bacteria | 3698 |
| 75 | Ga0065714_10002375 | 3300005288 | Bacteria | 22373 |
| 76 | Ga0065714_10002602 | 3300005288 | Bacteria | 25747 |
| 77 | Ga0065714_10003143 | 3300005288 | Bacteria | 8351 |
| 78 | Ga0065714_10064479 | 3300005288 | Bacteria | 55183 |
| 79 | Ga0065714_10064792 | 3300005288 | Bacteria | 18742 |
| 80 | Ga0065714_10097683 | 3300005288 | Bacteria | 1729 |
| 81 | Ga0065714_10104879 | 3300005288 | Bacteria | 1576 |
| 82 | Ga0065714_10108528 | 3300005288 | Bacteria | 1513 |
| 83 | Ga0065704_10000441 | 3300005289 | Bacteria | 40721 |
| 84 | Ga0065704_10000981 | 3300005289 | Bacteria | 20736 |
| 85 | Ga0065704_10002804 | 3300005289 | Bacteria | 11634 |
| 86 | Ga0065704_10074928 | 3300005289 | Bacteria | 5905 |
| 87 | Ga0065704_10076308 | 3300005289 | Bacteria | 5171 |
| 88 | Ga0065704_10079284 | 3300005289 | Bacteria | 4206 |
| 89 | Ga0065704_10085700 | 3300005289 | Bacteria | 3195 |
| 90 | Ga0065704_10093930 | 3300005289 | Bacteria | 2570 |
| 91 | Ga0065704_10095309 | 3300005289 | Bacteria | 2494 |
| 92 | Ga0065712_10068313 | 3300005290 | Bacteria | 11825 |
| 93 | Ga0065712_10079953 | 3300005290 | Bacteria | 3160 |
| 94 | Ga0065715_10095933 | 3300005293 | Bacteria | 3969 |
| 95 | Ga0070670_100283255 | 3300005331 | Bacteria | 1447 |
| 96 | Ga0070660_100246220 | 3300005339 | Bacteria | 1457 |
| 97 | Ga0070661_100004923 | 3300005344 | Bacteria | 9196 |
| 98 | Ga0070669_100000313 | 3300005353 | Bacteria | 37996 |
| 99 | Ga0070669_100000691 | 3300005353 | Bacteria | 24753 |
| 100 | Ga0070659_100305183 | 3300005366 | Bacteria | 1328 |
| 101 | Ga0070662_100003761 | 3300005457 | Bacteria | 9498 |
| 102 | Ga0070662_100017614 | 3300005457 | Bacteria | 4820 |
| 103 | Ga0070681_10004942 | 3300005458 | Bacteria | 12818 |
| 104 | Ga0070679_100111266 | 3300005530 | Bacteria | 2725 |
| 105 | Ga0068853_100002022 | 3300005539 | Bacteria | 14995 |
| 106 | Ga0068853_100143573 | 3300005539 | Bacteria | 2144 |
| 107 | Ga0068853_100207216 | 3300005539 | Bacteria | 1786 |
| 108 | Ga0070665_100000191 | 3300005548 | Bacteria | 108807 |
| 109 | Ga0070665_100048327 | 3300005548 | Bacteria | 4272 |
| 110 | Ga0070665_100430501 | 3300005548 | Bacteria | 1328 |
| 111 | Ga0070664_100000062 | 3300005564 | Bacteria | 65997 |
| 112 | Ga0068857_100002061 | 3300005577 | Bacteria | 16334 |
| 113 | Ga0068854_100104014 | 3300005578 | Bacteria | 2132 |
| 114 | Ga0068851_10000004 | 3300005834 | Bacteria | 269685 |
| 115 | Ga0081455_10234412 | 3300005937 | Bacteria | 1352 |
| 116 | Ga0081540_1022308 | 3300005983 | Bacteria | 3741 |
| 117 | Ga0075364_10025240 | 3300006051 | Bacteria | 3781 |
| 118 | Ga0075364_10045215 | 3300006051 | Bacteria | 2865 |
| 119 | Ga0075364_10063409 | 3300006051 | Bacteria | 2426 |
| 120 | Ga0075364_10174293 | 3300006051 | Bacteria | 1454 |
| 121 | Ga0075432_10000430 | 3300006058 | Bacteria | 12297 |
| 122 | Ga0075432_10001440 | 3300006058 | Bacteria | 7761 |
| 123 | Ga0075362_10007447 | 3300006177 | Bacteria | 4147 |
| 124 | Ga0075369_10062893 | 3300006186 | Bacteria | 1622 |
| 125 | Ga0075369_10083316 | 3300006186 | Bacteria | 1420 |
| 126 | Ga0075366_10026091 | 3300006195 | Bacteria | 3420 |
| 127 | Ga0075366_10034230 | 3300006195 | Bacteria | 2992 |
| 128 | Ga0075370_10013321 | 3300006353 | Bacteria | 4367 |
| 129 | Ga0075430_100235086 | 3300006846 | Bacteria | 1519 |
| 130 | Ga0099823_1030284 | 3300006944 | Bacteria | 4536 |
| 131 | Ga0099823_1048943 | 3300006944 | Bacteria | 2665 |
| 132 | Ga0079104_1000164 | 3300006946 | Bacteria | 94084 |
| 133 | Ga0079104_1000670 | 3300006946 | Bacteria | 32217 |
| 134 | Ga0079104_1000973 | 3300006946 | Bacteria | 22420 |
| 135 | Ga0079104_1001028 | 3300006946 | Bacteria | 21419 |
| 136 | Ga0079104_1001053 | 3300006946 | Bacteria | 20907 |
| 137 | Ga0079104_1001133 | 3300006946 | Bacteria | 19422 |
| 138 | Ga0079104_1001349 | 3300006946 | Bacteria | 16772 |
| 139 | Ga0079104_1016164 | 3300006946 | Bacteria | 2190 |
| 140 | Ga0099826_10001603 | 3300006948 | Bacteria | 13795 |
| 141 | Ga0105251_10000145 | 3300009011 | Bacteria | 72430 |
| 142 | Ga0105251_10000320 | 3300009011 | Bacteria | 48103 |
| 143 | Ga0105251_10000478 | 3300009011 | Bacteria | 37893 |
| 144 | Ga0105251_10002029 | 3300009011 | Bacteria | 16425 |
| 145 | Ga0105251_10003572 | 3300009011 | Bacteria | 11213 |
| 146 | Ga0105251_10004352 | 3300009011 | Bacteria | 9684 |
| 147 | Ga0105251_10005036 | 3300009011 | Bacteria | 8767 |
| 148 | Ga0105251_10008082 | 3300009011 | Bacteria | 6371 |
| 149 | Ga0105251_10014644 | 3300009011 | Bacteria | 4324 |
| 150 | Ga0105251_10043066 | 3300009011 | Bacteria | 2188 |
| 151 | Ga0105251_10050745 | 3300009011 | Bacteria | 1981 |
| 152 | Ga0105251_10055935 | 3300009011 | Bacteria | 1869 |
| 153 | Ga0105251_10058903 | 3300009011 | Bacteria | 1813 |
| 154 | Ga0105251_10074721 | 3300009011 | Bacteria | 1574 |
| 155 | Ga0105244_10000020 | 3300009036 | Bacteria | 241021 |
| 156 | Ga0105244_10000908 | 3300009036 | Bacteria | 25011 |
| 157 | Ga0105244_10001258 | 3300009036 | Bacteria | 20775 |
| 158 | Ga0105244_10001405 | 3300009036 | Bacteria | 19496 |
| 159 | Ga0105244_10001929 | 3300009036 | Bacteria | 16122 |
| 160 | Ga0105244_10004386 | 3300009036 | Bacteria | 9728 |
| 161 | Ga0105244_10004738 | 3300009036 | Bacteria | 9259 |
| 162 | Ga0105244_10004882 | 3300009036 | Bacteria | 9087 |
| 163 | Ga0105244_10007999 | 3300009036 | Bacteria | 6654 |
| 164 | Ga0105244_10008927 | 3300009036 | Bacteria | 6207 |
| 165 | Ga0105244_10010746 | 3300009036 | Bacteria | 5531 |
| 166 | Ga0105244_10017190 | 3300009036 | Bacteria | 4097 |
| 167 | Ga0105244_10025469 | 3300009036 | Bacteria | 3215 |
| 168 | Ga0105244_10038102 | 3300009036 | Bacteria | 2509 |
| 169 | Ga0105244_10043407 | 3300009036 | Bacteria | 2320 |
| 170 | Ga0105244_10058077 | 3300009036 | Bacteria | 1954 |
| 171 | Ga0105244_10079343 | 3300009036 | Bacteria | 1627 |
| 172 | Ga0105244_10083581 | 3300009036 | Bacteria | 1578 |
| 173 | Ga0105244_10106143 | 3300009036 | Bacteria | 1370 |
| 174 | Ga0105250_10000009 | 3300009092 | Bacteria | 330307 |
| 175 | Ga0105250_10000125 | 3300009092 | Bacteria | 66657 |
| 176 | Ga0105250_10000467 | 3300009092 | Bacteria | 28775 |
| 177 | Ga0105250_10000502 | 3300009092 | Bacteria | 27455 |
| 178 | Ga0105250_10000907 | 3300009092 | Bacteria | 17427 |
| 179 | Ga0105250_10002154 | 3300009092 | Bacteria | 10105 |
| 180 | Ga0105250_10002468 | 3300009092 | Bacteria | 9279 |
| 181 | Ga0105250_10003819 | 3300009092 | Bacteria | 7072 |
| 182 | Ga0105250_10014681 | 3300009092 | Bacteria | 3214 |
| 183 | Ga0105250_10017420 | 3300009092 | Bacteria | 2921 |
| 184 | Ga0105250_10017507 | 3300009092 | Bacteria | 2914 |
| 185 | Ga0105250_10022270 | 3300009092 | Bacteria | 2556 |
| 186 | Ga0105250_10052245 | 3300009092 | Bacteria | 1640 |
| 187 | Ga0105247_10000030 | 3300009101 | Bacteria | 187803 |
| 188 | Ga0105243_10000100 | 3300009148 | Bacteria | 99372 |
| 189 | Ga0105243_10000639 | 3300009148 | Bacteria | 34674 |
| 190 | Ga0105243_10001648 | 3300009148 | Bacteria | 19360 |
| 191 | Ga0105243_10009069 | 3300009148 | Bacteria | 7599 |
| 192 | Ga0105243_10009900 | 3300009148 | Bacteria | 7249 |
| 193 | Ga0105243_10040568 | 3300009148 | Bacteria | 3636 |
| 194 | Ga0105241_10000001 | 3300009174 | Bacteria | 879793 |
| 195 | Ga0105242_10000478 | 3300009176 | Bacteria | 31824 |
| 196 | Ga0105242_10238641 | 3300009176 | Bacteria | 1633 |
| 197 | Ga0105237_10002559 | 3300009545 | Bacteria | 22438 |
| 198 | Ga0105033_101306 | 3300009986 | Bacteria | 2025 |
| 199 | Ga0105246_10000237 | 3300011119 | Bacteria | 28356 |
| 200 | Ga0105246_10014181 | 3300011119 | Bacteria | 5008 |
| 201 | Ga0105246_10015549 | 3300011119 | Bacteria | 4808 |
| 202 | Ga0105246_10056920 | 3300011119 | Bacteria | 2704 |
| 203 | Ga0105246_10092795 | 3300011119 | Bacteria | 2180 |
| 204 | Ga0157373_10000373 | 3300013100 | Bacteria | 35806 |
| 205 | Ga0157373_10001594 | 3300013100 | Bacteria | 17328 |
| 206 | Ga0157373_10002803 | 3300013100 | Bacteria | 13180 |
| 207 | Ga0157373_10019659 | 3300013100 | Bacteria | 4913 |
| 208 | Ga0157373_10041384 | 3300013100 | Bacteria | 3296 |
| 209 | Ga0157373_10128200 | 3300013100 | Bacteria | 1784 |
| 210 | Ga0157373_10209767 | 3300013100 | Bacteria | 1374 |
| 211 | Ga0157371_10000099 | 3300013102 | Bacteria | 133829 |
| 212 | Ga0157371_10003408 | 3300013102 | Bacteria | 14438 |
| 213 | Ga0157371_10004573 | 3300013102 | Bacteria | 12034 |
| 214 | Ga0157371_10011814 | 3300013102 | Bacteria | 6706 |
| 215 | Ga0157371_10015149 | 3300013102 | Bacteria | 5792 |
| 216 | Ga0157371_10021793 | 3300013102 | Bacteria | 4700 |
| 217 | Ga0157371_10033428 | 3300013102 | Bacteria | 3695 |
| 218 | Ga0157370_10000150 | 3300013104 | Bacteria | 85732 |
| 219 | Ga0157370_10001912 | 3300013104 | Bacteria | 25625 |
| 220 | Ga0157370_10026170 | 3300013104 | Bacteria | 5763 |
| 221 | Ga0157370_10060869 | 3300013104 | Bacteria | 3584 |
| 222 | Ga0157370_10095300 | 3300013104 | Bacteria | 2792 |
| 223 | Ga0157370_10251262 | 3300013104 | Bacteria | 1635 |
| 224 | Ga0157370_10297229 | 3300013104 | Bacteria | 1491 |
| 225 | Ga0157369_10011869 | 3300013105 | Bacteria | 9895 |
| 226 | Ga0157369_10043532 | 3300013105 | Bacteria | 4893 |
| 227 | Ga0157369_10307169 | 3300013105 | Bacteria | 1650 |
| 228 | Ga0171462_1042 | 3300013250 | Bacteria | 66199 |
| 229 | Ga0163162_10335420 | 3300013306 | Bacteria | 1644 |
| 230 | Ga0157372_10004722 | 3300013307 | Bacteria | 14474 |
| 231 | Ga0157372_10010613 | 3300013307 | Bacteria | 9800 |
| 232 | Ga0157372_10126252 | 3300013307 | Bacteria | 2941 |
| 233 | Ga0157372_10401376 | 3300013307 | Bacteria | 1597 |
| 234 | Ga0157375_10038552 | 3300013308 | Bacteria | 4588 |
| 235 | Ga0157380_10011062 | 3300014326 | Bacteria | 6510 |
| 236 | Ga0182008_10001110 | 3300014497 | Bacteria | 18522 |
| 237 | Ga0182008_10001450 | 3300014497 | Bacteria | 15842 |
| 238 | Ga0182008_10013093 | 3300014497 | Bacteria | 4363 |
| 239 | Ga0182008_10022989 | 3300014497 | Bacteria | 3189 |
| 240 | Ga0182008_10091633 | 3300014497 | Bacteria | 1499 |
| 241 | Ga0182008_10099374 | 3300014497 | Bacteria | 1437 |
| 242 | Ga0182006_1000018 | 3300015261 | Bacteria | 299376 |
| 243 | Ga0182006_1003209 | 3300015261 | Bacteria | 8501 |
| 244 | Ga0182006_1006488 | 3300015261 | Bacteria | 5434 |
| 245 | Ga0182006_1008810 | 3300015261 | Bacteria | 4559 |
| 246 | Ga0182006_1018838 | 3300015261 | Bacteria | 2912 |
| 247 | Ga0182007_10043059 | 3300015262 | Bacteria | 1501 |
| 248 | Ga0182005_1000422 | 3300015265 | Bacteria | 22747 |
| 249 | Ga0182005_1030897 | 3300015265 | Bacteria | 1459 |
| 250 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 251 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 252 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 253 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 254 | Ga0163161_10000031 | 3300017792 | Bacteria | 166584 |
| 255 | Ga0163161_10176355 | 3300017792 | Bacteria | 1636 |
| 256 | Ga0163161_10205761 | 3300017792 | Bacteria | 1518 |
| 257 | Ga0163161_10212350 | 3300017792 | Bacteria | 1495 |
| 258 | Ga0163161_10216470 | 3300017792 | Bacteria | 1482 |
| 259 | Ga0163161_10327356 | 3300017792 | Unclassified | 1213 |
| 260 | Ga0163161_10338463 | 3300017792 | Bacteria | 1193 |
| 261 | Ga0209435_101162 | 3300025206 | Bacteria | 3616 |
| 262 | Ga0209760_100031 | 3300025207 | Bacteria | 141487 |
| 263 | Ga0209760_100056 | 3300025207 | Bacteria | 100067 |
| 264 | Ga0209760_100137 | 3300025207 | Bacteria | 46738 |
| 265 | Ga0209760_100139 | 3300025207 | Bacteria | 46193 |
| 266 | Ga0209436_100580 | 3300025208 | Bacteria | 15666 |
| 267 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 268 | Ga0209784_100028 | 3300025224 | Bacteria | 357464 |
| 269 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 270 | Ga0209566_100028 | 3300025225 | Bacteria | 357464 |
| 271 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 272 | Ga0209674_100047 | 3300025226 | Bacteria | 357464 |
| 273 | Ga0209147_100031 | 3300025229 | Bacteria | 357464 |
| 274 | Ga0209563_100008 | 3300025230 | Bacteria | 1554545 |
| 275 | Ga0209563_100050 | 3300025230 | Bacteria | 357464 |
| 276 | Ga0209563_102472 | 3300025230 | Bacteria | 4171 |
| 277 | Ga0207427_100016 | 3300025231 | Bacteria | 538697 |
| 278 | Ga0207427_100067 | 3300025231 | Bacteria | 164839 |
| 279 | Ga0207427_100231 | 3300025231 | Bacteria | 46613 |
| 280 | Ga0209437_100007 | 3300025233 | Bacteria | 938377 |
| 281 | Ga0209437_100011 | 3300025233 | Bacteria | 818520 |
| 282 | Ga0209437_100016 | 3300025233 | Bacteria | 710118 |
| 283 | Ga0209437_104358 | 3300025233 | Bacteria | 2503 |
| 284 | Ga0209258_100170 | 3300025242 | Bacteria | 145191 |
| 285 | Ga0209646_1000357 | 3300025246 | Bacteria | 31806 |
| 286 | Ga0209677_100004 | 3300025253 | Bacteria | 1554545 |
| 287 | Ga0209677_100029 | 3300025253 | Bacteria | 357464 |
| 288 | Ga0209759_1005835 | 3300025256 | Bacteria | 4226 |
| 289 | Ga0209129_1001115 | 3300025258 | Bacteria | 15655 |
| 290 | Ga0209233_1000019 | 3300025261 | Bacteria | 818520 |
| 291 | Ga0209233_1000156 | 3300025261 | Bacteria | 164839 |
| 292 | Ga0209673_1000206 | 3300025273 | Bacteria | 118136 |
| 293 | Ga0209673_1002157 | 3300025273 | Bacteria | 14570 |
| 294 | Ga0209673_1009790 | 3300025273 | Bacteria | 4108 |
| 295 | Ga0209130_1000274 | 3300025284 | Bacteria | 64411 |
| 296 | Ga0209130_1000325 | 3300025284 | Bacteria | 55752 |
| 297 | Ga0209130_1000461 | 3300025284 | Bacteria | 42274 |
| 298 | Ga0209130_1000870 | 3300025284 | Bacteria | 24713 |
| 299 | Ga0209675_1002688 | 3300025291 | Bacteria | 8957 |
| 300 | Ga0209676_1000025 | 3300025292 | Bacteria | 577569 |
| 301 | Ga0209676_1000096 | 3300025292 | Bacteria | 240620 |
| 302 | Ga0209676_1000266 | 3300025292 | Bacteria | 109375 |
| 303 | Ga0209676_1000722 | 3300025292 | Bacteria | 45471 |
| 304 | Ga0209676_1009457 | 3300025292 | Bacteria | 4200 |
| 305 | Ga0209676_1009480 | 3300025292 | Bacteria | 4194 |
| 306 | Ga0209025_1000053 | 3300025294 | Bacteria | 317600 |
| 307 | Ga0209025_1000062 | 3300025294 | Bacteria | 304236 |
| 308 | Ga0209025_1000190 | 3300025294 | Bacteria | 153726 |
| 309 | Ga0209025_1000261 | 3300025294 | Bacteria | 123705 |
| 310 | Ga0209025_1000282 | 3300025294 | Bacteria | 115627 |
| 311 | Ga0209564_1000987 | 3300025295 | Bacteria | 35584 |
| 312 | Ga0209758_1000245 | 3300025297 | Bacteria | 111769 |
| 313 | Ga0209758_1001726 | 3300025297 | Bacteria | 24371 |
| 314 | Ga0209758_1004259 | 3300025297 | Bacteria | 12099 |
| 315 | Ga0209758_1007665 | 3300025297 | Bacteria | 7268 |
| 316 | Ga0209758_1011622 | 3300025297 | Bacteria | 5066 |
| 317 | Ga0209050_1000028 | 3300025298 | Bacteria | 477133 |
| 318 | Ga0209050_1000301 | 3300025298 | Bacteria | 103314 |
| 319 | Ga0209050_1000356 | 3300025298 | Bacteria | 88117 |
| 320 | Ga0209050_1001464 | 3300025298 | Bacteria | 25257 |
| 321 | Ga0209050_1003956 | 3300025298 | Bacteria | 10468 |
| 322 | Ga0209256_1003166 | 3300025299 | Bacteria | 11927 |
| 323 | Ga0207426_1000066 | 3300025302 | Bacteria | 351182 |
| 324 | Ga0207426_1000109 | 3300025302 | Bacteria | 238665 |
| 325 | Ga0207426_1000460 | 3300025302 | Bacteria | 63857 |
| 326 | Ga0207426_1000474 | 3300025302 | Bacteria | 61569 |
| 327 | Ga0207426_1000545 | 3300025302 | Bacteria | 52897 |
| 328 | Ga0209051_1000089 | 3300025303 | Bacteria | 175572 |
| 329 | Ga0209051_1000225 | 3300025303 | Bacteria | 95205 |
| 330 | Ga0209051_1000264 | 3300025303 | Bacteria | 87736 |
| 331 | Ga0209051_1000467 | 3300025303 | Bacteria | 52965 |
| 332 | Ga0209051_1008473 | 3300025303 | Bacteria | 5436 |
| 333 | Ga0209051_1009287 | 3300025303 | Bacteria | 5082 |
| 334 | Ga0209257_1000034 | 3300025304 | Bacteria | 662719 |
| 335 | Ga0209257_1002752 | 3300025304 | Bacteria | 16635 |
| 336 | Ga0209257_1003051 | 3300025304 | Bacteria | 15095 |
| 337 | Ga0207656_10000007 | 3300025321 | Bacteria | 289154 |
| 338 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 339 | Ga0207696_1000005 | 3300025711 | Bacteria | 642078 |
| 340 | Ga0207696_1000058 | 3300025711 | Bacteria | 248495 |
| 341 | Ga0207696_1000065 | 3300025711 | Bacteria | 231818 |
| 342 | Ga0207696_1000085 | 3300025711 | Bacteria | 195968 |
| 343 | Ga0207696_1000122 | 3300025711 | Bacteria | 143543 |
| 344 | Ga0207696_1000561 | 3300025711 | Bacteria | 29454 |
| 345 | Ga0207696_1000629 | 3300025711 | Bacteria | 25886 |
| 346 | Ga0207696_1002299 | 3300025711 | Bacteria | 9492 |
| 347 | Ga0207696_1003450 | 3300025711 | Bacteria | 7207 |
| 348 | Ga0207696_1006288 | 3300025711 | Bacteria | 4806 |
| 349 | Ga0207696_1009217 | 3300025711 | Bacteria | 3691 |
| 350 | Ga0207696_1009548 | 3300025711 | Bacteria | 3611 |
| 351 | Ga0207696_1010164 | 3300025711 | Bacteria | 3465 |
| 352 | Ga0207655_1000002 | 3300025728 | Bacteria | 1148694 |
| 353 | Ga0207655_1000004 | 3300025728 | Bacteria | 1021221 |
| 354 | Ga0207655_1000014 | 3300025728 | Bacteria | 607124 |
| 355 | Ga0207655_1000041 | 3300025728 | Bacteria | 333962 |
| 356 | Ga0207655_1000227 | 3300025728 | Bacteria | 94083 |
| 357 | Ga0207655_1000394 | 3300025728 | Bacteria | 60812 |
| 358 | Ga0207655_1000443 | 3300025728 | Bacteria | 55002 |
| 359 | Ga0207655_1000678 | 3300025728 | Bacteria | 39720 |
| 360 | Ga0207655_1003228 | 3300025728 | Bacteria | 12246 |
| 361 | Ga0207655_1004333 | 3300025728 | Bacteria | 10118 |
| 362 | Ga0207655_1004334 | 3300025728 | Bacteria | 10117 |
| 363 | Ga0207655_1004908 | 3300025728 | Bacteria | 9279 |
| 364 | Ga0207655_1005999 | 3300025728 | Bacteria | 8127 |
| 365 | Ga0207655_1012607 | 3300025728 | Bacteria | 4926 |
| 366 | Ga0207655_1013326 | 3300025728 | Bacteria | 4728 |
| 367 | Ga0207655_1024328 | 3300025728 | Bacteria | 2971 |
| 368 | Ga0207655_1026304 | 3300025728 | Bacteria | 2796 |
| 369 | Ga0207655_1028526 | 3300025728 | Bacteria | 2632 |
| 370 | Ga0207655_1028656 | 3300025728 | Bacteria | 2623 |
| 371 | Ga0207655_1046564 | 3300025728 | Bacteria | 1800 |
| 372 | Ga0207655_1066948 | 3300025728 | Bacteria | 1354 |
| 373 | Ga0207713_1000002 | 3300025735 | Bacteria | 1061749 |
| 374 | Ga0207713_1000004 | 3300025735 | Bacteria | 702781 |
| 375 | Ga0207713_1000018 | 3300025735 | Bacteria | 362635 |
| 376 | Ga0207713_1000022 | 3300025735 | Bacteria | 351775 |
| 377 | Ga0207713_1000067 | 3300025735 | Bacteria | 195418 |
| 378 | Ga0207713_1000094 | 3300025735 | Bacteria | 146176 |
| 379 | Ga0207713_1000964 | 3300025735 | Bacteria | 25438 |
| 380 | Ga0207713_1001330 | 3300025735 | Bacteria | 20250 |
| 381 | Ga0207713_1004153 | 3300025735 | Bacteria | 9517 |
| 382 | Ga0207713_1007041 | 3300025735 | Bacteria | 6736 |
| 383 | Ga0207713_1008064 | 3300025735 | Bacteria | 6112 |
| 384 | Ga0207713_1008210 | 3300025735 | Bacteria | 6042 |
| 385 | Ga0207713_1011692 | 3300025735 | Bacteria | 4749 |
| 386 | Ga0207713_1013070 | 3300025735 | Bacteria | 4399 |
| 387 | Ga0207713_1016008 | 3300025735 | Bacteria | 3824 |
| 388 | Ga0207713_1019652 | 3300025735 | Bacteria | 3298 |
| 389 | Ga0207713_1020173 | 3300025735 | Bacteria | 3238 |
| 390 | Ga0207713_1020309 | 3300025735 | Bacteria | 3222 |
| 391 | Ga0207713_1022531 | 3300025735 | Bacteria | 2987 |
| 392 | Ga0207713_1037981 | 3300025735 | Bacteria | 2048 |
| 393 | Ga0207713_1039478 | 3300025735 | Bacteria | 1991 |
| 394 | Ga0207710_10000068 | 3300025900 | Bacteria | 152636 |
| 395 | Ga0207654_10000004 | 3300025911 | Bacteria | 902334 |
| 396 | Ga0207707_10003784 | 3300025912 | Bacteria | 13409 |
| 397 | Ga0207671_10000015 | 3300025914 | Bacteria | 439607 |
| 398 | Ga0207649_10000001 | 3300025920 | Bacteria | 537851 |
| 399 | Ga0207652_10163162 | 3300025921 | Bacteria | 1998 |
| 400 | Ga0207646_10249818 | 3300025922 | Bacteria | 1602 |
| 401 | Ga0207681_10000115 | 3300025923 | Bacteria | 67810 |
| 402 | Ga0207681_10000917 | 3300025923 | Bacteria | 19251 |
| 403 | Ga0207650_10005199 | 3300025925 | Bacteria | 8876 |
| 404 | Ga0207650_10005751 | 3300025925 | Bacteria | 8458 |
| 405 | Ga0207706_10002419 | 3300025933 | Bacteria | 18213 |
| 406 | Ga0207706_10006144 | 3300025933 | Bacteria | 11153 |
| 407 | Ga0207686_10000588 | 3300025934 | Bacteria | 22744 |
| 408 | Ga0207709_10000022 | 3300025935 | Bacteria | 383573 |
| 409 | Ga0207709_10000252 | 3300025935 | Bacteria | 64225 |
| 410 | Ga0207709_10005827 | 3300025935 | Bacteria | 6963 |
| 411 | Ga0207709_10014232 | 3300025935 | Bacteria | 4390 |
| 412 | Ga0207709_10276151 | 3300025935 | Bacteria | 1239 |
| 413 | Ga0207679_10000011 | 3300025945 | Bacteria | 346112 |
| 414 | Ga0207639_10002699 | 3300026041 | Bacteria | 11910 |
| 415 | Ga0207639_10061278 | 3300026041 | Bacteria | 2905 |
| 416 | Ga0207639_10128523 | 3300026041 | Bacteria | 2094 |
| 417 | Ga0207708_10337085 | 3300026075 | Bacteria | 1234 |
| 418 | Ga0207674_10004718 | 3300026116 | Bacteria | 16341 |
| 419 | Ga0209281_1000006 | 3300027111 | Bacteria | 1170244 |
| 420 | Ga0209281_1000033 | 3300027111 | Bacteria | 383539 |
| 421 | Ga0209281_1000038 | 3300027111 | Bacteria | 361154 |
| 422 | Ga0209281_1000071 | 3300027111 | Bacteria | 274050 |
| 423 | Ga0209281_1000109 | 3300027111 | Bacteria | 216504 |
| 424 | Ga0209281_1000159 | 3300027111 | Bacteria | 161872 |
| 425 | Ga0209281_1000257 | 3300027111 | Bacteria | 103090 |
| 426 | Ga0209281_1001006 | 3300027111 | Bacteria | 22077 |
| 427 | Ga0209281_1002968 | 3300027111 | Bacteria | 6045 |
| 428 | Ga0209389_1000298 | 3300027296 | Bacteria | 30991 |
| 429 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 430 | Ga0209371_1000005 | 3300027312 | Bacteria | 1061740 |
| 431 | Ga0209371_1000089 | 3300027312 | Bacteria | 173483 |
| 432 | Ga0209371_1000153 | 3300027312 | Bacteria | 108815 |
| 433 | Ga0209371_1000496 | 3300027312 | Bacteria | 38249 |
| 434 | Ga0209371_1001032 | 3300027312 | Bacteria | 21055 |
| 435 | Ga0209371_1002187 | 3300027312 | Bacteria | 11404 |
| 436 | Ga0209371_1002726 | 3300027312 | Bacteria | 9510 |
| 437 | Ga0209371_1003926 | 3300027312 | Bacteria | 6831 |
| 438 | Ga0209371_1023281 | 3300027312 | Bacteria | 1461 |
| 439 | Ga0209282_1043159 | 3300027666 | Bacteria | 2654 |
| 440 | Ga0207428_10010914 | 3300027907 | Bacteria | 8086 |
| 441 | Ga0207428_10047509 | 3300027907 | Bacteria | 3446 |
| 442 | Ga0268266_10001011 | 3300028379 | Bacteria | 35400 |
| 443 | Ga0268266_10008268 | 3300028379 | Bacteria | 9272 |
| 444 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 445 | Ga0268256_1000006 | 3300030500 | Bacteria | 1063991 |
| 446 | Ga0268256_1000103 | 3300030500 | Bacteria | 129125 |
| 447 | Ga0268256_1001232 | 3300030500 | Bacteria | 16066 |
| 448 | Ga0268256_1001701 | 3300030500 | Bacteria | 12552 |
| 449 | Ga0268256_1001923 | 3300030500 | Bacteria | 11404 |
| 450 | Ga0268256_1002152 | 3300030500 | Bacteria | 10466 |
| 451 | Ga0268256_1002425 | 3300030500 | Bacteria | 9517 |
| 452 | Ga0268256_1003645 | 3300030500 | Bacteria | 6831 |
| 453 | Ga0268256_1026373 | 3300030500 | Bacteria | 1461 |
| 454 | Ga0316178_1009271 | 3300030735 | Bacteria | 51087 |
| 455 | Ga0316181_1270085 | 3300030744 | Bacteria | 7045 |
| 456 | Ga0316181_1279945 | 3300030744 | Bacteria | 1605 |
| 457 | Ga0265327_10058290 | 3300031251 | Bacteria | 1982 |
| 458 | Ga0307408_100034206 | 3300031548 | Bacteria | 3557 |
| 459 | Ga0307408_100299887 | 3300031548 | Bacteria | 1345 |
| 460 | Ga0307516_10217623 | 3300031730 | Bacteria | 1621 |
| 461 | Ga0307405_10173132 | 3300031731 | Bacteria | 1542 |
| 462 | Ga0307409_100245063 | 3300031995 | Bacteria | 1634 |
| 463 | Ga0307411_10200626 | 3300032005 | Bacteria | 1531 |
| 464 | Ga0307510_10026777 | 3300033180 | Bacteria | 6619 |
| 465 | Ga0307510_10173174 | 3300033180 | Bacteria | 1733 |
| 466 | Ga0237819_00859 | 3300038705 | Bacteria | 9568 |
| 467 | Ga0436360_1287249 | 3300039438 | Bacteria | 2444 |
| 468 | Ga0436361_0524714 | 3300039447 | Bacteria | 1880 |
| 469 | Ga0439436_0002120 | 3300041404 | Bacteria | 5920 |
| 470 | Ga0439438_000498 | 3300041405 | Bacteria | 17802 |
| 471 | Ga0439438_001218 | 3300041405 | Bacteria | 11404 |
| 472 | Ga0439438_001498 | 3300041405 | Bacteria | 10295 |
| 473 | Ga0439438_001594 | 3300041405 | Bacteria | 9970 |
| 474 | Ga0439438_003029 | 3300041405 | Bacteria | 6922 |
| 475 | Ga0439438_004069 | 3300041405 | Bacteria | 5727 |
| 476 | Ga0439438_004895 | 3300041405 | Bacteria | 5021 |
| 477 | Ga0439447_000310 | 3300041407 | Bacteria | 17421 |
| 478 | Ga0439447_000501 | 3300041407 | Bacteria | 14560 |
| 479 | Ga0439447_012552 | 3300041407 | Bacteria | 2430 |
| 480 | Ga0439447_013724 | 3300041407 | Bacteria | 2290 |
| 481 | Ga0439447_025060 | 3300041407 | Bacteria | 1539 |
| 482 | Ga0439466_0000334 | 3300041411 | Bacteria | 18158 |
| 483 | Ga0439466_0000620 | 3300041411 | Bacteria | 13368 |
| 484 | Ga0439466_0000665 | 3300041411 | Bacteria | 12944 |
| 485 | Ga0439466_0001745 | 3300041411 | Bacteria | 8500 |
| 486 | Ga0439466_0004892 | 3300041411 | Bacteria | 5148 |
| 487 | Ga0439466_0010143 | 3300041411 | Bacteria | 3502 |
| 488 | Ga0439466_0021445 | 3300041411 | Bacteria | 2288 |
| 489 | Ga0439466_0029369 | 3300041411 | Bacteria | 1892 |
| 490 | Ga0439465_0000550 | 3300041413 | Bacteria | 11247 |
| 491 | Ga0439465_0028570 | 3300041413 | Bacteria | 1769 |
| 492 | Ga0451853_1126616 | 3300041512 | Bacteria | 5590 |
| 493 | Ga0451853_2641771 | 3300041512 | Bacteria | 2584 |
| 494 | Ga0439431_0002829 | 3300041997 | Bacteria | 3815 |
| 495 | Ga0439431_0027821 | 3300041997 | Bacteria | 1391 |
| 496 | Ga0439445_0009126 | 3300042004 | Bacteria | 2332 |
| 497 | Ga0439445_0031278 | 3300042004 | Bacteria | 1383 |
| 498 | Ga0439432_001900 | 3300042006 | Bacteria | 7875 |
| 499 | Ga0439432_002858 | 3300042006 | Bacteria | 6437 |
| 500 | Ga0439432_005967 | 3300042006 | Bacteria | 4372 |
| 501 | Ga0439432_008787 | 3300042006 | Bacteria | 3536 |
| 502 | Ga0439432_049980 | 3300042006 | Bacteria | 1306 |
| 503 | Ga0439449_0019279 | 3300042007 | Bacteria | 2557 |
| 504 | Ga0439451_004666 | 3300042009 | Bacteria | 2788 |
| 505 | Ga0439452_000002 | 3300042010 | Bacteria | 1377577 |
| 506 | Ga0439452_000101 | 3300042010 | Bacteria | 72026 |
| 507 | Ga0439452_000628 | 3300042010 | Bacteria | 17817 |
| 508 | Ga0439452_000662 | 3300042010 | Bacteria | 17058 |
| 509 | Ga0439452_002594 | 3300042010 | Bacteria | 6625 |
| 510 | Ga0439452_004284 | 3300042010 | Bacteria | 4822 |
| 511 | Ga0439452_006204 | 3300042010 | Bacteria | 3762 |
| 512 | Ga0439452_017215 | 3300042010 | Bacteria | 1948 |
| 513 | Ga0439452_021422 | 3300042010 | Bacteria | 1684 |
| 514 | Ga0439452_026388 | 3300042010 | Bacteria | 1466 |
| 515 | Ga0439456_002941 | 3300042013 | Bacteria | 3446 |
| 516 | Ga0439456_007129 | 3300042013 | Bacteria | 2290 |
| 517 | Ga0439463_000574 | 3300042016 | Bacteria | 10292 |
| 518 | Ga0439463_002244 | 3300042016 | Bacteria | 4958 |
| 519 | Ga0439463_002774 | 3300042016 | Bacteria | 4442 |
| 520 | Ga0439463_004470 | 3300042016 | Bacteria | 3509 |
| 521 | Ga0450911_002519 | 3300042115 | Bacteria | 3561 |
| 522 | Ga0450919_003687 | 3300042121 | Bacteria | 1901 |
| 523 | Ga0450922_002044 | 3300042124 | Bacteria | 1923 |
| 524 | Ga0450890_001172 | 3300042127 | Bacteria | 3793 |
| 525 | Ga0450902_000023 | 3300042137 | Bacteria | 13838 |
| 526 | Ga0450903_001230 | 3300042138 | Bacteria | 4809 |
| 527 | Ga0450903_002557 | 3300042138 | Bacteria | 3228 |
| 528 | Ga0450906_001654 | 3300042145 | Bacteria | 4894 |
| 529 | Ga0450907_000201 | 3300042146 | Bacteria | 21621 |
| 530 | Ga0450907_001929 | 3300042146 | Bacteria | 4192 |
| 531 | Ga0450907_002149 | 3300042146 | Bacteria | 3877 |
| 532 | Ga0450910_004385 | 3300042147 | Bacteria | 1905 |
| 533 | Ga0439446_0001401 | 3300042156 | Bacteria | 5465 |
| 534 | Ga0439446_0005590 | 3300042156 | Bacteria | 3238 |
| 535 | Ga0439446_0007826 | 3300042156 | Bacteria | 2818 |
| 536 | Ga0450908_002206 | 3300042184 | Bacteria | 3822 |
| 537 | Ga0450909_000517 | 3300042185 | Bacteria | 5038 |
| 538 | Ga0439434_0002623 | 3300042435 | Bacteria | 5236 |
| 539 | Ga0439434_0023103 | 3300042435 | Bacteria | 1870 |
| 540 | Ga0439464_0004184 | 3300042439 | Bacteria | 3678 |
| 541 | Ga0439464_0023444 | 3300042439 | Bacteria | 1704 |
| 542 | Ga0439460_0000611 | 3300042461 | Bacteria | 7880 |
| 543 | Ga0439460_0002720 | 3300042461 | Bacteria | 4262 |
| 544 | Ga0451577_0018662 | 3300042876 | Bacteria | 6386 |
| 545 | Ga0466981_0000008 | 3300044669 | Bacteria | 147179 |
| 546 | Ga0453684_0002280 | 3300044712 | Bacteria | 47260 |
| 547 | Ga0466959_0085344 | 3300045049 | Bacteria | 2272 |
| 548 | Ga0495617_002486 | 3300046452 | Bacteria | 7313 |
| 549 | Ga0495617_037767 | 3300046452 | Bacteria | 1616 |
| 550 | Ga0495627_000019 | 3300046453 | Bacteria | 309691 |
| 551 | Ga0495627_000117 | 3300046453 | Bacteria | 99610 |
| 552 | Ga0495627_000551 | 3300046453 | Bacteria | 30944 |
| 553 | Ga0495627_004205 | 3300046453 | Bacteria | 6095 |
| 554 | Ga0495627_006324 | 3300046453 | Bacteria | 4651 |
| 555 | Ga0495627_031662 | 3300046453 | Bacteria | 1668 |
| 556 | Ga0495603_0003088 | 3300046455 | Bacteria | 9891 |
| 557 | Ga0495603_0139336 | 3300046455 | Bacteria | 1411 |
| 558 | Ga0495590_0000657 | 3300046457 | Bacteria | 16002 |
| 559 | Ga0495590_0012603 | 3300046457 | Bacteria | 3134 |
| 560 | Ga0495590_0016167 | 3300046457 | Bacteria | 2696 |
| 561 | Ga0495591_000057 | 3300046458 | Bacteria | 132157 |
| 562 | Ga0495591_000059 | 3300046458 | Bacteria | 130522 |
| 563 | Ga0495591_000619 | 3300046458 | Bacteria | 26640 |
| 564 | Ga0495591_001018 | 3300046458 | Bacteria | 18940 |
| 565 | Ga0495591_002042 | 3300046458 | Bacteria | 11727 |
| 566 | Ga0495591_002860 | 3300046458 | Bacteria | 9275 |
| 567 | Ga0495591_005213 | 3300046458 | Bacteria | 6084 |
| 568 | Ga0495591_007937 | 3300046458 | Bacteria | 4420 |
| 569 | Ga0495591_023061 | 3300046458 | Bacteria | 2001 |
| 570 | Ga0495591_029879 | 3300046458 | Bacteria | 1650 |
| 571 | Ga0495629_0023997 | 3300046459 | Bacteria | 4344 |
| 572 | Ga0495638_0001624 | 3300046460 | Bacteria | 20011 |
| 573 | Ga0495638_0020882 | 3300046460 | Bacteria | 4323 |
| 574 | Ga0495638_0032284 | 3300046460 | Bacteria | 3358 |
| 575 | Ga0495638_0126224 | 3300046460 | Bacteria | 1507 |
| 576 | Ga0495638_0126805 | 3300046460 | Bacteria | 1503 |
| 577 | Ga0495653_0010480 | 3300046463 | Bacteria | 7585 |
| 578 | Ga0495653_0083924 | 3300046463 | Bacteria | 2347 |
| 579 | Ga0495653_0120013 | 3300046463 | Bacteria | 1875 |
| 580 | Ga0495653_0203599 | 3300046463 | Bacteria | 1341 |
| 581 | Ga0495650_0000031 | 3300046471 | Bacteria | 433811 |
| 582 | Ga0495650_0000090 | 3300046471 | Bacteria | 232897 |
| 583 | Ga0495650_0000493 | 3300046471 | Bacteria | 59904 |
| 584 | Ga0495650_0001674 | 3300046471 | Bacteria | 20469 |
| 585 | Ga0495650_0002040 | 3300046471 | Bacteria | 17653 |
| 586 | Ga0495650_0005457 | 3300046471 | Bacteria | 8253 |
| 587 | Ga0495650_0007113 | 3300046471 | Bacteria | 6797 |
| 588 | Ga0495650_0010884 | 3300046471 | Bacteria | 5038 |
| 589 | Ga0495650_0018034 | 3300046471 | Bacteria | 3520 |
| 590 | Ga0495605_0000093 | 3300046474 | Bacteria | 113652 |
| 591 | Ga0495605_0000106 | 3300046474 | Bacteria | 105494 |
| 592 | Ga0495605_0000398 | 3300046474 | Bacteria | 40047 |
| 593 | Ga0495605_0000623 | 3300046474 | Bacteria | 27301 |
| 594 | Ga0495605_0000674 | 3300046474 | Bacteria | 25755 |
| 595 | Ga0495605_0002177 | 3300046474 | Bacteria | 12245 |
| 596 | Ga0495605_0002729 | 3300046474 | Bacteria | 10775 |
| 597 | Ga0495605_0004162 | 3300046474 | Bacteria | 8520 |
| 598 | Ga0495605_0004990 | 3300046474 | Bacteria | 7752 |
| 599 | Ga0495605_0015840 | 3300046474 | Bacteria | 4093 |
| 600 | Ga0495605_0024658 | 3300046474 | Bacteria | 3143 |
| 601 | Ga0495605_0089390 | 3300046474 | Bacteria | 1429 |
| 602 | Ga0495639_0001663 | 3300046475 | Bacteria | 9885 |
| 603 | Ga0495639_0003693 | 3300046475 | Bacteria | 6591 |
| 604 | Ga0495584_0000056 | 3300046491 | Bacteria | 81387 |
| 605 | Ga0495584_0000721 | 3300046491 | Bacteria | 21813 |
| 606 | Ga0495584_0003343 | 3300046491 | Bacteria | 8861 |
| 607 | Ga0495584_0008479 | 3300046491 | Bacteria | 5323 |
| 608 | Ga0495584_0008776 | 3300046491 | Bacteria | 5226 |
| 609 | Ga0495584_0008890 | 3300046491 | Bacteria | 5192 |
| 610 | Ga0495584_0011447 | 3300046491 | Bacteria | 4542 |
| 611 | Ga0495584_0015653 | 3300046491 | Bacteria | 3867 |
| 612 | Ga0495585_0001600 | 3300046492 | Bacteria | 17498 |
| 613 | Ga0495585_0052856 | 3300046492 | Bacteria | 2248 |
| 614 | Ga0495585_0052945 | 3300046492 | Bacteria | 2247 |
| 615 | Ga0495585_0092853 | 3300046492 | Bacteria | 1623 |
| 616 | Ga0495585_0099000 | 3300046492 | Bacteria | 1561 |
| 617 | Ga0495585_0106755 | 3300046492 | Bacteria | 1492 |
| 618 | Ga0495594_0001925 | 3300046499 | Bacteria | 10832 |
| 619 | Ga0495594_0025819 | 3300046499 | Bacteria | 3158 |
| 620 | Ga0495596_0000810 | 3300046500 | Bacteria | 18926 |
| 621 | Ga0495596_0014963 | 3300046500 | Bacteria | 3259 |
| 622 | Ga0495596_0043369 | 3300046500 | Bacteria | 1773 |
| 623 | Ga0495596_0084890 | 3300046500 | Bacteria | 1229 |
| 624 | Ga0495607_0000425 | 3300046501 | Bacteria | 42890 |
| 625 | Ga0495607_0000443 | 3300046501 | Bacteria | 41669 |
| 626 | Ga0495607_0000564 | 3300046501 | Bacteria | 36186 |
| 627 | Ga0495607_0001753 | 3300046501 | Bacteria | 18564 |
| 628 | Ga0495607_0002121 | 3300046501 | Bacteria | 16567 |
| 629 | Ga0495607_0005450 | 3300046501 | Bacteria | 9105 |
| 630 | Ga0495607_0006483 | 3300046501 | Bacteria | 8230 |
| 631 | Ga0495607_0017113 | 3300046501 | Bacteria | 4663 |
| 632 | Ga0495607_0024819 | 3300046501 | Bacteria | 3733 |
| 633 | Ga0495607_0025613 | 3300046501 | Bacteria | 3667 |
| 634 | Ga0495607_0037333 | 3300046501 | Bacteria | 2919 |
| 635 | Ga0495607_0037970 | 3300046501 | Bacteria | 2888 |
| 636 | Ga0495607_0063508 | 3300046501 | Bacteria | 2088 |
| 637 | Ga0495607_0087000 | 3300046501 | Bacteria | 1702 |
| 638 | Ga0495607_0091210 | 3300046501 | Bacteria | 1650 |
| 639 | Ga0495607_0160091 | 3300046501 | Bacteria | 1144 |
| 640 | Ga0495583_0000105 | 3300046506 | Bacteria | 142444 |
| 641 | Ga0495583_0000327 | 3300046506 | Bacteria | 75285 |
| 642 | Ga0495583_0000610 | 3300046506 | Bacteria | 48428 |
| 643 | Ga0495583_0000663 | 3300046506 | Bacteria | 45092 |
| 644 | Ga0495583_0001084 | 3300046506 | Bacteria | 30185 |
| 645 | Ga0495583_0003160 | 3300046506 | Bacteria | 12967 |
| 646 | Ga0495583_0005897 | 3300046506 | Bacteria | 8156 |
| 647 | Ga0495583_0011350 | 3300046506 | Bacteria | 5120 |
| 648 | Ga0495583_0061864 | 3300046506 | Bacteria | 1668 |
| 649 | Ga0495583_0082047 | 3300046506 | Bacteria | 1400 |
| 650 | Ga0495606_0000384 | 3300046507 | Bacteria | 75041 |
| 651 | Ga0495606_0000568 | 3300046507 | Bacteria | 58524 |
| 652 | Ga0495606_0000613 | 3300046507 | Bacteria | 56133 |
| 653 | Ga0495606_0001546 | 3300046507 | Bacteria | 30307 |
| 654 | Ga0495606_0009470 | 3300046507 | Bacteria | 8238 |
| 655 | Ga0495606_0009914 | 3300046507 | Bacteria | 7979 |
| 656 | Ga0495606_0017681 | 3300046507 | Bacteria | 5380 |
| 657 | Ga0495606_0018554 | 3300046507 | Bacteria | 5210 |
| 658 | Ga0495606_0021496 | 3300046507 | Bacteria | 4726 |
| 659 | Ga0495606_0032264 | 3300046507 | Bacteria | 3630 |
| 660 | Ga0495606_0115019 | 3300046507 | Bacteria | 1617 |
| 661 | Ga0495606_0132736 | 3300046507 | Bacteria | 1478 |
| 662 | Ga0495606_0136279 | 3300046507 | Bacteria | 1453 |
| 663 | Ga0495606_0175549 | 3300046507 | Bacteria | 1239 |
| 664 | Ga0495610_0001910 | 3300046512 | Bacteria | 17974 |
| 665 | Ga0495610_0007780 | 3300046512 | Bacteria | 7070 |
| 666 | Ga0495610_0010267 | 3300046512 | Bacteria | 5835 |
| 667 | Ga0495610_0017120 | 3300046512 | Bacteria | 4142 |
| 668 | Ga0495610_0021472 | 3300046512 | Bacteria | 3549 |
| 669 | Ga0495610_0032164 | 3300046512 | Bacteria | 2730 |
| 670 | Ga0495610_0036793 | 3300046512 | Bacteria | 2498 |
| 671 | Ga0495610_0052983 | 3300046512 | Bacteria | 1967 |
| 672 | Ga0495610_0069315 | 3300046512 | Bacteria | 1651 |
| 673 | Ga0495616_0013437 | 3300046513 | Bacteria | 4618 |
| 674 | Ga0495616_0034408 | 3300046513 | Bacteria | 2632 |
| 675 | Ga0495616_0071217 | 3300046513 | Bacteria | 1681 |
| 676 | Ga0495616_0076326 | 3300046513 | Bacteria | 1611 |
| 677 | Ga0495616_0078233 | 3300046513 | Bacteria | 1586 |
| 678 | Ga0495616_0083980 | 3300046513 | Bacteria | 1518 |
| 679 | Ga0495616_0098549 | 3300046513 | Bacteria | 1373 |
| 680 | Ga0495620_0000071 | 3300046515 | Bacteria | 85732 |
| 681 | Ga0495620_0000353 | 3300046515 | Bacteria | 31870 |
| 682 | Ga0495620_0001683 | 3300046515 | Bacteria | 13041 |
| 683 | Ga0495620_0004814 | 3300046515 | Bacteria | 7586 |
| 684 | Ga0495620_0009341 | 3300046515 | Bacteria | 5220 |
| 685 | Ga0495620_0023714 | 3300046515 | Bacteria | 2928 |
| 686 | Ga0495620_0034588 | 3300046515 | Bacteria | 2280 |
| 687 | Ga0495620_0037060 | 3300046515 | Bacteria | 2175 |
| 688 | Ga0495620_0056079 | 3300046515 | Bacteria | 1659 |
| 689 | Ga0495630_0019223 | 3300046517 | Bacteria | 5021 |
| 690 | Ga0495631_0000110 | 3300046518 | Bacteria | 54728 |
| 691 | Ga0495631_0025731 | 3300046518 | Bacteria | 2706 |
| 692 | Ga0495631_0036702 | 3300046518 | Bacteria | 2187 |
| 693 | Ga0495632_0000265 | 3300046519 | Bacteria | 52032 |
| 694 | Ga0495632_0001736 | 3300046519 | Bacteria | 17674 |
| 695 | Ga0495632_0006622 | 3300046519 | Bacteria | 7411 |
| 696 | Ga0495632_0007347 | 3300046519 | Bacteria | 6934 |
| 697 | Ga0495632_0009322 | 3300046519 | Bacteria | 5925 |
| 698 | Ga0495632_0011651 | 3300046519 | Bacteria | 5122 |
| 699 | Ga0495632_0017874 | 3300046519 | Bacteria | 3901 |
| 700 | Ga0495632_0033367 | 3300046519 | Bacteria | 2643 |
| 701 | Ga0495632_0077817 | 3300046519 | Bacteria | 1585 |
| 702 | Ga0495632_0102475 | 3300046519 | Bacteria | 1348 |
| 703 | Ga0495632_0109835 | 3300046519 | Bacteria | 1295 |
| 704 | Ga0495637_0000216 | 3300046520 | Bacteria | 44389 |
| 705 | Ga0495637_0000488 | 3300046520 | Bacteria | 28750 |
| 706 | Ga0495637_0000687 | 3300046520 | Bacteria | 23309 |
| 707 | Ga0495637_0001900 | 3300046520 | Bacteria | 11905 |
| 708 | Ga0495637_0009397 | 3300046520 | Bacteria | 4771 |
| 709 | Ga0495637_0009448 | 3300046520 | Bacteria | 4755 |
| 710 | Ga0495637_0013767 | 3300046520 | Bacteria | 3833 |
| 711 | Ga0495637_0016618 | 3300046520 | Bacteria | 3438 |
| 712 | Ga0495637_0050010 | 3300046520 | Bacteria | 1754 |
| 713 | Ga0495637_0065583 | 3300046520 | Bacteria | 1478 |
| 714 | Ga0495643_0000585 | 3300046522 | Bacteria | 44407 |
| 715 | Ga0495643_0002726 | 3300046522 | Bacteria | 13592 |
| 716 | Ga0495643_0007542 | 3300046522 | Bacteria | 7002 |
| 717 | Ga0495643_0009165 | 3300046522 | Bacteria | 6180 |
| 718 | Ga0495643_0014200 | 3300046522 | Bacteria | 4742 |
| 719 | Ga0495643_0032002 | 3300046522 | Bacteria | 2922 |
| 720 | Ga0495644_0001299 | 3300046523 | Bacteria | 10246 |
| 721 | Ga0495644_0001407 | 3300046523 | Bacteria | 9825 |
| 722 | Ga0495644_0005713 | 3300046523 | Bacteria | 4855 |
| 723 | Ga0495644_0023353 | 3300046523 | Bacteria | 2354 |
| 724 | Ga0495648_0001916 | 3300046524 | Bacteria | 19825 |
| 725 | Ga0495648_0003690 | 3300046524 | Bacteria | 13384 |
| 726 | Ga0495648_0004560 | 3300046524 | Bacteria | 11804 |
| 727 | Ga0495648_0006334 | 3300046524 | Bacteria | 9681 |
| 728 | Ga0495648_0007582 | 3300046524 | Bacteria | 8666 |
| 729 | Ga0495648_0008853 | 3300046524 | Bacteria | 7874 |
| 730 | Ga0495648_0045693 | 3300046524 | Bacteria | 2721 |
| 731 | Ga0495648_0076196 | 3300046524 | Bacteria | 1926 |
| 732 | Ga0495648_0095426 | 3300046524 | Bacteria | 1654 |
| 733 | Ga0495648_0096643 | 3300046524 | Bacteria | 1640 |
| 734 | Ga0495648_0097987 | 3300046524 | Bacteria | 1625 |
| 735 | Ga0495648_0098006 | 3300046524 | Bacteria | 1624 |
| 736 | Ga0495666_0111942 | 3300046526 | Bacteria | 1281 |
| 737 | Ga0495642_0000361 | 3300046528 | Bacteria | 24687 |
| 738 | Ga0495642_0003199 | 3300046528 | Bacteria | 6489 |
| 739 | Ga0495642_0059416 | 3300046528 | Bacteria | 1584 |
| 740 | Ga0495654_0000098 | 3300046530 | Bacteria | 98806 |
| 741 | Ga0495654_0000818 | 3300046530 | Bacteria | 23720 |
| 742 | Ga0495654_0000955 | 3300046530 | Bacteria | 21364 |
| 743 | Ga0495654_0002993 | 3300046530 | Bacteria | 10567 |
| 744 | Ga0495654_0004622 | 3300046530 | Bacteria | 8125 |
| 745 | Ga0495654_0005237 | 3300046530 | Bacteria | 7567 |
| 746 | Ga0495654_0011053 | 3300046530 | Bacteria | 4902 |
| 747 | Ga0495654_0011442 | 3300046530 | Bacteria | 4800 |
| 748 | Ga0495654_0012057 | 3300046530 | Bacteria | 4656 |
| 749 | Ga0495654_0037409 | 3300046530 | Bacteria | 2434 |
| 750 | Ga0495654_0059781 | 3300046530 | Bacteria | 1833 |
| 751 | Ga0495654_0088775 | 3300046530 | Bacteria | 1437 |
| 752 | Ga0495654_0124101 | 3300046530 | Bacteria | 1165 |
| 753 | Ga0495586_0008590 | 3300046535 | Bacteria | 5437 |
| 754 | Ga0495587_0005426 | 3300046536 | Bacteria | 8324 |
| 755 | Ga0495609_0000056 | 3300046538 | Bacteria | 146060 |
| 756 | Ga0495609_0000196 | 3300046538 | Bacteria | 60569 |
| 757 | Ga0495609_0000275 | 3300046538 | Bacteria | 47724 |
| 758 | Ga0495609_0001849 | 3300046538 | Bacteria | 13539 |
| 759 | Ga0495609_0011092 | 3300046538 | Bacteria | 4302 |
| 760 | Ga0495609_0066997 | 3300046538 | Bacteria | 1581 |
| 761 | Ga0495609_0091835 | 3300046538 | Bacteria | 1320 |
| 762 | Ga0495597_0000090 | 3300046542 | Bacteria | 80509 |
| 763 | Ga0495597_0000482 | 3300046542 | Bacteria | 33359 |
| 764 | Ga0495597_0000627 | 3300046542 | Bacteria | 28810 |
| 765 | Ga0495597_0029378 | 3300046542 | Bacteria | 2510 |
| 766 | Ga0495597_0068913 | 3300046542 | Bacteria | 1527 |
| 767 | Ga0495597_0073274 | 3300046542 | Bacteria | 1472 |
| 768 | Ga0495645_0107898 | 3300046543 | Bacteria | 1973 |
| 769 | Ga0495622_0000577 | 3300046557 | Bacteria | 21933 |
| 770 | Ga0495622_0002011 | 3300046557 | Bacteria | 9942 |
| 771 | Ga0495622_0009385 | 3300046557 | Bacteria | 4527 |
| 772 | Ga0495622_0045649 | 3300046557 | Bacteria | 2035 |
| 773 | Ga0495622_0068076 | 3300046557 | Bacteria | 1644 |
| 774 | Ga0495633_0000169 | 3300046558 | Bacteria | 86289 |
| 775 | Ga0495633_0010976 | 3300046558 | Bacteria | 4918 |
| 776 | Ga0495633_0039030 | 3300046558 | Bacteria | 2266 |
| 777 | Ga0495668_0001865 | 3300046616 | Bacteria | 18894 |
| 778 | Ga0495668_0028942 | 3300046616 | Bacteria | 3131 |
| 779 | Ga0495668_0029043 | 3300046616 | Bacteria | 3125 |
| 780 | Ga0495668_0063743 | 3300046616 | Bacteria | 2029 |
| 781 | Ga0495668_0096405 | 3300046616 | Bacteria | 1618 |
| 782 | Ga0495634_0001928 | 3300046642 | Bacteria | 17757 |
| 783 | Ga0495634_0108470 | 3300046642 | Bacteria | 1787 |
| 784 | Ga0495611_0000772 | 3300046648 | Bacteria | 17876 |
| 785 | Ga0495611_0003100 | 3300046648 | Bacteria | 7380 |
| 786 | Ga0495611_0031356 | 3300046648 | Bacteria | 2339 |
| 787 | Ga0495611_0043191 | 3300046648 | Bacteria | 2015 |
| 788 | Ga0495611_0058897 | 3300046648 | Bacteria | 1743 |
| 789 | Ga0495625_0000082 | 3300046660 | Bacteria | 153730 |
| 790 | Ga0495625_0003062 | 3300046660 | Bacteria | 17123 |
| 791 | Ga0495625_0005099 | 3300046660 | Bacteria | 12154 |
| 792 | Ga0495625_0013828 | 3300046660 | Bacteria | 6466 |
| 793 | Ga0495625_0135276 | 3300046660 | Bacteria | 1666 |
| 794 | Ga0495625_0137336 | 3300046660 | Bacteria | 1651 |
| 795 | Ga0495635_0043550 | 3300046663 | Bacteria | 3097 |
| 796 | Ga0495635_0113024 | 3300046663 | Bacteria | 1854 |
| 797 | Ga0495659_0000023 | 3300046664 | Bacteria | 71429 |
| 798 | Ga0495659_0001057 | 3300046664 | Bacteria | 9612 |
| 799 | Ga0495659_0008999 | 3300046664 | Bacteria | 3181 |
| 800 | Ga0495661_0000027 | 3300046665 | Bacteria | 184297 |
| 801 | Ga0495661_0000140 | 3300046665 | Bacteria | 85015 |
| 802 | Ga0495661_0000268 | 3300046665 | Bacteria | 59809 |
| 803 | Ga0495661_0000466 | 3300046665 | Bacteria | 42800 |
| 804 | Ga0495661_0011149 | 3300046665 | Bacteria | 6101 |
| 805 | Ga0495661_0019998 | 3300046665 | Bacteria | 4378 |
| 806 | Ga0495661_0027101 | 3300046665 | Bacteria | 3681 |
| 807 | Ga0495661_0159207 | 3300046665 | Bacteria | 1213 |
| 808 | Ga0495588_0000196 | 3300046674 | Bacteria | 63197 |
| 809 | Ga0495588_0063616 | 3300046674 | Bacteria | 1913 |
| 810 | Ga0495646_0020601 | 3300046680 | Bacteria | 4172 |
| 811 | Ga0495646_0088296 | 3300046680 | Bacteria | 1795 |
| 812 | Ga0495669_0001255 | 3300046684 | Bacteria | 10554 |
| 813 | Ga0495613_0011595 | 3300046689 | Bacteria | 6551 |
| 814 | Ga0495624_0010836 | 3300046690 | Bacteria | 6283 |
| 815 | Ga0495670_0001231 | 3300046691 | Bacteria | 12472 |
| 816 | Ga0495670_0003754 | 3300046691 | Bacteria | 7474 |
| 817 | Ga0495670_0015037 | 3300046691 | Bacteria | 3807 |
| 818 | Ga0495670_0043884 | 3300046691 | Bacteria | 2231 |
| 819 | Ga0495670_0100266 | 3300046691 | Bacteria | 1491 |
| 820 | Ga0495670_0102974 | 3300046691 | Bacteria | 1471 |
| 821 | Ga0495671_0002323 | 3300046692 | Bacteria | 12083 |
| 822 | Ga0495671_0003837 | 3300046692 | Bacteria | 9133 |
| 823 | Ga0495671_0007018 | 3300046692 | Bacteria | 6455 |
| 824 | Ga0495671_0017735 | 3300046692 | Bacteria | 3786 |
| 825 | Ga0495671_0020414 | 3300046692 | Bacteria | 3491 |
| 826 | Ga0495671_0025898 | 3300046692 | Bacteria | 3045 |
| 827 | Ga0495671_0058343 | 3300046692 | Bacteria | 1910 |
| 828 | Ga0495671_0084157 | 3300046692 | Bacteria | 1558 |
| 829 | Ga0495671_0085367 | 3300046692 | Bacteria | 1546 |
| 830 | Ga0495649_0003922 | 3300046694 | Bacteria | 9841 |
| 831 | Ga0495649_0006811 | 3300046694 | Bacteria | 7074 |
| 832 | Ga0495649_0018297 | 3300046694 | Bacteria | 3943 |
| 833 | Ga0495649_0025704 | 3300046694 | Bacteria | 3278 |
| 834 | Ga0495649_0034423 | 3300046694 | Bacteria | 2787 |
| 835 | Ga0495649_0040950 | 3300046694 | Bacteria | 2534 |
| 836 | Ga0495649_0100500 | 3300046694 | Bacteria | 1537 |
| 837 | Ga0495589_0000003 | 3300046794 | Bacteria | 453448 |
| 838 | Ga0495589_0000961 | 3300046794 | Bacteria | 17600 |
| 839 | Ga0495589_0001089 | 3300046794 | Bacteria | 16196 |
| 840 | Ga0495589_0001677 | 3300046794 | Bacteria | 12679 |
| 841 | Ga0495589_0007479 | 3300046794 | Bacteria | 5725 |
| 842 | Ga0495589_0020240 | 3300046794 | Bacteria | 3404 |
| 843 | Ga0495589_0050961 | 3300046794 | Bacteria | 2047 |
| 844 | Ga0495589_0074899 | 3300046794 | Bacteria | 1650 |
| 845 | Ga0495589_0136605 | 3300046794 | Bacteria | 1175 |
| 846 | Ga0495600_0037880 | 3300046809 | Bacteria | 3136 |
| 847 | Ga0495600_0099631 | 3300046809 | Bacteria | 1894 |
| 848 | Ga0495660_0000015 | 3300046810 | Bacteria | 324892 |
| 849 | Ga0495660_0000028 | 3300046810 | Bacteria | 244534 |
| 850 | Ga0495660_0000837 | 3300046810 | Bacteria | 22817 |
| 851 | Ga0495660_0000967 | 3300046810 | Bacteria | 20989 |
| 852 | Ga0495660_0004920 | 3300046810 | Bacteria | 8049 |
| 853 | Ga0495660_0013715 | 3300046810 | Bacteria | 4697 |
| 854 | Ga0495660_0020346 | 3300046810 | Bacteria | 3803 |
| 855 | Ga0495660_0026190 | 3300046810 | Bacteria | 3307 |
| 856 | Ga0495660_0040943 | 3300046810 | Bacteria | 2567 |
| 857 | Ga0495660_0053605 | 3300046810 | Bacteria | 2188 |
| 858 | Ga0495660_0083999 | 3300046810 | Bacteria | 1665 |
| 859 | Ga0495660_0107511 | 3300046810 | Bacteria | 1427 |
| 860 | Ga0495581_0012020 | 3300047315 | Bacteria | 5008 |
| 861 | Ga0495604_0011263 | 3300047317 | Bacteria | 7101 |
| 862 | Ga0495604_0031397 | 3300047317 | Bacteria | 4212 |
| 863 | Ga0495636_0026961 | 3300047318 | Bacteria | 2339 |
| 864 | Ga0495672_0000001 | 3300047320 | Bacteria | 1458820 |
| 865 | Ga0495672_0000009 | 3300047320 | Bacteria | 557755 |
| 866 | Ga0495672_0000357 | 3300047320 | Bacteria | 58589 |
| 867 | Ga0495672_0000537 | 3300047320 | Bacteria | 42948 |
| 868 | Ga0495672_0000945 | 3300047320 | Bacteria | 30295 |
| 869 | Ga0495672_0012686 | 3300047320 | Bacteria | 5862 |
| 870 | Ga0495672_0021273 | 3300047320 | Bacteria | 4233 |
| 871 | Ga0495672_0024118 | 3300047320 | Bacteria | 3925 |
| 872 | Ga0495672_0032914 | 3300047320 | Bacteria | 3217 |
| 873 | Ga0495672_0051956 | 3300047320 | Bacteria | 2410 |
| 874 | Ga0495672_0060431 | 3300047320 | Bacteria | 2189 |
| 875 | Ga0495672_0075158 | 3300047320 | Bacteria | 1901 |
| 876 | Ga0495672_0107175 | 3300047320 | Bacteria | 1505 |
| 877 | Ga0495672_0158056 | 3300047320 | Bacteria | 1168 |
| 878 | Ga0495676_0000057 | 3300047321 | Bacteria | 86160 |
| 879 | Ga0495676_0006636 | 3300047321 | Bacteria | 10668 |
| 880 | Ga0495680_0027481 | 3300047322 | Bacteria | 4673 |
| 881 | Ga0495680_0042106 | 3300047322 | Bacteria | 3626 |
| 882 | Ga0495680_0046267 | 3300047322 | Bacteria | 3431 |
| 883 | Ga0495683_0000101 | 3300047323 | Bacteria | 87633 |
| 884 | Ga0495683_0000473 | 3300047323 | Bacteria | 31227 |
| 885 | Ga0495683_0001281 | 3300047323 | Bacteria | 17041 |
| 886 | Ga0495683_0002172 | 3300047323 | Bacteria | 12046 |
| 887 | Ga0495683_0010971 | 3300047323 | Bacteria | 4778 |
| 888 | Ga0495687_000159 | 3300047443 | Bacteria | 101178 |
| 889 | Ga0495687_000160 | 3300047443 | Bacteria | 100989 |
| 890 | Ga0495675_0031533 | 3300047444 | Bacteria | 3383 |
| 891 | Ga0495677_0003409 | 3300047445 | Bacteria | 6170 |
| 892 | Ga0495679_000047 | 3300047446 | Bacteria | 128559 |
| 893 | Ga0495679_000052 | 3300047446 | Bacteria | 120793 |
| 894 | Ga0495679_000576 | 3300047446 | Bacteria | 25525 |
| 895 | Ga0495679_050823 | 3300047446 | Bacteria | 1245 |
| 896 | Ga0495673_0000073 | 3300047469 | Bacteria | 211743 |
| 897 | Ga0495673_0000919 | 3300047469 | Bacteria | 26786 |
| 898 | Ga0495673_0001324 | 3300047469 | Bacteria | 20106 |
| 899 | Ga0495673_0001971 | 3300047469 | Bacteria | 15192 |
| 900 | Ga0495673_0002739 | 3300047469 | Bacteria | 12076 |
| 901 | Ga0495673_0006025 | 3300047469 | Bacteria | 7206 |
| 902 | Ga0495673_0006245 | 3300047469 | Bacteria | 7041 |
| 903 | Ga0495673_0007924 | 3300047469 | Bacteria | 6032 |
| 904 | Ga0495673_0011220 | 3300047469 | Bacteria | 4833 |
| 905 | Ga0495673_0011557 | 3300047469 | Bacteria | 4740 |
| 906 | Ga0495673_0022252 | 3300047469 | Bacteria | 3110 |
| 907 | Ga0495673_0029520 | 3300047469 | Bacteria | 2587 |
| 908 | Ga0495673_0044224 | 3300047469 | Bacteria | 1987 |
| 909 | Ga0495673_0055724 | 3300047469 | Bacteria | 1713 |
| 910 | Ga0495673_0066210 | 3300047469 | Bacteria | 1532 |
| 911 | Ga0495681_0010987 | 3300047470 | Bacteria | 5431 |
| 912 | Ga0495681_0013984 | 3300047470 | Bacteria | 4627 |
| 913 | Ga0495681_0024601 | 3300047470 | Bacteria | 3167 |
| 914 | Ga0495681_0035781 | 3300047470 | Bacteria | 2462 |
| 915 | Ga0495681_0059434 | 3300047470 | Bacteria | 1767 |
| 916 | Ga0495681_0064413 | 3300047470 | Bacteria | 1679 |
| 917 | Ga0495681_0065882 | 3300047470 | Bacteria | 1655 |
| 918 | Ga0495686_0078682 | 3300047472 | Bacteria | 2018 |
| 919 | Ga0495686_0095469 | 3300047472 | Bacteria | 1800 |
| 920 | Ga0495686_0110518 | 3300047472 | Bacteria | 1648 |
| 921 | Ga0495593_0040257 | 3300047673 | Bacteria | 2516 |
| 922 | Ga0495593_0041815 | 3300047673 | Bacteria | 2462 |
| 923 | Ga0495593_0062691 | 3300047673 | Bacteria | 1942 |
| 924 | Ga0495602_0056914 | 3300048088 | Bacteria | 3434 |
| 925 | Ga0495615_0022192 | 3300048090 | Bacteria | 1441 |
| 926 | Ga0495626_0000063 | 3300048091 | Bacteria | 142456 |
| 927 | Ga0495626_0001629 | 3300048091 | Bacteria | 17429 |
| 928 | Ga0495626_0003486 | 3300048091 | Bacteria | 10076 |
| 929 | Ga0495626_0013796 | 3300048091 | Bacteria | 4190 |
| 930 | Ga0495626_0018344 | 3300048091 | Bacteria | 3515 |
| 931 | Ga0495626_0040581 | 3300048091 | Bacteria | 2197 |
| 932 | Ga0495626_0046618 | 3300048091 | Bacteria | 2018 |
| 933 | Ga0495626_0076919 | 3300048091 | Bacteria | 1488 |
| 934 | Ga0496100_0037329 | 3300048903 | Bacteria | 3071 |
| 935 | Ga0496101_0000238 | 3300048904 | Bacteria | 40786 |
| 936 | Ga0496101_0006349 | 3300048904 | Bacteria | 7610 |
| 937 | Ga0496102_0001561 | 3300048905 | Bacteria | 20220 |
| 938 | Ga0496102_0141729 | 3300048905 | Bacteria | 2254 |
| 939 | Ga0496102_0322605 | 3300048905 | Bacteria | 1455 |
| 940 | Ga0496103_0047306 | 3300048906 | Bacteria | 2658 |
| 941 | Ga0496104_0000870 | 3300048907 | Bacteria | 26016 |
| 942 | Ga0496104_0001961 | 3300048907 | Bacteria | 17815 |
| 943 | Ga0496105_0004949 | 3300048908 | Bacteria | 10074 |
| 944 | Ga0496105_0078866 | 3300048908 | Bacteria | 2719 |
| 945 | Ga0496110_0051032 | 3300048913 | Bacteria | 3634 |
| 946 | Ga0496114_0017785 | 3300048917 | Bacteria | 5745 |
| 947 | Ga0496115_0329107 | 3300048918 | Bacteria | 1248 |
| 948 | Ga0496116_0000007 | 3300048919 | Bacteria | 795464 |
| 949 | Ga0496116_0000234 | 3300048919 | Bacteria | 101720 |
| 950 | Ga0496116_0000613 | 3300048919 | Bacteria | 47094 |
| 951 | Ga0496116_0000845 | 3300048919 | Bacteria | 38435 |
| 952 | Ga0496116_0000960 | 3300048919 | Bacteria | 35604 |
| 953 | Ga0496116_0002607 | 3300048919 | Bacteria | 18730 |
| 954 | Ga0496116_0038048 | 3300048919 | Bacteria | 3346 |
| 955 | Ga0496116_0045368 | 3300048919 | Bacteria | 2976 |
| 956 | Ga0496116_0048025 | 3300048919 | Bacteria | 2868 |
| 957 | Ga0496116_0060651 | 3300048919 | Bacteria | 2452 |
| 958 | Ga0496117_0000775 | 3300048920 | Bacteria | 50341 |
| 959 | Ga0496117_0001091 | 3300048920 | Bacteria | 41004 |
| 960 | Ga0496117_0001727 | 3300048920 | Bacteria | 30214 |
| 961 | Ga0496117_0001930 | 3300048920 | Bacteria | 27662 |
| 962 | Ga0496117_0002207 | 3300048920 | Bacteria | 25273 |
| 963 | Ga0496117_0002377 | 3300048920 | Bacteria | 23995 |
| 964 | Ga0496117_0004181 | 3300048920 | Bacteria | 16143 |
| 965 | Ga0496117_0006885 | 3300048920 | Bacteria | 11281 |
| 966 | Ga0496117_0010931 | 3300048920 | Bacteria | 8180 |
| 967 | Ga0496117_0011127 | 3300048920 | Bacteria | 8090 |
| 968 | Ga0496117_0046368 | 3300048920 | Bacteria | 3127 |
| 969 | Ga0496117_0066163 | 3300048920 | Bacteria | 2453 |
| 970 | Ga0496117_0074435 | 3300048920 | Bacteria | 2260 |
| 971 | Ga0496118_0003126 | 3300048921 | Bacteria | 21206 |
| 972 | Ga0496118_0004107 | 3300048921 | Bacteria | 17625 |
| 973 | Ga0496118_0004537 | 3300048921 | Bacteria | 16390 |
| 974 | Ga0496118_0007973 | 3300048921 | Bacteria | 11068 |
| 975 | Ga0496118_0010603 | 3300048921 | Bacteria | 9101 |
| 976 | Ga0496118_0011077 | 3300048921 | Bacteria | 8850 |
| 977 | Ga0496118_0020365 | 3300048921 | Bacteria | 5882 |
| 978 | Ga0496118_0048483 | 3300048921 | Bacteria | 3280 |
| 979 | Ga0496118_0056224 | 3300048921 | Bacteria | 2960 |
| 980 | Ga0496118_0113397 | 3300048921 | Bacteria | 1791 |
| 981 | Ga0496118_0137613 | 3300048921 | Bacteria | 1555 |
| 982 | Ga0496119_0000348 | 3300048922 | Bacteria | 64966 |
| 983 | Ga0496119_0000582 | 3300048922 | Bacteria | 49332 |
| 984 | Ga0496119_0001764 | 3300048922 | Bacteria | 25191 |
| 985 | Ga0496119_0003562 | 3300048922 | Bacteria | 16071 |
| 986 | Ga0496119_0019362 | 3300048922 | Bacteria | 5017 |
| 987 | Ga0496119_0056980 | 3300048922 | Bacteria | 2364 |
| 988 | Ga0496120_0000287 | 3300048923 | Bacteria | 84850 |
| 989 | Ga0496120_0000364 | 3300048923 | Bacteria | 73688 |
| 990 | Ga0496120_0000452 | 3300048923 | Bacteria | 64992 |
| 991 | Ga0496120_0000945 | 3300048923 | Bacteria | 39769 |
| 992 | Ga0496120_0002643 | 3300048923 | Bacteria | 17713 |
| 993 | Ga0496120_0003670 | 3300048923 | Bacteria | 13732 |
| 994 | Ga0496120_0006581 | 3300048923 | Bacteria | 8875 |
| 995 | Ga0496120_0012383 | 3300048923 | Bacteria | 5810 |
| 996 | Ga0496120_0023634 | 3300048923 | Bacteria | 3844 |
| 997 | Ga0496121_0000346 | 3300048924 | Bacteria | 96825 |
| 998 | Ga0496121_0000565 | 3300048924 | Bacteria | 69798 |
| 999 | Ga0496121_0001904 | 3300048924 | Bacteria | 33404 |
| 1000 | Ga0496121_0002181 | 3300048924 | Bacteria | 30635 |
| 1001 | Ga0496121_0002811 | 3300048924 | Bacteria | 25742 |
| 1002 | Ga0496121_0008337 | 3300048924 | Bacteria | 12238 |
| 1003 | Ga0496121_0011723 | 3300048924 | Bacteria | 9677 |
| 1004 | Ga0496121_0029547 | 3300048924 | Bacteria | 5064 |
| 1005 | Ga0496121_0160313 | 3300048924 | Bacteria | 1646 |
| 1006 | Ga0496122_0000058 | 3300048925 | Bacteria | 248805 |
| 1007 | Ga0496122_0000264 | 3300048925 | Bacteria | 117620 |
| 1008 | Ga0496122_0001113 | 3300048925 | Bacteria | 46432 |
| 1009 | Ga0496122_0001199 | 3300048925 | Bacteria | 44239 |
| 1010 | Ga0496122_0002597 | 3300048925 | Bacteria | 25313 |
| 1011 | Ga0496122_0005299 | 3300048925 | Bacteria | 15430 |
| 1012 | Ga0496122_0011643 | 3300048925 | Bacteria | 8870 |
| 1013 | Ga0496122_0011681 | 3300048925 | Bacteria | 8850 |
| 1014 | Ga0496122_0012048 | 3300048925 | Bacteria | 8669 |
| 1015 | Ga0496122_0022107 | 3300048925 | Bacteria | 5666 |
| 1016 | Ga0496122_0038656 | 3300048925 | Bacteria | 3817 |
| 1017 | Ga0496122_0047885 | 3300048925 | Bacteria | 3294 |
| 1018 | Ga0496122_0062023 | 3300048925 | Bacteria | 2739 |
| 1019 | Ga0496122_0132195 | 3300048925 | Bacteria | 1582 |
| 1020 | Ga0496123_0000044 | 3300048926 | Bacteria | 253396 |
| 1021 | Ga0496123_0000215 | 3300048926 | Bacteria | 117620 |
| 1022 | Ga0496123_0000846 | 3300048926 | Bacteria | 48945 |
| 1023 | Ga0496123_0000911 | 3300048926 | Bacteria | 46460 |
| 1024 | Ga0496123_0001400 | 3300048926 | Bacteria | 33807 |
| 1025 | Ga0496123_0001530 | 3300048926 | Bacteria | 31946 |
| 1026 | Ga0496123_0007508 | 3300048926 | Bacteria | 10238 |
| 1027 | Ga0496123_0010260 | 3300048926 | Bacteria | 8307 |
| 1028 | Ga0496123_0011236 | 3300048926 | Bacteria | 7788 |
| 1029 | Ga0496123_0012065 | 3300048926 | Bacteria | 7410 |
| 1030 | Ga0496123_0023517 | 3300048926 | Bacteria | 4714 |
| 1031 | Ga0496123_0061416 | 3300048926 | Bacteria | 2414 |
| 1032 | Ga0496124_0000092 | 3300048927 | Bacteria | 189213 |
| 1033 | Ga0496124_0000787 | 3300048927 | Bacteria | 51800 |
| 1034 | Ga0496124_0001050 | 3300048927 | Bacteria | 43582 |
| 1035 | Ga0496124_0005454 | 3300048927 | Bacteria | 14296 |
| 1036 | Ga0496124_0005640 | 3300048927 | Bacteria | 13996 |
| 1037 | Ga0496124_0014243 | 3300048927 | Bacteria | 7703 |
| 1038 | Ga0496124_0016521 | 3300048927 | Bacteria | 7009 |
| 1039 | Ga0496124_0017975 | 3300048927 | Bacteria | 6644 |
| 1040 | Ga0496124_0020494 | 3300048927 | Bacteria | 6106 |
| 1041 | Ga0496124_0039710 | 3300048927 | Bacteria | 4076 |
| 1042 | Ga0496124_0040970 | 3300048927 | Bacteria | 4001 |
| 1043 | Ga0496124_0054934 | 3300048927 | Bacteria | 3368 |
| 1044 | Ga0496124_0061012 | 3300048927 | Bacteria | 3162 |
| 1045 | Ga0496124_0065726 | 3300048927 | Bacteria | 3023 |
| 1046 | Ga0496124_0079101 | 3300048927 | Bacteria | 2708 |
| 1047 | Ga0496124_0226447 | 3300048927 | Bacteria | 1401 |
| 1048 | Ga0496125_0000103 | 3300048928 | Bacteria | 201675 |
| 1049 | Ga0496125_0000264 | 3300048928 | Bacteria | 108134 |
| 1050 | Ga0496125_0000922 | 3300048928 | Bacteria | 46122 |
| 1051 | Ga0496125_0002771 | 3300048928 | Bacteria | 22177 |
| 1052 | Ga0496125_0006920 | 3300048928 | Bacteria | 12140 |
| 1053 | Ga0496125_0008984 | 3300048928 | Bacteria | 10362 |
| 1054 | Ga0496125_0030208 | 3300048928 | Bacteria | 4851 |
| 1055 | Ga0496125_0058292 | 3300048928 | Bacteria | 3120 |
| 1056 | Ga0496126_0002072 | 3300048929 | Bacteria | 28126 |
| 1057 | Ga0496126_0002455 | 3300048929 | Bacteria | 25034 |
| 1058 | Ga0496126_0005468 | 3300048929 | Bacteria | 14483 |
| 1059 | Ga0496126_0075310 | 3300048929 | Bacteria | 2996 |
| 1060 | Ga0495678_000057 | 3300049459 | Bacteria | 146738 |
| 1061 | Ga0495678_000964 | 3300049459 | Bacteria | 24862 |
| 1062 | Ga0495678_001561 | 3300049459 | Bacteria | 17597 |
| 1063 | Ga0495678_003445 | 3300049459 | Bacteria | 9802 |
| 1064 | Ga0495678_006404 | 3300049459 | Bacteria | 6270 |
| 1065 | Ga0495678_022022 | 3300049459 | Bacteria | 2794 |
| 1066 | Ga0495678_029439 | 3300049459 | Bacteria | 2305 |
| 1067 | Ga0495678_033199 | 3300049459 | Bacteria | 2132 |
| 1068 | Ga0495678_055956 | 3300049459 | Bacteria | 1502 |
| 1069 | Ga0495678_060500 | 3300049459 | Bacteria | 1424 |
| 1070 | Ga0495682_0000001 | 3300049460 | Bacteria | 1559116 |
| 1071 | Ga0495682_0000057 | 3300049460 | Bacteria | 102695 |
| 1072 | Ga0495682_0000218 | 3300049460 | Bacteria | 45117 |
| 1073 | Ga0495682_0001324 | 3300049460 | Bacteria | 13755 |
| 1074 | Ga0495682_0005152 | 3300049460 | Bacteria | 5466 |
| 1075 | Ga0495682_0021872 | 3300049460 | Bacteria | 2394 |
| 1076 | Ga0495682_0056322 | 3300049460 | Bacteria | 1425 |
| 1077 | Ga0501032_0018586 | 3300049569 | Bacteria | 4867 |
| 1078 | Ga0501034_0000085 | 3300049571 | Bacteria | 166893 |
| 1079 | Ga0501039_0263384 | 3300049575 | Bacteria | 1355 |
| 1080 | nmdc:mga03683_6050_c1 | 3300050489 | Bacteria | 4124 |
| 1081 | nmdc:mga0k408_24689_c1 | 3300050493 | Bacteria | 3399 |
| 1082 | nmdc:mga06z11_4626_c1 | 3300050494 | Bacteria | 5429 |
| 1083 | nmdc:mga0qj67_222290_c1 | 3300050509 | Bacteria | 1533 |
| 1084 | nmdc:mga0sz30_20900_c1 | 3300050516 | Bacteria | 2644 |
| 1085 | nmdc:mga0sz30_6298_c2 | 3300050516 | Bacteria | 2369 |
| 1086 | Ga0500578_0026286 | 3300053086 | Bacteria | 3736 |
| 1087 | Ga0500651_0078781 | 3300053093 | Bacteria | 2043 |
| 1088 | Ga0500641_0005518 | 3300053096 | Bacteria | 4479 |
| 1089 | Ga0500572_023756 | 3300053111 | Bacteria | 1648 |
| 1090 | Ga0500594_0002751 | 3300053118 | Bacteria | 3830 |
| 1091 | Ga0500621_000002 | 3300053126 | Bacteria | 849473 |
| 1092 | Ga0500658_0000490 | 3300053134 | Bacteria | 16932 |
| 1093 | Ga0500573_0024946 | 3300053140 | Bacteria | 3438 |
| 1094 | Ga0500637_0010545 | 3300053178 | Bacteria | 4742 |
| 1095 | Ga0500645_040348 | 3300053730 | Bacteria | 1381 |
| 1096 | Ga0500609_001726 | 3300053731 | Bacteria | 3173 |
| 1097 | 2506579396 | 2506520007 | Bacteria | 5442880 |
| 1098 | 2506584535 | 2506520008 | Bacteria | 5443009 |
| 1099 | 2508853260 | 2508501071 | Bacteria | 5454741 |
| 1100 | 2510285424 | 2510065053 | Bacteria | 5005518 |
| 1101 | 2510295933 | 2510065055 | Bacteria | 5037935 |
| 1102 | 2510313562 | 2510065058 | Bacteria | 5005894 |
| 1103 | 2511256194 | 2511231004 | Bacteria | 6669789 |
| 1104 | 2511265248 | 2511231006 | Bacteria | 6794709 |
| 1105 | 2511272292 | 2511231007 | Bacteria | 6306603 |
| 1106 | 2511279339 | 2511231008 | Bacteria | 6624100 |
| 1107 | 2511287551 | 2511231010 | Bacteria | 6373152 |
| 1108 | 2511297473 | 2511231011 | Bacteria | 6149768 |
| 1109 | 2511304360 | 2511231012 | Bacteria | 6738011 |
| 1110 | 2511316203 | 2511231014 | Bacteria | 6462302 |
| 1111 | 2511322040 | 2511231015 | Bacteria | 6598026 |
| 1112 | 2511326395 | 2511231016 | Bacteria | 6704427 |
| 1113 | 2511330874 | 2511231017 | Bacteria | 6503007 |
| 1114 | 2511341478 | 2511231018 | Bacteria | 6436256 |
| 1115 | 2511346521 | 2511231019 | Bacteria | 6520662 |
| 1116 | 2511349234 | 2511231020 | Bacteria | 6115223 |
| 1117 | 2511356380 | 2511231021 | Bacteria | 7302637 |
| 1118 | 2511361493 | 2511231022 | Bacteria | 6719296 |
| 1119 | 2511367161 | 2511231023 | Bacteria | 6808468 |
| 1120 | 2511372924 | 2511231024 | Bacteria | 5835885 |
| 1121 | 2511380296 | 2511231025 | Bacteria | 5324661 |
| 1122 | 2511414420 | 2511231031 | Bacteria | 6558529 |
| 1123 | 2511436625 | 2511231035 | Bacteria | 5341610 |
| 1124 | 2511822579 | 2511231156 | Bacteria | 6845832 |
| 1125 | 2512327627 | 2512047018 | Bacteria | 6663241 |
| 1126 | 2513568465 | 2513237084 | Bacteria | 7231967 |
| 1127 | 2513579443 | 2513237085 | Bacteria | 7695351 |
| 1128 | 2515738451 | 2515154134 | Bacteria | 7220242 |
| 1129 | 2517080487 | 2516653085 | Bacteria | 7346596 |
| 1130 | 2524610867 | 2524023250 | Bacteria | 5457705 |
| 1131 | 2548650591 | 2547132416 | Bacteria | 4633861 |
| 1132 | 2554817942 | 2554235132 | Bacteria | 6772433 |
| 1133 | 2555247471 | 2554235231 | Bacteria | 5215788 |
| 1134 | 2555667546 | 2554235341 | Bacteria | 6867980 |
| 1135 | 2583789689 | 2582580891 | Bacteria | 6800976 |
| 1136 | 2585269333 | 2582581306 | Bacteria | 6450535 |
| 1137 | 2585327179 | 2582581315 | Bacteria | 7318924 |
| 1138 | 2585391312 | 2582581865 | Bacteria | 6644329 |
| 1139 | 2585391780 | 2582581866 | Bacteria | 6859583 |
| 1140 | 2585526813 | 2585427526 | Bacteria | 7258840 |
| 1141 | 2585543081 | 2585427528 | Bacteria | 6842387 |
| 1142 | 2585557484 | 2585427530 | Bacteria | 7383882 |
| 1143 | 2585564246 | 2585427531 | Bacteria | 6992870 |
| 1144 | 2585825507 | 2585427591 | Bacteria | 5482980 |
| 1145 | 2585832011 | 2585427592 | Bacteria | 5370892 |
| 1146 | 2585841446 | 2585427593 | Bacteria | 7141551 |
| 1147 | 2597855775 | 2597489887 | Bacteria | 6666321 |
| 1148 | 2597861784 | 2597489888 | Bacteria | 6179543 |
| 1149 | 2597867510 | 2597489889 | Bacteria | 6297495 |
| 1150 | 2599327254 | 2599185155 | Bacteria | 5827168 |
| 1151 | 2599356767 | 2599185160 | Bacteria | 6844013 |
| 1152 | 2599363203 | 2599185161 | Bacteria | 6960462 |
| 1153 | 2599369845 | 2599185162 | Bacteria | 6957254 |
| 1154 | 2599376312 | 2599185163 | Bacteria | 6995158 |
| 1155 | 2599381872 | 2599185164 | Bacteria | 6841688 |
| 1156 | 2599387984 | 2599185165 | Bacteria | 6843250 |
| 1157 | 2599395490 | 2599185166 | Bacteria | 6959206 |
| 1158 | 2599398736 | 2599185167 | Bacteria | 6353609 |
| 1159 | 2599407255 | 2599185168 | Bacteria | 6997636 |
| 1160 | 2599408778 | 2599185169 | Bacteria | 5441380 |
| 1161 | 2599450791 | 2599185179 | Bacteria | 6611171 |
| 1162 | 2599463600 | 2599185181 | Bacteria | 6844519 |
| 1163 | 2599469052 | 2599185182 | Bacteria | 6883168 |
| 1164 | 2599485677 | 2599185185 | Bacteria | 6652270 |
| 1165 | 2599492619 | 2599185186 | Bacteria | 6831633 |
| 1166 | 2599499983 | 2599185188 | Bacteria | 6164180 |
| 1167 | 2599506546 | 2599185189 | Bacteria | 5862825 |
| 1168 | 2599514264 | 2599185190 | Bacteria | 6285678 |
| 1169 | 2599518864 | 2599185191 | Bacteria | 6297582 |
| 1170 | 2599616711 | 2599185212 | Bacteria | 6765997 |
| 1171 | 2599769539 | 2599185248 | Bacteria | 6696816 |
| 1172 | 2599806807 | 2599185257 | Bacteria | 6492581 |
| 1173 | 2599882959 | 2599185288 | Bacteria | 6666191 |
| 1174 | 2599886960 | 2599185289 | Bacteria | 6778765 |
| 1175 | 2599893402 | 2599185290 | Bacteria | 6289611 |
| 1176 | 2599898289 | 2599185291 | Bacteria | 6775623 |
| 1177 | 2599931021 | 2599185300 | Bacteria | 6062622 |
| 1178 | 2599944599 | 2599185302 | Bacteria | 5954930 |
| 1179 | 2599952411 | 2599185303 | Bacteria | 6512725 |
| 1180 | 2599956058 | 2599185304 | Bacteria | 5951361 |
| 1181 | 2599961217 | 2599185305 | Bacteria | 6748700 |
| 1182 | 2599964676 | 2599185306 | Bacteria | 6637356 |
| 1183 | 2599973079 | 2599185307 | Bacteria | 6194719 |
| 1184 | 2599977392 | 2599185308 | Bacteria | 6621546 |
| 1185 | 2599983175 | 2599185309 | Bacteria | 5969593 |
| 1186 | 2599991108 | 2599185310 | Bacteria | 6014457 |
| 1187 | 2599997761 | 2599185311 | Bacteria | 6354990 |
| 1188 | 2600001020 | 2599185312 | Bacteria | 5912071 |
| 1189 | 2600007055 | 2599185313 | Bacteria | 6658188 |
| 1190 | 2600011561 | 2599185314 | Bacteria | 6621749 |
| 1191 | 2600019207 | 2599185315 | Bacteria | 6771107 |
| 1192 | 2600026417 | 2599185316 | Bacteria | 6320029 |
| 1193 | 2600031991 | 2599185317 | Bacteria | 6435722 |
| 1194 | 2600036839 | 2599185318 | Bacteria | 6961590 |
| 1195 | 2600043265 | 2599185319 | Bacteria | 6637840 |
| 1196 | 2600048179 | 2599185320 | Bacteria | 5963263 |
| 1197 | 2600055785 | 2599185321 | Bacteria | 6764560 |
| 1198 | 2600061184 | 2599185322 | Bacteria | 6763055 |
| 1199 | 2600068428 | 2599185323 | Bacteria | 6688755 |
| 1200 | 2600072464 | 2599185324 | Bacteria | 6590677 |
| 1201 | 2600078420 | 2599185325 | Bacteria | 6324919 |
| 1202 | 2600216229 | 2599185356 | Bacteria | 6843884 |
| 1203 | 2600360270 | 2600254930 | Bacteria | 6431253 |
| 1204 | 2600364763 | 2600254931 | Bacteria | 6734225 |
| 1205 | 2601522708 | 2600255254 | Bacteria | 5281859 |
| 1206 | 2601527735 | 2600255255 | Bacteria | 5282785 |
| 1207 | 2601614566 | 2600255280 | Bacteria | 5292309 |
| 1208 | 2601619286 | 2600255281 | Bacteria | 5288753 |
| 1209 | 2601627064 | 2600255283 | Bacteria | 6061572 |
| 1210 | 2601642114 | 2600255287 | Bacteria | 5210468 |
| 1211 | 2601646956 | 2600255288 | Bacteria | 5282738 |
| 1212 | 2601652713 | 2600255289 | Bacteria | 5281907 |
| 1213 | 2601658039 | 2600255290 | Bacteria | 5282218 |
| 1214 | 2601661936 | 2600255291 | Bacteria | 5217298 |
| 1215 | 2601692465 | 2600255296 | Bacteria | 5784754 |
| 1216 | 2601694894 | 2600255298 | Bacteria | 5215185 |
| 1217 | 2601701857 | 2600255299 | Bacteria | 5218662 |
| 1218 | 2601706560 | 2600255300 | Bacteria | 5287774 |
| 1219 | 2601710864 | 2600255301 | Bacteria | 5280532 |
| 1220 | 2601715878 | 2600255302 | Bacteria | 5288235 |
| 1221 | 2601719921 | 2600255303 | Bacteria | 5219315 |
| 1222 | 2601726284 | 2600255304 | Bacteria | 5283973 |
| 1223 | 2601730825 | 2600255305 | Bacteria | 5282329 |
| 1224 | 2601735840 | 2600255306 | Bacteria | 5281613 |
| 1225 | 2601741106 | 2600255307 | Bacteria | 5439064 |
| 1226 | 2601751037 | 2600255309 | Bacteria | 5431045 |
| 1227 | 2601776396 | 2600255313 | Bacteria | 6842543 |
| 1228 | 2601797964 | 2600255318 | Bacteria | 6383414 |
| 1229 | 2602018290 | 2600255392 | Bacteria | 5437392 |
| 1230 | 2603645150 | 2602042047 | Bacteria | 4697674 |
| 1231 | 2603661616 | 2602042052 | Bacteria | 5215873 |
| 1232 | 2603664571 | 2602042053 | Bacteria | 5214361 |
| 1233 | 2603699022 | 2602042066 | Bacteria | 4423871 |
| 1234 | 2603705055 | 2602042067 | Bacteria | 4863713 |
| 1235 | 2603838218 | 2602042103 | Bacteria | 5284714 |
| 1236 | 2603843296 | 2602042104 | Bacteria | 5281639 |
| 1237 | 2603848369 | 2602042105 | Bacteria | 5282303 |
| 1238 | 2603853442 | 2602042106 | Bacteria | 5282744 |
| 1239 | 2603866949 | 2602042109 | Bacteria | 5152801 |
| 1240 | 2603871496 | 2602042110 | Bacteria | 5283285 |
| 1241 | 2603876402 | 2602042111 | Bacteria | 5212080 |
| 1242 | 2606048687 | 2603880178 | Bacteria | 5283018 |
| 1243 | 2606069003 | 2603880184 | Bacteria | 5217896 |
| 1244 | 2606076553 | 2603880185 | Bacteria | 6379190 |
| 1245 | 2606129033 | 2603880199 | Bacteria | 6377649 |
| 1246 | 2606144800 | 2603880202 | Bacteria | 5284684 |
| 1247 | 2606176089 | 2603880211 | Bacteria | 5284226 |
| 1248 | 2608380745 | 2606217733 | Bacteria | 6360972 |
| 1249 | 2621302062 | 2619619299 | Bacteria | 6649820 |
| 1250 | 2624478347 | 2623620443 | Bacteria | 6427864 |
| 1251 | 2624489898 | 2623620446 | Bacteria | 6500345 |
| 1252 | 2637224589 | 2636415599 | Bacteria | 5718434 |
| 1253 | 2643841114 | 2643221565 | Bacteria | 6216018 |
| 1254 | 2643872504 | 2643221571 | Bacteria | 6228673 |
| 1255 | 2643954777 | 2643221589 | Bacteria | 6250934 |
| 1256 | 2644024417 | 2643221602 | Bacteria | 6249926 |
| 1257 | 2644190110 | 2643221633 | Bacteria | 6733554 |
| 1258 | 2644210608 | 2643221637 | Bacteria | 5345260 |
| 1259 | 2644281391 | 2643221650 | Bacteria | 7029547 |
| 1260 | 2644619764 | 2643221713 | Bacteria | 6554480 |
| 1261 | 2644654142 | 2643221718 | Bacteria | 5345506 |
| 1262 | 2656275917 | 2654587920 | Bacteria | 5475511 |
| 1263 | 2671090671 | 2667528170 | Bacteria | 6786960 |
| 1264 | 2671099844 | 2667528171 | Bacteria | 6900659 |
| 1265 | 2671101496 | 2667528172 | Bacteria | 5170840 |
| 1266 | 2671109888 | 2667528173 | Bacteria | 5375747 |
| 1267 | 2671129211 | 2667528176 | Bacteria | 6724917 |
| 1268 | 2671772459 | 2671180172 | Bacteria | 6495783 |
| 1269 | 2676405917 | 2675903046 | Bacteria | 5451247 |
| 1270 | 2677898842 | 2675903420 | Bacteria | 6247433 |
| 1271 | 2678261122 | 2675903515 | Bacteria | 6580491 |
| 1272 | 2681996530 | 2681812866 | Bacteria | 4552357 |
| 1273 | 2682006056 | 2681812869 | Bacteria | 5014465 |
| 1274 | 2689445970 | 2687453601 | Bacteria | 5546041 |
| 1275 | 2692318073 | 2690316117 | Bacteria | 6800650 |
| 1276 | 2712469490 | 2711768156 | Bacteria | 4471618 |
| 1277 | 2715749341 | 2713897148 | Bacteria | 5883533 |
| 1278 | 2715755607 | 2713897149 | Bacteria | 6506249 |
| 1279 | 2718632289 | 2718217725 | Bacteria | 5758958 |
| 1280 | 2723246678 | 2721755607 | Bacteria | 5841722 |
| 1281 | 2738674201 | 2738541265 | Bacteria | 6594665 |
| 1282 | 2738687465 | 2738541271 | Bacteria | 5657310 |
| 1283 | 2738752594 | 2738541282 | Bacteria | 6593925 |
| 1284 | 2738807783 | 2738541294 | Bacteria | 6925949 |
| 1285 | 2738861635 | 2738541303 | Bacteria | 6591772 |
| 1286 | 2738895143 | 2738541309 | Bacteria | 6926455 |
| 1287 | 2739035149 | 2738541333 | Bacteria | 7106503 |
| 1288 | 2739200585 | 2738543004 | Bacteria | 6381073 |
| 1289 | 2739259937 | 2738543015 | Bacteria | 6750701 |
| 1290 | 2739263086 | 2738543016 | Bacteria | 5657564 |
| 1291 | 2739288618 | 2738543020 | Bacteria | 5718238 |
| 1292 | 2739293930 | 2738543021 | Bacteria | 5718241 |
| 1293 | 2739311415 | 2738543025 | Bacteria | 6600348 |
| 1294 | 2743735195 | 2740892503 | Bacteria | 6855563 |
| 1295 | 2745006433 | 2744054620 | Bacteria | 6551379 |
| 1296 | 2753856607 | 2751185917 | Bacteria | 4551186 |
| 1297 | 2765581725 | 2765235841 | Bacteria | 6137024 |
| 1298 | 2765589626 | 2765235842 | Bacteria | 4799256 |
| 1299 | 2766068902 | 2765235942 | Bacteria | 7445910 |
| 1300 | 2772439836 | 2772190666 | Bacteria | 5117644 |
| 1301 | 2774119426 | 2773857670 | Bacteria | 6407454 |
| 1302 | 2774132440 | 2773857672 | Bacteria | 4993178 |
| 1303 | 2774134863 | 2773857673 | Bacteria | 6513460 |
| 1304 | 2775539624 | 2775506706 | Bacteria | 4873073 |
| 1305 | 2776259455 | 2775506901 | Bacteria | 9631051 |
| 1306 | 2777023005 | 2775507074 | Bacteria | 5532402 |
| 1307 | 2784260917 | 2784132063 | Bacteria | 6262788 |
| 1308 | 2784316365 | 2784132072 | Bacteria | 6596533 |
| 1309 | 2793342724 | 2791355263 | Bacteria | 6872478 |
| 1310 | 2793363402 | 2791355266 | Bacteria | 7116587 |
| 1311 | 2793368744 | 2791355267 | Bacteria | 7222458 |
| 1312 | 2794594157 | 2791355520 | Bacteria | 5948615 |
| 1313 | 2806049601 | 2802429633 | Bacteria | 7341974 |
| 1314 | 2806054587 | 2802429634 | Bacteria | 7083200 |
| 1315 | 2806060595 | 2802429635 | Bacteria | 7650140 |
| 1316 | 2806069485 | 2802429636 | Bacteria | 7597525 |
| 1317 | 2806076880 | 2802429637 | Bacteria | 7067217 |
| 1318 | 2807176812 | 2806310673 | Bacteria | 4801221 |
| 1319 | 2807406353 | 2806310737 | Bacteria | 5751088 |
| 1320 | 2807454706 | 2806310745 | Bacteria | 5742165 |
| 1321 | 2808856217 | 2808606361 | Bacteria | 6136259 |
| 1322 | 2808922615 | 2808606376 | Bacteria | 6248667 |
| 1323 | 2808932673 | 2808606377 | Bacteria | 6646337 |
| 1324 | 2808936277 | 2808606378 | Bacteria | 6177535 |
| 1325 | 2808940151 | 2808606379 | Bacteria | 5022697 |
| 1326 | 2808944302 | 2808606380 | Bacteria | 6248705 |
| 1327 | 2808954794 | 2808606381 | Bacteria | 6646461 |
| 1328 | 2808955997 | 2808606382 | Bacteria | 6841132 |
| 1329 | 2808965614 | 2808606383 | Bacteria | 6138645 |
| 1330 | 2808976532 | 2808606385 | Bacteria | 6711065 |
| 1331 | 2808992030 | 2808606388 | Bacteria | 6706662 |
| 1332 | 2808999610 | 2808606389 | Bacteria | 6138126 |
| 1333 | 2809218103 | 2808606445 | Bacteria | 6057339 |
| 1334 | 2812370340 | 2811994881 | Bacteria | 6298475 |
| 1335 | 2817488530 | 2816332298 | Bacteria | 6852809 |
| 1336 | 2819657357 | 2818991456 | Bacteria | 6123676 |
| 1337 | 2819705340 | 2818991464 | Bacteria | 6907494 |
| 1338 | 2821121689 | 2821118458 | Bacteria | 4714306 |
| 1339 | 2821444159 | 2821443989 | Bacteria | 7658172 |
| 1340 | 2821450076 | 2821443989 | Bacteria | 7658172 |
| 1341 | 2821450762 | 2821443989 | Bacteria | 7658172 |
| 1342 | 2823375348 | 2823373977 | Bacteria | 4779415 |
| 1343 | 2825654138 | 2825651385 | Bacteria | 6715909 |
| 1344 | 2826586245 | 2826581358 | Bacteria | 5963467 |
| 1345 | 2834032097 | 2834028612 | Bacteria | 6354979 |
| 1346 | 2838690500 | 2838686498 | Bacteria | 7807632 |
| 1347 | 2838733143 | 2838729681 | Bacteria | 7400765 |
| 1348 | 2838747268 | 2838742623 | Bacteria | 7396178 |
| 1349 | 2841855421 | 2841851746 | Bacteria | 7532261 |
| 1350 | 2842117007 | 2842110456 | Bacteria | 7656360 |
| 1351 | 2842160872 | 2842156927 | Bacteria | 6894975 |
| 1352 | 2842164401 | 2842163707 | Bacteria | 6916235 |
| 1353 | 2842184488 | 2842180545 | Bacteria | 6888678 |
| 1354 | 2842232071 | 2842229732 | Bacteria | 7475766 |
| 1355 | 2842248527 | 2842243621 | Bacteria | 7421798 |
| 1356 | 2842262665 | 2842257432 | Bacteria | 7401195 |
| 1357 | 2842275186 | 2842271015 | Bacteria | 7807131 |
| 1358 | 2842307378 | 2842304105 | Bacteria | 7023636 |
| 1359 | 2842396969 | 2842395702 | Bacteria | 6780583 |
| 1360 | 2842807139 | 2842805378 | Bacteria | 5385175 |
| 1361 | 2842817879 | 2842815866 | Bacteria | 5947510 |
| 1362 | 2842832217 | 2842826826 | Bacteria | 5974129 |
| 1363 | 2842834293 | 2842832357 | Bacteria | 5959113 |
| 1364 | 2842842892 | 2842837860 | Bacteria | 6066181 |
| 1365 | 2842846230 | 2842843487 | Bacteria | 6004777 |
| 1366 | 2842851825 | 2842849001 | Bacteria | 5924277 |
| 1367 | 2842859969 | 2842854478 | Bacteria | 6143501 |
| 1368 | 2844428059 | 2844425489 | Bacteria | 4854065 |
| 1369 | 2844460156 | 2844454524 | Bacteria | 7952546 |
| 1370 | 2844534015 | 2844533157 | Bacteria | 7517899 |
| 1371 | 2844536641 | 2844533157 | Bacteria | 7517899 |
| 1372 | 2844539481 | 2844533157 | Bacteria | 7517899 |
| 1373 | 2844668021 | 2844665904 | Bacteria | 6817974 |
| 1374 | 2844671157 | 2844665904 | Bacteria | 6817974 |
| 1375 | 2847423419 | 2847417321 | Bacteria | 6913799 |
| 1376 | 2848997099 | 2848992105 | Bacteria | 6810864 |
| 1377 | 2852104104 | 2852103415 | Bacteria | 5193810 |
| 1378 | 2852617202 | 2852612431 | Bacteria | 6885235 |
| 1379 | 2852660324 | 2852657418 | Bacteria | 6472974 |
| 1380 | 2852671809 | 2852667396 | Bacteria | 6885555 |
| 1381 | 2855875134 | 2855872281 | Bacteria | 6964271 |
| 1382 | 2857517729 | 2857516855 | Bacteria | 7787325 |
| 1383 | 2860343513 | 2860339153 | Bacteria | 6846989 |
| 1384 | 2860868560 | 2860867994 | Bacteria | 5645326 |
| 1385 | 2869555308 | 2869551831 | Bacteria | 5474685 |
| 1386 | 2876601808 | 2876601092 | Bacteria | 5114497 |
| 1387 | 2878030296 | 2878029506 | Bacteria | 6418441 |
| 1388 | 2880231240 | 2880230671 | Bacteria | 6140320 |
| 1389 | 2884088267 | 2884086401 | Bacteria | 5005459 |
| 1390 | 2888369952 | 2888366609 | Bacteria | 5155009 |
| 1391 | 2891374531 | 2891373044 | Bacteria | 5202277 |
| 1392 | 2891673925 | 2891670763 | Bacteria | 4967099 |
| 1393 | 2904478251 | 2904474040 | Bacteria | 5504324 |
| 1394 | 2904514478 | 2904513164 | Bacteria | 5476410 |
| 1395 | 2904519697 | 2904518522 | Bacteria | 6068986 |
| 1396 | 2904553929 | 2904550169 | Bacteria | 6221258 |
| 1397 | 2908447151 | 2908446538 | Bacteria | 6829095 |
| 1398 | 2912964301 | 2912963787 | Bacteria | 5646108 |
| 1399 | 2913037412 | 2913036834 | Bacteria | 6704877 |
| 1400 | 2917071298 | 2917070673 | Bacteria | 6868303 |
| 1401 | 2917701228 | 2917699015 | Bacteria | 7043791 |
| 1402 | 2917833957 | 2917832318 | Bacteria | 5346010 |
| 1403 | 2919066023 | 2919063839 | Bacteria | 6302690 |
| 1404 | 2919129969 | 2919125081 | Bacteria | 5385106 |
| 1405 | 2919155499 | 2919150387 | Bacteria | 5500879 |
| 1406 | 2919160020 | 2919155634 | Bacteria | 4860545 |
| 1407 | 2919389640 | 2919385768 | Bacteria | 5897293 |
| 1408 | 2919460112 | 2919456309 | Bacteria | 6586567 |
| 1409 | 2919486556 | 2919481497 | Bacteria | 6907839 |
| 1410 | 2919488568 | 2919487758 | Bacteria | 5929766 |
| 1411 | 2919698824 | 2919697872 | Bacteria | 6553725 |
| 1412 | 2923154191 | 2923153595 | Bacteria | 6870622 |
| 1413 | 2923524428 | 2923519811 | Bacteria | 6298479 |
| 1414 | 2923591646 | 2923586266 | Bacteria | 6565975 |
| 1415 | 2923635514 | 2923634449 | Bacteria | 4753480 |
| 1416 | 2927147909 | 2927143783 | Bacteria | 5504251 |
| 1417 | 2927833511 | 2927833300 | Bacteria | 4923934 |
| 1418 | 2929144944 | 2929144301 | Bacteria | 6622272 |
| 1419 | 2929190416 | 2929189879 | Bacteria | 5930554 |
| 1420 | 2931371719 | 2931369376 | Bacteria | 6847892 |
| 1421 | 2931391500 | 2931390751 | Bacteria | 6273349 |
| 1422 | 2931398970 | 2931396565 | Bacteria | 7251677 |
| 1423 | 2932408895 | 2932406140 | Bacteria | 5134491 |
| 1424 | 2933573966 | 2933570622 | Bacteria | 7023390 |
| 1425 | 2933593243 | 2933586486 | Bacteria | 7667493 |
| 1426 | 2935359126 | 2935353572 | Unclassified | 6955622 |
| 1427 | 2935906138 | 2935901341 | Bacteria | 7341747 |
| 1428 | 2936384492 | 2936381700 | Bacteria | 7006523 |
| 1429 | 2937540689 | 2937539931 | Bacteria | 4639830 |
| 1430 | 2937968478 | 2937967321 | Bacteria | 5094075 |
| 1431 | 2939582027 | 2939577877 | Bacteria | 5132791 |
| 1432 | 2939605790 | 2939602548 | Bacteria | 4950493 |
| 1433 | 2939608981 | 2939607340 | Bacteria | 4719256 |
| 1434 | 2939641232 | 2939636861 | Bacteria | 6297853 |
| 1435 | 2939655908 | 2939651529 | Bacteria | 5895393 |
| 1436 | 2945930038 | 2945928738 | Bacteria | 6053221 |
| 1437 | 2945967714 | 2945961074 | Bacteria | 7342064 |
| 1438 | 2946012387 | 2946006987 | Bacteria | 6705746 |
| 1439 | 2946028761 | 2946027586 | Bacteria | 6049274 |
| 1440 | 2947235293 | 2947233263 | Bacteria | 6439278 |
| 1441 | 2969081632 | 2969079654 | Bacteria | 5439582 |
| 1442 | 2969305088 | 2969304461 | Bacteria | 6601805 |
| 1443 | 2974293217 | 2974289157 | Bacteria | 6080362 |
| 1444 | 2974302854 | 2974298342 | Bacteria | 4840922 |
| 1445 | 2974311443 | 2974310843 | Bacteria | 4947816 |
| 1446 | 2984291867 | 2984286254 | Bacteria | 6702062 |
| 1447 | 2984499561 | 2984499530 | Bacteria | 5020881 |
| 1448 | 2984506002 | 2984504281 | Bacteria | 5262371 |
| 1449 | 2984564046 | 2984559226 | Bacteria | 5683096 |
| 1450 | 2984596779 | 2984595703 | Bacteria | 5682994 |
| 1451 | 2988732335 | 2988728565 | Bacteria | 6124362 |
| 1452 | 2989352467 | 2989349275 | Bacteria | 6349068 |
| 1453 | 2998140598 | 2998139840 | Bacteria | 6073514 |
| 1454 | 3003935922 | 3003930520 | Bacteria | 5667563 |
| 1455 | 3007320172 | 3007315729 | Bacteria | 5076637 |
| 1456 | 3007399746 | 3007395558 | Bacteria | 6755444 |
| 1457 | 3007420135 | 3007419365 | Bacteria | 7026924 |
| 1458 | 3007518044 | 3007511990 | Bacteria | 6481491 |
| 1459 | 3007618294 | 3007614139 | Bacteria | 6053559 |
| 1460 | 3007622271 | 3007619802 | Bacteria | 6411688 |
| 1461 | 3007720391 | 3007718800 | Bacteria | 5971527 |
| 1462 | 3007808889 | 3007803356 | Bacteria | 5931491 |
| 1463 | 3007859825 | 3007855910 | Bacteria | 5637581 |
| 1464 | 3007864195 | 3007861166 | Bacteria | 6045338 |
| 1465 | 3007870832 | 3007866637 | Bacteria | 5899198 |
| 1466 | 3007873258 | 3007872151 | Bacteria | 5268868 |
| 1467 | 637317941 | 637000220 | Bacteria | 7074893 |
| 1468 | 640938745 | 640753048 | Bacteria | 5495657 |
| 1469 | 8002746975 | 8002745576 | Bacteria | 4840272 |
| 1470 | 8004595936 | 8004592986 | Bacteria | 5122074 |
| 1471 | 8005308272 | 8005307578 | Bacteria | 7395396 |
| 1472 | 8005559517 | 8005556819 | Bacteria | 6908598 |
| 1473 | 8005566438 | 8005563573 | Bacteria | 7153261 |
| 1474 | 8005571306 | 8005570704 | Bacteria | 6957481 |
| 1475 | 8005697056 | 8005695170 | Bacteria | 6912330 |
| 1476 | 8011352780 | 8011350971 | Bacteria | 6158957 |
| 1477 | 8015397969 | 8015394850 | Bacteria | 5064660 |
| 1478 | 8015688441 | 8015687852 | Bacteria | 6613826 |
| 1479 | 8016735305 | 8016733728 | Bacteria | 5274317 |
| 1480 | 8018163712 | 8018163183 | Bacteria | 7277977 |
| 1481 | 8018222998 | 8018221730 | Bacteria | 4616064 |
| 1482 | 8018409651 | 8018405270 | Bacteria | 4978981 |
| 1483 | 8019501216 | 8019499862 | Bacteria | 5169538 |
| 1484 | 8019770422 | 8019769354 | Bacteria | 6924660 |
| 1485 | 8019777472 | 8019775933 | Bacteria | 6858656 |
| 1486 | 8023681599 | 8023680758 | Bacteria | 7729763 |
| 1487 | 8030000142 | 8029995093 | Bacteria | 5990776 |
| 1488 | 8052495165 | 8052494512 | Bacteria | 5765634 |
| 1489 | 8054006557 | 8054002106 | Bacteria | 7987183 |
| 1490 | 8054291009 | 8054285046 | Bacteria | 6919322 |
| 1491 | 8054350012 | 8054347763 | Bacteria | 5901107 |
| 1492 | 8054504091 | 8054503363 | Bacteria | 6101651 |
| 1493 | 8054930818 | 8054929484 | Bacteria | 5599761 |
| 1494 | 8055088132 | 8055087960 | Bacteria | 4784273 |
| 1495 | 8055095176 | 8055092621 | Bacteria | 4873875 |
| 1496 | 8055098522 | 8055097453 | Bacteria | 4865496 |
| 1497 | 8055771541 | 8055770955 | Bacteria | 6827675 |
| 1498 | 8055818487 | 8055817908 | Bacteria | 6609162 |
| 1499 | 8055879856 | 8055878733 | Bacteria | 5907058 |
| 1500 | 8056116848 | 8056115690 | Bacteria | 5527654 |
| 1501 | 8056125353 | 8056120720 | Bacteria | 5758328 |
| 1502 | 8056126596 | 8056125926 | Bacteria | 6228218 |
| 1503 | 8056132458 | 8056131705 | Bacteria | 6107031 |
| 1504 | 8056142432 | 8056137416 | Bacteria | 6147080 |
| 1505 | 8056143876 | 8056143049 | Bacteria | 6307666 |
| 1506 | 8056152593 | 8056148874 | Bacteria | 6479865 |
| 1507 | 8056158639 | 8056155041 | Bacteria | 6486948 |
| 1508 | 8056164471 | 8056161164 | Bacteria | 6106669 |
| 1509 | 8056170453 | 8056166840 | Bacteria | 5820959 |
| 1510 | 8056176583 | 8056172158 | Bacteria | 6133900 |
| 1511 | 8056182915 | 8056177738 | Bacteria | 6748268 |
| 1512 | 8056378089 | 8056375014 | Bacteria | 7006639 |
| 1513 | 8056573421 | 8056569372 | Bacteria | 5997322 |
| 1514 | 8057802825 | 8057798959 | Bacteria | 6713499 |
| 1515 | 8057881333 | 8057874678 | Bacteria | 7494653 |
| 1516 | Ga0157371_10000279 | |||
| 1517 | MRS2a_Contig_17 | |||
| 1518 | SwRhRL2b_contig_119184 | |||
| 1519 | SwRhRL2b_contig_1308625 | |||
| 1520 | SwRhRL2b_contig_805411 | |||
| 1521 | SwRhRL2b_contig_979588 | |||
| 1522 | JGI24741J21665_1001405 | |||
| 1523 | JGI25162J39368_1000090 | |||
| 1524 | JGI25162J39368_1000096 | |||
| 1525 | JGI25162J39368_1000291 | |||
| 1526 | JGI25163J39215_1000070 | |||
| 1527 | JGI25163J39215_1000085 | |||
| 1528 | JGI25163J39215_1001614 | |||
| 1529 | JGI25164J39214_1000070 | |||
| 1530 | JGI25164J39214_1000074 | |||
| 1531 | JGI25164J39214_1000218 | |||
| 1532 | JGI25159J45721_1000043 | |||
| 1533 | JGI25159J45721_1012276 | |||
| 1534 | JGI25151J46595_10000071 | |||
| 1535 | JGI25151J46595_10000429 | |||
| 1536 | JGI25151J46595_10003884 | |||
| 1537 | JGI25151J46595_10004422 | |||
| 1538 | JGI25165J46597_1000170 | |||
| 1539 | JGI25165J46597_1000177 | |||
| 1540 | JGI25153J46596_10033024 | |||
| 1541 | rootH2_10068894 | |||
| 1542 | rootL2_10004729 | |||
| 1543 | JGI25160J50197_1000144 | |||
| 1544 | JGI25160J50197_1001782 | |||
| 1545 | JGI25160J50197_1002007 | |||
| 1546 | JGI25160J50197_1019317 | |||
| 1547 | JGI25160J50197_1024053 | |||
| 1548 | JGI25161J50226_1000932 | |||
| 1549 | JGI25161J50226_1001484 | |||
| 1550 | Ga0006562J51391_1007340 | |||
| 1551 | Ga0055538_1000044 | |||
| 1552 | Ga0055538_1000154 | |||
| 1553 | Ga0055539_1000063 | |||
| 1554 | Ga0055539_1000204 | |||
| 1555 | Ga0055533_1000065 | |||
| 1556 | Ga0055533_1000206 | |||
| 1557 | Ga0055532_1000067 | |||
| 1558 | Ga0055525_1000083 | |||
| 1559 | Ga0055525_1000102 | |||
| 1560 | Ga0055525_1000283 | |||
| 1561 | Ga0055535_1004784 | |||
| 1562 | Ga0055526_1000888 | |||
| 1563 | Ga0055524_1004021 | |||
| 1564 | Ga0055536_1000101 | |||
| 1565 | Ga0055536_1028124 | |||
| 1566 | Ga0055536_1028415 | |||
| 1567 | Ga0055528_1002804 | |||
| 1568 | Ga0055530_10000097 | |||
| 1569 | Ga0055530_10000216 | |||
| 1570 | Ga0055530_10001211 | |||
| 1571 | Ga0055540_1000098 | |||
| 1572 | Ga0055540_1000108 | |||
| 1573 | Ga0055540_1000232 | |||
| 1574 | Ga0055540_1000837 | |||
| 1575 | Ga0055531_10000811 | |||
| 1576 | Ga0055541_1000040 | |||
| 1577 | Ga0055541_1000132 | |||
| 1578 | Ga0058692_1000431 | |||
| 1579 | Ga0058692_1000887 | |||
| 1580 | Ga0058692_1001196 | |||
| 1581 | Ga0058692_1006599 | |||
| 1582 | Ga0058692_1009102 | |||
| 1583 | Ga0058692_1018727 | |||
| 1584 | Ga0058692_1019180 | |||
| 1585 | Ga0055543_1000806 | |||
| 1586 | Ga0055543_1000841 | |||
| 1587 | Ga0065165_1000461 | |||
| 1588 | Ga0065165_1013706 | |||
| 1589 | Ga0065714_10000570 | |||
| 1590 | Ga0065714_10002375 | |||
| 1591 | Ga0065714_10002602 | |||
| 1592 | Ga0065714_10003143 | |||
| 1593 | Ga0065714_10064479 | |||
| 1594 | Ga0065714_10064792 | |||
| 1595 | Ga0065714_10097683 | |||
| 1596 | Ga0065714_10104879 | |||
| 1597 | Ga0065714_10108528 | |||
| 1598 | Ga0065704_10000441 | |||
| 1599 | Ga0065704_10000981 | |||
| 1600 | Ga0065704_10002804 | |||
| 1601 | Ga0065704_10074928 | |||
| 1602 | Ga0065704_10076308 | |||
| 1603 | Ga0065704_10079284 | |||
| 1604 | Ga0065704_10085700 | |||
| 1605 | Ga0065704_10093930 | |||
| 1606 | Ga0065704_10095309 | |||
| 1607 | Ga0065712_10068313 | |||
| 1608 | Ga0065712_10079953 | |||
| 1609 | Ga0065715_10095933 | |||
| 1610 | Ga0070670_100283255 | |||
| 1611 | Ga0070660_100246220 | |||
| 1612 | Ga0070661_100004923 | |||
| 1613 | Ga0070669_100000313 | |||
| 1614 | Ga0070669_100000691 | |||
| 1615 | Ga0070659_100305183 | |||
| 1616 | Ga0070662_100003761 | |||
| 1617 | Ga0070662_100017614 | |||
| 1618 | Ga0070681_10004942 | |||
| 1619 | Ga0070679_100111266 | |||
| 1620 | Ga0068853_100002022 | |||
| 1621 | Ga0068853_100143573 | |||
| 1622 | Ga0068853_100207216 | |||
| 1623 | Ga0070665_100000191 | |||
| 1624 | Ga0070665_100048327 | |||
| 1625 | Ga0070665_100430501 | |||
| 1626 | Ga0070664_100000062 | |||
| 1627 | Ga0068857_100002061 | |||
| 1628 | Ga0068854_100104014 | |||
| 1629 | Ga0068851_10000004 | |||
| 1630 | Ga0081455_10234412 | |||
| 1631 | Ga0081540_1022308 | |||
| 1632 | Ga0075364_10025240 | |||
| 1633 | Ga0075364_10045215 | |||
| 1634 | Ga0075364_10063409 | |||
| 1635 | Ga0075364_10174293 | |||
| 1636 | Ga0075432_10000430 | |||
| 1637 | Ga0075432_10001440 | |||
| 1638 | Ga0075362_10007447 | |||
| 1639 | Ga0075369_10062893 | |||
| 1640 | Ga0075369_10083316 | |||
| 1641 | Ga0075366_10026091 | |||
| 1642 | Ga0075366_10034230 | |||
| 1643 | Ga0075370_10013321 | |||
| 1644 | Ga0075430_100235086 | |||
| 1645 | Ga0099823_1030284 | |||
| 1646 | Ga0099823_1048943 | |||
| 1647 | Ga0079104_1000164 | |||
| 1648 | Ga0079104_1000670 | |||
| 1649 | Ga0079104_1000973 | |||
| 1650 | Ga0079104_1001028 | |||
| 1651 | Ga0079104_1001053 | |||
| 1652 | Ga0079104_1001133 | |||
| 1653 | Ga0079104_1001349 | |||
| 1654 | Ga0079104_1016164 | |||
| 1655 | Ga0099826_10001603 | |||
| 1656 | Ga0105251_10000145 | |||
| 1657 | Ga0105251_10000320 | |||
| 1658 | Ga0105251_10000478 | |||
| 1659 | Ga0105251_10002029 | |||
| 1660 | Ga0105251_10003572 | |||
| 1661 | Ga0105251_10004352 | |||
| 1662 | Ga0105251_10005036 | |||
| 1663 | Ga0105251_10008082 | |||
| 1664 | Ga0105251_10014644 | |||
| 1665 | Ga0105251_10043066 | |||
| 1666 | Ga0105251_10050745 | |||
| 1667 | Ga0105251_10055935 | |||
| 1668 | Ga0105251_10058903 | |||
| 1669 | Ga0105251_10074721 | |||
| 1670 | Ga0105244_10000020 | |||
| 1671 | Ga0105244_10000908 | |||
| 1672 | Ga0105244_10001258 | |||
| 1673 | Ga0105244_10001405 | |||
| 1674 | Ga0105244_10001929 | |||
| 1675 | Ga0105244_10004386 | |||
| 1676 | Ga0105244_10004738 | |||
| 1677 | Ga0105244_10004882 | |||
| 1678 | Ga0105244_10007999 | |||
| 1679 | Ga0105244_10008927 | |||
| 1680 | Ga0105244_10010746 | |||
| 1681 | Ga0105244_10017190 | |||
| 1682 | Ga0105244_10025469 | |||
| 1683 | Ga0105244_10038102 | |||
| 1684 | Ga0105244_10043407 | |||
| 1685 | Ga0105244_10058077 | |||
| 1686 | Ga0105244_10079343 | |||
| 1687 | Ga0105244_10083581 | |||
| 1688 | Ga0105244_10106143 | |||
| 1689 | Ga0105250_10000009 | |||
| 1690 | Ga0105250_10000125 | |||
| 1691 | Ga0105250_10000467 | |||
| 1692 | Ga0105250_10000502 | |||
| 1693 | Ga0105250_10000907 | |||
| 1694 | Ga0105250_10002154 | |||
| 1695 | Ga0105250_10002468 | |||
| 1696 | Ga0105250_10003819 | |||
| 1697 | Ga0105250_10014681 | |||
| 1698 | Ga0105250_10017420 | |||
| 1699 | Ga0105250_10017507 | |||
| 1700 | Ga0105250_10022270 | |||
| 1701 | Ga0105250_10052245 | |||
| 1702 | Ga0105247_10000030 | |||
| 1703 | Ga0105243_10000100 | |||
| 1704 | Ga0105243_10000639 | |||
| 1705 | Ga0105243_10001648 | |||
| 1706 | Ga0105243_10009069 | |||
| 1707 | Ga0105243_10009900 | |||
| 1708 | Ga0105243_10040568 | |||
| 1709 | Ga0105241_10000001 | |||
| 1710 | Ga0105242_10000478 | |||
| 1711 | Ga0105242_10238641 | |||
| 1712 | Ga0105237_10002559 | |||
| 1713 | Ga0105033_101306 | |||
| 1714 | Ga0105246_10000237 | |||
| 1715 | Ga0105246_10014181 | |||
| 1716 | Ga0105246_10015549 | |||
| 1717 | Ga0105246_10056920 | |||
| 1718 | Ga0105246_10092795 | |||
| 1719 | Ga0157373_10000373 | |||
| 1720 | Ga0157373_10001594 | |||
| 1721 | Ga0157373_10002803 | |||
| 1722 | Ga0157373_10019659 | |||
| 1723 | Ga0157373_10041384 | |||
| 1724 | Ga0157373_10128200 | |||
| 1725 | Ga0157373_10209767 | |||
| 1726 | Ga0157371_10000099 | |||
| 1727 | Ga0157371_10003408 | |||
| 1728 | Ga0157371_10004573 | |||
| 1729 | Ga0157371_10011814 | |||
| 1730 | Ga0157371_10015149 | |||
| 1731 | Ga0157371_10021793 | |||
| 1732 | Ga0157371_10033428 | |||
| 1733 | Ga0157370_10000150 | |||
| 1734 | Ga0157370_10001912 | |||
| 1735 | Ga0157370_10026170 | |||
| 1736 | Ga0157370_10060869 | |||
| 1737 | Ga0157370_10095300 | |||
| 1738 | Ga0157370_10251262 | |||
| 1739 | Ga0157370_10297229 | |||
| 1740 | Ga0157369_10011869 | |||
| 1741 | Ga0157369_10043532 | |||
| 1742 | Ga0157369_10307169 | |||
| 1743 | Ga0171462_1042 | |||
| 1744 | Ga0163162_10335420 | |||
| 1745 | Ga0157372_10004722 | |||
| 1746 | Ga0157372_10010613 | |||
| 1747 | Ga0157372_10126252 | |||
| 1748 | Ga0157372_10401376 | |||
| 1749 | Ga0157375_10038552 | |||
| 1750 | Ga0157380_10011062 | |||
| 1751 | Ga0182008_10001110 | |||
| 1752 | Ga0182008_10001450 | |||
| 1753 | Ga0182008_10013093 | |||
| 1754 | Ga0182008_10022989 | |||
| 1755 | Ga0182008_10091633 | |||
| 1756 | Ga0182008_10099374 | |||
| 1757 | Ga0182006_1000018 | |||
| 1758 | Ga0182006_1003209 | |||
| 1759 | Ga0182006_1006488 | |||
| 1760 | Ga0182006_1008810 | |||
| 1761 | Ga0182006_1018838 | |||
| 1762 | Ga0182007_10043059 | |||
| 1763 | Ga0182005_1000422 | |||
| 1764 | Ga0182005_1030897 | |||
| 1765 | Ga0183366_1001 | |||
| 1766 | Ga0183370_1001 | |||
| 1767 | Ga0183369_1001 | |||
| 1768 | Ga0183368_1001 | |||
| 1769 | Ga0163161_10000031 | |||
| 1770 | Ga0163161_10176355 | |||
| 1771 | Ga0163161_10205761 | |||
| 1772 | Ga0163161_10212350 | |||
| 1773 | Ga0163161_10216470 | |||
| 1774 | Ga0163161_10327356 | |||
| 1775 | Ga0163161_10338463 | |||
| 1776 | Ga0209435_101162 | |||
| 1777 | Ga0209760_100031 | |||
| 1778 | Ga0209760_100056 | |||
| 1779 | Ga0209760_100137 | |||
| 1780 | Ga0209760_100139 | |||
| 1781 | Ga0209436_100580 | |||
| 1782 | Ga0209784_100001 | |||
| 1783 | Ga0209784_100028 | |||
| 1784 | Ga0209566_100001 | |||
| 1785 | Ga0209566_100028 | |||
| 1786 | Ga0209674_100002 | |||
| 1787 | Ga0209674_100047 | |||
| 1788 | Ga0209147_100031 | |||
| 1789 | Ga0209563_100008 | |||
| 1790 | Ga0209563_100050 | |||
| 1791 | Ga0209563_102472 | |||
| 1792 | Ga0207427_100016 | |||
| 1793 | Ga0207427_100067 | |||
| 1794 | Ga0207427_100231 | |||
| 1795 | Ga0209437_100007 | |||
| 1796 | Ga0209437_100011 | |||
| 1797 | Ga0209437_100016 | |||
| 1798 | Ga0209437_104358 | |||
| 1799 | Ga0209258_100170 | |||
| 1800 | Ga0209646_1000357 | |||
| 1801 | Ga0209677_100004 | |||
| 1802 | Ga0209677_100029 | |||
| 1803 | Ga0209759_1005835 | |||
| 1804 | Ga0209129_1001115 | |||
| 1805 | Ga0209233_1000019 | |||
| 1806 | Ga0209233_1000156 | |||
| 1807 | Ga0209673_1000206 | |||
| 1808 | Ga0209673_1002157 | |||
| 1809 | Ga0209673_1009790 | |||
| 1810 | Ga0209130_1000274 | |||
| 1811 | Ga0209130_1000325 | |||
| 1812 | Ga0209130_1000461 | |||
| 1813 | Ga0209130_1000870 | |||
| 1814 | Ga0209675_1002688 | |||
| 1815 | Ga0209676_1000025 | |||
| 1816 | Ga0209676_1000096 | |||
| 1817 | Ga0209676_1000266 | |||
| 1818 | Ga0209676_1000722 | |||
| 1819 | Ga0209676_1009457 | |||
| 1820 | Ga0209676_1009480 | |||
| 1821 | Ga0209025_1000053 | |||
| 1822 | Ga0209025_1000062 | |||
| 1823 | Ga0209025_1000190 | |||
| 1824 | Ga0209025_1000261 | |||
| 1825 | Ga0209025_1000282 | |||
| 1826 | Ga0209564_1000987 | |||
| 1827 | Ga0209758_1000245 | |||
| 1828 | Ga0209758_1001726 | |||
| 1829 | Ga0209758_1004259 | |||
| 1830 | Ga0209758_1007665 | |||
| 1831 | Ga0209758_1011622 | |||
| 1832 | Ga0209050_1000028 | |||
| 1833 | Ga0209050_1000301 | |||
| 1834 | Ga0209050_1000356 | |||
| 1835 | Ga0209050_1001464 | |||
| 1836 | Ga0209050_1003956 | |||
| 1837 | Ga0209256_1003166 | |||
| 1838 | Ga0207426_1000066 | |||
| 1839 | Ga0207426_1000109 | |||
| 1840 | Ga0207426_1000460 | |||
| 1841 | Ga0207426_1000474 | |||
| 1842 | Ga0207426_1000545 | |||
| 1843 | Ga0209051_1000089 | |||
| 1844 | Ga0209051_1000225 | |||
| 1845 | Ga0209051_1000264 | |||
| 1846 | Ga0209051_1000467 | |||
| 1847 | Ga0209051_1008473 | |||
| 1848 | Ga0209051_1009287 | |||
| 1849 | Ga0209257_1000034 | |||
| 1850 | Ga0209257_1002752 | |||
| 1851 | Ga0209257_1003051 | |||
| 1852 | Ga0207656_10000007 | |||
| 1853 | Ga0207696_1000001 | |||
| 1854 | Ga0207696_1000005 | |||
| 1855 | Ga0207696_1000058 | |||
| 1856 | Ga0207696_1000065 | |||
| 1857 | Ga0207696_1000085 | |||
| 1858 | Ga0207696_1000122 | |||
| 1859 | Ga0207696_1000561 | |||
| 1860 | Ga0207696_1000629 | |||
| 1861 | Ga0207696_1002299 | |||
| 1862 | Ga0207696_1003450 | |||
| 1863 | Ga0207696_1006288 | |||
| 1864 | Ga0207696_1009217 | |||
| 1865 | Ga0207696_1009548 | |||
| 1866 | Ga0207696_1010164 | |||
| 1867 | Ga0207655_1000002 | |||
| 1868 | Ga0207655_1000004 | |||
| 1869 | Ga0207655_1000014 | |||
| 1870 | Ga0207655_1000041 | |||
| 1871 | Ga0207655_1000227 | |||
| 1872 | Ga0207655_1000394 | |||
| 1873 | Ga0207655_1000443 | |||
| 1874 | Ga0207655_1000678 | |||
| 1875 | Ga0207655_1003228 | |||
| 1876 | Ga0207655_1004333 | |||
| 1877 | Ga0207655_1004334 | |||
| 1878 | Ga0207655_1004908 | |||
| 1879 | Ga0207655_1005999 | |||
| 1880 | Ga0207655_1012607 | |||
| 1881 | Ga0207655_1013326 | |||
| 1882 | Ga0207655_1024328 | |||
| 1883 | Ga0207655_1026304 | |||
| 1884 | Ga0207655_1028526 | |||
| 1885 | Ga0207655_1028656 | |||
| 1886 | Ga0207655_1046564 | |||
| 1887 | Ga0207655_1066948 | |||
| 1888 | Ga0207713_1000002 | |||
| 1889 | Ga0207713_1000004 | |||
| 1890 | Ga0207713_1000018 | |||
| 1891 | Ga0207713_1000022 | |||
| 1892 | Ga0207713_1000067 | |||
| 1893 | Ga0207713_1000094 | |||
| 1894 | Ga0207713_1000964 | |||
| 1895 | Ga0207713_1001330 | |||
| 1896 | Ga0207713_1004153 | |||
| 1897 | Ga0207713_1007041 | |||
| 1898 | Ga0207713_1008064 | |||
| 1899 | Ga0207713_1008210 | |||
| 1900 | Ga0207713_1011692 | |||
| 1901 | Ga0207713_1013070 | |||
| 1902 | Ga0207713_1016008 | |||
| 1903 | Ga0207713_1019652 | |||
| 1904 | Ga0207713_1020173 | |||
| 1905 | Ga0207713_1020309 | |||
| 1906 | Ga0207713_1022531 | |||
| 1907 | Ga0207713_1037981 | |||
| 1908 | Ga0207713_1039478 | |||
| 1909 | Ga0207710_10000068 | |||
| 1910 | Ga0207654_10000004 | |||
| 1911 | Ga0207707_10003784 | |||
| 1912 | Ga0207671_10000015 | |||
| 1913 | Ga0207649_10000001 | |||
| 1914 | Ga0207652_10163162 | |||
| 1915 | Ga0207646_10249818 | |||
| 1916 | Ga0207681_10000115 | |||
| 1917 | Ga0207681_10000917 | |||
| 1918 | Ga0207650_10005199 | |||
| 1919 | Ga0207650_10005751 | |||
| 1920 | Ga0207706_10002419 | |||
| 1921 | Ga0207706_10006144 | |||
| 1922 | Ga0207686_10000588 | |||
| 1923 | Ga0207709_10000022 | |||
| 1924 | Ga0207709_10000252 | |||
| 1925 | Ga0207709_10005827 | |||
| 1926 | Ga0207709_10014232 | |||
| 1927 | Ga0207709_10276151 | |||
| 1928 | Ga0207679_10000011 | |||
| 1929 | Ga0207639_10002699 | |||
| 1930 | Ga0207639_10061278 | |||
| 1931 | Ga0207639_10128523 | |||
| 1932 | Ga0207708_10337085 | |||
| 1933 | Ga0207674_10004718 | |||
| 1934 | Ga0209281_1000006 | |||
| 1935 | Ga0209281_1000033 | |||
| 1936 | Ga0209281_1000038 | |||
| 1937 | Ga0209281_1000071 | |||
| 1938 | Ga0209281_1000109 | |||
| 1939 | Ga0209281_1000159 | |||
| 1940 | Ga0209281_1000257 | |||
| 1941 | Ga0209281_1001006 | |||
| 1942 | Ga0209281_1002968 | |||
| 1943 | Ga0209389_1000298 | |||
| 1944 | Ga0209371_1000001 | |||
| 1945 | Ga0209371_1000005 | |||
| 1946 | Ga0209371_1000089 | |||
| 1947 | Ga0209371_1000153 | |||
| 1948 | Ga0209371_1000496 | |||
| 1949 | Ga0209371_1001032 | |||
| 1950 | Ga0209371_1002187 | |||
| 1951 | Ga0209371_1002726 | |||
| 1952 | Ga0209371_1003926 | |||
| 1953 | Ga0209371_1023281 | |||
| 1954 | Ga0209282_1043159 | |||
| 1955 | Ga0207428_10010914 | |||
| 1956 | Ga0207428_10047509 | |||
| 1957 | Ga0268266_10001011 | |||
| 1958 | Ga0268266_10008268 | |||
| 1959 | Ga0268256_1000001 | |||
| 1960 | Ga0268256_1000006 | |||
| 1961 | Ga0268256_1000103 | |||
| 1962 | Ga0268256_1001232 | |||
| 1963 | Ga0268256_1001701 | |||
| 1964 | Ga0268256_1001923 | |||
| 1965 | Ga0268256_1002152 | |||
| 1966 | Ga0268256_1002425 | |||
| 1967 | Ga0268256_1003645 | |||
| 1968 | Ga0268256_1026373 | |||
| 1969 | Ga0316178_1009271 | |||
| 1970 | Ga0316181_1270085 | |||
| 1971 | Ga0316181_1279945 | |||
| 1972 | Ga0265327_10058290 | |||
| 1973 | Ga0307408_100034206 | |||
| 1974 | Ga0307408_100299887 | |||
| 1975 | Ga0307516_10217623 | |||
| 1976 | Ga0307405_10173132 | |||
| 1977 | Ga0307409_100245063 | |||
| 1978 | Ga0307411_10200626 | |||
| 1979 | Ga0307510_10026777 | |||
| 1980 | Ga0307510_10173174 | |||
| 1981 | Ga0237819_00859 | |||
| 1982 | Ga0436360_1287249 | |||
| 1983 | Ga0436361_0524714 | |||
| 1984 | Ga0439436_0002120 | |||
| 1985 | Ga0439438_000498 | |||
| 1986 | Ga0439438_001218 | |||
| 1987 | Ga0439438_001498 | |||
| 1988 | Ga0439438_001594 | |||
| 1989 | Ga0439438_003029 | |||
| 1990 | Ga0439438_004069 | |||
| 1991 | Ga0439438_004895 | |||
| 1992 | Ga0439447_000310 | |||
| 1993 | Ga0439447_000501 | |||
| 1994 | Ga0439447_012552 | |||
| 1995 | Ga0439447_013724 | |||
| 1996 | Ga0439447_025060 | |||
| 1997 | Ga0439466_0000334 | |||
| 1998 | Ga0439466_0000620 | |||
| 1999 | Ga0439466_0000665 | |||
| 2000 | Ga0439466_0001745 | |||
| 2001 | Ga0439466_0004892 | |||
| 2002 | Ga0439466_0010143 | |||
| 2003 | Ga0439466_0021445 | |||
| 2004 | Ga0439466_0029369 | |||
| 2005 | Ga0439465_0000550 | |||
| 2006 | Ga0439465_0028570 | |||
| 2007 | Ga0451853_1126616 | |||
| 2008 | Ga0451853_2641771 | |||
| 2009 | Ga0439431_0002829 | |||
| 2010 | Ga0439431_0027821 | |||
| 2011 | Ga0439445_0009126 | |||
| 2012 | Ga0439445_0031278 | |||
| 2013 | Ga0439432_001900 | |||
| 2014 | Ga0439432_002858 | |||
| 2015 | Ga0439432_005967 | |||
| 2016 | Ga0439432_008787 | |||
| 2017 | Ga0439432_049980 | |||
| 2018 | Ga0439449_0019279 | |||
| 2019 | Ga0439451_004666 | |||
| 2020 | Ga0439452_000002 | |||
| 2021 | Ga0439452_000101 | |||
| 2022 | Ga0439452_000628 | |||
| 2023 | Ga0439452_000662 | |||
| 2024 | Ga0439452_002594 | |||
| 2025 | Ga0439452_004284 | |||
| 2026 | Ga0439452_006204 | |||
| 2027 | Ga0439452_017215 | |||
| 2028 | Ga0439452_021422 | |||
| 2029 | Ga0439452_026388 | |||
| 2030 | Ga0439456_002941 | |||
| 2031 | Ga0439456_007129 | |||
| 2032 | Ga0439463_000574 | |||
| 2033 | Ga0439463_002244 | |||
| 2034 | Ga0439463_002774 | |||
| 2035 | Ga0439463_004470 | |||
| 2036 | Ga0450911_002519 | |||
| 2037 | Ga0450919_003687 | |||
| 2038 | Ga0450922_002044 | |||
| 2039 | Ga0450890_001172 | |||
| 2040 | Ga0450902_000023 | |||
| 2041 | Ga0450903_001230 | |||
| 2042 | Ga0450903_002557 | |||
| 2043 | Ga0450906_001654 | |||
| 2044 | Ga0450907_000201 | |||
| 2045 | Ga0450907_001929 | |||
| 2046 | Ga0450907_002149 | |||
| 2047 | Ga0450910_004385 | |||
| 2048 | Ga0439446_0001401 | |||
| 2049 | Ga0439446_0005590 | |||
| 2050 | Ga0439446_0007826 | |||
| 2051 | Ga0450908_002206 | |||
| 2052 | Ga0450909_000517 | |||
| 2053 | Ga0439434_0002623 | |||
| 2054 | Ga0439434_0023103 | |||
| 2055 | Ga0439464_0004184 | |||
| 2056 | Ga0439464_0023444 | |||
| 2057 | Ga0439460_0000611 | |||
| 2058 | Ga0439460_0002720 | |||
| 2059 | Ga0451577_0018662 | |||
| 2060 | Ga0466981_0000008 | |||
| 2061 | Ga0453684_0002280 | |||
| 2062 | Ga0466959_0085344 | |||
| 2063 | Ga0495617_002486 | |||
| 2064 | Ga0495617_037767 | |||
| 2065 | Ga0495627_000019 | |||
| 2066 | Ga0495627_000117 | |||
| 2067 | Ga0495627_000551 | |||
| 2068 | Ga0495627_004205 | |||
| 2069 | Ga0495627_006324 | |||
| 2070 | Ga0495627_031662 | |||
| 2071 | Ga0495603_0003088 | |||
| 2072 | Ga0495603_0139336 | |||
| 2073 | Ga0495590_0000657 | |||
| 2074 | Ga0495590_0012603 | |||
| 2075 | Ga0495590_0016167 | |||
| 2076 | Ga0495591_000057 | |||
| 2077 | Ga0495591_000059 | |||
| 2078 | Ga0495591_000619 | |||
| 2079 | Ga0495591_001018 | |||
| 2080 | Ga0495591_002042 | |||
| 2081 | Ga0495591_002860 | |||
| 2082 | Ga0495591_005213 | |||
| 2083 | Ga0495591_007937 | |||
| 2084 | Ga0495591_023061 | |||
| 2085 | Ga0495591_029879 | |||
| 2086 | Ga0495629_0023997 | |||
| 2087 | Ga0495638_0001624 | |||
| 2088 | Ga0495638_0020882 | |||
| 2089 | Ga0495638_0032284 | |||
| 2090 | Ga0495638_0126224 | |||
| 2091 | Ga0495638_0126805 | |||
| 2092 | Ga0495653_0010480 | |||
| 2093 | Ga0495653_0083924 | |||
| 2094 | Ga0495653_0120013 | |||
| 2095 | Ga0495653_0203599 | |||
| 2096 | Ga0495650_0000031 | |||
| 2097 | Ga0495650_0000090 | |||
| 2098 | Ga0495650_0000493 | |||
| 2099 | Ga0495650_0001674 | |||
| 2100 | Ga0495650_0002040 | |||
| 2101 | Ga0495650_0005457 | |||
| 2102 | Ga0495650_0007113 | |||
| 2103 | Ga0495650_0010884 | |||
| 2104 | Ga0495650_0018034 | |||
| 2105 | Ga0495605_0000093 | |||
| 2106 | Ga0495605_0000106 | |||
| 2107 | Ga0495605_0000398 | |||
| 2108 | Ga0495605_0000623 | |||
| 2109 | Ga0495605_0000674 | |||
| 2110 | Ga0495605_0002177 | |||
| 2111 | Ga0495605_0002729 | |||
| 2112 | Ga0495605_0004162 | |||
| 2113 | Ga0495605_0004990 | |||
| 2114 | Ga0495605_0015840 | |||
| 2115 | Ga0495605_0024658 | |||
| 2116 | Ga0495605_0089390 | |||
| 2117 | Ga0495639_0001663 | |||
| 2118 | Ga0495639_0003693 | |||
| 2119 | Ga0495584_0000056 | |||
| 2120 | Ga0495584_0000721 | |||
| 2121 | Ga0495584_0003343 | |||
| 2122 | Ga0495584_0008479 | |||
| 2123 | Ga0495584_0008776 | |||
| 2124 | Ga0495584_0008890 | |||
| 2125 | Ga0495584_0011447 | |||
| 2126 | Ga0495584_0015653 | |||
| 2127 | Ga0495585_0001600 | |||
| 2128 | Ga0495585_0052856 | |||
| 2129 | Ga0495585_0052945 | |||
| 2130 | Ga0495585_0092853 | |||
| 2131 | Ga0495585_0099000 | |||
| 2132 | Ga0495585_0106755 | |||
| 2133 | Ga0495594_0001925 | |||
| 2134 | Ga0495594_0025819 | |||
| 2135 | Ga0495596_0000810 | |||
| 2136 | Ga0495596_0014963 | |||
| 2137 | Ga0495596_0043369 | |||
| 2138 | Ga0495596_0084890 | |||
| 2139 | Ga0495607_0000425 | |||
| 2140 | Ga0495607_0000443 | |||
| 2141 | Ga0495607_0000564 | |||
| 2142 | Ga0495607_0001753 | |||
| 2143 | Ga0495607_0002121 | |||
| 2144 | Ga0495607_0005450 | |||
| 2145 | Ga0495607_0006483 | |||
| 2146 | Ga0495607_0017113 | |||
| 2147 | Ga0495607_0024819 | |||
| 2148 | Ga0495607_0025613 | |||
| 2149 | Ga0495607_0037333 | |||
| 2150 | Ga0495607_0037970 | |||
| 2151 | Ga0495607_0063508 | |||
| 2152 | Ga0495607_0087000 | |||
| 2153 | Ga0495607_0091210 | |||
| 2154 | Ga0495607_0160091 | |||
| 2155 | Ga0495583_0000105 | |||
| 2156 | Ga0495583_0000327 | |||
| 2157 | Ga0495583_0000610 | |||
| 2158 | Ga0495583_0000663 | |||
| 2159 | Ga0495583_0001084 | |||
| 2160 | Ga0495583_0003160 | |||
| 2161 | Ga0495583_0005897 | |||
| 2162 | Ga0495583_0011350 | |||
| 2163 | Ga0495583_0061864 | |||
| 2164 | Ga0495583_0082047 | |||
| 2165 | Ga0495606_0000384 | |||
| 2166 | Ga0495606_0000568 | |||
| 2167 | Ga0495606_0000613 | |||
| 2168 | Ga0495606_0001546 | |||
| 2169 | Ga0495606_0009470 | |||
| 2170 | Ga0495606_0009914 | |||
| 2171 | Ga0495606_0017681 | |||
| 2172 | Ga0495606_0018554 | |||
| 2173 | Ga0495606_0021496 | |||
| 2174 | Ga0495606_0032264 | |||
| 2175 | Ga0495606_0115019 | |||
| 2176 | Ga0495606_0132736 | |||
| 2177 | Ga0495606_0136279 | |||
| 2178 | Ga0495606_0175549 | |||
| 2179 | Ga0495610_0001910 | |||
| 2180 | Ga0495610_0007780 | |||
| 2181 | Ga0495610_0010267 | |||
| 2182 | Ga0495610_0017120 | |||
| 2183 | Ga0495610_0021472 | |||
| 2184 | Ga0495610_0032164 | |||
| 2185 | Ga0495610_0036793 | |||
| 2186 | Ga0495610_0052983 | |||
| 2187 | Ga0495610_0069315 | |||
| 2188 | Ga0495616_0013437 | |||
| 2189 | Ga0495616_0034408 | |||
| 2190 | Ga0495616_0071217 | |||
| 2191 | Ga0495616_0076326 | |||
| 2192 | Ga0495616_0078233 | |||
| 2193 | Ga0495616_0083980 | |||
| 2194 | Ga0495616_0098549 | |||
| 2195 | Ga0495620_0000071 | |||
| 2196 | Ga0495620_0000353 | |||
| 2197 | Ga0495620_0001683 | |||
| 2198 | Ga0495620_0004814 | |||
| 2199 | Ga0495620_0009341 | |||
| 2200 | Ga0495620_0023714 | |||
| 2201 | Ga0495620_0034588 | |||
| 2202 | Ga0495620_0037060 | |||
| 2203 | Ga0495620_0056079 | |||
| 2204 | Ga0495630_0019223 | |||
| 2205 | Ga0495631_0000110 | |||
| 2206 | Ga0495631_0025731 | |||
| 2207 | Ga0495631_0036702 | |||
| 2208 | Ga0495632_0000265 | |||
| 2209 | Ga0495632_0001736 | |||
| 2210 | Ga0495632_0006622 | |||
| 2211 | Ga0495632_0007347 | |||
| 2212 | Ga0495632_0009322 | |||
| 2213 | Ga0495632_0011651 | |||
| 2214 | Ga0495632_0017874 | |||
| 2215 | Ga0495632_0033367 | |||
| 2216 | Ga0495632_0077817 | |||
| 2217 | Ga0495632_0102475 | |||
| 2218 | Ga0495632_0109835 | |||
| 2219 | Ga0495637_0000216 | |||
| 2220 | Ga0495637_0000488 | |||
| 2221 | Ga0495637_0000687 | |||
| 2222 | Ga0495637_0001900 | |||
| 2223 | Ga0495637_0009397 | |||
| 2224 | Ga0495637_0009448 | |||
| 2225 | Ga0495637_0013767 | |||
| 2226 | Ga0495637_0016618 | |||
| 2227 | Ga0495637_0050010 | |||
| 2228 | Ga0495637_0065583 | |||
| 2229 | Ga0495643_0000585 | |||
| 2230 | Ga0495643_0002726 | |||
| 2231 | Ga0495643_0007542 | |||
| 2232 | Ga0495643_0009165 | |||
| 2233 | Ga0495643_0014200 | |||
| 2234 | Ga0495643_0032002 | |||
| 2235 | Ga0495644_0001299 | |||
| 2236 | Ga0495644_0001407 | |||
| 2237 | Ga0495644_0005713 | |||
| 2238 | Ga0495644_0023353 | |||
| 2239 | Ga0495648_0001916 | |||
| 2240 | Ga0495648_0003690 | |||
| 2241 | Ga0495648_0004560 | |||
| 2242 | Ga0495648_0006334 | |||
| 2243 | Ga0495648_0007582 | |||
| 2244 | Ga0495648_0008853 | |||
| 2245 | Ga0495648_0045693 | |||
| 2246 | Ga0495648_0076196 | |||
| 2247 | Ga0495648_0095426 | |||
| 2248 | Ga0495648_0096643 | |||
| 2249 | Ga0495648_0097987 | |||
| 2250 | Ga0495648_0098006 | |||
| 2251 | Ga0495666_0111942 | |||
| 2252 | Ga0495642_0000361 | |||
| 2253 | Ga0495642_0003199 | |||
| 2254 | Ga0495642_0059416 | |||
| 2255 | Ga0495654_0000098 | |||
| 2256 | Ga0495654_0000818 | |||
| 2257 | Ga0495654_0000955 | |||
| 2258 | Ga0495654_0002993 | |||
| 2259 | Ga0495654_0004622 | |||
| 2260 | Ga0495654_0005237 | |||
| 2261 | Ga0495654_0011053 | |||
| 2262 | Ga0495654_0011442 | |||
| 2263 | Ga0495654_0012057 | |||
| 2264 | Ga0495654_0037409 | |||
| 2265 | Ga0495654_0059781 | |||
| 2266 | Ga0495654_0088775 | |||
| 2267 | Ga0495654_0124101 | |||
| 2268 | Ga0495586_0008590 | |||
| 2269 | Ga0495587_0005426 | |||
| 2270 | Ga0495609_0000056 | |||
| 2271 | Ga0495609_0000196 | |||
| 2272 | Ga0495609_0000275 | |||
| 2273 | Ga0495609_0001849 | |||
| 2274 | Ga0495609_0011092 | |||
| 2275 | Ga0495609_0066997 | |||
| 2276 | Ga0495609_0091835 | |||
| 2277 | Ga0495597_0000090 | |||
| 2278 | Ga0495597_0000482 | |||
| 2279 | Ga0495597_0000627 | |||
| 2280 | Ga0495597_0029378 | |||
| 2281 | Ga0495597_0068913 | |||
| 2282 | Ga0495597_0073274 | |||
| 2283 | Ga0495645_0107898 | |||
| 2284 | Ga0495622_0000577 | |||
| 2285 | Ga0495622_0002011 | |||
| 2286 | Ga0495622_0009385 | |||
| 2287 | Ga0495622_0045649 | |||
| 2288 | Ga0495622_0068076 | |||
| 2289 | Ga0495633_0000169 | |||
| 2290 | Ga0495633_0010976 | |||
| 2291 | Ga0495633_0039030 | |||
| 2292 | Ga0495668_0001865 | |||
| 2293 | Ga0495668_0028942 | |||
| 2294 | Ga0495668_0029043 | |||
| 2295 | Ga0495668_0063743 | |||
| 2296 | Ga0495668_0096405 | |||
| 2297 | Ga0495634_0001928 | |||
| 2298 | Ga0495634_0108470 | |||
| 2299 | Ga0495611_0000772 | |||
| 2300 | Ga0495611_0003100 | |||
| 2301 | Ga0495611_0031356 | |||
| 2302 | Ga0495611_0043191 | |||
| 2303 | Ga0495611_0058897 | |||
| 2304 | Ga0495625_0000082 | |||
| 2305 | Ga0495625_0003062 | |||
| 2306 | Ga0495625_0005099 | |||
| 2307 | Ga0495625_0013828 | |||
| 2308 | Ga0495625_0135276 | |||
| 2309 | Ga0495625_0137336 | |||
| 2310 | Ga0495635_0043550 | |||
| 2311 | Ga0495635_0113024 | |||
| 2312 | Ga0495659_0000023 | |||
| 2313 | Ga0495659_0001057 | |||
| 2314 | Ga0495659_0008999 | |||
| 2315 | Ga0495661_0000027 | |||
| 2316 | Ga0495661_0000140 | |||
| 2317 | Ga0495661_0000268 | |||
| 2318 | Ga0495661_0000466 | |||
| 2319 | Ga0495661_0011149 | |||
| 2320 | Ga0495661_0019998 | |||
| 2321 | Ga0495661_0027101 | |||
| 2322 | Ga0495661_0159207 | |||
| 2323 | Ga0495588_0000196 | |||
| 2324 | Ga0495588_0063616 | |||
| 2325 | Ga0495646_0020601 | |||
| 2326 | Ga0495646_0088296 | |||
| 2327 | Ga0495669_0001255 | |||
| 2328 | Ga0495613_0011595 | |||
| 2329 | Ga0495624_0010836 | |||
| 2330 | Ga0495670_0001231 | |||
| 2331 | Ga0495670_0003754 | |||
| 2332 | Ga0495670_0015037 | |||
| 2333 | Ga0495670_0043884 | |||
| 2334 | Ga0495670_0100266 | |||
| 2335 | Ga0495670_0102974 | |||
| 2336 | Ga0495671_0002323 | |||
| 2337 | Ga0495671_0003837 | |||
| 2338 | Ga0495671_0007018 | |||
| 2339 | Ga0495671_0017735 | |||
| 2340 | Ga0495671_0020414 | |||
| 2341 | Ga0495671_0025898 | |||
| 2342 | Ga0495671_0058343 | |||
| 2343 | Ga0495671_0084157 | |||
| 2344 | Ga0495671_0085367 | |||
| 2345 | Ga0495649_0003922 | |||
| 2346 | Ga0495649_0006811 | |||
| 2347 | Ga0495649_0018297 | |||
| 2348 | Ga0495649_0025704 | |||
| 2349 | Ga0495649_0034423 | |||
| 2350 | Ga0495649_0040950 | |||
| 2351 | Ga0495649_0100500 | |||
| 2352 | Ga0495589_0000003 | |||
| 2353 | Ga0495589_0000961 | |||
| 2354 | Ga0495589_0001089 | |||
| 2355 | Ga0495589_0001677 | |||
| 2356 | Ga0495589_0007479 | |||
| 2357 | Ga0495589_0020240 | |||
| 2358 | Ga0495589_0050961 | |||
| 2359 | Ga0495589_0074899 | |||
| 2360 | Ga0495589_0136605 | |||
| 2361 | Ga0495600_0037880 | |||
| 2362 | Ga0495600_0099631 | |||
| 2363 | Ga0495660_0000015 | |||
| 2364 | Ga0495660_0000028 | |||
| 2365 | Ga0495660_0000837 | |||
| 2366 | Ga0495660_0000967 | |||
| 2367 | Ga0495660_0004920 | |||
| 2368 | Ga0495660_0013715 | |||
| 2369 | Ga0495660_0020346 | |||
| 2370 | Ga0495660_0026190 | |||
| 2371 | Ga0495660_0040943 | |||
| 2372 | Ga0495660_0053605 | |||
| 2373 | Ga0495660_0083999 | |||
| 2374 | Ga0495660_0107511 | |||
| 2375 | Ga0495581_0012020 | |||
| 2376 | Ga0495604_0011263 | |||
| 2377 | Ga0495604_0031397 | |||
| 2378 | Ga0495636_0026961 | |||
| 2379 | Ga0495672_0000001 | |||
| 2380 | Ga0495672_0000009 | |||
| 2381 | Ga0495672_0000357 | |||
| 2382 | Ga0495672_0000537 | |||
| 2383 | Ga0495672_0000945 | |||
| 2384 | Ga0495672_0012686 | |||
| 2385 | Ga0495672_0021273 | |||
| 2386 | Ga0495672_0024118 | |||
| 2387 | Ga0495672_0032914 | |||
| 2388 | Ga0495672_0051956 | |||
| 2389 | Ga0495672_0060431 | |||
| 2390 | Ga0495672_0075158 | |||
| 2391 | Ga0495672_0107175 | |||
| 2392 | Ga0495672_0158056 | |||
| 2393 | Ga0495676_0000057 | |||
| 2394 | Ga0495676_0006636 | |||
| 2395 | Ga0495680_0027481 | |||
| 2396 | Ga0495680_0042106 | |||
| 2397 | Ga0495680_0046267 | |||
| 2398 | Ga0495683_0000101 | |||
| 2399 | Ga0495683_0000473 | |||
| 2400 | Ga0495683_0001281 | |||
| 2401 | Ga0495683_0002172 | |||
| 2402 | Ga0495683_0010971 | |||
| 2403 | Ga0495687_000159 | |||
| 2404 | Ga0495687_000160 | |||
| 2405 | Ga0495675_0031533 | |||
| 2406 | Ga0495677_0003409 | |||
| 2407 | Ga0495679_000047 | |||
| 2408 | Ga0495679_000052 | |||
| 2409 | Ga0495679_000576 | |||
| 2410 | Ga0495679_050823 | |||
| 2411 | Ga0495673_0000073 | |||
| 2412 | Ga0495673_0000919 | |||
| 2413 | Ga0495673_0001324 | |||
| 2414 | Ga0495673_0001971 | |||
| 2415 | Ga0495673_0002739 | |||
| 2416 | Ga0495673_0006025 | |||
| 2417 | Ga0495673_0006245 | |||
| 2418 | Ga0495673_0007924 | |||
| 2419 | Ga0495673_0011220 | |||
| 2420 | Ga0495673_0011557 | |||
| 2421 | Ga0495673_0022252 | |||
| 2422 | Ga0495673_0029520 | |||
| 2423 | Ga0495673_0044224 | |||
| 2424 | Ga0495673_0055724 | |||
| 2425 | Ga0495673_0066210 | |||
| 2426 | Ga0495681_0010987 | |||
| 2427 | Ga0495681_0013984 | |||
| 2428 | Ga0495681_0024601 | |||
| 2429 | Ga0495681_0035781 | |||
| 2430 | Ga0495681_0059434 | |||
| 2431 | Ga0495681_0064413 | |||
| 2432 | Ga0495681_0065882 | |||
| 2433 | Ga0495686_0078682 | |||
| 2434 | Ga0495686_0095469 | |||
| 2435 | Ga0495686_0110518 | |||
| 2436 | Ga0495593_0040257 | |||
| 2437 | Ga0495593_0041815 | |||
| 2438 | Ga0495593_0062691 | |||
| 2439 | Ga0495602_0056914 | |||
| 2440 | Ga0495615_0022192 | |||
| 2441 | Ga0495626_0000063 | |||
| 2442 | Ga0495626_0001629 | |||
| 2443 | Ga0495626_0003486 | |||
| 2444 | Ga0495626_0013796 | |||
| 2445 | Ga0495626_0018344 | |||
| 2446 | Ga0495626_0040581 | |||
| 2447 | Ga0495626_0046618 | |||
| 2448 | Ga0495626_0076919 | |||
| 2449 | Ga0496100_0037329 | |||
| 2450 | Ga0496101_0000238 | |||
| 2451 | Ga0496101_0006349 | |||
| 2452 | Ga0496102_0001561 | |||
| 2453 | Ga0496102_0141729 | |||
| 2454 | Ga0496102_0322605 | |||
| 2455 | Ga0496103_0047306 | |||
| 2456 | Ga0496104_0000870 | |||
| 2457 | Ga0496104_0001961 | |||
| 2458 | Ga0496105_0004949 | |||
| 2459 | Ga0496105_0078866 | |||
| 2460 | Ga0496110_0051032 | |||
| 2461 | Ga0496114_0017785 | |||
| 2462 | Ga0496115_0329107 | |||
| 2463 | Ga0496116_0000007 | |||
| 2464 | Ga0496116_0000234 | |||
| 2465 | Ga0496116_0000613 | |||
| 2466 | Ga0496116_0000845 | |||
| 2467 | Ga0496116_0000960 | |||
| 2468 | Ga0496116_0002607 | |||
| 2469 | Ga0496116_0038048 | |||
| 2470 | Ga0496116_0045368 | |||
| 2471 | Ga0496116_0048025 | |||
| 2472 | Ga0496116_0060651 | |||
| 2473 | Ga0496117_0000775 | |||
| 2474 | Ga0496117_0001091 | |||
| 2475 | Ga0496117_0001727 | |||
| 2476 | Ga0496117_0001930 | |||
| 2477 | Ga0496117_0002207 | |||
| 2478 | Ga0496117_0002377 | |||
| 2479 | Ga0496117_0004181 | |||
| 2480 | Ga0496117_0006885 | |||
| 2481 | Ga0496117_0010931 | |||
| 2482 | Ga0496117_0011127 | |||
| 2483 | Ga0496117_0046368 | |||
| 2484 | Ga0496117_0066163 | |||
| 2485 | Ga0496117_0074435 | |||
| 2486 | Ga0496118_0003126 | |||
| 2487 | Ga0496118_0004107 | |||
| 2488 | Ga0496118_0004537 | |||
| 2489 | Ga0496118_0007973 | |||
| 2490 | Ga0496118_0010603 | |||
| 2491 | Ga0496118_0011077 | |||
| 2492 | Ga0496118_0020365 | |||
| 2493 | Ga0496118_0048483 | |||
| 2494 | Ga0496118_0056224 | |||
| 2495 | Ga0496118_0113397 | |||
| 2496 | Ga0496118_0137613 | |||
| 2497 | Ga0496119_0000348 | |||
| 2498 | Ga0496119_0000582 | |||
| 2499 | Ga0496119_0001764 | |||
| 2500 | Ga0496119_0003562 | |||
| 2501 | Ga0496119_0019362 | |||
| 2502 | Ga0496119_0056980 | |||
| 2503 | Ga0496120_0000287 | |||
| 2504 | Ga0496120_0000364 | |||
| 2505 | Ga0496120_0000452 | |||
| 2506 | Ga0496120_0000945 | |||
| 2507 | Ga0496120_0002643 | |||
| 2508 | Ga0496120_0003670 | |||
| 2509 | Ga0496120_0006581 | |||
| 2510 | Ga0496120_0012383 | |||
| 2511 | Ga0496120_0023634 | |||
| 2512 | Ga0496121_0000346 | |||
| 2513 | Ga0496121_0000565 | |||
| 2514 | Ga0496121_0001904 | |||
| 2515 | Ga0496121_0002181 | |||
| 2516 | Ga0496121_0002811 | |||
| 2517 | Ga0496121_0008337 | |||
| 2518 | Ga0496121_0011723 | |||
| 2519 | Ga0496121_0029547 | |||
| 2520 | Ga0496121_0160313 | |||
| 2521 | Ga0496122_0000058 | |||
| 2522 | Ga0496122_0000264 | |||
| 2523 | Ga0496122_0001113 | |||
| 2524 | Ga0496122_0001199 | |||
| 2525 | Ga0496122_0002597 | |||
| 2526 | Ga0496122_0005299 | |||
| 2527 | Ga0496122_0011643 | |||
| 2528 | Ga0496122_0011681 | |||
| 2529 | Ga0496122_0012048 | |||
| 2530 | Ga0496122_0022107 | |||
| 2531 | Ga0496122_0038656 | |||
| 2532 | Ga0496122_0047885 | |||
| 2533 | Ga0496122_0062023 | |||
| 2534 | Ga0496122_0132195 | |||
| 2535 | Ga0496123_0000044 | |||
| 2536 | Ga0496123_0000215 | |||
| 2537 | Ga0496123_0000846 | |||
| 2538 | Ga0496123_0000911 | |||
| 2539 | Ga0496123_0001400 | |||
| 2540 | Ga0496123_0001530 | |||
| 2541 | Ga0496123_0007508 | |||
| 2542 | Ga0496123_0010260 | |||
| 2543 | Ga0496123_0011236 | |||
| 2544 | Ga0496123_0012065 | |||
| 2545 | Ga0496123_0023517 | |||
| 2546 | Ga0496123_0061416 | |||
| 2547 | Ga0496124_0000092 | |||
| 2548 | Ga0496124_0000787 | |||
| 2549 | Ga0496124_0001050 | |||
| 2550 | Ga0496124_0005454 | |||
| 2551 | Ga0496124_0005640 | |||
| 2552 | Ga0496124_0014243 | |||
| 2553 | Ga0496124_0016521 | |||
| 2554 | Ga0496124_0017975 | |||
| 2555 | Ga0496124_0020494 | |||
| 2556 | Ga0496124_0039710 | |||
| 2557 | Ga0496124_0040970 | |||
| 2558 | Ga0496124_0054934 | |||
| 2559 | Ga0496124_0061012 | |||
| 2560 | Ga0496124_0065726 | |||
| 2561 | Ga0496124_0079101 | |||
| 2562 | Ga0496124_0226447 | |||
| 2563 | Ga0496125_0000103 | |||
| 2564 | Ga0496125_0000264 | |||
| 2565 | Ga0496125_0000922 | |||
| 2566 | Ga0496125_0002771 | |||
| 2567 | Ga0496125_0006920 | |||
| 2568 | Ga0496125_0008984 | |||
| 2569 | Ga0496125_0030208 | |||
| 2570 | Ga0496125_0058292 | |||
| 2571 | Ga0496126_0002072 | |||
| 2572 | Ga0496126_0002455 | |||
| 2573 | Ga0496126_0005468 | |||
| 2574 | Ga0496126_0075310 | |||
| 2575 | Ga0495678_000057 | |||
| 2576 | Ga0495678_000964 | |||
| 2577 | Ga0495678_001561 | |||
| 2578 | Ga0495678_003445 | |||
| 2579 | Ga0495678_006404 | |||
| 2580 | Ga0495678_022022 | |||
| 2581 | Ga0495678_029439 | |||
| 2582 | Ga0495678_033199 | |||
| 2583 | Ga0495678_055956 | |||
| 2584 | Ga0495678_060500 | |||
| 2585 | Ga0495682_0000001 | |||
| 2586 | Ga0495682_0000057 | |||
| 2587 | Ga0495682_0000218 | |||
| 2588 | Ga0495682_0001324 | |||
| 2589 | Ga0495682_0005152 | |||
| 2590 | Ga0495682_0021872 | |||
| 2591 | Ga0495682_0056322 | |||
| 2592 | Ga0501032_0018586 | |||
| 2593 | Ga0501034_0000085 | |||
| 2594 | Ga0501039_0263384 | |||
| 2595 | nmdc:mga03683_6050_c1 | |||
| 2596 | nmdc:mga0k408_24689_c1 | |||
| 2597 | nmdc:mga06z11_4626_c1 | |||
| 2598 | nmdc:mga0qj67_222290_c1 | |||
| 2599 | nmdc:mga0sz30_20900_c1 | |||
| 2600 | nmdc:mga0sz30_6298_c2 | |||
| 2601 | Ga0500578_0026286 | |||
| 2602 | Ga0500651_0078781 | |||
| 2603 | Ga0500641_0005518 | |||
| 2604 | Ga0500572_023756 | |||
| 2605 | Ga0500594_0002751 | |||
| 2606 | Ga0500621_000002 | |||
| 2607 | Ga0500658_0000490 | |||
| 2608 | Ga0500573_0024946 | |||
| 2609 | Ga0500637_0010545 | |||
| 2610 | Ga0500645_040348 | |||
| 2611 | Ga0500609_001726 | |||
| 2612 | 2506579396 | |||
| 2613 | 2506584535 | |||
| 2614 | 2508853260 | |||
| 2615 | 2510285424 | |||
| 2616 | 2510295933 | |||
| 2617 | 2510313562 | |||
| 2618 | 2511256194 | |||
| 2619 | 2511265248 | |||
| 2620 | 2511272292 | |||
| 2621 | 2511279339 | |||
| 2622 | 2511287551 | |||
| 2623 | 2511297473 | |||
| 2624 | 2511304360 | |||
| 2625 | 2511316203 | |||
| 2626 | 2511322040 | |||
| 2627 | 2511326395 | |||
| 2628 | 2511330874 | |||
| 2629 | 2511341478 | |||
| 2630 | 2511346521 | |||
| 2631 | 2511349234 | |||
| 2632 | 2511356380 | |||
| 2633 | 2511361493 | |||
| 2634 | 2511367161 | |||
| 2635 | 2511372924 | |||
| 2636 | 2511380296 | |||
| 2637 | 2511414420 | |||
| 2638 | 2511436625 | |||
| 2639 | 2511822579 | |||
| 2640 | 2512327627 | |||
| 2641 | 2513568465 | |||
| 2642 | 2513579443 | |||
| 2643 | 2515738451 | |||
| 2644 | 2517080487 | |||
| 2645 | 2524610867 | |||
| 2646 | 2548650591 | |||
| 2647 | 2554817942 | |||
| 2648 | 2555247471 | |||
| 2649 | 2555667546 | |||
| 2650 | 2583789689 | |||
| 2651 | 2585269333 | |||
| 2652 | 2585327179 | |||
| 2653 | 2585391312 | |||
| 2654 | 2585391780 | |||
| 2655 | 2585526813 | |||
| 2656 | 2585543081 | |||
| 2657 | 2585557484 | |||
| 2658 | 2585564246 | |||
| 2659 | 2585825507 | |||
| 2660 | 2585832011 | |||
| 2661 | 2585841446 | |||
| 2662 | 2597855775 | |||
| 2663 | 2597861784 | |||
| 2664 | 2597867510 | |||
| 2665 | 2599327254 | |||
| 2666 | 2599356767 | |||
| 2667 | 2599363203 | |||
| 2668 | 2599369845 | |||
| 2669 | 2599376312 | |||
| 2670 | 2599381872 | |||
| 2671 | 2599387984 | |||
| 2672 | 2599395490 | |||
| 2673 | 2599398736 | |||
| 2674 | 2599407255 | |||
| 2675 | 2599408778 | |||
| 2676 | 2599450791 | |||
| 2677 | 2599463600 | |||
| 2678 | 2599469052 | |||
| 2679 | 2599485677 | |||
| 2680 | 2599492619 | |||
| 2681 | 2599499983 | |||
| 2682 | 2599506546 | |||
| 2683 | 2599514264 | |||
| 2684 | 2599518864 | |||
| 2685 | 2599616711 | |||
| 2686 | 2599769539 | |||
| 2687 | 2599806807 | |||
| 2688 | 2599882959 | |||
| 2689 | 2599886960 | |||
| 2690 | 2599893402 | |||
| 2691 | 2599898289 | |||
| 2692 | 2599931021 | |||
| 2693 | 2599944599 | |||
| 2694 | 2599952411 | |||
| 2695 | 2599956058 | |||
| 2696 | 2599961217 | |||
| 2697 | 2599964676 | |||
| 2698 | 2599973079 | |||
| 2699 | 2599977392 | |||
| 2700 | 2599983175 | |||
| 2701 | 2599991108 | |||
| 2702 | 2599997761 | |||
| 2703 | 2600001020 | |||
| 2704 | 2600007055 | |||
| 2705 | 2600011561 | |||
| 2706 | 2600019207 | |||
| 2707 | 2600026417 | |||
| 2708 | 2600031991 | |||
| 2709 | 2600036839 | |||
| 2710 | 2600043265 | |||
| 2711 | 2600048179 | |||
| 2712 | 2600055785 | |||
| 2713 | 2600061184 | |||
| 2714 | 2600068428 | |||
| 2715 | 2600072464 | |||
| 2716 | 2600078420 | |||
| 2717 | 2600216229 | |||
| 2718 | 2600360270 | |||
| 2719 | 2600364763 | |||
| 2720 | 2601522708 | |||
| 2721 | 2601527735 | |||
| 2722 | 2601614566 | |||
| 2723 | 2601619286 | |||
| 2724 | 2601627064 | |||
| 2725 | 2601642114 | |||
| 2726 | 2601646956 | |||
| 2727 | 2601652713 | |||
| 2728 | 2601658039 | |||
| 2729 | 2601661936 | |||
| 2730 | 2601692465 | |||
| 2731 | 2601694894 | |||
| 2732 | 2601701857 | |||
| 2733 | 2601706560 | |||
| 2734 | 2601710864 | |||
| 2735 | 2601715878 | |||
| 2736 | 2601719921 | |||
| 2737 | 2601726284 | |||
| 2738 | 2601730825 | |||
| 2739 | 2601735840 | |||
| 2740 | 2601741106 | |||
| 2741 | 2601751037 | |||
| 2742 | 2601776396 | |||
| 2743 | 2601797964 | |||
| 2744 | 2602018290 | |||
| 2745 | 2603645150 | |||
| 2746 | 2603661616 | |||
| 2747 | 2603664571 | |||
| 2748 | 2603699022 | |||
| 2749 | 2603705055 | |||
| 2750 | 2603838218 | |||
| 2751 | 2603843296 | |||
| 2752 | 2603848369 | |||
| 2753 | 2603853442 | |||
| 2754 | 2603866949 | |||
| 2755 | 2603871496 | |||
| 2756 | 2603876402 | |||
| 2757 | 2606048687 | |||
| 2758 | 2606069003 | |||
| 2759 | 2606076553 | |||
| 2760 | 2606129033 | |||
| 2761 | 2606144800 | |||
| 2762 | 2606176089 | |||
| 2763 | 2608380745 | |||
| 2764 | 2621302062 | |||
| 2765 | 2624478347 | |||
| 2766 | 2624489898 | |||
| 2767 | 2637224589 | |||
| 2768 | 2643841114 | |||
| 2769 | 2643872504 | |||
| 2770 | 2643954777 | |||
| 2771 | 2644024417 | |||
| 2772 | 2644190110 | |||
| 2773 | 2644210608 | |||
| 2774 | 2644281391 | |||
| 2775 | 2644619764 | |||
| 2776 | 2644654142 | |||
| 2777 | 2656275917 | |||
| 2778 | 2671090671 | |||
| 2779 | 2671099844 | |||
| 2780 | 2671101496 | |||
| 2781 | 2671109888 | |||
| 2782 | 2671129211 | |||
| 2783 | 2671772459 | |||
| 2784 | 2676405917 | |||
| 2785 | 2677898842 | |||
| 2786 | 2678261122 | |||
| 2787 | 2681996530 | |||
| 2788 | 2682006056 | |||
| 2789 | 2689445970 | |||
| 2790 | 2692318073 | |||
| 2791 | 2712469490 | |||
| 2792 | 2715749341 | |||
| 2793 | 2715755607 | |||
| 2794 | 2718632289 | |||
| 2795 | 2723246678 | |||
| 2796 | 2738674201 | |||
| 2797 | 2738687465 | |||
| 2798 | 2738752594 | |||
| 2799 | 2738807783 | |||
| 2800 | 2738861635 | |||
| 2801 | 2738895143 | |||
| 2802 | 2739035149 | |||
| 2803 | 2739200585 | |||
| 2804 | 2739259937 | |||
| 2805 | 2739263086 | |||
| 2806 | 2739288618 | |||
| 2807 | 2739293930 | |||
| 2808 | 2739311415 | |||
| 2809 | 2743735195 | |||
| 2810 | 2745006433 | |||
| 2811 | 2753856607 | |||
| 2812 | 2765581725 | |||
| 2813 | 2765589626 | |||
| 2814 | 2766068902 | |||
| 2815 | 2772439836 | |||
| 2816 | 2774119426 | |||
| 2817 | 2774132440 | |||
| 2818 | 2774134863 | |||
| 2819 | 2775539624 | |||
| 2820 | 2776259455 | |||
| 2821 | 2777023005 | |||
| 2822 | 2784260917 | |||
| 2823 | 2784316365 | |||
| 2824 | 2793342724 | |||
| 2825 | 2793363402 | |||
| 2826 | 2793368744 | |||
| 2827 | 2794594157 | |||
| 2828 | 2806049601 | |||
| 2829 | 2806054587 | |||
| 2830 | 2806060595 | |||
| 2831 | 2806069485 | |||
| 2832 | 2806076880 | |||
| 2833 | 2807176812 | |||
| 2834 | 2807406353 | |||
| 2835 | 2807454706 | |||
| 2836 | 2808856217 | |||
| 2837 | 2808922615 | |||
| 2838 | 2808932673 | |||
| 2839 | 2808936277 | |||
| 2840 | 2808940151 | |||
| 2841 | 2808944302 | |||
| 2842 | 2808954794 | |||
| 2843 | 2808955997 | |||
| 2844 | 2808965614 | |||
| 2845 | 2808976532 | |||
| 2846 | 2808992030 | |||
| 2847 | 2808999610 | |||
| 2848 | 2809218103 | |||
| 2849 | 2812370340 | |||
| 2850 | 2817488530 | |||
| 2851 | 2819657357 | |||
| 2852 | 2819705340 | |||
| 2853 | 2821121689 | |||
| 2854 | 2821444159 | |||
| 2855 | 2821450076 | |||
| 2856 | 2821450762 | |||
| 2857 | 2823375348 | |||
| 2858 | 2825654138 | |||
| 2859 | 2826586245 | |||
| 2860 | 2834032097 | |||
| 2861 | 2838690500 | |||
| 2862 | 2838733143 | |||
| 2863 | 2838747268 | |||
| 2864 | 2841855421 | |||
| 2865 | 2842117007 | |||
| 2866 | 2842160872 | |||
| 2867 | 2842164401 | |||
| 2868 | 2842184488 | |||
| 2869 | 2842232071 | |||
| 2870 | 2842248527 | |||
| 2871 | 2842262665 | |||
| 2872 | 2842275186 | |||
| 2873 | 2842307378 | |||
| 2874 | 2842396969 | |||
| 2875 | 2842807139 | |||
| 2876 | 2842817879 | |||
| 2877 | 2842832217 | |||
| 2878 | 2842834293 | |||
| 2879 | 2842842892 | |||
| 2880 | 2842846230 | |||
| 2881 | 2842851825 | |||
| 2882 | 2842859969 | |||
| 2883 | 2844428059 | |||
| 2884 | 2844460156 | |||
| 2885 | 2844534015 | |||
| 2886 | 2844536641 | |||
| 2887 | 2844539481 | |||
| 2888 | 2844668021 | |||
| 2889 | 2844671157 | |||
| 2890 | 2847423419 | |||
| 2891 | 2848997099 | |||
| 2892 | 2852104104 | |||
| 2893 | 2852617202 | |||
| 2894 | 2852660324 | |||
| 2895 | 2852671809 | |||
| 2896 | 2855875134 | |||
| 2897 | 2857517729 | |||
| 2898 | 2860343513 | |||
| 2899 | 2860868560 | |||
| 2900 | 2869555308 | |||
| 2901 | 2876601808 | |||
| 2902 | 2878030296 | |||
| 2903 | 2880231240 | |||
| 2904 | 2884088267 | |||
| 2905 | 2888369952 | |||
| 2906 | 2891374531 | |||
| 2907 | 2891673925 | |||
| 2908 | 2904478251 | |||
| 2909 | 2904514478 | |||
| 2910 | 2904519697 | |||
| 2911 | 2904553929 | |||
| 2912 | 2908447151 | |||
| 2913 | 2912964301 | |||
| 2914 | 2913037412 | |||
| 2915 | 2917071298 | |||
| 2916 | 2917701228 | |||
| 2917 | 2917833957 | |||
| 2918 | 2919066023 | |||
| 2919 | 2919129969 | |||
| 2920 | 2919155499 | |||
| 2921 | 2919160020 | |||
| 2922 | 2919389640 | |||
| 2923 | 2919460112 | |||
| 2924 | 2919486556 | |||
| 2925 | 2919488568 | |||
| 2926 | 2919698824 | |||
| 2927 | 2923154191 | |||
| 2928 | 2923524428 | |||
| 2929 | 2923591646 | |||
| 2930 | 2923635514 | |||
| 2931 | 2927147909 | |||
| 2932 | 2927833511 | |||
| 2933 | 2929144944 | |||
| 2934 | 2929190416 | |||
| 2935 | 2931371719 | |||
| 2936 | 2931391500 | |||
| 2937 | 2931398970 | |||
| 2938 | 2932408895 | |||
| 2939 | 2933573966 | |||
| 2940 | 2933593243 | |||
| 2941 | 2935359126 | |||
| 2942 | 2935906138 | |||
| 2943 | 2936384492 | |||
| 2944 | 2937540689 | |||
| 2945 | 2937968478 | |||
| 2946 | 2939582027 | |||
| 2947 | 2939605790 | |||
| 2948 | 2939608981 | |||
| 2949 | 2939641232 | |||
| 2950 | 2939655908 | |||
| 2951 | 2945930038 | |||
| 2952 | 2945967714 | |||
| 2953 | 2946012387 | |||
| 2954 | 2946028761 | |||
| 2955 | 2947235293 | |||
| 2956 | 2969081632 | |||
| 2957 | 2969305088 | |||
| 2958 | 2974293217 | |||
| 2959 | 2974302854 | |||
| 2960 | 2974311443 | |||
| 2961 | 2984291867 | |||
| 2962 | 2984499561 | |||
| 2963 | 2984506002 | |||
| 2964 | 2984564046 | |||
| 2965 | 2984596779 | |||
| 2966 | 2988732335 | |||
| 2967 | 2989352467 | |||
| 2968 | 2998140598 | |||
| 2969 | 3003935922 | |||
| 2970 | 3007320172 | |||
| 2971 | 3007399746 | |||
| 2972 | 3007420135 | |||
| 2973 | 3007518044 | |||
| 2974 | 3007618294 | |||
| 2975 | 3007622271 | |||
| 2976 | 3007720391 | |||
| 2977 | 3007808889 | |||
| 2978 | 3007859825 | |||
| 2979 | 3007864195 | |||
| 2980 | 3007870832 | |||
| 2981 | 3007873258 | |||
| 2982 | 637317941 | |||
| 2983 | 640938745 | |||
| 2984 | 8002746975 | |||
| 2985 | 8004595936 | |||
| 2986 | 8005308272 | |||
| 2987 | 8005559517 | |||
| 2988 | 8005566438 | |||
| 2989 | 8005571306 | |||
| 2990 | 8005697056 | |||
| 2991 | 8011352780 | |||
| 2992 | 8015397969 | |||
| 2993 | 8015688441 | |||
| 2994 | 8016735305 | |||
| 2995 | 8018163712 | |||
| 2996 | 8018222998 | |||
| 2997 | 8018409651 | |||
| 2998 | 8019501216 | |||
| 2999 | 8019770422 | |||
| 3000 | 8019777472 | |||
| 3001 | 8023681599 | |||
| 3002 | 8030000142 | |||
| 3003 | 8052495165 | |||
| 3004 | 8054006557 | |||
| 3005 | 8054291009 | |||
| 3006 | 8054350012 | |||
| 3007 | 8054504091 | |||
| 3008 | 8054930818 | |||
| 3009 | 8055088132 | |||
| 3010 | 8055095176 | |||
| 3011 | 8055098522 | |||
| 3012 | 8055771541 | |||
| 3013 | 8055818487 | |||
| 3014 | 8055879856 | |||
| 3015 | 8056116848 | |||
| 3016 | 8056125353 | |||
| 3017 | 8056126596 | |||
| 3018 | 8056132458 | |||
| 3019 | 8056142432 | |||
| 3020 | 8056143876 | |||
| 3021 | 8056152593 | |||
| 3022 | 8056158639 | |||
| 3023 | 8056164471 | |||
| 3024 | 8056170453 | |||
| 3025 | 8056176583 | |||
| 3026 | 8056182915 | |||
| 3027 | 8056378089 | |||
| 3028 | 8056573421 | |||
| 3029 | 8057802825 | |||
| 3030 | 8057881333 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ipc-assembly1.cif.gz_A | structure of atu2422-gaba f77a mutant receptor in complex with leucine | 0.963 | 27 | 363 |
| 3ip9-assembly1.cif.gz_A | structure of atu2422-gaba receptor in complex with gaba | 0.9622 | 27 | 363 |
| 4n0q-assembly1.cif.gz_A | crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic) | 0.9592 | 28 | 363 |
| 1z18-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9556 | 27 | 367 |
| 1z18-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9448 | 27 | 367 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1usiA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9736 | 148 | 275 | 3.40.50.2300 |
| af_P04816_25_358_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9681 | 28 | 356 | 3.40.190.10 |
| 4n0qA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9655 | 148 | 277 | 3.40.50.2300 |
| 3ipcA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9644 | 148 | 277 | 3.40.50.2300 |
| af_P04816_25_358_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9511 | 28 | 356 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A528G7S6-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9917 | 28 | 137 |
GO:0006865
|
| AF-W1EKH1-F1-model_v4 | deleted | 0.9908 | 24 | 288 |
|
| AF-A0A2X2T0D3-F1-model_v4 | Leucine-specific-binding protein | 0.9799 | 64 | 208 |
GO:0006865
|
| AF-A0A528G7S6-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9741 | 28 | 137 |
GO:0006865
|
| AF-W1EKH1-F1-model_v4 | deleted | 0.9725 | 24 | 288 |
|