F494499

General Info

Members Datasets Scaffolds Average Seq Length
1515 719 3030 374

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10000279|Ga0157371_100002797
Length 422
Sequence MAWRRAWTLGRWTFHALKTGWHGPCSAQSLKFVVPTKKTQEQHLMSQTFYRKGFLALAVASALSVSSFAQADIKIGVAGPMTGANASFGEQYMKGAQAAADAINKAGGVNGENIVLVAGDDACEPKQAVAVANRLVDQDKVVGVVGHFCSSSTIPASEVYADAGVIVITPGSTNPAVTERGLSDVFRMCGRDDQQGVVAGDYIVDVLKAKKVAVIHDKDTYGQGLADATKAQLEKRGVKPVLYEGLTRGEKDFSALVTKIRSTGAEVVYFGGLHPEAGPLVRQLREQGLKDVRFMSDDGIVTDELVTTAGGAQYVDGVYMTFGADPRALPDSKAVVDEFRKSGYEPEGYTLYAYASVQALAAGFNGAKSNKGDAASKWLKANPVKTVMGEKSWDTKGDLKVSDYVVYQWNKEGKYTQLEKQK

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
37 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
62 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
63 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
86 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
87 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
88 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
89 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
92 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
105 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
140 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
141 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
146 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
147 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
159 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
160 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
161 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
162 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
165 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
166 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
167 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
168 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
169 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
170 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
171 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
172 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
173 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
174 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
175 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
176 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
177 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
178 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
179 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
180 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
181 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
182 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
183 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
184 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
185 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
186 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
192 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
195 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
200 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
214 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
215 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
216 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
217 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
221 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
225 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
235 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
243 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
244 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
250 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
254 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
257 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
258 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
259 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
264 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
275 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
276 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
277 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
278 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
281 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
286 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
295 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
296 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
297 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
298 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
299 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
300 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
301 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
302 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
303 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
304 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
305 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
306 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
307 2506520008 Serratia plymuthica AS12 Isolate Unclassified
308 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
309 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
310 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
311 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
312 2511231004 Pseudomonas sp. GM102 Isolate Nodule
313 2511231006 Pseudomonas sp. GM17 Isolate Nodule
314 2511231007 Pseudomonas sp. GM18 Isolate Nodule
315 2511231008 Pseudomonas sp. GM21 Isolate Nodule
316 2511231010 Pseudomonas sp. GM25 Isolate Nodule
317 2511231011 Pseudomonas sp. GM30 Isolate Nodule
318 2511231012 Pseudomonas sp. GM33 Isolate Nodule
319 2511231014 Pseudomonas sp. GM48 Isolate Nodule
320 2511231015 Pseudomonas sp. GM49 Isolate Nodule
321 2511231016 Pseudomonas sp. GM50 Isolate Nodule
322 2511231017 Pseudomonas sp. GM55 Isolate Nodule
323 2511231018 Pseudomonas sp. GM60 Isolate Nodule
324 2511231019 Pseudomonas sp. GM67 Isolate Nodule
325 2511231020 Pseudomonas sp. GM74 Isolate Nodule
326 2511231021 Pseudomonas sp. GM78 Isolate Nodule
327 2511231022 Pseudomonas sp. GM79 Isolate Nodule
328 2511231023 Pseudomonas sp. GM80 Isolate Nodule
329 2511231024 Pseudomonas sp. GM84 Isolate Nodule
330 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
331 2511231031 Pseudomonas sp. GM16 Isolate Nodule
332 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
333 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
334 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
335 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
336 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
337 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
338 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
339 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
340 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
341 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
342 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
343 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
344 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
345 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
346 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
347 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
348 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
349 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
350 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
351 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
352 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
353 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
354 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
355 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
356 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
357 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
358 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
359 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
360 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
361 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
362 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
363 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
364 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
365 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
366 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
367 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
368 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
369 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
370 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
371 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
372 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
373 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
374 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
375 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
376 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
377 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
378 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
379 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
380 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
381 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
382 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
383 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
384 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
385 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
386 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
387 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
388 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
389 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
390 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
391 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
392 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
393 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
394 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
395 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
396 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
397 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
398 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
399 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
400 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
401 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
402 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
403 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
404 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
405 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
406 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
407 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
408 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
409 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
410 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
411 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
412 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
413 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
414 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
415 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
416 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
417 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
418 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
419 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
420 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
421 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
422 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
423 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
424 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
425 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
426 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
427 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
428 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
429 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
430 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
431 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
432 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
433 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
434 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
435 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
436 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
437 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
438 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
439 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
440 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
441 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
442 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
443 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
444 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
445 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
446 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
447 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
448 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
449 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
450 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
451 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
452 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
453 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
454 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
455 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
456 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
457 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
458 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
459 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
460 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
461 2636415599 Klebsiella variicola DX120E Isolate Unclassified
462 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
463 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
464 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
465 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
466 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
467 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
468 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
469 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
470 2643221718 Rhizobium sp. Root268 Isolate Unclassified
471 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
472 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
473 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
474 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
475 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
476 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
477 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
478 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
479 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
480 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
481 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
482 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
483 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
484 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
485 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
486 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
487 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
488 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
489 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
490 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
491 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
492 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
493 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
494 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
495 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
496 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
497 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
498 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
499 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
500 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
501 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
502 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
503 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
504 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
505 2751185917 Enterobacter sp. HK169 Isolate Unclassified
506 2765235841 Pseudomonas putida AA7 Isolate Unclassified
507 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
508 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
509 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
510 2773857670 Pseudomonas sp. 478 Isolate Unclassified
511 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
512 2773857673 Pseudomonas sp. 443 Isolate Unclassified
513 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
514 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
515 2775507074 Klebsiella sp. D5A Isolate Unclassified
516 2784132063 Pseudomonas sp. 424 Isolate Unclassified
517 2784132072 Pseudomonas sp. 460 Isolate Unclassified
518 2791355263 Rhizobium chutanense C5 Isolate Nodule
519 2791355266 Rhizobium sp. L43 Isolate Nodule
520 2791355267 Rhizobium sp. L18 Isolate Nodule
521 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
522 2802429633 Rhizobium anhuiense J3 Isolate Nodule
523 2802429634 Rhizobium anhuiense S10 Isolate Nodule
524 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
525 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
526 2802429637 Rhizobium anhuiense C15 Isolate Nodule
527 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
528 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
529 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
530 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
531 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
532 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
533 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
534 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
535 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
536 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
537 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
538 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
539 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
540 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
541 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
542 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
543 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
544 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
545 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
546 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
547 2821118458 Enterobacter asburiae 609 Isolate Unclassified
548 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
549 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
550 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
551 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
552 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
553 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
554 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
555 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
556 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
557 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
558 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
559 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
560 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
561 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
562 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
563 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
564 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
565 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
566 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
567 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
568 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
569 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
570 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
571 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
572 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
573 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
574 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
575 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
576 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
577 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
578 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
579 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
580 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
581 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
582 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
583 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
584 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
585 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
586 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
587 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
588 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
589 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
590 2876601092 Pantoea endophytica 596 Isolate Unclassified
591 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
592 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
593 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
594 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
595 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
596 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
597 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
598 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
599 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
600 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
601 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
602 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
603 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
604 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
605 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
606 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
607 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
608 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
609 2919150387 Rahnella aceris 1817 Isolate Unclassified
610 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
611 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
612 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
613 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
614 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
615 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
616 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
617 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
618 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
619 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
620 2927143783 Rahnella sp. 2050 Isolate Unclassified
621 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
622 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
623 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
624 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
625 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
626 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
627 2932406140 Serratia sp. 2723 Isolate Rhizosphere
628 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
629 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
630 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
631 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
632 2936381700 Rhizobium chutanense C16 Isolate Unclassified
633 2937539931 Pantoea sp. LS15 Isolate Unclassified
634 2937967321 Serratia sp. YC16 Isolate Unclassified
635 2939577877 Serratia sp. 509 Isolate Rhizosphere
636 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
637 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
638 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
639 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
640 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
641 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
642 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
643 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
644 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
645 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
646 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
647 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
648 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
649 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
650 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
651 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
652 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
653 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
654 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
655 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
656 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
657 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
658 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
659 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
660 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
661 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
662 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
663 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
664 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
665 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
666 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
667 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
668 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
669 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
670 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
671 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
672 640753048 Serratia proteamaculans 568 Isolate Endosphere
673 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
674 8004592986 Serratia sp. S119 Isolate Unclassified
675 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
676 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
677 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
678 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
679 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
680 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
681 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
682 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
683 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
684 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
685 8018221730 Enterobacter sp. CM29 Isolate Unclassified
686 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
687 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
688 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
689 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
690 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
691 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
692 8052494512 Pseudomonas putida LD6 Isolate Unclassified
693 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
694 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
695 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
696 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
697 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
698 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
699 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
700 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
701 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
702 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
703 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
704 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
705 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
706 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
707 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
708 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
709 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
710 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
711 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
712 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
713 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
714 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
715 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
716 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
717 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
718 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere
719 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.28
Metatranscriptomes 0.07
Isolates 27.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 10.3
Nodule 5.35
Rhizoplane 8.18
Rhizosphere 60.07
Stem 0
Stem Tuber 0
Unclassified 0.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10000279 3300013102 Bacteria 69160
2 MRS2a_Contig_17 2124908027 Bacteria 60592
3 SwRhRL2b_contig_119184 2162886007 Bacteria 2019
4 SwRhRL2b_contig_1308625 2162886007 Bacteria 4723
5 SwRhRL2b_contig_805411 2162886007 Bacteria 8621
6 SwRhRL2b_contig_979588 2162886007 Bacteria 1213
7 JGI24741J21665_1001405 3300001915 Bacteria 6915
8 JGI25162J39368_1000090 3300002737 Bacteria 102905
9 JGI25162J39368_1000096 3300002737 Bacteria 97855
10 JGI25162J39368_1000291 3300002737 Bacteria 46437
11 JGI25163J39215_1000070 3300002771 Bacteria 46438
12 JGI25163J39215_1000085 3300002771 Bacteria 40659
13 JGI25163J39215_1001614 3300002771 Bacteria 3377
14 JGI25164J39214_1000070 3300002772 Bacteria 102905
15 JGI25164J39214_1000074 3300002772 Bacteria 97855
16 JGI25164J39214_1000218 3300002772 Bacteria 46437
17 JGI25159J45721_1000043 3300002987 Bacteria 63751
18 JGI25159J45721_1012276 3300002987 Bacteria 2050
19 JGI25151J46595_10000071 3300003187 Bacteria 138433
20 JGI25151J46595_10000429 3300003187 Bacteria 41718
21 JGI25151J46595_10003884 3300003187 Bacteria 8072
22 JGI25151J46595_10004422 3300003187 Bacteria 7442
23 JGI25165J46597_1000170 3300003214 Bacteria 102905
24 JGI25165J46597_1000177 3300003214 Bacteria 97855
25 JGI25153J46596_10033024 3300003215 Bacteria 1715
26 rootH2_10068894 3300003320 Bacteria 17138
27 rootL2_10004729 3300003322 Bacteria 1584
28 JGI25160J50197_1000144 3300003354 Bacteria 63751
29 JGI25160J50197_1001782 3300003354 Bacteria 10424
30 JGI25160J50197_1002007 3300003354 Bacteria 9711
31 JGI25160J50197_1019317 3300003354 Bacteria 2093
32 JGI25160J50197_1024053 3300003354 Bacteria 1738
33 JGI25161J50226_1000932 3300003374 Bacteria 10470
34 JGI25161J50226_1001484 3300003374 Bacteria 7004
35 Ga0006562J51391_1007340 3300003578 Bacteria 5410
36 Ga0055538_1000044 3300003751 Bacteria 139501
37 Ga0055538_1000154 3300003751 Bacteria 46437
38 Ga0055539_1000063 3300003752 Bacteria 139484
39 Ga0055539_1000204 3300003752 Bacteria 46437
40 Ga0055533_1000065 3300003756 Bacteria 166911
41 Ga0055533_1000206 3300003756 Bacteria 46437
42 Ga0055532_1000067 3300003758 Bacteria 139497
43 Ga0055525_1000083 3300003759 Bacteria 157373
44 Ga0055525_1000102 3300003759 Bacteria 134908
45 Ga0055525_1000283 3300003759 Bacteria 46437
46 Ga0055535_1004784 3300003761 Bacteria 3168
47 Ga0055526_1000888 3300003771 Bacteria 22243
48 Ga0055524_1004021 3300003775 Bacteria 6932
49 Ga0055536_1000101 3300003781 Bacteria 73884
50 Ga0055536_1028124 3300003781 Bacteria 1538
51 Ga0055536_1028415 3300003781 Bacteria 1524
52 Ga0055528_1002804 3300003790 Bacteria 9113
53 Ga0055530_10000097 3300003791 Bacteria 73884
54 Ga0055530_10000216 3300003791 Bacteria 51438
55 Ga0055530_10001211 3300003791 Bacteria 19954
56 Ga0055540_1000098 3300003792 Bacteria 96649
57 Ga0055540_1000108 3300003792 Bacteria 89907
58 Ga0055540_1000232 3300003792 Bacteria 51558
59 Ga0055540_1000837 3300003792 Bacteria 20668
60 Ga0055531_10000811 3300003794 Bacteria 25894
61 Ga0055541_1000040 3300003841 Bacteria 166911
62 Ga0055541_1000132 3300003841 Bacteria 46437
63 Ga0058692_1000431 3300003856 Bacteria 19221
64 Ga0058692_1000887 3300003856 Bacteria 11780
65 Ga0058692_1001196 3300003856 Bacteria 9947
66 Ga0058692_1006599 3300003856 Bacteria 3162
67 Ga0058692_1009102 3300003856 Bacteria 2524
68 Ga0058692_1018727 3300003856 Bacteria 1490
69 Ga0058692_1019180 3300003856 Bacteria 1463
70 Ga0055543_1000806 3300004625 Bacteria 15450
71 Ga0055543_1000841 3300004625 Bacteria 14907
72 Ga0065165_1000461 3300005262 Bacteria 63722
73 Ga0065165_1013706 3300005262 Bacteria 3202
74 Ga0065714_10000570 3300005288 Bacteria 3698
75 Ga0065714_10002375 3300005288 Bacteria 22373
76 Ga0065714_10002602 3300005288 Bacteria 25747
77 Ga0065714_10003143 3300005288 Bacteria 8351
78 Ga0065714_10064479 3300005288 Bacteria 55183
79 Ga0065714_10064792 3300005288 Bacteria 18742
80 Ga0065714_10097683 3300005288 Bacteria 1729
81 Ga0065714_10104879 3300005288 Bacteria 1576
82 Ga0065714_10108528 3300005288 Bacteria 1513
83 Ga0065704_10000441 3300005289 Bacteria 40721
84 Ga0065704_10000981 3300005289 Bacteria 20736
85 Ga0065704_10002804 3300005289 Bacteria 11634
86 Ga0065704_10074928 3300005289 Bacteria 5905
87 Ga0065704_10076308 3300005289 Bacteria 5171
88 Ga0065704_10079284 3300005289 Bacteria 4206
89 Ga0065704_10085700 3300005289 Bacteria 3195
90 Ga0065704_10093930 3300005289 Bacteria 2570
91 Ga0065704_10095309 3300005289 Bacteria 2494
92 Ga0065712_10068313 3300005290 Bacteria 11825
93 Ga0065712_10079953 3300005290 Bacteria 3160
94 Ga0065715_10095933 3300005293 Bacteria 3969
95 Ga0070670_100283255 3300005331 Bacteria 1447
96 Ga0070660_100246220 3300005339 Bacteria 1457
97 Ga0070661_100004923 3300005344 Bacteria 9196
98 Ga0070669_100000313 3300005353 Bacteria 37996
99 Ga0070669_100000691 3300005353 Bacteria 24753
100 Ga0070659_100305183 3300005366 Bacteria 1328
101 Ga0070662_100003761 3300005457 Bacteria 9498
102 Ga0070662_100017614 3300005457 Bacteria 4820
103 Ga0070681_10004942 3300005458 Bacteria 12818
104 Ga0070679_100111266 3300005530 Bacteria 2725
105 Ga0068853_100002022 3300005539 Bacteria 14995
106 Ga0068853_100143573 3300005539 Bacteria 2144
107 Ga0068853_100207216 3300005539 Bacteria 1786
108 Ga0070665_100000191 3300005548 Bacteria 108807
109 Ga0070665_100048327 3300005548 Bacteria 4272
110 Ga0070665_100430501 3300005548 Bacteria 1328
111 Ga0070664_100000062 3300005564 Bacteria 65997
112 Ga0068857_100002061 3300005577 Bacteria 16334
113 Ga0068854_100104014 3300005578 Bacteria 2132
114 Ga0068851_10000004 3300005834 Bacteria 269685
115 Ga0081455_10234412 3300005937 Bacteria 1352
116 Ga0081540_1022308 3300005983 Bacteria 3741
117 Ga0075364_10025240 3300006051 Bacteria 3781
118 Ga0075364_10045215 3300006051 Bacteria 2865
119 Ga0075364_10063409 3300006051 Bacteria 2426
120 Ga0075364_10174293 3300006051 Bacteria 1454
121 Ga0075432_10000430 3300006058 Bacteria 12297
122 Ga0075432_10001440 3300006058 Bacteria 7761
123 Ga0075362_10007447 3300006177 Bacteria 4147
124 Ga0075369_10062893 3300006186 Bacteria 1622
125 Ga0075369_10083316 3300006186 Bacteria 1420
126 Ga0075366_10026091 3300006195 Bacteria 3420
127 Ga0075366_10034230 3300006195 Bacteria 2992
128 Ga0075370_10013321 3300006353 Bacteria 4367
129 Ga0075430_100235086 3300006846 Bacteria 1519
130 Ga0099823_1030284 3300006944 Bacteria 4536
131 Ga0099823_1048943 3300006944 Bacteria 2665
132 Ga0079104_1000164 3300006946 Bacteria 94084
133 Ga0079104_1000670 3300006946 Bacteria 32217
134 Ga0079104_1000973 3300006946 Bacteria 22420
135 Ga0079104_1001028 3300006946 Bacteria 21419
136 Ga0079104_1001053 3300006946 Bacteria 20907
137 Ga0079104_1001133 3300006946 Bacteria 19422
138 Ga0079104_1001349 3300006946 Bacteria 16772
139 Ga0079104_1016164 3300006946 Bacteria 2190
140 Ga0099826_10001603 3300006948 Bacteria 13795
141 Ga0105251_10000145 3300009011 Bacteria 72430
142 Ga0105251_10000320 3300009011 Bacteria 48103
143 Ga0105251_10000478 3300009011 Bacteria 37893
144 Ga0105251_10002029 3300009011 Bacteria 16425
145 Ga0105251_10003572 3300009011 Bacteria 11213
146 Ga0105251_10004352 3300009011 Bacteria 9684
147 Ga0105251_10005036 3300009011 Bacteria 8767
148 Ga0105251_10008082 3300009011 Bacteria 6371
149 Ga0105251_10014644 3300009011 Bacteria 4324
150 Ga0105251_10043066 3300009011 Bacteria 2188
151 Ga0105251_10050745 3300009011 Bacteria 1981
152 Ga0105251_10055935 3300009011 Bacteria 1869
153 Ga0105251_10058903 3300009011 Bacteria 1813
154 Ga0105251_10074721 3300009011 Bacteria 1574
155 Ga0105244_10000020 3300009036 Bacteria 241021
156 Ga0105244_10000908 3300009036 Bacteria 25011
157 Ga0105244_10001258 3300009036 Bacteria 20775
158 Ga0105244_10001405 3300009036 Bacteria 19496
159 Ga0105244_10001929 3300009036 Bacteria 16122
160 Ga0105244_10004386 3300009036 Bacteria 9728
161 Ga0105244_10004738 3300009036 Bacteria 9259
162 Ga0105244_10004882 3300009036 Bacteria 9087
163 Ga0105244_10007999 3300009036 Bacteria 6654
164 Ga0105244_10008927 3300009036 Bacteria 6207
165 Ga0105244_10010746 3300009036 Bacteria 5531
166 Ga0105244_10017190 3300009036 Bacteria 4097
167 Ga0105244_10025469 3300009036 Bacteria 3215
168 Ga0105244_10038102 3300009036 Bacteria 2509
169 Ga0105244_10043407 3300009036 Bacteria 2320
170 Ga0105244_10058077 3300009036 Bacteria 1954
171 Ga0105244_10079343 3300009036 Bacteria 1627
172 Ga0105244_10083581 3300009036 Bacteria 1578
173 Ga0105244_10106143 3300009036 Bacteria 1370
174 Ga0105250_10000009 3300009092 Bacteria 330307
175 Ga0105250_10000125 3300009092 Bacteria 66657
176 Ga0105250_10000467 3300009092 Bacteria 28775
177 Ga0105250_10000502 3300009092 Bacteria 27455
178 Ga0105250_10000907 3300009092 Bacteria 17427
179 Ga0105250_10002154 3300009092 Bacteria 10105
180 Ga0105250_10002468 3300009092 Bacteria 9279
181 Ga0105250_10003819 3300009092 Bacteria 7072
182 Ga0105250_10014681 3300009092 Bacteria 3214
183 Ga0105250_10017420 3300009092 Bacteria 2921
184 Ga0105250_10017507 3300009092 Bacteria 2914
185 Ga0105250_10022270 3300009092 Bacteria 2556
186 Ga0105250_10052245 3300009092 Bacteria 1640
187 Ga0105247_10000030 3300009101 Bacteria 187803
188 Ga0105243_10000100 3300009148 Bacteria 99372
189 Ga0105243_10000639 3300009148 Bacteria 34674
190 Ga0105243_10001648 3300009148 Bacteria 19360
191 Ga0105243_10009069 3300009148 Bacteria 7599
192 Ga0105243_10009900 3300009148 Bacteria 7249
193 Ga0105243_10040568 3300009148 Bacteria 3636
194 Ga0105241_10000001 3300009174 Bacteria 879793
195 Ga0105242_10000478 3300009176 Bacteria 31824
196 Ga0105242_10238641 3300009176 Bacteria 1633
197 Ga0105237_10002559 3300009545 Bacteria 22438
198 Ga0105033_101306 3300009986 Bacteria 2025
199 Ga0105246_10000237 3300011119 Bacteria 28356
200 Ga0105246_10014181 3300011119 Bacteria 5008
201 Ga0105246_10015549 3300011119 Bacteria 4808
202 Ga0105246_10056920 3300011119 Bacteria 2704
203 Ga0105246_10092795 3300011119 Bacteria 2180
204 Ga0157373_10000373 3300013100 Bacteria 35806
205 Ga0157373_10001594 3300013100 Bacteria 17328
206 Ga0157373_10002803 3300013100 Bacteria 13180
207 Ga0157373_10019659 3300013100 Bacteria 4913
208 Ga0157373_10041384 3300013100 Bacteria 3296
209 Ga0157373_10128200 3300013100 Bacteria 1784
210 Ga0157373_10209767 3300013100 Bacteria 1374
211 Ga0157371_10000099 3300013102 Bacteria 133829
212 Ga0157371_10003408 3300013102 Bacteria 14438
213 Ga0157371_10004573 3300013102 Bacteria 12034
214 Ga0157371_10011814 3300013102 Bacteria 6706
215 Ga0157371_10015149 3300013102 Bacteria 5792
216 Ga0157371_10021793 3300013102 Bacteria 4700
217 Ga0157371_10033428 3300013102 Bacteria 3695
218 Ga0157370_10000150 3300013104 Bacteria 85732
219 Ga0157370_10001912 3300013104 Bacteria 25625
220 Ga0157370_10026170 3300013104 Bacteria 5763
221 Ga0157370_10060869 3300013104 Bacteria 3584
222 Ga0157370_10095300 3300013104 Bacteria 2792
223 Ga0157370_10251262 3300013104 Bacteria 1635
224 Ga0157370_10297229 3300013104 Bacteria 1491
225 Ga0157369_10011869 3300013105 Bacteria 9895
226 Ga0157369_10043532 3300013105 Bacteria 4893
227 Ga0157369_10307169 3300013105 Bacteria 1650
228 Ga0171462_1042 3300013250 Bacteria 66199
229 Ga0163162_10335420 3300013306 Bacteria 1644
230 Ga0157372_10004722 3300013307 Bacteria 14474
231 Ga0157372_10010613 3300013307 Bacteria 9800
232 Ga0157372_10126252 3300013307 Bacteria 2941
233 Ga0157372_10401376 3300013307 Bacteria 1597
234 Ga0157375_10038552 3300013308 Bacteria 4588
235 Ga0157380_10011062 3300014326 Bacteria 6510
236 Ga0182008_10001110 3300014497 Bacteria 18522
237 Ga0182008_10001450 3300014497 Bacteria 15842
238 Ga0182008_10013093 3300014497 Bacteria 4363
239 Ga0182008_10022989 3300014497 Bacteria 3189
240 Ga0182008_10091633 3300014497 Bacteria 1499
241 Ga0182008_10099374 3300014497 Bacteria 1437
242 Ga0182006_1000018 3300015261 Bacteria 299376
243 Ga0182006_1003209 3300015261 Bacteria 8501
244 Ga0182006_1006488 3300015261 Bacteria 5434
245 Ga0182006_1008810 3300015261 Bacteria 4559
246 Ga0182006_1018838 3300015261 Bacteria 2912
247 Ga0182007_10043059 3300015262 Bacteria 1501
248 Ga0182005_1000422 3300015265 Bacteria 22747
249 Ga0182005_1030897 3300015265 Bacteria 1459
250 Ga0183366_1001 3300015679 Bacteria 2743932
251 Ga0183370_1001 3300015680 Bacteria 2743932
252 Ga0183369_1001 3300015685 Bacteria 2743932
253 Ga0183368_1001 3300015687 Bacteria 2743932
254 Ga0163161_10000031 3300017792 Bacteria 166584
255 Ga0163161_10176355 3300017792 Bacteria 1636
256 Ga0163161_10205761 3300017792 Bacteria 1518
257 Ga0163161_10212350 3300017792 Bacteria 1495
258 Ga0163161_10216470 3300017792 Bacteria 1482
259 Ga0163161_10327356 3300017792 Unclassified 1213
260 Ga0163161_10338463 3300017792 Bacteria 1193
261 Ga0209435_101162 3300025206 Bacteria 3616
262 Ga0209760_100031 3300025207 Bacteria 141487
263 Ga0209760_100056 3300025207 Bacteria 100067
264 Ga0209760_100137 3300025207 Bacteria 46738
265 Ga0209760_100139 3300025207 Bacteria 46193
266 Ga0209436_100580 3300025208 Bacteria 15666
267 Ga0209784_100001 3300025224 Bacteria 3600592
268 Ga0209784_100028 3300025224 Bacteria 357464
269 Ga0209566_100001 3300025225 Bacteria 3600765
270 Ga0209566_100028 3300025225 Bacteria 357464
271 Ga0209674_100002 3300025226 Bacteria 3600592
272 Ga0209674_100047 3300025226 Bacteria 357464
273 Ga0209147_100031 3300025229 Bacteria 357464
274 Ga0209563_100008 3300025230 Bacteria 1554545
275 Ga0209563_100050 3300025230 Bacteria 357464
276 Ga0209563_102472 3300025230 Bacteria 4171
277 Ga0207427_100016 3300025231 Bacteria 538697
278 Ga0207427_100067 3300025231 Bacteria 164839
279 Ga0207427_100231 3300025231 Bacteria 46613
280 Ga0209437_100007 3300025233 Bacteria 938377
281 Ga0209437_100011 3300025233 Bacteria 818520
282 Ga0209437_100016 3300025233 Bacteria 710118
283 Ga0209437_104358 3300025233 Bacteria 2503
284 Ga0209258_100170 3300025242 Bacteria 145191
285 Ga0209646_1000357 3300025246 Bacteria 31806
286 Ga0209677_100004 3300025253 Bacteria 1554545
287 Ga0209677_100029 3300025253 Bacteria 357464
288 Ga0209759_1005835 3300025256 Bacteria 4226
289 Ga0209129_1001115 3300025258 Bacteria 15655
290 Ga0209233_1000019 3300025261 Bacteria 818520
291 Ga0209233_1000156 3300025261 Bacteria 164839
292 Ga0209673_1000206 3300025273 Bacteria 118136
293 Ga0209673_1002157 3300025273 Bacteria 14570
294 Ga0209673_1009790 3300025273 Bacteria 4108
295 Ga0209130_1000274 3300025284 Bacteria 64411
296 Ga0209130_1000325 3300025284 Bacteria 55752
297 Ga0209130_1000461 3300025284 Bacteria 42274
298 Ga0209130_1000870 3300025284 Bacteria 24713
299 Ga0209675_1002688 3300025291 Bacteria 8957
300 Ga0209676_1000025 3300025292 Bacteria 577569
301 Ga0209676_1000096 3300025292 Bacteria 240620
302 Ga0209676_1000266 3300025292 Bacteria 109375
303 Ga0209676_1000722 3300025292 Bacteria 45471
304 Ga0209676_1009457 3300025292 Bacteria 4200
305 Ga0209676_1009480 3300025292 Bacteria 4194
306 Ga0209025_1000053 3300025294 Bacteria 317600
307 Ga0209025_1000062 3300025294 Bacteria 304236
308 Ga0209025_1000190 3300025294 Bacteria 153726
309 Ga0209025_1000261 3300025294 Bacteria 123705
310 Ga0209025_1000282 3300025294 Bacteria 115627
311 Ga0209564_1000987 3300025295 Bacteria 35584
312 Ga0209758_1000245 3300025297 Bacteria 111769
313 Ga0209758_1001726 3300025297 Bacteria 24371
314 Ga0209758_1004259 3300025297 Bacteria 12099
315 Ga0209758_1007665 3300025297 Bacteria 7268
316 Ga0209758_1011622 3300025297 Bacteria 5066
317 Ga0209050_1000028 3300025298 Bacteria 477133
318 Ga0209050_1000301 3300025298 Bacteria 103314
319 Ga0209050_1000356 3300025298 Bacteria 88117
320 Ga0209050_1001464 3300025298 Bacteria 25257
321 Ga0209050_1003956 3300025298 Bacteria 10468
322 Ga0209256_1003166 3300025299 Bacteria 11927
323 Ga0207426_1000066 3300025302 Bacteria 351182
324 Ga0207426_1000109 3300025302 Bacteria 238665
325 Ga0207426_1000460 3300025302 Bacteria 63857
326 Ga0207426_1000474 3300025302 Bacteria 61569
327 Ga0207426_1000545 3300025302 Bacteria 52897
328 Ga0209051_1000089 3300025303 Bacteria 175572
329 Ga0209051_1000225 3300025303 Bacteria 95205
330 Ga0209051_1000264 3300025303 Bacteria 87736
331 Ga0209051_1000467 3300025303 Bacteria 52965
332 Ga0209051_1008473 3300025303 Bacteria 5436
333 Ga0209051_1009287 3300025303 Bacteria 5082
334 Ga0209257_1000034 3300025304 Bacteria 662719
335 Ga0209257_1002752 3300025304 Bacteria 16635
336 Ga0209257_1003051 3300025304 Bacteria 15095
337 Ga0207656_10000007 3300025321 Bacteria 289154
338 Ga0207696_1000001 3300025711 Bacteria 2579611
339 Ga0207696_1000005 3300025711 Bacteria 642078
340 Ga0207696_1000058 3300025711 Bacteria 248495
341 Ga0207696_1000065 3300025711 Bacteria 231818
342 Ga0207696_1000085 3300025711 Bacteria 195968
343 Ga0207696_1000122 3300025711 Bacteria 143543
344 Ga0207696_1000561 3300025711 Bacteria 29454
345 Ga0207696_1000629 3300025711 Bacteria 25886
346 Ga0207696_1002299 3300025711 Bacteria 9492
347 Ga0207696_1003450 3300025711 Bacteria 7207
348 Ga0207696_1006288 3300025711 Bacteria 4806
349 Ga0207696_1009217 3300025711 Bacteria 3691
350 Ga0207696_1009548 3300025711 Bacteria 3611
351 Ga0207696_1010164 3300025711 Bacteria 3465
352 Ga0207655_1000002 3300025728 Bacteria 1148694
353 Ga0207655_1000004 3300025728 Bacteria 1021221
354 Ga0207655_1000014 3300025728 Bacteria 607124
355 Ga0207655_1000041 3300025728 Bacteria 333962
356 Ga0207655_1000227 3300025728 Bacteria 94083
357 Ga0207655_1000394 3300025728 Bacteria 60812
358 Ga0207655_1000443 3300025728 Bacteria 55002
359 Ga0207655_1000678 3300025728 Bacteria 39720
360 Ga0207655_1003228 3300025728 Bacteria 12246
361 Ga0207655_1004333 3300025728 Bacteria 10118
362 Ga0207655_1004334 3300025728 Bacteria 10117
363 Ga0207655_1004908 3300025728 Bacteria 9279
364 Ga0207655_1005999 3300025728 Bacteria 8127
365 Ga0207655_1012607 3300025728 Bacteria 4926
366 Ga0207655_1013326 3300025728 Bacteria 4728
367 Ga0207655_1024328 3300025728 Bacteria 2971
368 Ga0207655_1026304 3300025728 Bacteria 2796
369 Ga0207655_1028526 3300025728 Bacteria 2632
370 Ga0207655_1028656 3300025728 Bacteria 2623
371 Ga0207655_1046564 3300025728 Bacteria 1800
372 Ga0207655_1066948 3300025728 Bacteria 1354
373 Ga0207713_1000002 3300025735 Bacteria 1061749
374 Ga0207713_1000004 3300025735 Bacteria 702781
375 Ga0207713_1000018 3300025735 Bacteria 362635
376 Ga0207713_1000022 3300025735 Bacteria 351775
377 Ga0207713_1000067 3300025735 Bacteria 195418
378 Ga0207713_1000094 3300025735 Bacteria 146176
379 Ga0207713_1000964 3300025735 Bacteria 25438
380 Ga0207713_1001330 3300025735 Bacteria 20250
381 Ga0207713_1004153 3300025735 Bacteria 9517
382 Ga0207713_1007041 3300025735 Bacteria 6736
383 Ga0207713_1008064 3300025735 Bacteria 6112
384 Ga0207713_1008210 3300025735 Bacteria 6042
385 Ga0207713_1011692 3300025735 Bacteria 4749
386 Ga0207713_1013070 3300025735 Bacteria 4399
387 Ga0207713_1016008 3300025735 Bacteria 3824
388 Ga0207713_1019652 3300025735 Bacteria 3298
389 Ga0207713_1020173 3300025735 Bacteria 3238
390 Ga0207713_1020309 3300025735 Bacteria 3222
391 Ga0207713_1022531 3300025735 Bacteria 2987
392 Ga0207713_1037981 3300025735 Bacteria 2048
393 Ga0207713_1039478 3300025735 Bacteria 1991
394 Ga0207710_10000068 3300025900 Bacteria 152636
395 Ga0207654_10000004 3300025911 Bacteria 902334
396 Ga0207707_10003784 3300025912 Bacteria 13409
397 Ga0207671_10000015 3300025914 Bacteria 439607
398 Ga0207649_10000001 3300025920 Bacteria 537851
399 Ga0207652_10163162 3300025921 Bacteria 1998
400 Ga0207646_10249818 3300025922 Bacteria 1602
401 Ga0207681_10000115 3300025923 Bacteria 67810
402 Ga0207681_10000917 3300025923 Bacteria 19251
403 Ga0207650_10005199 3300025925 Bacteria 8876
404 Ga0207650_10005751 3300025925 Bacteria 8458
405 Ga0207706_10002419 3300025933 Bacteria 18213
406 Ga0207706_10006144 3300025933 Bacteria 11153
407 Ga0207686_10000588 3300025934 Bacteria 22744
408 Ga0207709_10000022 3300025935 Bacteria 383573
409 Ga0207709_10000252 3300025935 Bacteria 64225
410 Ga0207709_10005827 3300025935 Bacteria 6963
411 Ga0207709_10014232 3300025935 Bacteria 4390
412 Ga0207709_10276151 3300025935 Bacteria 1239
413 Ga0207679_10000011 3300025945 Bacteria 346112
414 Ga0207639_10002699 3300026041 Bacteria 11910
415 Ga0207639_10061278 3300026041 Bacteria 2905
416 Ga0207639_10128523 3300026041 Bacteria 2094
417 Ga0207708_10337085 3300026075 Bacteria 1234
418 Ga0207674_10004718 3300026116 Bacteria 16341
419 Ga0209281_1000006 3300027111 Bacteria 1170244
420 Ga0209281_1000033 3300027111 Bacteria 383539
421 Ga0209281_1000038 3300027111 Bacteria 361154
422 Ga0209281_1000071 3300027111 Bacteria 274050
423 Ga0209281_1000109 3300027111 Bacteria 216504
424 Ga0209281_1000159 3300027111 Bacteria 161872
425 Ga0209281_1000257 3300027111 Bacteria 103090
426 Ga0209281_1001006 3300027111 Bacteria 22077
427 Ga0209281_1002968 3300027111 Bacteria 6045
428 Ga0209389_1000298 3300027296 Bacteria 30991
429 Ga0209371_1000001 3300027312 Bacteria 2771503
430 Ga0209371_1000005 3300027312 Bacteria 1061740
431 Ga0209371_1000089 3300027312 Bacteria 173483
432 Ga0209371_1000153 3300027312 Bacteria 108815
433 Ga0209371_1000496 3300027312 Bacteria 38249
434 Ga0209371_1001032 3300027312 Bacteria 21055
435 Ga0209371_1002187 3300027312 Bacteria 11404
436 Ga0209371_1002726 3300027312 Bacteria 9510
437 Ga0209371_1003926 3300027312 Bacteria 6831
438 Ga0209371_1023281 3300027312 Bacteria 1461
439 Ga0209282_1043159 3300027666 Bacteria 2654
440 Ga0207428_10010914 3300027907 Bacteria 8086
441 Ga0207428_10047509 3300027907 Bacteria 3446
442 Ga0268266_10001011 3300028379 Bacteria 35400
443 Ga0268266_10008268 3300028379 Bacteria 9272
444 Ga0268256_1000001 3300030500 Bacteria 2771065
445 Ga0268256_1000006 3300030500 Bacteria 1063991
446 Ga0268256_1000103 3300030500 Bacteria 129125
447 Ga0268256_1001232 3300030500 Bacteria 16066
448 Ga0268256_1001701 3300030500 Bacteria 12552
449 Ga0268256_1001923 3300030500 Bacteria 11404
450 Ga0268256_1002152 3300030500 Bacteria 10466
451 Ga0268256_1002425 3300030500 Bacteria 9517
452 Ga0268256_1003645 3300030500 Bacteria 6831
453 Ga0268256_1026373 3300030500 Bacteria 1461
454 Ga0316178_1009271 3300030735 Bacteria 51087
455 Ga0316181_1270085 3300030744 Bacteria 7045
456 Ga0316181_1279945 3300030744 Bacteria 1605
457 Ga0265327_10058290 3300031251 Bacteria 1982
458 Ga0307408_100034206 3300031548 Bacteria 3557
459 Ga0307408_100299887 3300031548 Bacteria 1345
460 Ga0307516_10217623 3300031730 Bacteria 1621
461 Ga0307405_10173132 3300031731 Bacteria 1542
462 Ga0307409_100245063 3300031995 Bacteria 1634
463 Ga0307411_10200626 3300032005 Bacteria 1531
464 Ga0307510_10026777 3300033180 Bacteria 6619
465 Ga0307510_10173174 3300033180 Bacteria 1733
466 Ga0237819_00859 3300038705 Bacteria 9568
467 Ga0436360_1287249 3300039438 Bacteria 2444
468 Ga0436361_0524714 3300039447 Bacteria 1880
469 Ga0439436_0002120 3300041404 Bacteria 5920
470 Ga0439438_000498 3300041405 Bacteria 17802
471 Ga0439438_001218 3300041405 Bacteria 11404
472 Ga0439438_001498 3300041405 Bacteria 10295
473 Ga0439438_001594 3300041405 Bacteria 9970
474 Ga0439438_003029 3300041405 Bacteria 6922
475 Ga0439438_004069 3300041405 Bacteria 5727
476 Ga0439438_004895 3300041405 Bacteria 5021
477 Ga0439447_000310 3300041407 Bacteria 17421
478 Ga0439447_000501 3300041407 Bacteria 14560
479 Ga0439447_012552 3300041407 Bacteria 2430
480 Ga0439447_013724 3300041407 Bacteria 2290
481 Ga0439447_025060 3300041407 Bacteria 1539
482 Ga0439466_0000334 3300041411 Bacteria 18158
483 Ga0439466_0000620 3300041411 Bacteria 13368
484 Ga0439466_0000665 3300041411 Bacteria 12944
485 Ga0439466_0001745 3300041411 Bacteria 8500
486 Ga0439466_0004892 3300041411 Bacteria 5148
487 Ga0439466_0010143 3300041411 Bacteria 3502
488 Ga0439466_0021445 3300041411 Bacteria 2288
489 Ga0439466_0029369 3300041411 Bacteria 1892
490 Ga0439465_0000550 3300041413 Bacteria 11247
491 Ga0439465_0028570 3300041413 Bacteria 1769
492 Ga0451853_1126616 3300041512 Bacteria 5590
493 Ga0451853_2641771 3300041512 Bacteria 2584
494 Ga0439431_0002829 3300041997 Bacteria 3815
495 Ga0439431_0027821 3300041997 Bacteria 1391
496 Ga0439445_0009126 3300042004 Bacteria 2332
497 Ga0439445_0031278 3300042004 Bacteria 1383
498 Ga0439432_001900 3300042006 Bacteria 7875
499 Ga0439432_002858 3300042006 Bacteria 6437
500 Ga0439432_005967 3300042006 Bacteria 4372
501 Ga0439432_008787 3300042006 Bacteria 3536
502 Ga0439432_049980 3300042006 Bacteria 1306
503 Ga0439449_0019279 3300042007 Bacteria 2557
504 Ga0439451_004666 3300042009 Bacteria 2788
505 Ga0439452_000002 3300042010 Bacteria 1377577
506 Ga0439452_000101 3300042010 Bacteria 72026
507 Ga0439452_000628 3300042010 Bacteria 17817
508 Ga0439452_000662 3300042010 Bacteria 17058
509 Ga0439452_002594 3300042010 Bacteria 6625
510 Ga0439452_004284 3300042010 Bacteria 4822
511 Ga0439452_006204 3300042010 Bacteria 3762
512 Ga0439452_017215 3300042010 Bacteria 1948
513 Ga0439452_021422 3300042010 Bacteria 1684
514 Ga0439452_026388 3300042010 Bacteria 1466
515 Ga0439456_002941 3300042013 Bacteria 3446
516 Ga0439456_007129 3300042013 Bacteria 2290
517 Ga0439463_000574 3300042016 Bacteria 10292
518 Ga0439463_002244 3300042016 Bacteria 4958
519 Ga0439463_002774 3300042016 Bacteria 4442
520 Ga0439463_004470 3300042016 Bacteria 3509
521 Ga0450911_002519 3300042115 Bacteria 3561
522 Ga0450919_003687 3300042121 Bacteria 1901
523 Ga0450922_002044 3300042124 Bacteria 1923
524 Ga0450890_001172 3300042127 Bacteria 3793
525 Ga0450902_000023 3300042137 Bacteria 13838
526 Ga0450903_001230 3300042138 Bacteria 4809
527 Ga0450903_002557 3300042138 Bacteria 3228
528 Ga0450906_001654 3300042145 Bacteria 4894
529 Ga0450907_000201 3300042146 Bacteria 21621
530 Ga0450907_001929 3300042146 Bacteria 4192
531 Ga0450907_002149 3300042146 Bacteria 3877
532 Ga0450910_004385 3300042147 Bacteria 1905
533 Ga0439446_0001401 3300042156 Bacteria 5465
534 Ga0439446_0005590 3300042156 Bacteria 3238
535 Ga0439446_0007826 3300042156 Bacteria 2818
536 Ga0450908_002206 3300042184 Bacteria 3822
537 Ga0450909_000517 3300042185 Bacteria 5038
538 Ga0439434_0002623 3300042435 Bacteria 5236
539 Ga0439434_0023103 3300042435 Bacteria 1870
540 Ga0439464_0004184 3300042439 Bacteria 3678
541 Ga0439464_0023444 3300042439 Bacteria 1704
542 Ga0439460_0000611 3300042461 Bacteria 7880
543 Ga0439460_0002720 3300042461 Bacteria 4262
544 Ga0451577_0018662 3300042876 Bacteria 6386
545 Ga0466981_0000008 3300044669 Bacteria 147179
546 Ga0453684_0002280 3300044712 Bacteria 47260
547 Ga0466959_0085344 3300045049 Bacteria 2272
548 Ga0495617_002486 3300046452 Bacteria 7313
549 Ga0495617_037767 3300046452 Bacteria 1616
550 Ga0495627_000019 3300046453 Bacteria 309691
551 Ga0495627_000117 3300046453 Bacteria 99610
552 Ga0495627_000551 3300046453 Bacteria 30944
553 Ga0495627_004205 3300046453 Bacteria 6095
554 Ga0495627_006324 3300046453 Bacteria 4651
555 Ga0495627_031662 3300046453 Bacteria 1668
556 Ga0495603_0003088 3300046455 Bacteria 9891
557 Ga0495603_0139336 3300046455 Bacteria 1411
558 Ga0495590_0000657 3300046457 Bacteria 16002
559 Ga0495590_0012603 3300046457 Bacteria 3134
560 Ga0495590_0016167 3300046457 Bacteria 2696
561 Ga0495591_000057 3300046458 Bacteria 132157
562 Ga0495591_000059 3300046458 Bacteria 130522
563 Ga0495591_000619 3300046458 Bacteria 26640
564 Ga0495591_001018 3300046458 Bacteria 18940
565 Ga0495591_002042 3300046458 Bacteria 11727
566 Ga0495591_002860 3300046458 Bacteria 9275
567 Ga0495591_005213 3300046458 Bacteria 6084
568 Ga0495591_007937 3300046458 Bacteria 4420
569 Ga0495591_023061 3300046458 Bacteria 2001
570 Ga0495591_029879 3300046458 Bacteria 1650
571 Ga0495629_0023997 3300046459 Bacteria 4344
572 Ga0495638_0001624 3300046460 Bacteria 20011
573 Ga0495638_0020882 3300046460 Bacteria 4323
574 Ga0495638_0032284 3300046460 Bacteria 3358
575 Ga0495638_0126224 3300046460 Bacteria 1507
576 Ga0495638_0126805 3300046460 Bacteria 1503
577 Ga0495653_0010480 3300046463 Bacteria 7585
578 Ga0495653_0083924 3300046463 Bacteria 2347
579 Ga0495653_0120013 3300046463 Bacteria 1875
580 Ga0495653_0203599 3300046463 Bacteria 1341
581 Ga0495650_0000031 3300046471 Bacteria 433811
582 Ga0495650_0000090 3300046471 Bacteria 232897
583 Ga0495650_0000493 3300046471 Bacteria 59904
584 Ga0495650_0001674 3300046471 Bacteria 20469
585 Ga0495650_0002040 3300046471 Bacteria 17653
586 Ga0495650_0005457 3300046471 Bacteria 8253
587 Ga0495650_0007113 3300046471 Bacteria 6797
588 Ga0495650_0010884 3300046471 Bacteria 5038
589 Ga0495650_0018034 3300046471 Bacteria 3520
590 Ga0495605_0000093 3300046474 Bacteria 113652
591 Ga0495605_0000106 3300046474 Bacteria 105494
592 Ga0495605_0000398 3300046474 Bacteria 40047
593 Ga0495605_0000623 3300046474 Bacteria 27301
594 Ga0495605_0000674 3300046474 Bacteria 25755
595 Ga0495605_0002177 3300046474 Bacteria 12245
596 Ga0495605_0002729 3300046474 Bacteria 10775
597 Ga0495605_0004162 3300046474 Bacteria 8520
598 Ga0495605_0004990 3300046474 Bacteria 7752
599 Ga0495605_0015840 3300046474 Bacteria 4093
600 Ga0495605_0024658 3300046474 Bacteria 3143
601 Ga0495605_0089390 3300046474 Bacteria 1429
602 Ga0495639_0001663 3300046475 Bacteria 9885
603 Ga0495639_0003693 3300046475 Bacteria 6591
604 Ga0495584_0000056 3300046491 Bacteria 81387
605 Ga0495584_0000721 3300046491 Bacteria 21813
606 Ga0495584_0003343 3300046491 Bacteria 8861
607 Ga0495584_0008479 3300046491 Bacteria 5323
608 Ga0495584_0008776 3300046491 Bacteria 5226
609 Ga0495584_0008890 3300046491 Bacteria 5192
610 Ga0495584_0011447 3300046491 Bacteria 4542
611 Ga0495584_0015653 3300046491 Bacteria 3867
612 Ga0495585_0001600 3300046492 Bacteria 17498
613 Ga0495585_0052856 3300046492 Bacteria 2248
614 Ga0495585_0052945 3300046492 Bacteria 2247
615 Ga0495585_0092853 3300046492 Bacteria 1623
616 Ga0495585_0099000 3300046492 Bacteria 1561
617 Ga0495585_0106755 3300046492 Bacteria 1492
618 Ga0495594_0001925 3300046499 Bacteria 10832
619 Ga0495594_0025819 3300046499 Bacteria 3158
620 Ga0495596_0000810 3300046500 Bacteria 18926
621 Ga0495596_0014963 3300046500 Bacteria 3259
622 Ga0495596_0043369 3300046500 Bacteria 1773
623 Ga0495596_0084890 3300046500 Bacteria 1229
624 Ga0495607_0000425 3300046501 Bacteria 42890
625 Ga0495607_0000443 3300046501 Bacteria 41669
626 Ga0495607_0000564 3300046501 Bacteria 36186
627 Ga0495607_0001753 3300046501 Bacteria 18564
628 Ga0495607_0002121 3300046501 Bacteria 16567
629 Ga0495607_0005450 3300046501 Bacteria 9105
630 Ga0495607_0006483 3300046501 Bacteria 8230
631 Ga0495607_0017113 3300046501 Bacteria 4663
632 Ga0495607_0024819 3300046501 Bacteria 3733
633 Ga0495607_0025613 3300046501 Bacteria 3667
634 Ga0495607_0037333 3300046501 Bacteria 2919
635 Ga0495607_0037970 3300046501 Bacteria 2888
636 Ga0495607_0063508 3300046501 Bacteria 2088
637 Ga0495607_0087000 3300046501 Bacteria 1702
638 Ga0495607_0091210 3300046501 Bacteria 1650
639 Ga0495607_0160091 3300046501 Bacteria 1144
640 Ga0495583_0000105 3300046506 Bacteria 142444
641 Ga0495583_0000327 3300046506 Bacteria 75285
642 Ga0495583_0000610 3300046506 Bacteria 48428
643 Ga0495583_0000663 3300046506 Bacteria 45092
644 Ga0495583_0001084 3300046506 Bacteria 30185
645 Ga0495583_0003160 3300046506 Bacteria 12967
646 Ga0495583_0005897 3300046506 Bacteria 8156
647 Ga0495583_0011350 3300046506 Bacteria 5120
648 Ga0495583_0061864 3300046506 Bacteria 1668
649 Ga0495583_0082047 3300046506 Bacteria 1400
650 Ga0495606_0000384 3300046507 Bacteria 75041
651 Ga0495606_0000568 3300046507 Bacteria 58524
652 Ga0495606_0000613 3300046507 Bacteria 56133
653 Ga0495606_0001546 3300046507 Bacteria 30307
654 Ga0495606_0009470 3300046507 Bacteria 8238
655 Ga0495606_0009914 3300046507 Bacteria 7979
656 Ga0495606_0017681 3300046507 Bacteria 5380
657 Ga0495606_0018554 3300046507 Bacteria 5210
658 Ga0495606_0021496 3300046507 Bacteria 4726
659 Ga0495606_0032264 3300046507 Bacteria 3630
660 Ga0495606_0115019 3300046507 Bacteria 1617
661 Ga0495606_0132736 3300046507 Bacteria 1478
662 Ga0495606_0136279 3300046507 Bacteria 1453
663 Ga0495606_0175549 3300046507 Bacteria 1239
664 Ga0495610_0001910 3300046512 Bacteria 17974
665 Ga0495610_0007780 3300046512 Bacteria 7070
666 Ga0495610_0010267 3300046512 Bacteria 5835
667 Ga0495610_0017120 3300046512 Bacteria 4142
668 Ga0495610_0021472 3300046512 Bacteria 3549
669 Ga0495610_0032164 3300046512 Bacteria 2730
670 Ga0495610_0036793 3300046512 Bacteria 2498
671 Ga0495610_0052983 3300046512 Bacteria 1967
672 Ga0495610_0069315 3300046512 Bacteria 1651
673 Ga0495616_0013437 3300046513 Bacteria 4618
674 Ga0495616_0034408 3300046513 Bacteria 2632
675 Ga0495616_0071217 3300046513 Bacteria 1681
676 Ga0495616_0076326 3300046513 Bacteria 1611
677 Ga0495616_0078233 3300046513 Bacteria 1586
678 Ga0495616_0083980 3300046513 Bacteria 1518
679 Ga0495616_0098549 3300046513 Bacteria 1373
680 Ga0495620_0000071 3300046515 Bacteria 85732
681 Ga0495620_0000353 3300046515 Bacteria 31870
682 Ga0495620_0001683 3300046515 Bacteria 13041
683 Ga0495620_0004814 3300046515 Bacteria 7586
684 Ga0495620_0009341 3300046515 Bacteria 5220
685 Ga0495620_0023714 3300046515 Bacteria 2928
686 Ga0495620_0034588 3300046515 Bacteria 2280
687 Ga0495620_0037060 3300046515 Bacteria 2175
688 Ga0495620_0056079 3300046515 Bacteria 1659
689 Ga0495630_0019223 3300046517 Bacteria 5021
690 Ga0495631_0000110 3300046518 Bacteria 54728
691 Ga0495631_0025731 3300046518 Bacteria 2706
692 Ga0495631_0036702 3300046518 Bacteria 2187
693 Ga0495632_0000265 3300046519 Bacteria 52032
694 Ga0495632_0001736 3300046519 Bacteria 17674
695 Ga0495632_0006622 3300046519 Bacteria 7411
696 Ga0495632_0007347 3300046519 Bacteria 6934
697 Ga0495632_0009322 3300046519 Bacteria 5925
698 Ga0495632_0011651 3300046519 Bacteria 5122
699 Ga0495632_0017874 3300046519 Bacteria 3901
700 Ga0495632_0033367 3300046519 Bacteria 2643
701 Ga0495632_0077817 3300046519 Bacteria 1585
702 Ga0495632_0102475 3300046519 Bacteria 1348
703 Ga0495632_0109835 3300046519 Bacteria 1295
704 Ga0495637_0000216 3300046520 Bacteria 44389
705 Ga0495637_0000488 3300046520 Bacteria 28750
706 Ga0495637_0000687 3300046520 Bacteria 23309
707 Ga0495637_0001900 3300046520 Bacteria 11905
708 Ga0495637_0009397 3300046520 Bacteria 4771
709 Ga0495637_0009448 3300046520 Bacteria 4755
710 Ga0495637_0013767 3300046520 Bacteria 3833
711 Ga0495637_0016618 3300046520 Bacteria 3438
712 Ga0495637_0050010 3300046520 Bacteria 1754
713 Ga0495637_0065583 3300046520 Bacteria 1478
714 Ga0495643_0000585 3300046522 Bacteria 44407
715 Ga0495643_0002726 3300046522 Bacteria 13592
716 Ga0495643_0007542 3300046522 Bacteria 7002
717 Ga0495643_0009165 3300046522 Bacteria 6180
718 Ga0495643_0014200 3300046522 Bacteria 4742
719 Ga0495643_0032002 3300046522 Bacteria 2922
720 Ga0495644_0001299 3300046523 Bacteria 10246
721 Ga0495644_0001407 3300046523 Bacteria 9825
722 Ga0495644_0005713 3300046523 Bacteria 4855
723 Ga0495644_0023353 3300046523 Bacteria 2354
724 Ga0495648_0001916 3300046524 Bacteria 19825
725 Ga0495648_0003690 3300046524 Bacteria 13384
726 Ga0495648_0004560 3300046524 Bacteria 11804
727 Ga0495648_0006334 3300046524 Bacteria 9681
728 Ga0495648_0007582 3300046524 Bacteria 8666
729 Ga0495648_0008853 3300046524 Bacteria 7874
730 Ga0495648_0045693 3300046524 Bacteria 2721
731 Ga0495648_0076196 3300046524 Bacteria 1926
732 Ga0495648_0095426 3300046524 Bacteria 1654
733 Ga0495648_0096643 3300046524 Bacteria 1640
734 Ga0495648_0097987 3300046524 Bacteria 1625
735 Ga0495648_0098006 3300046524 Bacteria 1624
736 Ga0495666_0111942 3300046526 Bacteria 1281
737 Ga0495642_0000361 3300046528 Bacteria 24687
738 Ga0495642_0003199 3300046528 Bacteria 6489
739 Ga0495642_0059416 3300046528 Bacteria 1584
740 Ga0495654_0000098 3300046530 Bacteria 98806
741 Ga0495654_0000818 3300046530 Bacteria 23720
742 Ga0495654_0000955 3300046530 Bacteria 21364
743 Ga0495654_0002993 3300046530 Bacteria 10567
744 Ga0495654_0004622 3300046530 Bacteria 8125
745 Ga0495654_0005237 3300046530 Bacteria 7567
746 Ga0495654_0011053 3300046530 Bacteria 4902
747 Ga0495654_0011442 3300046530 Bacteria 4800
748 Ga0495654_0012057 3300046530 Bacteria 4656
749 Ga0495654_0037409 3300046530 Bacteria 2434
750 Ga0495654_0059781 3300046530 Bacteria 1833
751 Ga0495654_0088775 3300046530 Bacteria 1437
752 Ga0495654_0124101 3300046530 Bacteria 1165
753 Ga0495586_0008590 3300046535 Bacteria 5437
754 Ga0495587_0005426 3300046536 Bacteria 8324
755 Ga0495609_0000056 3300046538 Bacteria 146060
756 Ga0495609_0000196 3300046538 Bacteria 60569
757 Ga0495609_0000275 3300046538 Bacteria 47724
758 Ga0495609_0001849 3300046538 Bacteria 13539
759 Ga0495609_0011092 3300046538 Bacteria 4302
760 Ga0495609_0066997 3300046538 Bacteria 1581
761 Ga0495609_0091835 3300046538 Bacteria 1320
762 Ga0495597_0000090 3300046542 Bacteria 80509
763 Ga0495597_0000482 3300046542 Bacteria 33359
764 Ga0495597_0000627 3300046542 Bacteria 28810
765 Ga0495597_0029378 3300046542 Bacteria 2510
766 Ga0495597_0068913 3300046542 Bacteria 1527
767 Ga0495597_0073274 3300046542 Bacteria 1472
768 Ga0495645_0107898 3300046543 Bacteria 1973
769 Ga0495622_0000577 3300046557 Bacteria 21933
770 Ga0495622_0002011 3300046557 Bacteria 9942
771 Ga0495622_0009385 3300046557 Bacteria 4527
772 Ga0495622_0045649 3300046557 Bacteria 2035
773 Ga0495622_0068076 3300046557 Bacteria 1644
774 Ga0495633_0000169 3300046558 Bacteria 86289
775 Ga0495633_0010976 3300046558 Bacteria 4918
776 Ga0495633_0039030 3300046558 Bacteria 2266
777 Ga0495668_0001865 3300046616 Bacteria 18894
778 Ga0495668_0028942 3300046616 Bacteria 3131
779 Ga0495668_0029043 3300046616 Bacteria 3125
780 Ga0495668_0063743 3300046616 Bacteria 2029
781 Ga0495668_0096405 3300046616 Bacteria 1618
782 Ga0495634_0001928 3300046642 Bacteria 17757
783 Ga0495634_0108470 3300046642 Bacteria 1787
784 Ga0495611_0000772 3300046648 Bacteria 17876
785 Ga0495611_0003100 3300046648 Bacteria 7380
786 Ga0495611_0031356 3300046648 Bacteria 2339
787 Ga0495611_0043191 3300046648 Bacteria 2015
788 Ga0495611_0058897 3300046648 Bacteria 1743
789 Ga0495625_0000082 3300046660 Bacteria 153730
790 Ga0495625_0003062 3300046660 Bacteria 17123
791 Ga0495625_0005099 3300046660 Bacteria 12154
792 Ga0495625_0013828 3300046660 Bacteria 6466
793 Ga0495625_0135276 3300046660 Bacteria 1666
794 Ga0495625_0137336 3300046660 Bacteria 1651
795 Ga0495635_0043550 3300046663 Bacteria 3097
796 Ga0495635_0113024 3300046663 Bacteria 1854
797 Ga0495659_0000023 3300046664 Bacteria 71429
798 Ga0495659_0001057 3300046664 Bacteria 9612
799 Ga0495659_0008999 3300046664 Bacteria 3181
800 Ga0495661_0000027 3300046665 Bacteria 184297
801 Ga0495661_0000140 3300046665 Bacteria 85015
802 Ga0495661_0000268 3300046665 Bacteria 59809
803 Ga0495661_0000466 3300046665 Bacteria 42800
804 Ga0495661_0011149 3300046665 Bacteria 6101
805 Ga0495661_0019998 3300046665 Bacteria 4378
806 Ga0495661_0027101 3300046665 Bacteria 3681
807 Ga0495661_0159207 3300046665 Bacteria 1213
808 Ga0495588_0000196 3300046674 Bacteria 63197
809 Ga0495588_0063616 3300046674 Bacteria 1913
810 Ga0495646_0020601 3300046680 Bacteria 4172
811 Ga0495646_0088296 3300046680 Bacteria 1795
812 Ga0495669_0001255 3300046684 Bacteria 10554
813 Ga0495613_0011595 3300046689 Bacteria 6551
814 Ga0495624_0010836 3300046690 Bacteria 6283
815 Ga0495670_0001231 3300046691 Bacteria 12472
816 Ga0495670_0003754 3300046691 Bacteria 7474
817 Ga0495670_0015037 3300046691 Bacteria 3807
818 Ga0495670_0043884 3300046691 Bacteria 2231
819 Ga0495670_0100266 3300046691 Bacteria 1491
820 Ga0495670_0102974 3300046691 Bacteria 1471
821 Ga0495671_0002323 3300046692 Bacteria 12083
822 Ga0495671_0003837 3300046692 Bacteria 9133
823 Ga0495671_0007018 3300046692 Bacteria 6455
824 Ga0495671_0017735 3300046692 Bacteria 3786
825 Ga0495671_0020414 3300046692 Bacteria 3491
826 Ga0495671_0025898 3300046692 Bacteria 3045
827 Ga0495671_0058343 3300046692 Bacteria 1910
828 Ga0495671_0084157 3300046692 Bacteria 1558
829 Ga0495671_0085367 3300046692 Bacteria 1546
830 Ga0495649_0003922 3300046694 Bacteria 9841
831 Ga0495649_0006811 3300046694 Bacteria 7074
832 Ga0495649_0018297 3300046694 Bacteria 3943
833 Ga0495649_0025704 3300046694 Bacteria 3278
834 Ga0495649_0034423 3300046694 Bacteria 2787
835 Ga0495649_0040950 3300046694 Bacteria 2534
836 Ga0495649_0100500 3300046694 Bacteria 1537
837 Ga0495589_0000003 3300046794 Bacteria 453448
838 Ga0495589_0000961 3300046794 Bacteria 17600
839 Ga0495589_0001089 3300046794 Bacteria 16196
840 Ga0495589_0001677 3300046794 Bacteria 12679
841 Ga0495589_0007479 3300046794 Bacteria 5725
842 Ga0495589_0020240 3300046794 Bacteria 3404
843 Ga0495589_0050961 3300046794 Bacteria 2047
844 Ga0495589_0074899 3300046794 Bacteria 1650
845 Ga0495589_0136605 3300046794 Bacteria 1175
846 Ga0495600_0037880 3300046809 Bacteria 3136
847 Ga0495600_0099631 3300046809 Bacteria 1894
848 Ga0495660_0000015 3300046810 Bacteria 324892
849 Ga0495660_0000028 3300046810 Bacteria 244534
850 Ga0495660_0000837 3300046810 Bacteria 22817
851 Ga0495660_0000967 3300046810 Bacteria 20989
852 Ga0495660_0004920 3300046810 Bacteria 8049
853 Ga0495660_0013715 3300046810 Bacteria 4697
854 Ga0495660_0020346 3300046810 Bacteria 3803
855 Ga0495660_0026190 3300046810 Bacteria 3307
856 Ga0495660_0040943 3300046810 Bacteria 2567
857 Ga0495660_0053605 3300046810 Bacteria 2188
858 Ga0495660_0083999 3300046810 Bacteria 1665
859 Ga0495660_0107511 3300046810 Bacteria 1427
860 Ga0495581_0012020 3300047315 Bacteria 5008
861 Ga0495604_0011263 3300047317 Bacteria 7101
862 Ga0495604_0031397 3300047317 Bacteria 4212
863 Ga0495636_0026961 3300047318 Bacteria 2339
864 Ga0495672_0000001 3300047320 Bacteria 1458820
865 Ga0495672_0000009 3300047320 Bacteria 557755
866 Ga0495672_0000357 3300047320 Bacteria 58589
867 Ga0495672_0000537 3300047320 Bacteria 42948
868 Ga0495672_0000945 3300047320 Bacteria 30295
869 Ga0495672_0012686 3300047320 Bacteria 5862
870 Ga0495672_0021273 3300047320 Bacteria 4233
871 Ga0495672_0024118 3300047320 Bacteria 3925
872 Ga0495672_0032914 3300047320 Bacteria 3217
873 Ga0495672_0051956 3300047320 Bacteria 2410
874 Ga0495672_0060431 3300047320 Bacteria 2189
875 Ga0495672_0075158 3300047320 Bacteria 1901
876 Ga0495672_0107175 3300047320 Bacteria 1505
877 Ga0495672_0158056 3300047320 Bacteria 1168
878 Ga0495676_0000057 3300047321 Bacteria 86160
879 Ga0495676_0006636 3300047321 Bacteria 10668
880 Ga0495680_0027481 3300047322 Bacteria 4673
881 Ga0495680_0042106 3300047322 Bacteria 3626
882 Ga0495680_0046267 3300047322 Bacteria 3431
883 Ga0495683_0000101 3300047323 Bacteria 87633
884 Ga0495683_0000473 3300047323 Bacteria 31227
885 Ga0495683_0001281 3300047323 Bacteria 17041
886 Ga0495683_0002172 3300047323 Bacteria 12046
887 Ga0495683_0010971 3300047323 Bacteria 4778
888 Ga0495687_000159 3300047443 Bacteria 101178
889 Ga0495687_000160 3300047443 Bacteria 100989
890 Ga0495675_0031533 3300047444 Bacteria 3383
891 Ga0495677_0003409 3300047445 Bacteria 6170
892 Ga0495679_000047 3300047446 Bacteria 128559
893 Ga0495679_000052 3300047446 Bacteria 120793
894 Ga0495679_000576 3300047446 Bacteria 25525
895 Ga0495679_050823 3300047446 Bacteria 1245
896 Ga0495673_0000073 3300047469 Bacteria 211743
897 Ga0495673_0000919 3300047469 Bacteria 26786
898 Ga0495673_0001324 3300047469 Bacteria 20106
899 Ga0495673_0001971 3300047469 Bacteria 15192
900 Ga0495673_0002739 3300047469 Bacteria 12076
901 Ga0495673_0006025 3300047469 Bacteria 7206
902 Ga0495673_0006245 3300047469 Bacteria 7041
903 Ga0495673_0007924 3300047469 Bacteria 6032
904 Ga0495673_0011220 3300047469 Bacteria 4833
905 Ga0495673_0011557 3300047469 Bacteria 4740
906 Ga0495673_0022252 3300047469 Bacteria 3110
907 Ga0495673_0029520 3300047469 Bacteria 2587
908 Ga0495673_0044224 3300047469 Bacteria 1987
909 Ga0495673_0055724 3300047469 Bacteria 1713
910 Ga0495673_0066210 3300047469 Bacteria 1532
911 Ga0495681_0010987 3300047470 Bacteria 5431
912 Ga0495681_0013984 3300047470 Bacteria 4627
913 Ga0495681_0024601 3300047470 Bacteria 3167
914 Ga0495681_0035781 3300047470 Bacteria 2462
915 Ga0495681_0059434 3300047470 Bacteria 1767
916 Ga0495681_0064413 3300047470 Bacteria 1679
917 Ga0495681_0065882 3300047470 Bacteria 1655
918 Ga0495686_0078682 3300047472 Bacteria 2018
919 Ga0495686_0095469 3300047472 Bacteria 1800
920 Ga0495686_0110518 3300047472 Bacteria 1648
921 Ga0495593_0040257 3300047673 Bacteria 2516
922 Ga0495593_0041815 3300047673 Bacteria 2462
923 Ga0495593_0062691 3300047673 Bacteria 1942
924 Ga0495602_0056914 3300048088 Bacteria 3434
925 Ga0495615_0022192 3300048090 Bacteria 1441
926 Ga0495626_0000063 3300048091 Bacteria 142456
927 Ga0495626_0001629 3300048091 Bacteria 17429
928 Ga0495626_0003486 3300048091 Bacteria 10076
929 Ga0495626_0013796 3300048091 Bacteria 4190
930 Ga0495626_0018344 3300048091 Bacteria 3515
931 Ga0495626_0040581 3300048091 Bacteria 2197
932 Ga0495626_0046618 3300048091 Bacteria 2018
933 Ga0495626_0076919 3300048091 Bacteria 1488
934 Ga0496100_0037329 3300048903 Bacteria 3071
935 Ga0496101_0000238 3300048904 Bacteria 40786
936 Ga0496101_0006349 3300048904 Bacteria 7610
937 Ga0496102_0001561 3300048905 Bacteria 20220
938 Ga0496102_0141729 3300048905 Bacteria 2254
939 Ga0496102_0322605 3300048905 Bacteria 1455
940 Ga0496103_0047306 3300048906 Bacteria 2658
941 Ga0496104_0000870 3300048907 Bacteria 26016
942 Ga0496104_0001961 3300048907 Bacteria 17815
943 Ga0496105_0004949 3300048908 Bacteria 10074
944 Ga0496105_0078866 3300048908 Bacteria 2719
945 Ga0496110_0051032 3300048913 Bacteria 3634
946 Ga0496114_0017785 3300048917 Bacteria 5745
947 Ga0496115_0329107 3300048918 Bacteria 1248
948 Ga0496116_0000007 3300048919 Bacteria 795464
949 Ga0496116_0000234 3300048919 Bacteria 101720
950 Ga0496116_0000613 3300048919 Bacteria 47094
951 Ga0496116_0000845 3300048919 Bacteria 38435
952 Ga0496116_0000960 3300048919 Bacteria 35604
953 Ga0496116_0002607 3300048919 Bacteria 18730
954 Ga0496116_0038048 3300048919 Bacteria 3346
955 Ga0496116_0045368 3300048919 Bacteria 2976
956 Ga0496116_0048025 3300048919 Bacteria 2868
957 Ga0496116_0060651 3300048919 Bacteria 2452
958 Ga0496117_0000775 3300048920 Bacteria 50341
959 Ga0496117_0001091 3300048920 Bacteria 41004
960 Ga0496117_0001727 3300048920 Bacteria 30214
961 Ga0496117_0001930 3300048920 Bacteria 27662
962 Ga0496117_0002207 3300048920 Bacteria 25273
963 Ga0496117_0002377 3300048920 Bacteria 23995
964 Ga0496117_0004181 3300048920 Bacteria 16143
965 Ga0496117_0006885 3300048920 Bacteria 11281
966 Ga0496117_0010931 3300048920 Bacteria 8180
967 Ga0496117_0011127 3300048920 Bacteria 8090
968 Ga0496117_0046368 3300048920 Bacteria 3127
969 Ga0496117_0066163 3300048920 Bacteria 2453
970 Ga0496117_0074435 3300048920 Bacteria 2260
971 Ga0496118_0003126 3300048921 Bacteria 21206
972 Ga0496118_0004107 3300048921 Bacteria 17625
973 Ga0496118_0004537 3300048921 Bacteria 16390
974 Ga0496118_0007973 3300048921 Bacteria 11068
975 Ga0496118_0010603 3300048921 Bacteria 9101
976 Ga0496118_0011077 3300048921 Bacteria 8850
977 Ga0496118_0020365 3300048921 Bacteria 5882
978 Ga0496118_0048483 3300048921 Bacteria 3280
979 Ga0496118_0056224 3300048921 Bacteria 2960
980 Ga0496118_0113397 3300048921 Bacteria 1791
981 Ga0496118_0137613 3300048921 Bacteria 1555
982 Ga0496119_0000348 3300048922 Bacteria 64966
983 Ga0496119_0000582 3300048922 Bacteria 49332
984 Ga0496119_0001764 3300048922 Bacteria 25191
985 Ga0496119_0003562 3300048922 Bacteria 16071
986 Ga0496119_0019362 3300048922 Bacteria 5017
987 Ga0496119_0056980 3300048922 Bacteria 2364
988 Ga0496120_0000287 3300048923 Bacteria 84850
989 Ga0496120_0000364 3300048923 Bacteria 73688
990 Ga0496120_0000452 3300048923 Bacteria 64992
991 Ga0496120_0000945 3300048923 Bacteria 39769
992 Ga0496120_0002643 3300048923 Bacteria 17713
993 Ga0496120_0003670 3300048923 Bacteria 13732
994 Ga0496120_0006581 3300048923 Bacteria 8875
995 Ga0496120_0012383 3300048923 Bacteria 5810
996 Ga0496120_0023634 3300048923 Bacteria 3844
997 Ga0496121_0000346 3300048924 Bacteria 96825
998 Ga0496121_0000565 3300048924 Bacteria 69798
999 Ga0496121_0001904 3300048924 Bacteria 33404
1000 Ga0496121_0002181 3300048924 Bacteria 30635
1001 Ga0496121_0002811 3300048924 Bacteria 25742
1002 Ga0496121_0008337 3300048924 Bacteria 12238
1003 Ga0496121_0011723 3300048924 Bacteria 9677
1004 Ga0496121_0029547 3300048924 Bacteria 5064
1005 Ga0496121_0160313 3300048924 Bacteria 1646
1006 Ga0496122_0000058 3300048925 Bacteria 248805
1007 Ga0496122_0000264 3300048925 Bacteria 117620
1008 Ga0496122_0001113 3300048925 Bacteria 46432
1009 Ga0496122_0001199 3300048925 Bacteria 44239
1010 Ga0496122_0002597 3300048925 Bacteria 25313
1011 Ga0496122_0005299 3300048925 Bacteria 15430
1012 Ga0496122_0011643 3300048925 Bacteria 8870
1013 Ga0496122_0011681 3300048925 Bacteria 8850
1014 Ga0496122_0012048 3300048925 Bacteria 8669
1015 Ga0496122_0022107 3300048925 Bacteria 5666
1016 Ga0496122_0038656 3300048925 Bacteria 3817
1017 Ga0496122_0047885 3300048925 Bacteria 3294
1018 Ga0496122_0062023 3300048925 Bacteria 2739
1019 Ga0496122_0132195 3300048925 Bacteria 1582
1020 Ga0496123_0000044 3300048926 Bacteria 253396
1021 Ga0496123_0000215 3300048926 Bacteria 117620
1022 Ga0496123_0000846 3300048926 Bacteria 48945
1023 Ga0496123_0000911 3300048926 Bacteria 46460
1024 Ga0496123_0001400 3300048926 Bacteria 33807
1025 Ga0496123_0001530 3300048926 Bacteria 31946
1026 Ga0496123_0007508 3300048926 Bacteria 10238
1027 Ga0496123_0010260 3300048926 Bacteria 8307
1028 Ga0496123_0011236 3300048926 Bacteria 7788
1029 Ga0496123_0012065 3300048926 Bacteria 7410
1030 Ga0496123_0023517 3300048926 Bacteria 4714
1031 Ga0496123_0061416 3300048926 Bacteria 2414
1032 Ga0496124_0000092 3300048927 Bacteria 189213
1033 Ga0496124_0000787 3300048927 Bacteria 51800
1034 Ga0496124_0001050 3300048927 Bacteria 43582
1035 Ga0496124_0005454 3300048927 Bacteria 14296
1036 Ga0496124_0005640 3300048927 Bacteria 13996
1037 Ga0496124_0014243 3300048927 Bacteria 7703
1038 Ga0496124_0016521 3300048927 Bacteria 7009
1039 Ga0496124_0017975 3300048927 Bacteria 6644
1040 Ga0496124_0020494 3300048927 Bacteria 6106
1041 Ga0496124_0039710 3300048927 Bacteria 4076
1042 Ga0496124_0040970 3300048927 Bacteria 4001
1043 Ga0496124_0054934 3300048927 Bacteria 3368
1044 Ga0496124_0061012 3300048927 Bacteria 3162
1045 Ga0496124_0065726 3300048927 Bacteria 3023
1046 Ga0496124_0079101 3300048927 Bacteria 2708
1047 Ga0496124_0226447 3300048927 Bacteria 1401
1048 Ga0496125_0000103 3300048928 Bacteria 201675
1049 Ga0496125_0000264 3300048928 Bacteria 108134
1050 Ga0496125_0000922 3300048928 Bacteria 46122
1051 Ga0496125_0002771 3300048928 Bacteria 22177
1052 Ga0496125_0006920 3300048928 Bacteria 12140
1053 Ga0496125_0008984 3300048928 Bacteria 10362
1054 Ga0496125_0030208 3300048928 Bacteria 4851
1055 Ga0496125_0058292 3300048928 Bacteria 3120
1056 Ga0496126_0002072 3300048929 Bacteria 28126
1057 Ga0496126_0002455 3300048929 Bacteria 25034
1058 Ga0496126_0005468 3300048929 Bacteria 14483
1059 Ga0496126_0075310 3300048929 Bacteria 2996
1060 Ga0495678_000057 3300049459 Bacteria 146738
1061 Ga0495678_000964 3300049459 Bacteria 24862
1062 Ga0495678_001561 3300049459 Bacteria 17597
1063 Ga0495678_003445 3300049459 Bacteria 9802
1064 Ga0495678_006404 3300049459 Bacteria 6270
1065 Ga0495678_022022 3300049459 Bacteria 2794
1066 Ga0495678_029439 3300049459 Bacteria 2305
1067 Ga0495678_033199 3300049459 Bacteria 2132
1068 Ga0495678_055956 3300049459 Bacteria 1502
1069 Ga0495678_060500 3300049459 Bacteria 1424
1070 Ga0495682_0000001 3300049460 Bacteria 1559116
1071 Ga0495682_0000057 3300049460 Bacteria 102695
1072 Ga0495682_0000218 3300049460 Bacteria 45117
1073 Ga0495682_0001324 3300049460 Bacteria 13755
1074 Ga0495682_0005152 3300049460 Bacteria 5466
1075 Ga0495682_0021872 3300049460 Bacteria 2394
1076 Ga0495682_0056322 3300049460 Bacteria 1425
1077 Ga0501032_0018586 3300049569 Bacteria 4867
1078 Ga0501034_0000085 3300049571 Bacteria 166893
1079 Ga0501039_0263384 3300049575 Bacteria 1355
1080 nmdc:mga03683_6050_c1 3300050489 Bacteria 4124
1081 nmdc:mga0k408_24689_c1 3300050493 Bacteria 3399
1082 nmdc:mga06z11_4626_c1 3300050494 Bacteria 5429
1083 nmdc:mga0qj67_222290_c1 3300050509 Bacteria 1533
1084 nmdc:mga0sz30_20900_c1 3300050516 Bacteria 2644
1085 nmdc:mga0sz30_6298_c2 3300050516 Bacteria 2369
1086 Ga0500578_0026286 3300053086 Bacteria 3736
1087 Ga0500651_0078781 3300053093 Bacteria 2043
1088 Ga0500641_0005518 3300053096 Bacteria 4479
1089 Ga0500572_023756 3300053111 Bacteria 1648
1090 Ga0500594_0002751 3300053118 Bacteria 3830
1091 Ga0500621_000002 3300053126 Bacteria 849473
1092 Ga0500658_0000490 3300053134 Bacteria 16932
1093 Ga0500573_0024946 3300053140 Bacteria 3438
1094 Ga0500637_0010545 3300053178 Bacteria 4742
1095 Ga0500645_040348 3300053730 Bacteria 1381
1096 Ga0500609_001726 3300053731 Bacteria 3173
1097 2506579396 2506520007 Bacteria 5442880
1098 2506584535 2506520008 Bacteria 5443009
1099 2508853260 2508501071 Bacteria 5454741
1100 2510285424 2510065053 Bacteria 5005518
1101 2510295933 2510065055 Bacteria 5037935
1102 2510313562 2510065058 Bacteria 5005894
1103 2511256194 2511231004 Bacteria 6669789
1104 2511265248 2511231006 Bacteria 6794709
1105 2511272292 2511231007 Bacteria 6306603
1106 2511279339 2511231008 Bacteria 6624100
1107 2511287551 2511231010 Bacteria 6373152
1108 2511297473 2511231011 Bacteria 6149768
1109 2511304360 2511231012 Bacteria 6738011
1110 2511316203 2511231014 Bacteria 6462302
1111 2511322040 2511231015 Bacteria 6598026
1112 2511326395 2511231016 Bacteria 6704427
1113 2511330874 2511231017 Bacteria 6503007
1114 2511341478 2511231018 Bacteria 6436256
1115 2511346521 2511231019 Bacteria 6520662
1116 2511349234 2511231020 Bacteria 6115223
1117 2511356380 2511231021 Bacteria 7302637
1118 2511361493 2511231022 Bacteria 6719296
1119 2511367161 2511231023 Bacteria 6808468
1120 2511372924 2511231024 Bacteria 5835885
1121 2511380296 2511231025 Bacteria 5324661
1122 2511414420 2511231031 Bacteria 6558529
1123 2511436625 2511231035 Bacteria 5341610
1124 2511822579 2511231156 Bacteria 6845832
1125 2512327627 2512047018 Bacteria 6663241
1126 2513568465 2513237084 Bacteria 7231967
1127 2513579443 2513237085 Bacteria 7695351
1128 2515738451 2515154134 Bacteria 7220242
1129 2517080487 2516653085 Bacteria 7346596
1130 2524610867 2524023250 Bacteria 5457705
1131 2548650591 2547132416 Bacteria 4633861
1132 2554817942 2554235132 Bacteria 6772433
1133 2555247471 2554235231 Bacteria 5215788
1134 2555667546 2554235341 Bacteria 6867980
1135 2583789689 2582580891 Bacteria 6800976
1136 2585269333 2582581306 Bacteria 6450535
1137 2585327179 2582581315 Bacteria 7318924
1138 2585391312 2582581865 Bacteria 6644329
1139 2585391780 2582581866 Bacteria 6859583
1140 2585526813 2585427526 Bacteria 7258840
1141 2585543081 2585427528 Bacteria 6842387
1142 2585557484 2585427530 Bacteria 7383882
1143 2585564246 2585427531 Bacteria 6992870
1144 2585825507 2585427591 Bacteria 5482980
1145 2585832011 2585427592 Bacteria 5370892
1146 2585841446 2585427593 Bacteria 7141551
1147 2597855775 2597489887 Bacteria 6666321
1148 2597861784 2597489888 Bacteria 6179543
1149 2597867510 2597489889 Bacteria 6297495
1150 2599327254 2599185155 Bacteria 5827168
1151 2599356767 2599185160 Bacteria 6844013
1152 2599363203 2599185161 Bacteria 6960462
1153 2599369845 2599185162 Bacteria 6957254
1154 2599376312 2599185163 Bacteria 6995158
1155 2599381872 2599185164 Bacteria 6841688
1156 2599387984 2599185165 Bacteria 6843250
1157 2599395490 2599185166 Bacteria 6959206
1158 2599398736 2599185167 Bacteria 6353609
1159 2599407255 2599185168 Bacteria 6997636
1160 2599408778 2599185169 Bacteria 5441380
1161 2599450791 2599185179 Bacteria 6611171
1162 2599463600 2599185181 Bacteria 6844519
1163 2599469052 2599185182 Bacteria 6883168
1164 2599485677 2599185185 Bacteria 6652270
1165 2599492619 2599185186 Bacteria 6831633
1166 2599499983 2599185188 Bacteria 6164180
1167 2599506546 2599185189 Bacteria 5862825
1168 2599514264 2599185190 Bacteria 6285678
1169 2599518864 2599185191 Bacteria 6297582
1170 2599616711 2599185212 Bacteria 6765997
1171 2599769539 2599185248 Bacteria 6696816
1172 2599806807 2599185257 Bacteria 6492581
1173 2599882959 2599185288 Bacteria 6666191
1174 2599886960 2599185289 Bacteria 6778765
1175 2599893402 2599185290 Bacteria 6289611
1176 2599898289 2599185291 Bacteria 6775623
1177 2599931021 2599185300 Bacteria 6062622
1178 2599944599 2599185302 Bacteria 5954930
1179 2599952411 2599185303 Bacteria 6512725
1180 2599956058 2599185304 Bacteria 5951361
1181 2599961217 2599185305 Bacteria 6748700
1182 2599964676 2599185306 Bacteria 6637356
1183 2599973079 2599185307 Bacteria 6194719
1184 2599977392 2599185308 Bacteria 6621546
1185 2599983175 2599185309 Bacteria 5969593
1186 2599991108 2599185310 Bacteria 6014457
1187 2599997761 2599185311 Bacteria 6354990
1188 2600001020 2599185312 Bacteria 5912071
1189 2600007055 2599185313 Bacteria 6658188
1190 2600011561 2599185314 Bacteria 6621749
1191 2600019207 2599185315 Bacteria 6771107
1192 2600026417 2599185316 Bacteria 6320029
1193 2600031991 2599185317 Bacteria 6435722
1194 2600036839 2599185318 Bacteria 6961590
1195 2600043265 2599185319 Bacteria 6637840
1196 2600048179 2599185320 Bacteria 5963263
1197 2600055785 2599185321 Bacteria 6764560
1198 2600061184 2599185322 Bacteria 6763055
1199 2600068428 2599185323 Bacteria 6688755
1200 2600072464 2599185324 Bacteria 6590677
1201 2600078420 2599185325 Bacteria 6324919
1202 2600216229 2599185356 Bacteria 6843884
1203 2600360270 2600254930 Bacteria 6431253
1204 2600364763 2600254931 Bacteria 6734225
1205 2601522708 2600255254 Bacteria 5281859
1206 2601527735 2600255255 Bacteria 5282785
1207 2601614566 2600255280 Bacteria 5292309
1208 2601619286 2600255281 Bacteria 5288753
1209 2601627064 2600255283 Bacteria 6061572
1210 2601642114 2600255287 Bacteria 5210468
1211 2601646956 2600255288 Bacteria 5282738
1212 2601652713 2600255289 Bacteria 5281907
1213 2601658039 2600255290 Bacteria 5282218
1214 2601661936 2600255291 Bacteria 5217298
1215 2601692465 2600255296 Bacteria 5784754
1216 2601694894 2600255298 Bacteria 5215185
1217 2601701857 2600255299 Bacteria 5218662
1218 2601706560 2600255300 Bacteria 5287774
1219 2601710864 2600255301 Bacteria 5280532
1220 2601715878 2600255302 Bacteria 5288235
1221 2601719921 2600255303 Bacteria 5219315
1222 2601726284 2600255304 Bacteria 5283973
1223 2601730825 2600255305 Bacteria 5282329
1224 2601735840 2600255306 Bacteria 5281613
1225 2601741106 2600255307 Bacteria 5439064
1226 2601751037 2600255309 Bacteria 5431045
1227 2601776396 2600255313 Bacteria 6842543
1228 2601797964 2600255318 Bacteria 6383414
1229 2602018290 2600255392 Bacteria 5437392
1230 2603645150 2602042047 Bacteria 4697674
1231 2603661616 2602042052 Bacteria 5215873
1232 2603664571 2602042053 Bacteria 5214361
1233 2603699022 2602042066 Bacteria 4423871
1234 2603705055 2602042067 Bacteria 4863713
1235 2603838218 2602042103 Bacteria 5284714
1236 2603843296 2602042104 Bacteria 5281639
1237 2603848369 2602042105 Bacteria 5282303
1238 2603853442 2602042106 Bacteria 5282744
1239 2603866949 2602042109 Bacteria 5152801
1240 2603871496 2602042110 Bacteria 5283285
1241 2603876402 2602042111 Bacteria 5212080
1242 2606048687 2603880178 Bacteria 5283018
1243 2606069003 2603880184 Bacteria 5217896
1244 2606076553 2603880185 Bacteria 6379190
1245 2606129033 2603880199 Bacteria 6377649
1246 2606144800 2603880202 Bacteria 5284684
1247 2606176089 2603880211 Bacteria 5284226
1248 2608380745 2606217733 Bacteria 6360972
1249 2621302062 2619619299 Bacteria 6649820
1250 2624478347 2623620443 Bacteria 6427864
1251 2624489898 2623620446 Bacteria 6500345
1252 2637224589 2636415599 Bacteria 5718434
1253 2643841114 2643221565 Bacteria 6216018
1254 2643872504 2643221571 Bacteria 6228673
1255 2643954777 2643221589 Bacteria 6250934
1256 2644024417 2643221602 Bacteria 6249926
1257 2644190110 2643221633 Bacteria 6733554
1258 2644210608 2643221637 Bacteria 5345260
1259 2644281391 2643221650 Bacteria 7029547
1260 2644619764 2643221713 Bacteria 6554480
1261 2644654142 2643221718 Bacteria 5345506
1262 2656275917 2654587920 Bacteria 5475511
1263 2671090671 2667528170 Bacteria 6786960
1264 2671099844 2667528171 Bacteria 6900659
1265 2671101496 2667528172 Bacteria 5170840
1266 2671109888 2667528173 Bacteria 5375747
1267 2671129211 2667528176 Bacteria 6724917
1268 2671772459 2671180172 Bacteria 6495783
1269 2676405917 2675903046 Bacteria 5451247
1270 2677898842 2675903420 Bacteria 6247433
1271 2678261122 2675903515 Bacteria 6580491
1272 2681996530 2681812866 Bacteria 4552357
1273 2682006056 2681812869 Bacteria 5014465
1274 2689445970 2687453601 Bacteria 5546041
1275 2692318073 2690316117 Bacteria 6800650
1276 2712469490 2711768156 Bacteria 4471618
1277 2715749341 2713897148 Bacteria 5883533
1278 2715755607 2713897149 Bacteria 6506249
1279 2718632289 2718217725 Bacteria 5758958
1280 2723246678 2721755607 Bacteria 5841722
1281 2738674201 2738541265 Bacteria 6594665
1282 2738687465 2738541271 Bacteria 5657310
1283 2738752594 2738541282 Bacteria 6593925
1284 2738807783 2738541294 Bacteria 6925949
1285 2738861635 2738541303 Bacteria 6591772
1286 2738895143 2738541309 Bacteria 6926455
1287 2739035149 2738541333 Bacteria 7106503
1288 2739200585 2738543004 Bacteria 6381073
1289 2739259937 2738543015 Bacteria 6750701
1290 2739263086 2738543016 Bacteria 5657564
1291 2739288618 2738543020 Bacteria 5718238
1292 2739293930 2738543021 Bacteria 5718241
1293 2739311415 2738543025 Bacteria 6600348
1294 2743735195 2740892503 Bacteria 6855563
1295 2745006433 2744054620 Bacteria 6551379
1296 2753856607 2751185917 Bacteria 4551186
1297 2765581725 2765235841 Bacteria 6137024
1298 2765589626 2765235842 Bacteria 4799256
1299 2766068902 2765235942 Bacteria 7445910
1300 2772439836 2772190666 Bacteria 5117644
1301 2774119426 2773857670 Bacteria 6407454
1302 2774132440 2773857672 Bacteria 4993178
1303 2774134863 2773857673 Bacteria 6513460
1304 2775539624 2775506706 Bacteria 4873073
1305 2776259455 2775506901 Bacteria 9631051
1306 2777023005 2775507074 Bacteria 5532402
1307 2784260917 2784132063 Bacteria 6262788
1308 2784316365 2784132072 Bacteria 6596533
1309 2793342724 2791355263 Bacteria 6872478
1310 2793363402 2791355266 Bacteria 7116587
1311 2793368744 2791355267 Bacteria 7222458
1312 2794594157 2791355520 Bacteria 5948615
1313 2806049601 2802429633 Bacteria 7341974
1314 2806054587 2802429634 Bacteria 7083200
1315 2806060595 2802429635 Bacteria 7650140
1316 2806069485 2802429636 Bacteria 7597525
1317 2806076880 2802429637 Bacteria 7067217
1318 2807176812 2806310673 Bacteria 4801221
1319 2807406353 2806310737 Bacteria 5751088
1320 2807454706 2806310745 Bacteria 5742165
1321 2808856217 2808606361 Bacteria 6136259
1322 2808922615 2808606376 Bacteria 6248667
1323 2808932673 2808606377 Bacteria 6646337
1324 2808936277 2808606378 Bacteria 6177535
1325 2808940151 2808606379 Bacteria 5022697
1326 2808944302 2808606380 Bacteria 6248705
1327 2808954794 2808606381 Bacteria 6646461
1328 2808955997 2808606382 Bacteria 6841132
1329 2808965614 2808606383 Bacteria 6138645
1330 2808976532 2808606385 Bacteria 6711065
1331 2808992030 2808606388 Bacteria 6706662
1332 2808999610 2808606389 Bacteria 6138126
1333 2809218103 2808606445 Bacteria 6057339
1334 2812370340 2811994881 Bacteria 6298475
1335 2817488530 2816332298 Bacteria 6852809
1336 2819657357 2818991456 Bacteria 6123676
1337 2819705340 2818991464 Bacteria 6907494
1338 2821121689 2821118458 Bacteria 4714306
1339 2821444159 2821443989 Bacteria 7658172
1340 2821450076 2821443989 Bacteria 7658172
1341 2821450762 2821443989 Bacteria 7658172
1342 2823375348 2823373977 Bacteria 4779415
1343 2825654138 2825651385 Bacteria 6715909
1344 2826586245 2826581358 Bacteria 5963467
1345 2834032097 2834028612 Bacteria 6354979
1346 2838690500 2838686498 Bacteria 7807632
1347 2838733143 2838729681 Bacteria 7400765
1348 2838747268 2838742623 Bacteria 7396178
1349 2841855421 2841851746 Bacteria 7532261
1350 2842117007 2842110456 Bacteria 7656360
1351 2842160872 2842156927 Bacteria 6894975
1352 2842164401 2842163707 Bacteria 6916235
1353 2842184488 2842180545 Bacteria 6888678
1354 2842232071 2842229732 Bacteria 7475766
1355 2842248527 2842243621 Bacteria 7421798
1356 2842262665 2842257432 Bacteria 7401195
1357 2842275186 2842271015 Bacteria 7807131
1358 2842307378 2842304105 Bacteria 7023636
1359 2842396969 2842395702 Bacteria 6780583
1360 2842807139 2842805378 Bacteria 5385175
1361 2842817879 2842815866 Bacteria 5947510
1362 2842832217 2842826826 Bacteria 5974129
1363 2842834293 2842832357 Bacteria 5959113
1364 2842842892 2842837860 Bacteria 6066181
1365 2842846230 2842843487 Bacteria 6004777
1366 2842851825 2842849001 Bacteria 5924277
1367 2842859969 2842854478 Bacteria 6143501
1368 2844428059 2844425489 Bacteria 4854065
1369 2844460156 2844454524 Bacteria 7952546
1370 2844534015 2844533157 Bacteria 7517899
1371 2844536641 2844533157 Bacteria 7517899
1372 2844539481 2844533157 Bacteria 7517899
1373 2844668021 2844665904 Bacteria 6817974
1374 2844671157 2844665904 Bacteria 6817974
1375 2847423419 2847417321 Bacteria 6913799
1376 2848997099 2848992105 Bacteria 6810864
1377 2852104104 2852103415 Bacteria 5193810
1378 2852617202 2852612431 Bacteria 6885235
1379 2852660324 2852657418 Bacteria 6472974
1380 2852671809 2852667396 Bacteria 6885555
1381 2855875134 2855872281 Bacteria 6964271
1382 2857517729 2857516855 Bacteria 7787325
1383 2860343513 2860339153 Bacteria 6846989
1384 2860868560 2860867994 Bacteria 5645326
1385 2869555308 2869551831 Bacteria 5474685
1386 2876601808 2876601092 Bacteria 5114497
1387 2878030296 2878029506 Bacteria 6418441
1388 2880231240 2880230671 Bacteria 6140320
1389 2884088267 2884086401 Bacteria 5005459
1390 2888369952 2888366609 Bacteria 5155009
1391 2891374531 2891373044 Bacteria 5202277
1392 2891673925 2891670763 Bacteria 4967099
1393 2904478251 2904474040 Bacteria 5504324
1394 2904514478 2904513164 Bacteria 5476410
1395 2904519697 2904518522 Bacteria 6068986
1396 2904553929 2904550169 Bacteria 6221258
1397 2908447151 2908446538 Bacteria 6829095
1398 2912964301 2912963787 Bacteria 5646108
1399 2913037412 2913036834 Bacteria 6704877
1400 2917071298 2917070673 Bacteria 6868303
1401 2917701228 2917699015 Bacteria 7043791
1402 2917833957 2917832318 Bacteria 5346010
1403 2919066023 2919063839 Bacteria 6302690
1404 2919129969 2919125081 Bacteria 5385106
1405 2919155499 2919150387 Bacteria 5500879
1406 2919160020 2919155634 Bacteria 4860545
1407 2919389640 2919385768 Bacteria 5897293
1408 2919460112 2919456309 Bacteria 6586567
1409 2919486556 2919481497 Bacteria 6907839
1410 2919488568 2919487758 Bacteria 5929766
1411 2919698824 2919697872 Bacteria 6553725
1412 2923154191 2923153595 Bacteria 6870622
1413 2923524428 2923519811 Bacteria 6298479
1414 2923591646 2923586266 Bacteria 6565975
1415 2923635514 2923634449 Bacteria 4753480
1416 2927147909 2927143783 Bacteria 5504251
1417 2927833511 2927833300 Bacteria 4923934
1418 2929144944 2929144301 Bacteria 6622272
1419 2929190416 2929189879 Bacteria 5930554
1420 2931371719 2931369376 Bacteria 6847892
1421 2931391500 2931390751 Bacteria 6273349
1422 2931398970 2931396565 Bacteria 7251677
1423 2932408895 2932406140 Bacteria 5134491
1424 2933573966 2933570622 Bacteria 7023390
1425 2933593243 2933586486 Bacteria 7667493
1426 2935359126 2935353572 Unclassified 6955622
1427 2935906138 2935901341 Bacteria 7341747
1428 2936384492 2936381700 Bacteria 7006523
1429 2937540689 2937539931 Bacteria 4639830
1430 2937968478 2937967321 Bacteria 5094075
1431 2939582027 2939577877 Bacteria 5132791
1432 2939605790 2939602548 Bacteria 4950493
1433 2939608981 2939607340 Bacteria 4719256
1434 2939641232 2939636861 Bacteria 6297853
1435 2939655908 2939651529 Bacteria 5895393
1436 2945930038 2945928738 Bacteria 6053221
1437 2945967714 2945961074 Bacteria 7342064
1438 2946012387 2946006987 Bacteria 6705746
1439 2946028761 2946027586 Bacteria 6049274
1440 2947235293 2947233263 Bacteria 6439278
1441 2969081632 2969079654 Bacteria 5439582
1442 2969305088 2969304461 Bacteria 6601805
1443 2974293217 2974289157 Bacteria 6080362
1444 2974302854 2974298342 Bacteria 4840922
1445 2974311443 2974310843 Bacteria 4947816
1446 2984291867 2984286254 Bacteria 6702062
1447 2984499561 2984499530 Bacteria 5020881
1448 2984506002 2984504281 Bacteria 5262371
1449 2984564046 2984559226 Bacteria 5683096
1450 2984596779 2984595703 Bacteria 5682994
1451 2988732335 2988728565 Bacteria 6124362
1452 2989352467 2989349275 Bacteria 6349068
1453 2998140598 2998139840 Bacteria 6073514
1454 3003935922 3003930520 Bacteria 5667563
1455 3007320172 3007315729 Bacteria 5076637
1456 3007399746 3007395558 Bacteria 6755444
1457 3007420135 3007419365 Bacteria 7026924
1458 3007518044 3007511990 Bacteria 6481491
1459 3007618294 3007614139 Bacteria 6053559
1460 3007622271 3007619802 Bacteria 6411688
1461 3007720391 3007718800 Bacteria 5971527
1462 3007808889 3007803356 Bacteria 5931491
1463 3007859825 3007855910 Bacteria 5637581
1464 3007864195 3007861166 Bacteria 6045338
1465 3007870832 3007866637 Bacteria 5899198
1466 3007873258 3007872151 Bacteria 5268868
1467 637317941 637000220 Bacteria 7074893
1468 640938745 640753048 Bacteria 5495657
1469 8002746975 8002745576 Bacteria 4840272
1470 8004595936 8004592986 Bacteria 5122074
1471 8005308272 8005307578 Bacteria 7395396
1472 8005559517 8005556819 Bacteria 6908598
1473 8005566438 8005563573 Bacteria 7153261
1474 8005571306 8005570704 Bacteria 6957481
1475 8005697056 8005695170 Bacteria 6912330
1476 8011352780 8011350971 Bacteria 6158957
1477 8015397969 8015394850 Bacteria 5064660
1478 8015688441 8015687852 Bacteria 6613826
1479 8016735305 8016733728 Bacteria 5274317
1480 8018163712 8018163183 Bacteria 7277977
1481 8018222998 8018221730 Bacteria 4616064
1482 8018409651 8018405270 Bacteria 4978981
1483 8019501216 8019499862 Bacteria 5169538
1484 8019770422 8019769354 Bacteria 6924660
1485 8019777472 8019775933 Bacteria 6858656
1486 8023681599 8023680758 Bacteria 7729763
1487 8030000142 8029995093 Bacteria 5990776
1488 8052495165 8052494512 Bacteria 5765634
1489 8054006557 8054002106 Bacteria 7987183
1490 8054291009 8054285046 Bacteria 6919322
1491 8054350012 8054347763 Bacteria 5901107
1492 8054504091 8054503363 Bacteria 6101651
1493 8054930818 8054929484 Bacteria 5599761
1494 8055088132 8055087960 Bacteria 4784273
1495 8055095176 8055092621 Bacteria 4873875
1496 8055098522 8055097453 Bacteria 4865496
1497 8055771541 8055770955 Bacteria 6827675
1498 8055818487 8055817908 Bacteria 6609162
1499 8055879856 8055878733 Bacteria 5907058
1500 8056116848 8056115690 Bacteria 5527654
1501 8056125353 8056120720 Bacteria 5758328
1502 8056126596 8056125926 Bacteria 6228218
1503 8056132458 8056131705 Bacteria 6107031
1504 8056142432 8056137416 Bacteria 6147080
1505 8056143876 8056143049 Bacteria 6307666
1506 8056152593 8056148874 Bacteria 6479865
1507 8056158639 8056155041 Bacteria 6486948
1508 8056164471 8056161164 Bacteria 6106669
1509 8056170453 8056166840 Bacteria 5820959
1510 8056176583 8056172158 Bacteria 6133900
1511 8056182915 8056177738 Bacteria 6748268
1512 8056378089 8056375014 Bacteria 7006639
1513 8056573421 8056569372 Bacteria 5997322
1514 8057802825 8057798959 Bacteria 6713499
1515 8057881333 8057874678 Bacteria 7494653
1516 Ga0157371_10000279
1517 MRS2a_Contig_17
1518 SwRhRL2b_contig_119184
1519 SwRhRL2b_contig_1308625
1520 SwRhRL2b_contig_805411
1521 SwRhRL2b_contig_979588
1522 JGI24741J21665_1001405
1523 JGI25162J39368_1000090
1524 JGI25162J39368_1000096
1525 JGI25162J39368_1000291
1526 JGI25163J39215_1000070
1527 JGI25163J39215_1000085
1528 JGI25163J39215_1001614
1529 JGI25164J39214_1000070
1530 JGI25164J39214_1000074
1531 JGI25164J39214_1000218
1532 JGI25159J45721_1000043
1533 JGI25159J45721_1012276
1534 JGI25151J46595_10000071
1535 JGI25151J46595_10000429
1536 JGI25151J46595_10003884
1537 JGI25151J46595_10004422
1538 JGI25165J46597_1000170
1539 JGI25165J46597_1000177
1540 JGI25153J46596_10033024
1541 rootH2_10068894
1542 rootL2_10004729
1543 JGI25160J50197_1000144
1544 JGI25160J50197_1001782
1545 JGI25160J50197_1002007
1546 JGI25160J50197_1019317
1547 JGI25160J50197_1024053
1548 JGI25161J50226_1000932
1549 JGI25161J50226_1001484
1550 Ga0006562J51391_1007340
1551 Ga0055538_1000044
1552 Ga0055538_1000154
1553 Ga0055539_1000063
1554 Ga0055539_1000204
1555 Ga0055533_1000065
1556 Ga0055533_1000206
1557 Ga0055532_1000067
1558 Ga0055525_1000083
1559 Ga0055525_1000102
1560 Ga0055525_1000283
1561 Ga0055535_1004784
1562 Ga0055526_1000888
1563 Ga0055524_1004021
1564 Ga0055536_1000101
1565 Ga0055536_1028124
1566 Ga0055536_1028415
1567 Ga0055528_1002804
1568 Ga0055530_10000097
1569 Ga0055530_10000216
1570 Ga0055530_10001211
1571 Ga0055540_1000098
1572 Ga0055540_1000108
1573 Ga0055540_1000232
1574 Ga0055540_1000837
1575 Ga0055531_10000811
1576 Ga0055541_1000040
1577 Ga0055541_1000132
1578 Ga0058692_1000431
1579 Ga0058692_1000887
1580 Ga0058692_1001196
1581 Ga0058692_1006599
1582 Ga0058692_1009102
1583 Ga0058692_1018727
1584 Ga0058692_1019180
1585 Ga0055543_1000806
1586 Ga0055543_1000841
1587 Ga0065165_1000461
1588 Ga0065165_1013706
1589 Ga0065714_10000570
1590 Ga0065714_10002375
1591 Ga0065714_10002602
1592 Ga0065714_10003143
1593 Ga0065714_10064479
1594 Ga0065714_10064792
1595 Ga0065714_10097683
1596 Ga0065714_10104879
1597 Ga0065714_10108528
1598 Ga0065704_10000441
1599 Ga0065704_10000981
1600 Ga0065704_10002804
1601 Ga0065704_10074928
1602 Ga0065704_10076308
1603 Ga0065704_10079284
1604 Ga0065704_10085700
1605 Ga0065704_10093930
1606 Ga0065704_10095309
1607 Ga0065712_10068313
1608 Ga0065712_10079953
1609 Ga0065715_10095933
1610 Ga0070670_100283255
1611 Ga0070660_100246220
1612 Ga0070661_100004923
1613 Ga0070669_100000313
1614 Ga0070669_100000691
1615 Ga0070659_100305183
1616 Ga0070662_100003761
1617 Ga0070662_100017614
1618 Ga0070681_10004942
1619 Ga0070679_100111266
1620 Ga0068853_100002022
1621 Ga0068853_100143573
1622 Ga0068853_100207216
1623 Ga0070665_100000191
1624 Ga0070665_100048327
1625 Ga0070665_100430501
1626 Ga0070664_100000062
1627 Ga0068857_100002061
1628 Ga0068854_100104014
1629 Ga0068851_10000004
1630 Ga0081455_10234412
1631 Ga0081540_1022308
1632 Ga0075364_10025240
1633 Ga0075364_10045215
1634 Ga0075364_10063409
1635 Ga0075364_10174293
1636 Ga0075432_10000430
1637 Ga0075432_10001440
1638 Ga0075362_10007447
1639 Ga0075369_10062893
1640 Ga0075369_10083316
1641 Ga0075366_10026091
1642 Ga0075366_10034230
1643 Ga0075370_10013321
1644 Ga0075430_100235086
1645 Ga0099823_1030284
1646 Ga0099823_1048943
1647 Ga0079104_1000164
1648 Ga0079104_1000670
1649 Ga0079104_1000973
1650 Ga0079104_1001028
1651 Ga0079104_1001053
1652 Ga0079104_1001133
1653 Ga0079104_1001349
1654 Ga0079104_1016164
1655 Ga0099826_10001603
1656 Ga0105251_10000145
1657 Ga0105251_10000320
1658 Ga0105251_10000478
1659 Ga0105251_10002029
1660 Ga0105251_10003572
1661 Ga0105251_10004352
1662 Ga0105251_10005036
1663 Ga0105251_10008082
1664 Ga0105251_10014644
1665 Ga0105251_10043066
1666 Ga0105251_10050745
1667 Ga0105251_10055935
1668 Ga0105251_10058903
1669 Ga0105251_10074721
1670 Ga0105244_10000020
1671 Ga0105244_10000908
1672 Ga0105244_10001258
1673 Ga0105244_10001405
1674 Ga0105244_10001929
1675 Ga0105244_10004386
1676 Ga0105244_10004738
1677 Ga0105244_10004882
1678 Ga0105244_10007999
1679 Ga0105244_10008927
1680 Ga0105244_10010746
1681 Ga0105244_10017190
1682 Ga0105244_10025469
1683 Ga0105244_10038102
1684 Ga0105244_10043407
1685 Ga0105244_10058077
1686 Ga0105244_10079343
1687 Ga0105244_10083581
1688 Ga0105244_10106143
1689 Ga0105250_10000009
1690 Ga0105250_10000125
1691 Ga0105250_10000467
1692 Ga0105250_10000502
1693 Ga0105250_10000907
1694 Ga0105250_10002154
1695 Ga0105250_10002468
1696 Ga0105250_10003819
1697 Ga0105250_10014681
1698 Ga0105250_10017420
1699 Ga0105250_10017507
1700 Ga0105250_10022270
1701 Ga0105250_10052245
1702 Ga0105247_10000030
1703 Ga0105243_10000100
1704 Ga0105243_10000639
1705 Ga0105243_10001648
1706 Ga0105243_10009069
1707 Ga0105243_10009900
1708 Ga0105243_10040568
1709 Ga0105241_10000001
1710 Ga0105242_10000478
1711 Ga0105242_10238641
1712 Ga0105237_10002559
1713 Ga0105033_101306
1714 Ga0105246_10000237
1715 Ga0105246_10014181
1716 Ga0105246_10015549
1717 Ga0105246_10056920
1718 Ga0105246_10092795
1719 Ga0157373_10000373
1720 Ga0157373_10001594
1721 Ga0157373_10002803
1722 Ga0157373_10019659
1723 Ga0157373_10041384
1724 Ga0157373_10128200
1725 Ga0157373_10209767
1726 Ga0157371_10000099
1727 Ga0157371_10003408
1728 Ga0157371_10004573
1729 Ga0157371_10011814
1730 Ga0157371_10015149
1731 Ga0157371_10021793
1732 Ga0157371_10033428
1733 Ga0157370_10000150
1734 Ga0157370_10001912
1735 Ga0157370_10026170
1736 Ga0157370_10060869
1737 Ga0157370_10095300
1738 Ga0157370_10251262
1739 Ga0157370_10297229
1740 Ga0157369_10011869
1741 Ga0157369_10043532
1742 Ga0157369_10307169
1743 Ga0171462_1042
1744 Ga0163162_10335420
1745 Ga0157372_10004722
1746 Ga0157372_10010613
1747 Ga0157372_10126252
1748 Ga0157372_10401376
1749 Ga0157375_10038552
1750 Ga0157380_10011062
1751 Ga0182008_10001110
1752 Ga0182008_10001450
1753 Ga0182008_10013093
1754 Ga0182008_10022989
1755 Ga0182008_10091633
1756 Ga0182008_10099374
1757 Ga0182006_1000018
1758 Ga0182006_1003209
1759 Ga0182006_1006488
1760 Ga0182006_1008810
1761 Ga0182006_1018838
1762 Ga0182007_10043059
1763 Ga0182005_1000422
1764 Ga0182005_1030897
1765 Ga0183366_1001
1766 Ga0183370_1001
1767 Ga0183369_1001
1768 Ga0183368_1001
1769 Ga0163161_10000031
1770 Ga0163161_10176355
1771 Ga0163161_10205761
1772 Ga0163161_10212350
1773 Ga0163161_10216470
1774 Ga0163161_10327356
1775 Ga0163161_10338463
1776 Ga0209435_101162
1777 Ga0209760_100031
1778 Ga0209760_100056
1779 Ga0209760_100137
1780 Ga0209760_100139
1781 Ga0209436_100580
1782 Ga0209784_100001
1783 Ga0209784_100028
1784 Ga0209566_100001
1785 Ga0209566_100028
1786 Ga0209674_100002
1787 Ga0209674_100047
1788 Ga0209147_100031
1789 Ga0209563_100008
1790 Ga0209563_100050
1791 Ga0209563_102472
1792 Ga0207427_100016
1793 Ga0207427_100067
1794 Ga0207427_100231
1795 Ga0209437_100007
1796 Ga0209437_100011
1797 Ga0209437_100016
1798 Ga0209437_104358
1799 Ga0209258_100170
1800 Ga0209646_1000357
1801 Ga0209677_100004
1802 Ga0209677_100029
1803 Ga0209759_1005835
1804 Ga0209129_1001115
1805 Ga0209233_1000019
1806 Ga0209233_1000156
1807 Ga0209673_1000206
1808 Ga0209673_1002157
1809 Ga0209673_1009790
1810 Ga0209130_1000274
1811 Ga0209130_1000325
1812 Ga0209130_1000461
1813 Ga0209130_1000870
1814 Ga0209675_1002688
1815 Ga0209676_1000025
1816 Ga0209676_1000096
1817 Ga0209676_1000266
1818 Ga0209676_1000722
1819 Ga0209676_1009457
1820 Ga0209676_1009480
1821 Ga0209025_1000053
1822 Ga0209025_1000062
1823 Ga0209025_1000190
1824 Ga0209025_1000261
1825 Ga0209025_1000282
1826 Ga0209564_1000987
1827 Ga0209758_1000245
1828 Ga0209758_1001726
1829 Ga0209758_1004259
1830 Ga0209758_1007665
1831 Ga0209758_1011622
1832 Ga0209050_1000028
1833 Ga0209050_1000301
1834 Ga0209050_1000356
1835 Ga0209050_1001464
1836 Ga0209050_1003956
1837 Ga0209256_1003166
1838 Ga0207426_1000066
1839 Ga0207426_1000109
1840 Ga0207426_1000460
1841 Ga0207426_1000474
1842 Ga0207426_1000545
1843 Ga0209051_1000089
1844 Ga0209051_1000225
1845 Ga0209051_1000264
1846 Ga0209051_1000467
1847 Ga0209051_1008473
1848 Ga0209051_1009287
1849 Ga0209257_1000034
1850 Ga0209257_1002752
1851 Ga0209257_1003051
1852 Ga0207656_10000007
1853 Ga0207696_1000001
1854 Ga0207696_1000005
1855 Ga0207696_1000058
1856 Ga0207696_1000065
1857 Ga0207696_1000085
1858 Ga0207696_1000122
1859 Ga0207696_1000561
1860 Ga0207696_1000629
1861 Ga0207696_1002299
1862 Ga0207696_1003450
1863 Ga0207696_1006288
1864 Ga0207696_1009217
1865 Ga0207696_1009548
1866 Ga0207696_1010164
1867 Ga0207655_1000002
1868 Ga0207655_1000004
1869 Ga0207655_1000014
1870 Ga0207655_1000041
1871 Ga0207655_1000227
1872 Ga0207655_1000394
1873 Ga0207655_1000443
1874 Ga0207655_1000678
1875 Ga0207655_1003228
1876 Ga0207655_1004333
1877 Ga0207655_1004334
1878 Ga0207655_1004908
1879 Ga0207655_1005999
1880 Ga0207655_1012607
1881 Ga0207655_1013326
1882 Ga0207655_1024328
1883 Ga0207655_1026304
1884 Ga0207655_1028526
1885 Ga0207655_1028656
1886 Ga0207655_1046564
1887 Ga0207655_1066948
1888 Ga0207713_1000002
1889 Ga0207713_1000004
1890 Ga0207713_1000018
1891 Ga0207713_1000022
1892 Ga0207713_1000067
1893 Ga0207713_1000094
1894 Ga0207713_1000964
1895 Ga0207713_1001330
1896 Ga0207713_1004153
1897 Ga0207713_1007041
1898 Ga0207713_1008064
1899 Ga0207713_1008210
1900 Ga0207713_1011692
1901 Ga0207713_1013070
1902 Ga0207713_1016008
1903 Ga0207713_1019652
1904 Ga0207713_1020173
1905 Ga0207713_1020309
1906 Ga0207713_1022531
1907 Ga0207713_1037981
1908 Ga0207713_1039478
1909 Ga0207710_10000068
1910 Ga0207654_10000004
1911 Ga0207707_10003784
1912 Ga0207671_10000015
1913 Ga0207649_10000001
1914 Ga0207652_10163162
1915 Ga0207646_10249818
1916 Ga0207681_10000115
1917 Ga0207681_10000917
1918 Ga0207650_10005199
1919 Ga0207650_10005751
1920 Ga0207706_10002419
1921 Ga0207706_10006144
1922 Ga0207686_10000588
1923 Ga0207709_10000022
1924 Ga0207709_10000252
1925 Ga0207709_10005827
1926 Ga0207709_10014232
1927 Ga0207709_10276151
1928 Ga0207679_10000011
1929 Ga0207639_10002699
1930 Ga0207639_10061278
1931 Ga0207639_10128523
1932 Ga0207708_10337085
1933 Ga0207674_10004718
1934 Ga0209281_1000006
1935 Ga0209281_1000033
1936 Ga0209281_1000038
1937 Ga0209281_1000071
1938 Ga0209281_1000109
1939 Ga0209281_1000159
1940 Ga0209281_1000257
1941 Ga0209281_1001006
1942 Ga0209281_1002968
1943 Ga0209389_1000298
1944 Ga0209371_1000001
1945 Ga0209371_1000005
1946 Ga0209371_1000089
1947 Ga0209371_1000153
1948 Ga0209371_1000496
1949 Ga0209371_1001032
1950 Ga0209371_1002187
1951 Ga0209371_1002726
1952 Ga0209371_1003926
1953 Ga0209371_1023281
1954 Ga0209282_1043159
1955 Ga0207428_10010914
1956 Ga0207428_10047509
1957 Ga0268266_10001011
1958 Ga0268266_10008268
1959 Ga0268256_1000001
1960 Ga0268256_1000006
1961 Ga0268256_1000103
1962 Ga0268256_1001232
1963 Ga0268256_1001701
1964 Ga0268256_1001923
1965 Ga0268256_1002152
1966 Ga0268256_1002425
1967 Ga0268256_1003645
1968 Ga0268256_1026373
1969 Ga0316178_1009271
1970 Ga0316181_1270085
1971 Ga0316181_1279945
1972 Ga0265327_10058290
1973 Ga0307408_100034206
1974 Ga0307408_100299887
1975 Ga0307516_10217623
1976 Ga0307405_10173132
1977 Ga0307409_100245063
1978 Ga0307411_10200626
1979 Ga0307510_10026777
1980 Ga0307510_10173174
1981 Ga0237819_00859
1982 Ga0436360_1287249
1983 Ga0436361_0524714
1984 Ga0439436_0002120
1985 Ga0439438_000498
1986 Ga0439438_001218
1987 Ga0439438_001498
1988 Ga0439438_001594
1989 Ga0439438_003029
1990 Ga0439438_004069
1991 Ga0439438_004895
1992 Ga0439447_000310
1993 Ga0439447_000501
1994 Ga0439447_012552
1995 Ga0439447_013724
1996 Ga0439447_025060
1997 Ga0439466_0000334
1998 Ga0439466_0000620
1999 Ga0439466_0000665
2000 Ga0439466_0001745
2001 Ga0439466_0004892
2002 Ga0439466_0010143
2003 Ga0439466_0021445
2004 Ga0439466_0029369
2005 Ga0439465_0000550
2006 Ga0439465_0028570
2007 Ga0451853_1126616
2008 Ga0451853_2641771
2009 Ga0439431_0002829
2010 Ga0439431_0027821
2011 Ga0439445_0009126
2012 Ga0439445_0031278
2013 Ga0439432_001900
2014 Ga0439432_002858
2015 Ga0439432_005967
2016 Ga0439432_008787
2017 Ga0439432_049980
2018 Ga0439449_0019279
2019 Ga0439451_004666
2020 Ga0439452_000002
2021 Ga0439452_000101
2022 Ga0439452_000628
2023 Ga0439452_000662
2024 Ga0439452_002594
2025 Ga0439452_004284
2026 Ga0439452_006204
2027 Ga0439452_017215
2028 Ga0439452_021422
2029 Ga0439452_026388
2030 Ga0439456_002941
2031 Ga0439456_007129
2032 Ga0439463_000574
2033 Ga0439463_002244
2034 Ga0439463_002774
2035 Ga0439463_004470
2036 Ga0450911_002519
2037 Ga0450919_003687
2038 Ga0450922_002044
2039 Ga0450890_001172
2040 Ga0450902_000023
2041 Ga0450903_001230
2042 Ga0450903_002557
2043 Ga0450906_001654
2044 Ga0450907_000201
2045 Ga0450907_001929
2046 Ga0450907_002149
2047 Ga0450910_004385
2048 Ga0439446_0001401
2049 Ga0439446_0005590
2050 Ga0439446_0007826
2051 Ga0450908_002206
2052 Ga0450909_000517
2053 Ga0439434_0002623
2054 Ga0439434_0023103
2055 Ga0439464_0004184
2056 Ga0439464_0023444
2057 Ga0439460_0000611
2058 Ga0439460_0002720
2059 Ga0451577_0018662
2060 Ga0466981_0000008
2061 Ga0453684_0002280
2062 Ga0466959_0085344
2063 Ga0495617_002486
2064 Ga0495617_037767
2065 Ga0495627_000019
2066 Ga0495627_000117
2067 Ga0495627_000551
2068 Ga0495627_004205
2069 Ga0495627_006324
2070 Ga0495627_031662
2071 Ga0495603_0003088
2072 Ga0495603_0139336
2073 Ga0495590_0000657
2074 Ga0495590_0012603
2075 Ga0495590_0016167
2076 Ga0495591_000057
2077 Ga0495591_000059
2078 Ga0495591_000619
2079 Ga0495591_001018
2080 Ga0495591_002042
2081 Ga0495591_002860
2082 Ga0495591_005213
2083 Ga0495591_007937
2084 Ga0495591_023061
2085 Ga0495591_029879
2086 Ga0495629_0023997
2087 Ga0495638_0001624
2088 Ga0495638_0020882
2089 Ga0495638_0032284
2090 Ga0495638_0126224
2091 Ga0495638_0126805
2092 Ga0495653_0010480
2093 Ga0495653_0083924
2094 Ga0495653_0120013
2095 Ga0495653_0203599
2096 Ga0495650_0000031
2097 Ga0495650_0000090
2098 Ga0495650_0000493
2099 Ga0495650_0001674
2100 Ga0495650_0002040
2101 Ga0495650_0005457
2102 Ga0495650_0007113
2103 Ga0495650_0010884
2104 Ga0495650_0018034
2105 Ga0495605_0000093
2106 Ga0495605_0000106
2107 Ga0495605_0000398
2108 Ga0495605_0000623
2109 Ga0495605_0000674
2110 Ga0495605_0002177
2111 Ga0495605_0002729
2112 Ga0495605_0004162
2113 Ga0495605_0004990
2114 Ga0495605_0015840
2115 Ga0495605_0024658
2116 Ga0495605_0089390
2117 Ga0495639_0001663
2118 Ga0495639_0003693
2119 Ga0495584_0000056
2120 Ga0495584_0000721
2121 Ga0495584_0003343
2122 Ga0495584_0008479
2123 Ga0495584_0008776
2124 Ga0495584_0008890
2125 Ga0495584_0011447
2126 Ga0495584_0015653
2127 Ga0495585_0001600
2128 Ga0495585_0052856
2129 Ga0495585_0052945
2130 Ga0495585_0092853
2131 Ga0495585_0099000
2132 Ga0495585_0106755
2133 Ga0495594_0001925
2134 Ga0495594_0025819
2135 Ga0495596_0000810
2136 Ga0495596_0014963
2137 Ga0495596_0043369
2138 Ga0495596_0084890
2139 Ga0495607_0000425
2140 Ga0495607_0000443
2141 Ga0495607_0000564
2142 Ga0495607_0001753
2143 Ga0495607_0002121
2144 Ga0495607_0005450
2145 Ga0495607_0006483
2146 Ga0495607_0017113
2147 Ga0495607_0024819
2148 Ga0495607_0025613
2149 Ga0495607_0037333
2150 Ga0495607_0037970
2151 Ga0495607_0063508
2152 Ga0495607_0087000
2153 Ga0495607_0091210
2154 Ga0495607_0160091
2155 Ga0495583_0000105
2156 Ga0495583_0000327
2157 Ga0495583_0000610
2158 Ga0495583_0000663
2159 Ga0495583_0001084
2160 Ga0495583_0003160
2161 Ga0495583_0005897
2162 Ga0495583_0011350
2163 Ga0495583_0061864
2164 Ga0495583_0082047
2165 Ga0495606_0000384
2166 Ga0495606_0000568
2167 Ga0495606_0000613
2168 Ga0495606_0001546
2169 Ga0495606_0009470
2170 Ga0495606_0009914
2171 Ga0495606_0017681
2172 Ga0495606_0018554
2173 Ga0495606_0021496
2174 Ga0495606_0032264
2175 Ga0495606_0115019
2176 Ga0495606_0132736
2177 Ga0495606_0136279
2178 Ga0495606_0175549
2179 Ga0495610_0001910
2180 Ga0495610_0007780
2181 Ga0495610_0010267
2182 Ga0495610_0017120
2183 Ga0495610_0021472
2184 Ga0495610_0032164
2185 Ga0495610_0036793
2186 Ga0495610_0052983
2187 Ga0495610_0069315
2188 Ga0495616_0013437
2189 Ga0495616_0034408
2190 Ga0495616_0071217
2191 Ga0495616_0076326
2192 Ga0495616_0078233
2193 Ga0495616_0083980
2194 Ga0495616_0098549
2195 Ga0495620_0000071
2196 Ga0495620_0000353
2197 Ga0495620_0001683
2198 Ga0495620_0004814
2199 Ga0495620_0009341
2200 Ga0495620_0023714
2201 Ga0495620_0034588
2202 Ga0495620_0037060
2203 Ga0495620_0056079
2204 Ga0495630_0019223
2205 Ga0495631_0000110
2206 Ga0495631_0025731
2207 Ga0495631_0036702
2208 Ga0495632_0000265
2209 Ga0495632_0001736
2210 Ga0495632_0006622
2211 Ga0495632_0007347
2212 Ga0495632_0009322
2213 Ga0495632_0011651
2214 Ga0495632_0017874
2215 Ga0495632_0033367
2216 Ga0495632_0077817
2217 Ga0495632_0102475
2218 Ga0495632_0109835
2219 Ga0495637_0000216
2220 Ga0495637_0000488
2221 Ga0495637_0000687
2222 Ga0495637_0001900
2223 Ga0495637_0009397
2224 Ga0495637_0009448
2225 Ga0495637_0013767
2226 Ga0495637_0016618
2227 Ga0495637_0050010
2228 Ga0495637_0065583
2229 Ga0495643_0000585
2230 Ga0495643_0002726
2231 Ga0495643_0007542
2232 Ga0495643_0009165
2233 Ga0495643_0014200
2234 Ga0495643_0032002
2235 Ga0495644_0001299
2236 Ga0495644_0001407
2237 Ga0495644_0005713
2238 Ga0495644_0023353
2239 Ga0495648_0001916
2240 Ga0495648_0003690
2241 Ga0495648_0004560
2242 Ga0495648_0006334
2243 Ga0495648_0007582
2244 Ga0495648_0008853
2245 Ga0495648_0045693
2246 Ga0495648_0076196
2247 Ga0495648_0095426
2248 Ga0495648_0096643
2249 Ga0495648_0097987
2250 Ga0495648_0098006
2251 Ga0495666_0111942
2252 Ga0495642_0000361
2253 Ga0495642_0003199
2254 Ga0495642_0059416
2255 Ga0495654_0000098
2256 Ga0495654_0000818
2257 Ga0495654_0000955
2258 Ga0495654_0002993
2259 Ga0495654_0004622
2260 Ga0495654_0005237
2261 Ga0495654_0011053
2262 Ga0495654_0011442
2263 Ga0495654_0012057
2264 Ga0495654_0037409
2265 Ga0495654_0059781
2266 Ga0495654_0088775
2267 Ga0495654_0124101
2268 Ga0495586_0008590
2269 Ga0495587_0005426
2270 Ga0495609_0000056
2271 Ga0495609_0000196
2272 Ga0495609_0000275
2273 Ga0495609_0001849
2274 Ga0495609_0011092
2275 Ga0495609_0066997
2276 Ga0495609_0091835
2277 Ga0495597_0000090
2278 Ga0495597_0000482
2279 Ga0495597_0000627
2280 Ga0495597_0029378
2281 Ga0495597_0068913
2282 Ga0495597_0073274
2283 Ga0495645_0107898
2284 Ga0495622_0000577
2285 Ga0495622_0002011
2286 Ga0495622_0009385
2287 Ga0495622_0045649
2288 Ga0495622_0068076
2289 Ga0495633_0000169
2290 Ga0495633_0010976
2291 Ga0495633_0039030
2292 Ga0495668_0001865
2293 Ga0495668_0028942
2294 Ga0495668_0029043
2295 Ga0495668_0063743
2296 Ga0495668_0096405
2297 Ga0495634_0001928
2298 Ga0495634_0108470
2299 Ga0495611_0000772
2300 Ga0495611_0003100
2301 Ga0495611_0031356
2302 Ga0495611_0043191
2303 Ga0495611_0058897
2304 Ga0495625_0000082
2305 Ga0495625_0003062
2306 Ga0495625_0005099
2307 Ga0495625_0013828
2308 Ga0495625_0135276
2309 Ga0495625_0137336
2310 Ga0495635_0043550
2311 Ga0495635_0113024
2312 Ga0495659_0000023
2313 Ga0495659_0001057
2314 Ga0495659_0008999
2315 Ga0495661_0000027
2316 Ga0495661_0000140
2317 Ga0495661_0000268
2318 Ga0495661_0000466
2319 Ga0495661_0011149
2320 Ga0495661_0019998
2321 Ga0495661_0027101
2322 Ga0495661_0159207
2323 Ga0495588_0000196
2324 Ga0495588_0063616
2325 Ga0495646_0020601
2326 Ga0495646_0088296
2327 Ga0495669_0001255
2328 Ga0495613_0011595
2329 Ga0495624_0010836
2330 Ga0495670_0001231
2331 Ga0495670_0003754
2332 Ga0495670_0015037
2333 Ga0495670_0043884
2334 Ga0495670_0100266
2335 Ga0495670_0102974
2336 Ga0495671_0002323
2337 Ga0495671_0003837
2338 Ga0495671_0007018
2339 Ga0495671_0017735
2340 Ga0495671_0020414
2341 Ga0495671_0025898
2342 Ga0495671_0058343
2343 Ga0495671_0084157
2344 Ga0495671_0085367
2345 Ga0495649_0003922
2346 Ga0495649_0006811
2347 Ga0495649_0018297
2348 Ga0495649_0025704
2349 Ga0495649_0034423
2350 Ga0495649_0040950
2351 Ga0495649_0100500
2352 Ga0495589_0000003
2353 Ga0495589_0000961
2354 Ga0495589_0001089
2355 Ga0495589_0001677
2356 Ga0495589_0007479
2357 Ga0495589_0020240
2358 Ga0495589_0050961
2359 Ga0495589_0074899
2360 Ga0495589_0136605
2361 Ga0495600_0037880
2362 Ga0495600_0099631
2363 Ga0495660_0000015
2364 Ga0495660_0000028
2365 Ga0495660_0000837
2366 Ga0495660_0000967
2367 Ga0495660_0004920
2368 Ga0495660_0013715
2369 Ga0495660_0020346
2370 Ga0495660_0026190
2371 Ga0495660_0040943
2372 Ga0495660_0053605
2373 Ga0495660_0083999
2374 Ga0495660_0107511
2375 Ga0495581_0012020
2376 Ga0495604_0011263
2377 Ga0495604_0031397
2378 Ga0495636_0026961
2379 Ga0495672_0000001
2380 Ga0495672_0000009
2381 Ga0495672_0000357
2382 Ga0495672_0000537
2383 Ga0495672_0000945
2384 Ga0495672_0012686
2385 Ga0495672_0021273
2386 Ga0495672_0024118
2387 Ga0495672_0032914
2388 Ga0495672_0051956
2389 Ga0495672_0060431
2390 Ga0495672_0075158
2391 Ga0495672_0107175
2392 Ga0495672_0158056
2393 Ga0495676_0000057
2394 Ga0495676_0006636
2395 Ga0495680_0027481
2396 Ga0495680_0042106
2397 Ga0495680_0046267
2398 Ga0495683_0000101
2399 Ga0495683_0000473
2400 Ga0495683_0001281
2401 Ga0495683_0002172
2402 Ga0495683_0010971
2403 Ga0495687_000159
2404 Ga0495687_000160
2405 Ga0495675_0031533
2406 Ga0495677_0003409
2407 Ga0495679_000047
2408 Ga0495679_000052
2409 Ga0495679_000576
2410 Ga0495679_050823
2411 Ga0495673_0000073
2412 Ga0495673_0000919
2413 Ga0495673_0001324
2414 Ga0495673_0001971
2415 Ga0495673_0002739
2416 Ga0495673_0006025
2417 Ga0495673_0006245
2418 Ga0495673_0007924
2419 Ga0495673_0011220
2420 Ga0495673_0011557
2421 Ga0495673_0022252
2422 Ga0495673_0029520
2423 Ga0495673_0044224
2424 Ga0495673_0055724
2425 Ga0495673_0066210
2426 Ga0495681_0010987
2427 Ga0495681_0013984
2428 Ga0495681_0024601
2429 Ga0495681_0035781
2430 Ga0495681_0059434
2431 Ga0495681_0064413
2432 Ga0495681_0065882
2433 Ga0495686_0078682
2434 Ga0495686_0095469
2435 Ga0495686_0110518
2436 Ga0495593_0040257
2437 Ga0495593_0041815
2438 Ga0495593_0062691
2439 Ga0495602_0056914
2440 Ga0495615_0022192
2441 Ga0495626_0000063
2442 Ga0495626_0001629
2443 Ga0495626_0003486
2444 Ga0495626_0013796
2445 Ga0495626_0018344
2446 Ga0495626_0040581
2447 Ga0495626_0046618
2448 Ga0495626_0076919
2449 Ga0496100_0037329
2450 Ga0496101_0000238
2451 Ga0496101_0006349
2452 Ga0496102_0001561
2453 Ga0496102_0141729
2454 Ga0496102_0322605
2455 Ga0496103_0047306
2456 Ga0496104_0000870
2457 Ga0496104_0001961
2458 Ga0496105_0004949
2459 Ga0496105_0078866
2460 Ga0496110_0051032
2461 Ga0496114_0017785
2462 Ga0496115_0329107
2463 Ga0496116_0000007
2464 Ga0496116_0000234
2465 Ga0496116_0000613
2466 Ga0496116_0000845
2467 Ga0496116_0000960
2468 Ga0496116_0002607
2469 Ga0496116_0038048
2470 Ga0496116_0045368
2471 Ga0496116_0048025
2472 Ga0496116_0060651
2473 Ga0496117_0000775
2474 Ga0496117_0001091
2475 Ga0496117_0001727
2476 Ga0496117_0001930
2477 Ga0496117_0002207
2478 Ga0496117_0002377
2479 Ga0496117_0004181
2480 Ga0496117_0006885
2481 Ga0496117_0010931
2482 Ga0496117_0011127
2483 Ga0496117_0046368
2484 Ga0496117_0066163
2485 Ga0496117_0074435
2486 Ga0496118_0003126
2487 Ga0496118_0004107
2488 Ga0496118_0004537
2489 Ga0496118_0007973
2490 Ga0496118_0010603
2491 Ga0496118_0011077
2492 Ga0496118_0020365
2493 Ga0496118_0048483
2494 Ga0496118_0056224
2495 Ga0496118_0113397
2496 Ga0496118_0137613
2497 Ga0496119_0000348
2498 Ga0496119_0000582
2499 Ga0496119_0001764
2500 Ga0496119_0003562
2501 Ga0496119_0019362
2502 Ga0496119_0056980
2503 Ga0496120_0000287
2504 Ga0496120_0000364
2505 Ga0496120_0000452
2506 Ga0496120_0000945
2507 Ga0496120_0002643
2508 Ga0496120_0003670
2509 Ga0496120_0006581
2510 Ga0496120_0012383
2511 Ga0496120_0023634
2512 Ga0496121_0000346
2513 Ga0496121_0000565
2514 Ga0496121_0001904
2515 Ga0496121_0002181
2516 Ga0496121_0002811
2517 Ga0496121_0008337
2518 Ga0496121_0011723
2519 Ga0496121_0029547
2520 Ga0496121_0160313
2521 Ga0496122_0000058
2522 Ga0496122_0000264
2523 Ga0496122_0001113
2524 Ga0496122_0001199
2525 Ga0496122_0002597
2526 Ga0496122_0005299
2527 Ga0496122_0011643
2528 Ga0496122_0011681
2529 Ga0496122_0012048
2530 Ga0496122_0022107
2531 Ga0496122_0038656
2532 Ga0496122_0047885
2533 Ga0496122_0062023
2534 Ga0496122_0132195
2535 Ga0496123_0000044
2536 Ga0496123_0000215
2537 Ga0496123_0000846
2538 Ga0496123_0000911
2539 Ga0496123_0001400
2540 Ga0496123_0001530
2541 Ga0496123_0007508
2542 Ga0496123_0010260
2543 Ga0496123_0011236
2544 Ga0496123_0012065
2545 Ga0496123_0023517
2546 Ga0496123_0061416
2547 Ga0496124_0000092
2548 Ga0496124_0000787
2549 Ga0496124_0001050
2550 Ga0496124_0005454
2551 Ga0496124_0005640
2552 Ga0496124_0014243
2553 Ga0496124_0016521
2554 Ga0496124_0017975
2555 Ga0496124_0020494
2556 Ga0496124_0039710
2557 Ga0496124_0040970
2558 Ga0496124_0054934
2559 Ga0496124_0061012
2560 Ga0496124_0065726
2561 Ga0496124_0079101
2562 Ga0496124_0226447
2563 Ga0496125_0000103
2564 Ga0496125_0000264
2565 Ga0496125_0000922
2566 Ga0496125_0002771
2567 Ga0496125_0006920
2568 Ga0496125_0008984
2569 Ga0496125_0030208
2570 Ga0496125_0058292
2571 Ga0496126_0002072
2572 Ga0496126_0002455
2573 Ga0496126_0005468
2574 Ga0496126_0075310
2575 Ga0495678_000057
2576 Ga0495678_000964
2577 Ga0495678_001561
2578 Ga0495678_003445
2579 Ga0495678_006404
2580 Ga0495678_022022
2581 Ga0495678_029439
2582 Ga0495678_033199
2583 Ga0495678_055956
2584 Ga0495678_060500
2585 Ga0495682_0000001
2586 Ga0495682_0000057
2587 Ga0495682_0000218
2588 Ga0495682_0001324
2589 Ga0495682_0005152
2590 Ga0495682_0021872
2591 Ga0495682_0056322
2592 Ga0501032_0018586
2593 Ga0501034_0000085
2594 Ga0501039_0263384
2595 nmdc:mga03683_6050_c1
2596 nmdc:mga0k408_24689_c1
2597 nmdc:mga06z11_4626_c1
2598 nmdc:mga0qj67_222290_c1
2599 nmdc:mga0sz30_20900_c1
2600 nmdc:mga0sz30_6298_c2
2601 Ga0500578_0026286
2602 Ga0500651_0078781
2603 Ga0500641_0005518
2604 Ga0500572_023756
2605 Ga0500594_0002751
2606 Ga0500621_000002
2607 Ga0500658_0000490
2608 Ga0500573_0024946
2609 Ga0500637_0010545
2610 Ga0500645_040348
2611 Ga0500609_001726
2612 2506579396
2613 2506584535
2614 2508853260
2615 2510285424
2616 2510295933
2617 2510313562
2618 2511256194
2619 2511265248
2620 2511272292
2621 2511279339
2622 2511287551
2623 2511297473
2624 2511304360
2625 2511316203
2626 2511322040
2627 2511326395
2628 2511330874
2629 2511341478
2630 2511346521
2631 2511349234
2632 2511356380
2633 2511361493
2634 2511367161
2635 2511372924
2636 2511380296
2637 2511414420
2638 2511436625
2639 2511822579
2640 2512327627
2641 2513568465
2642 2513579443
2643 2515738451
2644 2517080487
2645 2524610867
2646 2548650591
2647 2554817942
2648 2555247471
2649 2555667546
2650 2583789689
2651 2585269333
2652 2585327179
2653 2585391312
2654 2585391780
2655 2585526813
2656 2585543081
2657 2585557484
2658 2585564246
2659 2585825507
2660 2585832011
2661 2585841446
2662 2597855775
2663 2597861784
2664 2597867510
2665 2599327254
2666 2599356767
2667 2599363203
2668 2599369845
2669 2599376312
2670 2599381872
2671 2599387984
2672 2599395490
2673 2599398736
2674 2599407255
2675 2599408778
2676 2599450791
2677 2599463600
2678 2599469052
2679 2599485677
2680 2599492619
2681 2599499983
2682 2599506546
2683 2599514264
2684 2599518864
2685 2599616711
2686 2599769539
2687 2599806807
2688 2599882959
2689 2599886960
2690 2599893402
2691 2599898289
2692 2599931021
2693 2599944599
2694 2599952411
2695 2599956058
2696 2599961217
2697 2599964676
2698 2599973079
2699 2599977392
2700 2599983175
2701 2599991108
2702 2599997761
2703 2600001020
2704 2600007055
2705 2600011561
2706 2600019207
2707 2600026417
2708 2600031991
2709 2600036839
2710 2600043265
2711 2600048179
2712 2600055785
2713 2600061184
2714 2600068428
2715 2600072464
2716 2600078420
2717 2600216229
2718 2600360270
2719 2600364763
2720 2601522708
2721 2601527735
2722 2601614566
2723 2601619286
2724 2601627064
2725 2601642114
2726 2601646956
2727 2601652713
2728 2601658039
2729 2601661936
2730 2601692465
2731 2601694894
2732 2601701857
2733 2601706560
2734 2601710864
2735 2601715878
2736 2601719921
2737 2601726284
2738 2601730825
2739 2601735840
2740 2601741106
2741 2601751037
2742 2601776396
2743 2601797964
2744 2602018290
2745 2603645150
2746 2603661616
2747 2603664571
2748 2603699022
2749 2603705055
2750 2603838218
2751 2603843296
2752 2603848369
2753 2603853442
2754 2603866949
2755 2603871496
2756 2603876402
2757 2606048687
2758 2606069003
2759 2606076553
2760 2606129033
2761 2606144800
2762 2606176089
2763 2608380745
2764 2621302062
2765 2624478347
2766 2624489898
2767 2637224589
2768 2643841114
2769 2643872504
2770 2643954777
2771 2644024417
2772 2644190110
2773 2644210608
2774 2644281391
2775 2644619764
2776 2644654142
2777 2656275917
2778 2671090671
2779 2671099844
2780 2671101496
2781 2671109888
2782 2671129211
2783 2671772459
2784 2676405917
2785 2677898842
2786 2678261122
2787 2681996530
2788 2682006056
2789 2689445970
2790 2692318073
2791 2712469490
2792 2715749341
2793 2715755607
2794 2718632289
2795 2723246678
2796 2738674201
2797 2738687465
2798 2738752594
2799 2738807783
2800 2738861635
2801 2738895143
2802 2739035149
2803 2739200585
2804 2739259937
2805 2739263086
2806 2739288618
2807 2739293930
2808 2739311415
2809 2743735195
2810 2745006433
2811 2753856607
2812 2765581725
2813 2765589626
2814 2766068902
2815 2772439836
2816 2774119426
2817 2774132440
2818 2774134863
2819 2775539624
2820 2776259455
2821 2777023005
2822 2784260917
2823 2784316365
2824 2793342724
2825 2793363402
2826 2793368744
2827 2794594157
2828 2806049601
2829 2806054587
2830 2806060595
2831 2806069485
2832 2806076880
2833 2807176812
2834 2807406353
2835 2807454706
2836 2808856217
2837 2808922615
2838 2808932673
2839 2808936277
2840 2808940151
2841 2808944302
2842 2808954794
2843 2808955997
2844 2808965614
2845 2808976532
2846 2808992030
2847 2808999610
2848 2809218103
2849 2812370340
2850 2817488530
2851 2819657357
2852 2819705340
2853 2821121689
2854 2821444159
2855 2821450076
2856 2821450762
2857 2823375348
2858 2825654138
2859 2826586245
2860 2834032097
2861 2838690500
2862 2838733143
2863 2838747268
2864 2841855421
2865 2842117007
2866 2842160872
2867 2842164401
2868 2842184488
2869 2842232071
2870 2842248527
2871 2842262665
2872 2842275186
2873 2842307378
2874 2842396969
2875 2842807139
2876 2842817879
2877 2842832217
2878 2842834293
2879 2842842892
2880 2842846230
2881 2842851825
2882 2842859969
2883 2844428059
2884 2844460156
2885 2844534015
2886 2844536641
2887 2844539481
2888 2844668021
2889 2844671157
2890 2847423419
2891 2848997099
2892 2852104104
2893 2852617202
2894 2852660324
2895 2852671809
2896 2855875134
2897 2857517729
2898 2860343513
2899 2860868560
2900 2869555308
2901 2876601808
2902 2878030296
2903 2880231240
2904 2884088267
2905 2888369952
2906 2891374531
2907 2891673925
2908 2904478251
2909 2904514478
2910 2904519697
2911 2904553929
2912 2908447151
2913 2912964301
2914 2913037412
2915 2917071298
2916 2917701228
2917 2917833957
2918 2919066023
2919 2919129969
2920 2919155499
2921 2919160020
2922 2919389640
2923 2919460112
2924 2919486556
2925 2919488568
2926 2919698824
2927 2923154191
2928 2923524428
2929 2923591646
2930 2923635514
2931 2927147909
2932 2927833511
2933 2929144944
2934 2929190416
2935 2931371719
2936 2931391500
2937 2931398970
2938 2932408895
2939 2933573966
2940 2933593243
2941 2935359126
2942 2935906138
2943 2936384492
2944 2937540689
2945 2937968478
2946 2939582027
2947 2939605790
2948 2939608981
2949 2939641232
2950 2939655908
2951 2945930038
2952 2945967714
2953 2946012387
2954 2946028761
2955 2947235293
2956 2969081632
2957 2969305088
2958 2974293217
2959 2974302854
2960 2974311443
2961 2984291867
2962 2984499561
2963 2984506002
2964 2984564046
2965 2984596779
2966 2988732335
2967 2989352467
2968 2998140598
2969 3003935922
2970 3007320172
2971 3007399746
2972 3007420135
2973 3007518044
2974 3007618294
2975 3007622271
2976 3007720391
2977 3007808889
2978 3007859825
2979 3007864195
2980 3007870832
2981 3007873258
2982 637317941
2983 640938745
2984 8002746975
2985 8004595936
2986 8005308272
2987 8005559517
2988 8005566438
2989 8005571306
2990 8005697056
2991 8011352780
2992 8015397969
2993 8015688441
2994 8016735305
2995 8018163712
2996 8018222998
2997 8018409651
2998 8019501216
2999 8019770422
3000 8019777472
3001 8023681599
3002 8030000142
3003 8052495165
3004 8054006557
3005 8054291009
3006 8054350012
3007 8054504091
3008 8054930818
3009 8055088132
3010 8055095176
3011 8055098522
3012 8055771541
3013 8055818487
3014 8055879856
3015 8056116848
3016 8056125353
3017 8056126596
3018 8056132458
3019 8056142432
3020 8056143876
3021 8056152593
3022 8056158639
3023 8056164471
3024 8056170453
3025 8056176583
3026 8056182915
3027 8056378089
3028 8056573421
3029 8057802825
3030 8057881333

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

72

414

0.94

PF13433

Peripla_BP_5

Periplasmic binding protein domain

73

422

0.87

PF01094

ANF_receptor

Receptor family ligand binding region

91

412

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ipc-assembly1.cif.gz_A structure of atu2422-gaba f77a mutant receptor in complex with leucine 0.963 27 363
3ip9-assembly1.cif.gz_A structure of atu2422-gaba receptor in complex with gaba 0.9622 27 363
4n0q-assembly1.cif.gz_A crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic) 0.9592 28 363
1z18-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9556 27 367
1z18-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9448 27 367
ID Description Score Start End Superfamily
1usiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9736 148 275 3.40.50.2300
af_P04816_25_358_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9681 28 356 3.40.190.10
4n0qA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9655 148 277 3.40.50.2300
3ipcA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9644 148 277 3.40.50.2300
af_P04816_25_358_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9511 28 356 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A528G7S6-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9917 28 137 GO:0006865
AF-W1EKH1-F1-model_v4 deleted 0.9908 24 288
AF-A0A2X2T0D3-F1-model_v4 Leucine-specific-binding protein 0.9799 64 208 GO:0006865
AF-A0A528G7S6-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9741 28 137 GO:0006865
AF-W1EKH1-F1-model_v4 deleted 0.9725 24 288

Map