F494528
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1520 | 448 | 3040 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300006353|Ga0075370_10729472|Ga0075370_107294722 |
| Length | 128 |
| Sequence | VIYGIGTDICDIRRIQASLDKHGERFAGKILSEAEMKTWRARSARVRYLATRFSAKEAFSKAVGLGMRMPMTWKLCEVGKLPSGKPVIVLHGVLKEWCEAKGLSAMVSVTDESDYAASFVVVEQKDPK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 89 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 106 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 196 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 205 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 208 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 209 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 210 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 211 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 212 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 213 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 215 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 216 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 217 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 218 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 225 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 226 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 227 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 228 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 235 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 239 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 249 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 250 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 251 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 252 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 253 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 254 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 255 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 256 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 267 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 268 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 269 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 270 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 271 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 272 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 273 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 274 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 275 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 276 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 277 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 278 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 279 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 280 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 281 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 282 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 283 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 284 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 285 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 286 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 287 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 288 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 289 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 290 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 291 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 292 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 293 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 294 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 295 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 296 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 297 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 298 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 299 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 300 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 301 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 302 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 303 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 304 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 305 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 306 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 307 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 308 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 309 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 310 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 311 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 312 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 313 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 314 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 315 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 316 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 317 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 318 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 319 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 320 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 374 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 375 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 376 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 377 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 378 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 379 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 382 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 383 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 384 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 385 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 386 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 387 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 388 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 389 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 390 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 391 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 392 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 393 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 394 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 400 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 401 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 404 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 405 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 406 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 407 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 408 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 409 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 410 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 411 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 420 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 422 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 423 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 424 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 425 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 427 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 428 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 430 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 431 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 432 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 433 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 434 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 435 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 436 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 437 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 438 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 439 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 440 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 441 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 442 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 443 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 444 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 445 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 446 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 447 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 448 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.28 |
| Metatranscriptomes | 0 |
| Isolates | 0.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.08 |
| Nodule | 0.26 |
| Rhizoplane | 4.28 |
| Rhizosphere | 74.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075370_10729472 | 3300006353 | Bacteria | 603 |
| 2 | rootH1_10010129 | 3300003316 | Bacteria | 3033 |
| 3 | rootH2_10039438 | 3300003320 | Bacteria | 6448 |
| 4 | rootH2_10043347 | 3300003320 | Bacteria | 1683 |
| 5 | rootL2_10013481 | 3300003322 | Bacteria | 10192 |
| 6 | rootL2_10026887 | 3300003322 | Bacteria | 4953 |
| 7 | rootH1_10044193 | 3300003323 | Bacteria | 6802 |
| 8 | rootH1_10044196 | 3300003323 | Bacteria | 15532 |
| 9 | rootH1_10161445 | 3300003323 | Bacteria | 2150 |
| 10 | Ga0055525_1000004 | 3300003759 | Bacteria | 888039 |
| 11 | Ga0055524_1003998 | 3300003775 | Bacteria | 6954 |
| 12 | Ga0055530_10005573 | 3300003791 | Bacteria | 5931 |
| 13 | Ga0055530_10034370 | 3300003791 | Bacteria | 1296 |
| 14 | Ga0055530_10066829 | 3300003791 | Bacteria | 785 |
| 15 | Ga0055540_1000001 | 3300003792 | Bacteria | 466834 |
| 16 | Ga0055540_1023341 | 3300003792 | Bacteria | 1560 |
| 17 | Ga0055540_1030847 | 3300003792 | Bacteria | 1238 |
| 18 | Ga0055531_10000730 | 3300003794 | Bacteria | 27806 |
| 19 | Ga0055531_10002938 | 3300003794 | Bacteria | 11090 |
| 20 | Ga0055531_10012364 | 3300003794 | Bacteria | 4023 |
| 21 | Ga0055531_10015992 | 3300003794 | Bacteria | 3267 |
| 22 | Ga0055531_10065451 | 3300003794 | Bacteria | 864 |
| 23 | Ga0055543_1004765 | 3300004625 | Bacteria | 3613 |
| 24 | Ga0065165_1000016 | 3300005262 | Bacteria | 286248 |
| 25 | Ga0065165_1030189 | 3300005262 | Bacteria | 1728 |
| 26 | Ga0065165_1042849 | 3300005262 | Bacteria | 1333 |
| 27 | Ga0065704_10470195 | 3300005289 | Bacteria | 690 |
| 28 | Ga0065715_10384956 | 3300005293 | Bacteria | 902 |
| 29 | Ga0065715_10786722 | 3300005293 | Bacteria | 615 |
| 30 | Ga0065707_10602331 | 3300005295 | Bacteria | 689 |
| 31 | Ga0065707_10765415 | 3300005295 | Bacteria | 612 |
| 32 | Ga0070658_10514254 | 3300005327 | Bacteria | 1035 |
| 33 | Ga0070676_10012789 | 3300005328 | Bacteria | 4592 |
| 34 | Ga0070676_10021065 | 3300005328 | Bacteria | 3647 |
| 35 | Ga0070676_10022439 | 3300005328 | Bacteria | 3539 |
| 36 | Ga0070676_10071093 | 3300005328 | Bacteria | 2089 |
| 37 | Ga0070676_10099440 | 3300005328 | Bacteria | 1795 |
| 38 | Ga0070676_10121342 | 3300005328 | Bacteria | 1641 |
| 39 | Ga0070676_10144140 | 3300005328 | Bacteria | 1519 |
| 40 | Ga0070676_10736202 | 3300005328 | Bacteria | 723 |
| 41 | Ga0070676_10807474 | 3300005328 | Bacteria | 693 |
| 42 | Ga0070676_11366954 | 3300005328 | Bacteria | 542 |
| 43 | Ga0070683_100186556 | 3300005329 | Bacteria | 1969 |
| 44 | Ga0070690_100010179 | 3300005330 | Bacteria | 5463 |
| 45 | Ga0070690_101072455 | 3300005330 | Bacteria | 638 |
| 46 | Ga0070670_100003220 | 3300005331 | Bacteria | 13475 |
| 47 | Ga0070670_100008161 | 3300005331 | Bacteria | 8917 |
| 48 | Ga0070670_100057570 | 3300005331 | Bacteria | 3336 |
| 49 | Ga0070670_100101782 | 3300005331 | Bacteria | 2473 |
| 50 | Ga0070670_100107001 | 3300005331 | Bacteria | 2410 |
| 51 | Ga0070670_100174034 | 3300005331 | Bacteria | 1868 |
| 52 | Ga0070670_100240883 | 3300005331 | Bacteria | 1575 |
| 53 | Ga0070670_100312486 | 3300005331 | Bacteria | 1376 |
| 54 | Ga0070670_100332533 | 3300005331 | Bacteria | 1332 |
| 55 | Ga0070670_100373467 | 3300005331 | Bacteria | 1255 |
| 56 | Ga0070670_100525826 | 3300005331 | Bacteria | 1054 |
| 57 | Ga0070677_10004653 | 3300005333 | Bacteria | 4489 |
| 58 | Ga0070677_10014642 | 3300005333 | Bacteria | 2765 |
| 59 | Ga0070677_10016371 | 3300005333 | Bacteria | 2638 |
| 60 | Ga0070677_10036642 | 3300005333 | Bacteria | 1909 |
| 61 | Ga0070677_10061088 | 3300005333 | Bacteria | 1555 |
| 62 | Ga0070677_10074467 | 3300005333 | Bacteria | 1436 |
| 63 | Ga0070677_10132128 | 3300005333 | Bacteria | 1141 |
| 64 | Ga0070677_10149801 | 3300005333 | Bacteria | 1084 |
| 65 | Ga0068869_100006018 | 3300005334 | Bacteria | 7673 |
| 66 | Ga0068869_100009303 | 3300005334 | Bacteria | 6373 |
| 67 | Ga0068869_100066966 | 3300005334 | Bacteria | 2648 |
| 68 | Ga0068869_100068467 | 3300005334 | Bacteria | 2622 |
| 69 | Ga0068869_100076582 | 3300005334 | Bacteria | 2487 |
| 70 | Ga0068869_100164474 | 3300005334 | Bacteria | 1729 |
| 71 | Ga0068869_101003464 | 3300005334 | Bacteria | 727 |
| 72 | Ga0068869_101042123 | 3300005334 | Bacteria | 714 |
| 73 | Ga0070666_10005842 | 3300005335 | Bacteria | 7558 |
| 74 | Ga0070666_10023270 | 3300005335 | Bacteria | 4033 |
| 75 | Ga0070666_10387518 | 3300005335 | Bacteria | 1004 |
| 76 | Ga0070666_10746725 | 3300005335 | Bacteria | 719 |
| 77 | Ga0070680_100478267 | 3300005336 | Bacteria | 1065 |
| 78 | Ga0070680_100563978 | 3300005336 | Bacteria | 976 |
| 79 | Ga0070682_100870299 | 3300005337 | Bacteria | 738 |
| 80 | Ga0068868_100025650 | 3300005338 | Bacteria | 4486 |
| 81 | Ga0068868_100044655 | 3300005338 | Bacteria | 3465 |
| 82 | Ga0068868_100050975 | 3300005338 | Bacteria | 3253 |
| 83 | Ga0068868_100053875 | 3300005338 | Bacteria | 3169 |
| 84 | Ga0068868_100239582 | 3300005338 | Bacteria | 1524 |
| 85 | Ga0068868_100372618 | 3300005338 | Bacteria | 1227 |
| 86 | Ga0070660_100055247 | 3300005339 | Bacteria | 3068 |
| 87 | Ga0070660_100073646 | 3300005339 | Bacteria | 2671 |
| 88 | Ga0070660_100277980 | 3300005339 | Bacteria | 1370 |
| 89 | Ga0070689_100054759 | 3300005340 | Bacteria | 3089 |
| 90 | Ga0070691_10089834 | 3300005341 | Bacteria | 1513 |
| 91 | Ga0070661_100091319 | 3300005344 | Bacteria | 2255 |
| 92 | Ga0070661_100473966 | 3300005344 | Bacteria | 999 |
| 93 | Ga0070661_100511107 | 3300005344 | Bacteria | 962 |
| 94 | Ga0070692_10586297 | 3300005345 | Bacteria | 736 |
| 95 | Ga0070668_100011100 | 3300005347 | Bacteria | 6705 |
| 96 | Ga0070668_100038204 | 3300005347 | Bacteria | 3669 |
| 97 | Ga0070668_100039496 | 3300005347 | Bacteria | 3609 |
| 98 | Ga0070668_100080198 | 3300005347 | Bacteria | 2556 |
| 99 | Ga0070668_101174531 | 3300005347 | Bacteria | 695 |
| 100 | Ga0070669_100008914 | 3300005353 | Bacteria | 7156 |
| 101 | Ga0070669_100129958 | 3300005353 | Bacteria | 1931 |
| 102 | Ga0070669_100235220 | 3300005353 | Bacteria | 1453 |
| 103 | Ga0070669_100306913 | 3300005353 | Bacteria | 1278 |
| 104 | Ga0070669_100369101 | 3300005353 | Bacteria | 1168 |
| 105 | Ga0070669_100413664 | 3300005353 | Bacteria | 1105 |
| 106 | Ga0070669_100511489 | 3300005353 | Bacteria | 997 |
| 107 | Ga0070669_100763692 | 3300005353 | Bacteria | 820 |
| 108 | Ga0070675_100001865 | 3300005354 | Bacteria | 15533 |
| 109 | Ga0070675_100004779 | 3300005354 | Bacteria | 10332 |
| 110 | Ga0070675_100010417 | 3300005354 | Bacteria | 7263 |
| 111 | Ga0070675_100011548 | 3300005354 | Bacteria | 6918 |
| 112 | Ga0070675_100017314 | 3300005354 | Bacteria | 5725 |
| 113 | Ga0070675_100025466 | 3300005354 | Bacteria | 4742 |
| 114 | Ga0070675_100117455 | 3300005354 | Bacteria | 2257 |
| 115 | Ga0070675_100185939 | 3300005354 | Bacteria | 1798 |
| 116 | Ga0070675_100478502 | 3300005354 | Bacteria | 1120 |
| 117 | Ga0070675_100520689 | 3300005354 | Bacteria | 1073 |
| 118 | Ga0070675_100601051 | 3300005354 | Bacteria | 998 |
| 119 | Ga0070671_100008478 | 3300005355 | Bacteria | 8238 |
| 120 | Ga0070671_100012328 | 3300005355 | Bacteria | 6883 |
| 121 | Ga0070671_100035021 | 3300005355 | Bacteria | 4158 |
| 122 | Ga0070671_100044632 | 3300005355 | Bacteria | 3684 |
| 123 | Ga0070671_100072731 | 3300005355 | Bacteria | 2871 |
| 124 | Ga0070671_100114652 | 3300005355 | Bacteria | 2265 |
| 125 | Ga0070671_100450904 | 3300005355 | Bacteria | 1104 |
| 126 | Ga0070671_100540394 | 3300005355 | Bacteria | 1004 |
| 127 | Ga0070671_100942887 | 3300005355 | Bacteria | 755 |
| 128 | Ga0070671_101079295 | 3300005355 | Bacteria | 705 |
| 129 | Ga0070674_100004964 | 3300005356 | Bacteria | 7624 |
| 130 | Ga0070674_100023906 | 3300005356 | Bacteria | 3962 |
| 131 | Ga0070674_100058113 | 3300005356 | Bacteria | 2687 |
| 132 | Ga0070674_100086860 | 3300005356 | Bacteria | 2248 |
| 133 | Ga0070674_100106645 | 3300005356 | Bacteria | 2050 |
| 134 | Ga0070674_100151955 | 3300005356 | Bacteria | 1748 |
| 135 | Ga0070674_100174927 | 3300005356 | Bacteria | 1640 |
| 136 | Ga0070674_100449500 | 3300005356 | Bacteria | 1063 |
| 137 | Ga0070673_100007810 | 3300005364 | Bacteria | 7083 |
| 138 | Ga0070673_100034667 | 3300005364 | Bacteria | 3821 |
| 139 | Ga0070673_100048394 | 3300005364 | Bacteria | 3314 |
| 140 | Ga0070673_100050422 | 3300005364 | Bacteria | 3255 |
| 141 | Ga0070673_100257087 | 3300005364 | Bacteria | 1524 |
| 142 | Ga0070673_100349150 | 3300005364 | Bacteria | 1312 |
| 143 | Ga0070673_100542472 | 3300005364 | Bacteria | 1056 |
| 144 | Ga0070673_101388204 | 3300005364 | Bacteria | 661 |
| 145 | Ga0070688_100486364 | 3300005365 | Bacteria | 929 |
| 146 | Ga0070659_100005335 | 3300005366 | Bacteria | 9220 |
| 147 | Ga0070659_100207367 | 3300005366 | Bacteria | 1614 |
| 148 | Ga0070667_100002053 | 3300005367 | Bacteria | 17829 |
| 149 | Ga0070667_100015048 | 3300005367 | Bacteria | 6392 |
| 150 | Ga0070667_100016760 | 3300005367 | Bacteria | 6063 |
| 151 | Ga0070667_100039535 | 3300005367 | Bacteria | 3954 |
| 152 | Ga0070667_100042339 | 3300005367 | Bacteria | 3821 |
| 153 | Ga0070667_100319074 | 3300005367 | Bacteria | 1402 |
| 154 | Ga0070667_100341779 | 3300005367 | Bacteria | 1354 |
| 155 | Ga0070667_101207418 | 3300005367 | Bacteria | 708 |
| 156 | Ga0070667_101264923 | 3300005367 | Bacteria | 691 |
| 157 | Ga0070667_101659328 | 3300005367 | Bacteria | 601 |
| 158 | Ga0070705_101325848 | 3300005440 | Bacteria | 597 |
| 159 | Ga0070700_100258326 | 3300005441 | Bacteria | 1253 |
| 160 | Ga0070708_100520446 | 3300005445 | Bacteria | 1122 |
| 161 | Ga0070663_100037006 | 3300005455 | Bacteria | 3394 |
| 162 | Ga0070663_100049975 | 3300005455 | Bacteria | 2972 |
| 163 | Ga0070663_100098399 | 3300005455 | Bacteria | 2179 |
| 164 | Ga0070663_100193777 | 3300005455 | Bacteria | 1583 |
| 165 | Ga0070663_100219994 | 3300005455 | Bacteria | 1490 |
| 166 | Ga0070663_100229848 | 3300005455 | Bacteria | 1460 |
| 167 | Ga0070663_100261169 | 3300005455 | Bacteria | 1374 |
| 168 | Ga0070663_100705700 | 3300005455 | Bacteria | 858 |
| 169 | Ga0070678_100035116 | 3300005456 | Bacteria | 3497 |
| 170 | Ga0070678_100060993 | 3300005456 | Bacteria | 2779 |
| 171 | Ga0070678_100067178 | 3300005456 | Bacteria | 2667 |
| 172 | Ga0070678_100085234 | 3300005456 | Bacteria | 2407 |
| 173 | Ga0070678_100092856 | 3300005456 | Bacteria | 2319 |
| 174 | Ga0070678_100102135 | 3300005456 | Bacteria | 2224 |
| 175 | Ga0070678_100223660 | 3300005456 | Bacteria | 1565 |
| 176 | Ga0070678_100259381 | 3300005456 | Bacteria | 1461 |
| 177 | Ga0070678_100302576 | 3300005456 | Bacteria | 1359 |
| 178 | Ga0070678_100440511 | 3300005456 | Bacteria | 1139 |
| 179 | Ga0070678_100593525 | 3300005456 | Bacteria | 988 |
| 180 | Ga0070678_100690436 | 3300005456 | Bacteria | 919 |
| 181 | Ga0070678_100691420 | 3300005456 | Bacteria | 918 |
| 182 | Ga0070662_100012119 | 3300005457 | Bacteria | 5708 |
| 183 | Ga0070662_100012323 | 3300005457 | Bacteria | 5667 |
| 184 | Ga0070662_100028919 | 3300005457 | Bacteria | 3863 |
| 185 | Ga0070662_100207991 | 3300005457 | Bacteria | 1556 |
| 186 | Ga0070662_100262001 | 3300005457 | Bacteria | 1393 |
| 187 | Ga0070662_100690746 | 3300005457 | Bacteria | 863 |
| 188 | Ga0070681_10422995 | 3300005458 | Bacteria | 1244 |
| 189 | Ga0068867_100003434 | 3300005459 | Bacteria | 11141 |
| 190 | Ga0068867_100006721 | 3300005459 | Bacteria | 8131 |
| 191 | Ga0068867_100020479 | 3300005459 | Bacteria | 4714 |
| 192 | Ga0068867_100043063 | 3300005459 | Bacteria | 3304 |
| 193 | Ga0068867_100046830 | 3300005459 | Bacteria | 3177 |
| 194 | Ga0068867_100085295 | 3300005459 | Bacteria | 2387 |
| 195 | Ga0068867_100141831 | 3300005459 | Bacteria | 1879 |
| 196 | Ga0068867_100270551 | 3300005459 | Bacteria | 1389 |
| 197 | Ga0068867_100511712 | 3300005459 | Bacteria | 1034 |
| 198 | Ga0068867_100529327 | 3300005459 | Bacteria | 1018 |
| 199 | Ga0068867_100577095 | 3300005459 | Bacteria | 977 |
| 200 | Ga0068867_100728608 | 3300005459 | Bacteria | 878 |
| 201 | Ga0068867_101252423 | 3300005459 | Bacteria | 683 |
| 202 | Ga0068867_101751015 | 3300005459 | Bacteria | 583 |
| 203 | Ga0070685_10973434 | 3300005466 | Bacteria | 635 |
| 204 | Ga0070706_100016764 | 3300005467 | Bacteria | 6767 |
| 205 | Ga0070706_100864366 | 3300005467 | Bacteria | 836 |
| 206 | Ga0070698_100084012 | 3300005471 | Bacteria | 3173 |
| 207 | Ga0070679_100042059 | 3300005530 | Bacteria | 4550 |
| 208 | Ga0070684_100124826 | 3300005535 | Bacteria | 2318 |
| 209 | Ga0070684_102177369 | 3300005535 | Bacteria | 523 |
| 210 | Ga0068853_100056523 | 3300005539 | Bacteria | 3384 |
| 211 | Ga0068853_100101997 | 3300005539 | Bacteria | 2539 |
| 212 | Ga0068853_100109430 | 3300005539 | Bacteria | 2452 |
| 213 | Ga0068853_100954154 | 3300005539 | Bacteria | 825 |
| 214 | Ga0068853_101218879 | 3300005539 | Bacteria | 727 |
| 215 | Ga0068853_101554761 | 3300005539 | Bacteria | 641 |
| 216 | Ga0070672_100001038 | 3300005543 | Bacteria | 16915 |
| 217 | Ga0070672_100002031 | 3300005543 | Bacteria | 12729 |
| 218 | Ga0070672_100007063 | 3300005543 | Bacteria | 7594 |
| 219 | Ga0070672_100010437 | 3300005543 | Bacteria | 6445 |
| 220 | Ga0070672_100052288 | 3300005543 | Bacteria | 3189 |
| 221 | Ga0070672_100080388 | 3300005543 | Bacteria | 2611 |
| 222 | Ga0070672_100101071 | 3300005543 | Bacteria | 2339 |
| 223 | Ga0070672_100174069 | 3300005543 | Bacteria | 1791 |
| 224 | Ga0070672_100214114 | 3300005543 | Bacteria | 1614 |
| 225 | Ga0070672_100380331 | 3300005543 | Bacteria | 1207 |
| 226 | Ga0070672_100438759 | 3300005543 | Bacteria | 1123 |
| 227 | Ga0070672_101358460 | 3300005543 | Bacteria | 635 |
| 228 | Ga0070686_100378076 | 3300005544 | Bacteria | 1071 |
| 229 | Ga0070693_100060705 | 3300005547 | Bacteria | 2195 |
| 230 | Ga0070693_100289674 | 3300005547 | Bacteria | 1100 |
| 231 | Ga0070665_100463074 | 3300005548 | Bacteria | 1278 |
| 232 | Ga0070665_100632979 | 3300005548 | Bacteria | 1083 |
| 233 | Ga0070665_101366806 | 3300005548 | Bacteria | 718 |
| 234 | Ga0068855_100048944 | 3300005563 | Bacteria | 4987 |
| 235 | Ga0068855_100963948 | 3300005563 | Bacteria | 898 |
| 236 | Ga0068855_101691164 | 3300005563 | Bacteria | 645 |
| 237 | Ga0070664_100025177 | 3300005564 | Bacteria | 4930 |
| 238 | Ga0070664_100128859 | 3300005564 | Bacteria | 2222 |
| 239 | Ga0070664_100221638 | 3300005564 | Bacteria | 1692 |
| 240 | Ga0070664_100428714 | 3300005564 | Bacteria | 1212 |
| 241 | Ga0070664_100815717 | 3300005564 | Bacteria | 873 |
| 242 | Ga0070664_101072872 | 3300005564 | Bacteria | 758 |
| 243 | Ga0068857_100107336 | 3300005577 | Bacteria | 2508 |
| 244 | Ga0068857_100190966 | 3300005577 | Bacteria | 1865 |
| 245 | Ga0068857_100614579 | 3300005577 | Bacteria | 1028 |
| 246 | Ga0068857_100994918 | 3300005577 | Bacteria | 807 |
| 247 | Ga0068854_100025152 | 3300005578 | Bacteria | 4085 |
| 248 | Ga0068854_100035781 | 3300005578 | Bacteria | 3477 |
| 249 | Ga0068854_100043140 | 3300005578 | Bacteria | 3195 |
| 250 | Ga0068854_100695447 | 3300005578 | Bacteria | 877 |
| 251 | Ga0068854_100760197 | 3300005578 | Bacteria | 841 |
| 252 | Ga0068856_100164041 | 3300005614 | Bacteria | 2233 |
| 253 | Ga0068856_100221898 | 3300005614 | Bacteria | 1905 |
| 254 | Ga0070702_100013522 | 3300005615 | Bacteria | 4121 |
| 255 | Ga0070702_100893751 | 3300005615 | Bacteria | 695 |
| 256 | Ga0068852_100017004 | 3300005616 | Bacteria | 5694 |
| 257 | Ga0068852_100037453 | 3300005616 | Bacteria | 4066 |
| 258 | Ga0068852_100108424 | 3300005616 | Bacteria | 2520 |
| 259 | Ga0068852_100138911 | 3300005616 | Bacteria | 2247 |
| 260 | Ga0068852_100390209 | 3300005616 | Bacteria | 1367 |
| 261 | Ga0068852_100408483 | 3300005616 | Bacteria | 1337 |
| 262 | Ga0068852_100560713 | 3300005616 | Bacteria | 1143 |
| 263 | Ga0068852_100668034 | 3300005616 | Bacteria | 1047 |
| 264 | Ga0068852_101061037 | 3300005616 | Bacteria | 830 |
| 265 | Ga0068852_101810053 | 3300005616 | Bacteria | 633 |
| 266 | Ga0068852_102237965 | 3300005616 | Bacteria | 568 |
| 267 | Ga0068859_100204443 | 3300005617 | Bacteria | 2060 |
| 268 | Ga0068859_100413546 | 3300005617 | Bacteria | 1445 |
| 269 | Ga0068859_100707430 | 3300005617 | Bacteria | 1098 |
| 270 | Ga0068859_101427336 | 3300005617 | Bacteria | 764 |
| 271 | Ga0068864_100009971 | 3300005618 | Bacteria | 7838 |
| 272 | Ga0068864_100020710 | 3300005618 | Bacteria | 5504 |
| 273 | Ga0068864_100032590 | 3300005618 | Bacteria | 4428 |
| 274 | Ga0068864_100045557 | 3300005618 | Bacteria | 3762 |
| 275 | Ga0068864_100055582 | 3300005618 | Bacteria | 3418 |
| 276 | Ga0068864_100076344 | 3300005618 | Bacteria | 2928 |
| 277 | Ga0068864_100456948 | 3300005618 | Bacteria | 1222 |
| 278 | Ga0068864_100572644 | 3300005618 | Bacteria | 1094 |
| 279 | Ga0068864_101122244 | 3300005618 | Bacteria | 783 |
| 280 | Ga0068864_101291798 | 3300005618 | Bacteria | 730 |
| 281 | Ga0068864_101839600 | 3300005618 | Bacteria | 611 |
| 282 | Ga0068866_10002843 | 3300005718 | Bacteria | 7136 |
| 283 | Ga0068861_100001754 | 3300005719 | Bacteria | 13938 |
| 284 | Ga0068861_100043521 | 3300005719 | Bacteria | 3371 |
| 285 | Ga0068861_100089193 | 3300005719 | Bacteria | 2430 |
| 286 | Ga0068861_102070570 | 3300005719 | Bacteria | 569 |
| 287 | Ga0068851_10019767 | 3300005834 | Bacteria | 3255 |
| 288 | Ga0068851_10117892 | 3300005834 | Bacteria | 1424 |
| 289 | Ga0068851_10140806 | 3300005834 | Bacteria | 1312 |
| 290 | Ga0068851_10390952 | 3300005834 | Bacteria | 817 |
| 291 | Ga0068870_10046087 | 3300005840 | Bacteria | 2285 |
| 292 | Ga0068870_10065329 | 3300005840 | Bacteria | 1968 |
| 293 | Ga0068870_10180092 | 3300005840 | Bacteria | 1268 |
| 294 | Ga0068870_10602106 | 3300005840 | Bacteria | 747 |
| 295 | Ga0068863_100008147 | 3300005841 | Bacteria | 10232 |
| 296 | Ga0068863_100020787 | 3300005841 | Bacteria | 6269 |
| 297 | Ga0068863_100071501 | 3300005841 | Bacteria | 3282 |
| 298 | Ga0068863_100104364 | 3300005841 | Bacteria | 2696 |
| 299 | Ga0068863_100182433 | 3300005841 | Bacteria | 2015 |
| 300 | Ga0068863_100203348 | 3300005841 | Bacteria | 1906 |
| 301 | Ga0068863_100351701 | 3300005841 | Bacteria | 1435 |
| 302 | Ga0068863_100354544 | 3300005841 | Bacteria | 1429 |
| 303 | Ga0068863_100603337 | 3300005841 | Bacteria | 1087 |
| 304 | Ga0068858_100024249 | 3300005842 | Bacteria | 5653 |
| 305 | Ga0068858_100029185 | 3300005842 | Bacteria | 5121 |
| 306 | Ga0068858_100032464 | 3300005842 | Bacteria | 4847 |
| 307 | Ga0068858_100035860 | 3300005842 | Bacteria | 4599 |
| 308 | Ga0068858_100136571 | 3300005842 | Bacteria | 2301 |
| 309 | Ga0068858_100556081 | 3300005842 | Bacteria | 1111 |
| 310 | Ga0068858_101960431 | 3300005842 | Bacteria | 579 |
| 311 | Ga0068860_100010210 | 3300005843 | Bacteria | 9293 |
| 312 | Ga0068860_100012046 | 3300005843 | Bacteria | 8517 |
| 313 | Ga0068860_100020052 | 3300005843 | Bacteria | 6477 |
| 314 | Ga0068860_100147011 | 3300005843 | Bacteria | 2268 |
| 315 | Ga0068860_100173567 | 3300005843 | Bacteria | 2083 |
| 316 | Ga0068860_100662478 | 3300005843 | Bacteria | 1052 |
| 317 | Ga0068860_101521563 | 3300005843 | Bacteria | 691 |
| 318 | Ga0068862_100018209 | 3300005844 | Bacteria | 5848 |
| 319 | Ga0068862_100075506 | 3300005844 | Bacteria | 2915 |
| 320 | Ga0068862_100463582 | 3300005844 | Bacteria | 1196 |
| 321 | Ga0068862_100526899 | 3300005844 | Bacteria | 1125 |
| 322 | Ga0068862_102413030 | 3300005844 | Bacteria | 538 |
| 323 | Ga0075365_10045821 | 3300006038 | Bacteria | 2870 |
| 324 | Ga0075365_10050774 | 3300006038 | Bacteria | 2737 |
| 325 | Ga0075365_10376216 | 3300006038 | Bacteria | 1002 |
| 326 | Ga0075365_10499449 | 3300006038 | Bacteria | 860 |
| 327 | Ga0075365_10598215 | 3300006038 | Bacteria | 780 |
| 328 | Ga0075368_10004315 | 3300006042 | Bacteria | 4808 |
| 329 | Ga0075368_10005763 | 3300006042 | Bacteria | 4283 |
| 330 | Ga0075368_10005874 | 3300006042 | Bacteria | 4249 |
| 331 | Ga0075368_10037262 | 3300006042 | Bacteria | 1901 |
| 332 | Ga0075368_10225068 | 3300006042 | Bacteria | 798 |
| 333 | Ga0075368_10475449 | 3300006042 | Bacteria | 556 |
| 334 | Ga0075363_100009000 | 3300006048 | Bacteria | 4679 |
| 335 | Ga0075363_100029084 | 3300006048 | Bacteria | 2849 |
| 336 | Ga0075363_100046125 | 3300006048 | Bacteria | 2311 |
| 337 | Ga0075363_100073619 | 3300006048 | Bacteria | 1859 |
| 338 | Ga0075363_100177915 | 3300006048 | Bacteria | 1209 |
| 339 | Ga0075363_100198374 | 3300006048 | Bacteria | 1146 |
| 340 | Ga0075363_100254853 | 3300006048 | Bacteria | 1011 |
| 341 | Ga0075363_100468302 | 3300006048 | Bacteria | 746 |
| 342 | Ga0075364_10006775 | 3300006051 | Bacteria | 6756 |
| 343 | Ga0075364_10063712 | 3300006051 | Bacteria | 2420 |
| 344 | Ga0075362_10010920 | 3300006177 | Bacteria | 3563 |
| 345 | Ga0075362_10015345 | 3300006177 | Bacteria | 3114 |
| 346 | Ga0075362_10028345 | 3300006177 | Bacteria | 2404 |
| 347 | Ga0075362_10035774 | 3300006177 | Bacteria | 2169 |
| 348 | Ga0075362_10048964 | 3300006177 | Bacteria | 1886 |
| 349 | Ga0075362_10162200 | 3300006177 | Bacteria | 1077 |
| 350 | Ga0075367_10010036 | 3300006178 | Bacteria | 4963 |
| 351 | Ga0075367_10013686 | 3300006178 | Bacteria | 4370 |
| 352 | Ga0075367_10018851 | 3300006178 | Bacteria | 3814 |
| 353 | Ga0075367_10286244 | 3300006178 | Bacteria | 1036 |
| 354 | Ga0075367_10980424 | 3300006178 | Bacteria | 539 |
| 355 | Ga0075369_10031398 | 3300006186 | Bacteria | 2242 |
| 356 | Ga0075369_10081032 | 3300006186 | Bacteria | 1439 |
| 357 | Ga0075366_10004389 | 3300006195 | Bacteria | 7569 |
| 358 | Ga0075366_10006193 | 3300006195 | Bacteria | 6529 |
| 359 | Ga0075366_10020276 | 3300006195 | Bacteria | 3856 |
| 360 | Ga0075366_10021908 | 3300006195 | Bacteria | 3715 |
| 361 | Ga0075366_10027485 | 3300006195 | Bacteria | 3338 |
| 362 | Ga0075366_10032058 | 3300006195 | Bacteria | 3093 |
| 363 | Ga0075366_10038291 | 3300006195 | Bacteria | 2832 |
| 364 | Ga0075366_10041096 | 3300006195 | Bacteria | 2737 |
| 365 | Ga0075366_10066259 | 3300006195 | Bacteria | 2148 |
| 366 | Ga0075366_10067942 | 3300006195 | Bacteria | 2121 |
| 367 | Ga0075366_10080306 | 3300006195 | Bacteria | 1947 |
| 368 | Ga0075366_10110296 | 3300006195 | Bacteria | 1654 |
| 369 | Ga0075366_10205748 | 3300006195 | Bacteria | 1197 |
| 370 | Ga0075366_10212009 | 3300006195 | Bacteria | 1179 |
| 371 | Ga0075366_10373179 | 3300006195 | Bacteria | 877 |
| 372 | Ga0075366_10931422 | 3300006195 | Bacteria | 541 |
| 373 | Ga0097621_100024414 | 3300006237 | Bacteria | 4720 |
| 374 | Ga0097621_100041515 | 3300006237 | Bacteria | 3703 |
| 375 | Ga0097621_100048189 | 3300006237 | Bacteria | 3456 |
| 376 | Ga0097621_100303567 | 3300006237 | Bacteria | 1411 |
| 377 | Ga0097621_100657890 | 3300006237 | Bacteria | 962 |
| 378 | Ga0097621_100861690 | 3300006237 | Bacteria | 842 |
| 379 | Ga0075370_10002177 | 3300006353 | Bacteria | 8992 |
| 380 | Ga0075370_10006689 | 3300006353 | Bacteria | 5815 |
| 381 | Ga0075370_10013105 | 3300006353 | Bacteria | 4398 |
| 382 | Ga0075370_10015981 | 3300006353 | Bacteria | 4031 |
| 383 | Ga0075370_10016103 | 3300006353 | Bacteria | 4018 |
| 384 | Ga0075370_10045271 | 3300006353 | Bacteria | 2488 |
| 385 | Ga0075370_10074890 | 3300006353 | Bacteria | 1940 |
| 386 | Ga0075370_10959655 | 3300006353 | Bacteria | 523 |
| 387 | Ga0075370_11011526 | 3300006353 | Bacteria | 509 |
| 388 | Ga0068871_100003964 | 3300006358 | Bacteria | 10223 |
| 389 | Ga0068871_100005973 | 3300006358 | Bacteria | 8569 |
| 390 | Ga0068871_100006732 | 3300006358 | Bacteria | 8160 |
| 391 | Ga0068871_100050006 | 3300006358 | Bacteria | 3380 |
| 392 | Ga0068871_100294081 | 3300006358 | Bacteria | 1424 |
| 393 | Ga0068871_100785498 | 3300006358 | Bacteria | 877 |
| 394 | Ga0068871_101166639 | 3300006358 | Bacteria | 722 |
| 395 | Ga0068871_101570543 | 3300006358 | Bacteria | 623 |
| 396 | Ga0068865_100015793 | 3300006881 | Bacteria | 4818 |
| 397 | Ga0068865_100051731 | 3300006881 | Bacteria | 2845 |
| 398 | Ga0068865_100111950 | 3300006881 | Bacteria | 2015 |
| 399 | Ga0068865_100145309 | 3300006881 | Bacteria | 1793 |
| 400 | Ga0097620_100204432 | 3300006931 | Bacteria | 2060 |
| 401 | Ga0097620_100413511 | 3300006931 | Bacteria | 1445 |
| 402 | Ga0097620_100707473 | 3300006931 | Bacteria | 1098 |
| 403 | Ga0097620_101427276 | 3300006931 | Bacteria | 764 |
| 404 | Ga0099823_1000021 | 3300006944 | Bacteria | 76133 |
| 405 | Ga0079104_1000001 | 3300006946 | Bacteria | 521847 |
| 406 | Ga0105251_10356287 | 3300009011 | Bacteria | 668 |
| 407 | Ga0105244_10042239 | 3300009036 | Bacteria | 2358 |
| 408 | Ga0105240_10060597 | 3300009093 | Bacteria | 4718 |
| 409 | Ga0105240_10148546 | 3300009093 | Bacteria | 2793 |
| 410 | Ga0105240_11306551 | 3300009093 | Bacteria | 765 |
| 411 | Ga0111539_10257504 | 3300009094 | Bacteria | 2032 |
| 412 | Ga0111539_10422133 | 3300009094 | Bacteria | 1553 |
| 413 | Ga0105245_10123515 | 3300009098 | Bacteria | 2421 |
| 414 | Ga0105245_10226069 | 3300009098 | Bacteria | 1808 |
| 415 | Ga0105245_10405021 | 3300009098 | Bacteria | 1364 |
| 416 | Ga0105245_10482268 | 3300009098 | Bacteria | 1253 |
| 417 | Ga0105245_10493458 | 3300009098 | Bacteria | 1239 |
| 418 | Ga0105245_11221919 | 3300009098 | Bacteria | 800 |
| 419 | Ga0105247_10792092 | 3300009101 | Bacteria | 722 |
| 420 | Ga0105243_10037064 | 3300009148 | Bacteria | 3787 |
| 421 | Ga0105243_10109870 | 3300009148 | Bacteria | 2304 |
| 422 | Ga0105243_10171815 | 3300009148 | Bacteria | 1878 |
| 423 | Ga0105243_10651208 | 3300009148 | Bacteria | 1021 |
| 424 | Ga0105243_10825827 | 3300009148 | Bacteria | 916 |
| 425 | Ga0105243_12073248 | 3300009148 | Bacteria | 604 |
| 426 | Ga0105241_10344731 | 3300009174 | Bacteria | 1292 |
| 427 | Ga0105241_11343903 | 3300009174 | Bacteria | 682 |
| 428 | Ga0105241_11969803 | 3300009174 | Bacteria | 574 |
| 429 | Ga0105242_10006564 | 3300009176 | Bacteria | 8960 |
| 430 | Ga0105242_10594298 | 3300009176 | Bacteria | 1068 |
| 431 | Ga0105242_10915127 | 3300009176 | Bacteria | 878 |
| 432 | Ga0105242_11441553 | 3300009176 | Bacteria | 717 |
| 433 | Ga0105242_11715097 | 3300009176 | Bacteria | 665 |
| 434 | Ga0105248_10000563 | 3300009177 | Bacteria | 42070 |
| 435 | Ga0105248_10010877 | 3300009177 | Bacteria | 10046 |
| 436 | Ga0105248_10035875 | 3300009177 | Bacteria | 5547 |
| 437 | Ga0105248_10201577 | 3300009177 | Bacteria | 2242 |
| 438 | Ga0105248_10495712 | 3300009177 | Bacteria | 1377 |
| 439 | Ga0105248_10605778 | 3300009177 | Bacteria | 1236 |
| 440 | Ga0105248_10756754 | 3300009177 | Bacteria | 1096 |
| 441 | Ga0105248_11189445 | 3300009177 | Bacteria | 862 |
| 442 | Ga0105248_11555976 | 3300009177 | Bacteria | 749 |
| 443 | Ga0105248_11952920 | 3300009177 | Bacteria | 666 |
| 444 | Ga0105248_12597160 | 3300009177 | Bacteria | 577 |
| 445 | Ga0105237_10341269 | 3300009545 | Bacteria | 1502 |
| 446 | Ga0105237_10496657 | 3300009545 | Bacteria | 1227 |
| 447 | Ga0105238_10038345 | 3300009551 | Bacteria | 4866 |
| 448 | Ga0105238_11305587 | 3300009551 | Bacteria | 752 |
| 449 | Ga0105238_12209097 | 3300009551 | Bacteria | 585 |
| 450 | Ga0105249_10059930 | 3300009553 | Bacteria | 3491 |
| 451 | Ga0105249_10245727 | 3300009553 | Bacteria | 1772 |
| 452 | Ga0105249_11490389 | 3300009553 | Bacteria | 749 |
| 453 | Ga0105249_12198012 | 3300009553 | Bacteria | 625 |
| 454 | Ga0105249_12232673 | 3300009553 | Bacteria | 620 |
| 455 | Ga0105239_10177521 | 3300010375 | Bacteria | 2382 |
| 456 | Ga0105239_11003670 | 3300010375 | Bacteria | 960 |
| 457 | Ga0105239_11496177 | 3300010375 | Bacteria | 780 |
| 458 | Ga0105246_10335557 | 3300011119 | Bacteria | 1233 |
| 459 | Ga0157319_1000008 | 3300012497 | Bacteria | 315600 |
| 460 | Ga0157326_1033884 | 3300012513 | Bacteria | 688 |
| 461 | Ga0157371_10065465 | 3300013102 | Bacteria | 2574 |
| 462 | Ga0157370_10089028 | 3300013104 | Bacteria | 2899 |
| 463 | Ga0157370_10358210 | 3300013104 | Bacteria | 1344 |
| 464 | Ga0157369_10202627 | 3300013105 | Bacteria | 2082 |
| 465 | Ga0157369_10381857 | 3300013105 | Bacteria | 1462 |
| 466 | Ga0157369_11180845 | 3300013105 | Bacteria | 781 |
| 467 | Ga0157374_10012674 | 3300013296 | Bacteria | 7342 |
| 468 | Ga0157374_10086676 | 3300013296 | Bacteria | 2979 |
| 469 | Ga0157374_10104497 | 3300013296 | Bacteria | 2719 |
| 470 | Ga0157374_10259805 | 3300013296 | Bacteria | 1710 |
| 471 | Ga0157374_10332302 | 3300013296 | Bacteria | 1508 |
| 472 | Ga0157374_10947951 | 3300013296 | Bacteria | 879 |
| 473 | Ga0157374_11209671 | 3300013296 | Bacteria | 777 |
| 474 | Ga0157374_11762539 | 3300013296 | Bacteria | 644 |
| 475 | Ga0157374_12158449 | 3300013296 | Bacteria | 584 |
| 476 | Ga0157378_10070169 | 3300013297 | Bacteria | 3145 |
| 477 | Ga0157378_10076073 | 3300013297 | Bacteria | 3024 |
| 478 | Ga0157378_11039385 | 3300013297 | Bacteria | 855 |
| 479 | Ga0157378_11261019 | 3300013297 | Bacteria | 779 |
| 480 | Ga0157378_12583705 | 3300013297 | Bacteria | 560 |
| 481 | Ga0163162_10006190 | 3300013306 | Bacteria | 11595 |
| 482 | Ga0163162_10009814 | 3300013306 | Bacteria | 9317 |
| 483 | Ga0163162_10015375 | 3300013306 | Bacteria | 7477 |
| 484 | Ga0163162_10015380 | 3300013306 | Bacteria | 7475 |
| 485 | Ga0163162_10072420 | 3300013306 | Bacteria | 3501 |
| 486 | Ga0163162_10162788 | 3300013306 | Bacteria | 2353 |
| 487 | Ga0163162_10181209 | 3300013306 | Bacteria | 2232 |
| 488 | Ga0163162_10393855 | 3300013306 | Bacteria | 1518 |
| 489 | Ga0163162_11814556 | 3300013306 | Bacteria | 697 |
| 490 | Ga0157372_10075427 | 3300013307 | Bacteria | 3805 |
| 491 | Ga0157372_10277248 | 3300013307 | Bacteria | 1949 |
| 492 | Ga0157372_10358459 | 3300013307 | Bacteria | 1699 |
| 493 | Ga0157375_10002731 | 3300013308 | Bacteria | 15254 |
| 494 | Ga0157375_10039310 | 3300013308 | Bacteria | 4553 |
| 495 | Ga0157375_10062939 | 3300013308 | Bacteria | 3689 |
| 496 | Ga0157375_10093843 | 3300013308 | Bacteria | 3068 |
| 497 | Ga0157375_10121655 | 3300013308 | Bacteria | 2720 |
| 498 | Ga0157375_10262258 | 3300013308 | Bacteria | 1889 |
| 499 | Ga0157375_10426748 | 3300013308 | Bacteria | 1492 |
| 500 | Ga0157375_12238112 | 3300013308 | Bacteria | 651 |
| 501 | Ga0157375_12512370 | 3300013308 | Bacteria | 615 |
| 502 | Ga0157375_12632520 | 3300013308 | Bacteria | 601 |
| 503 | Ga0163163_10037474 | 3300014325 | Bacteria | 4717 |
| 504 | Ga0163163_10180996 | 3300014325 | Bacteria | 2155 |
| 505 | Ga0163163_10288535 | 3300014325 | Bacteria | 1693 |
| 506 | Ga0163163_10452574 | 3300014325 | Bacteria | 1344 |
| 507 | Ga0163163_10453007 | 3300014325 | Bacteria | 1343 |
| 508 | Ga0163163_10458485 | 3300014325 | Bacteria | 1335 |
| 509 | Ga0163163_10855292 | 3300014325 | Bacteria | 973 |
| 510 | Ga0163163_11116307 | 3300014325 | Bacteria | 851 |
| 511 | Ga0163163_12445687 | 3300014325 | Bacteria | 580 |
| 512 | Ga0157380_10012326 | 3300014326 | Bacteria | 6201 |
| 513 | Ga0157380_10047810 | 3300014326 | Bacteria | 3367 |
| 514 | Ga0157380_10158031 | 3300014326 | Bacteria | 1967 |
| 515 | Ga0157380_10221504 | 3300014326 | Bacteria | 1693 |
| 516 | Ga0157380_10506804 | 3300014326 | Bacteria | 1174 |
| 517 | Ga0157380_10597499 | 3300014326 | Bacteria | 1091 |
| 518 | Ga0157380_10712750 | 3300014326 | Bacteria | 1010 |
| 519 | Ga0157380_10880485 | 3300014326 | Bacteria | 920 |
| 520 | Ga0182008_10009910 | 3300014497 | Bacteria | 5123 |
| 521 | Ga0182008_10322186 | 3300014497 | Bacteria | 813 |
| 522 | Ga0182008_10343772 | 3300014497 | Bacteria | 790 |
| 523 | Ga0182008_10518892 | 3300014497 | Bacteria | 658 |
| 524 | Ga0157377_10002823 | 3300014745 | Bacteria | 7749 |
| 525 | Ga0157377_10188773 | 3300014745 | Bacteria | 1301 |
| 526 | Ga0157377_10201891 | 3300014745 | Bacteria | 1263 |
| 527 | Ga0157379_10022800 | 3300014968 | Bacteria | 5548 |
| 528 | Ga0157379_10030462 | 3300014968 | Bacteria | 4803 |
| 529 | Ga0157379_10043791 | 3300014968 | Bacteria | 3996 |
| 530 | Ga0157379_10046178 | 3300014968 | Bacteria | 3887 |
| 531 | Ga0157379_10140733 | 3300014968 | Bacteria | 2175 |
| 532 | Ga0157379_10278218 | 3300014968 | Bacteria | 1523 |
| 533 | Ga0157379_10356949 | 3300014968 | Bacteria | 1339 |
| 534 | Ga0157379_10374875 | 3300014968 | Bacteria | 1305 |
| 535 | Ga0157379_10620088 | 3300014968 | Bacteria | 1011 |
| 536 | Ga0157379_10704423 | 3300014968 | Bacteria | 948 |
| 537 | Ga0157379_10722747 | 3300014968 | Bacteria | 936 |
| 538 | Ga0157379_11002017 | 3300014968 | Bacteria | 796 |
| 539 | Ga0157379_11294626 | 3300014968 | Bacteria | 704 |
| 540 | Ga0157376_10010115 | 3300014969 | Bacteria | 6889 |
| 541 | Ga0157376_10015391 | 3300014969 | Bacteria | 5777 |
| 542 | Ga0157376_10117781 | 3300014969 | Bacteria | 2349 |
| 543 | Ga0157376_10160682 | 3300014969 | Bacteria | 2036 |
| 544 | Ga0157376_10164684 | 3300014969 | Bacteria | 2013 |
| 545 | Ga0157376_10259272 | 3300014969 | Bacteria | 1628 |
| 546 | Ga0157376_10305566 | 3300014969 | Bacteria | 1507 |
| 547 | Ga0157376_10402674 | 3300014969 | Bacteria | 1324 |
| 548 | Ga0157376_10825888 | 3300014969 | Bacteria | 941 |
| 549 | Ga0157376_11189322 | 3300014969 | Bacteria | 790 |
| 550 | Ga0157376_11453668 | 3300014969 | Bacteria | 718 |
| 551 | Ga0157376_11935598 | 3300014969 | Bacteria | 627 |
| 552 | Ga0157376_11947120 | 3300014969 | Bacteria | 625 |
| 553 | Ga0182007_10007788 | 3300015262 | Bacteria | 4453 |
| 554 | Ga0182007_10105205 | 3300015262 | Bacteria | 936 |
| 555 | Ga0182007_10182845 | 3300015262 | Bacteria | 726 |
| 556 | Ga0182005_1065665 | 3300015265 | Bacteria | 993 |
| 557 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 558 | Ga0163161_10017287 | 3300017792 | Bacteria | 5047 |
| 559 | Ga0163161_10027884 | 3300017792 | Bacteria | 4007 |
| 560 | Ga0163161_10044555 | 3300017792 | Bacteria | 3196 |
| 561 | Ga0163161_10082389 | 3300017792 | Bacteria | 2370 |
| 562 | Ga0163161_10133272 | 3300017792 | Bacteria | 1876 |
| 563 | Ga0163161_10177024 | 3300017792 | Bacteria | 1633 |
| 564 | Ga0163161_10395836 | 3300017792 | Bacteria | 1107 |
| 565 | Ga0163161_10404016 | 3300017792 | Bacteria | 1096 |
| 566 | Ga0163161_10475519 | 3300017792 | Bacteria | 1014 |
| 567 | Ga0163161_10718575 | 3300017792 | Bacteria | 833 |
| 568 | Ga0163161_11752938 | 3300017792 | Bacteria | 551 |
| 569 | Ga0163161_11967308 | 3300017792 | Bacteria | 520 |
| 570 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 571 | Ga0209565_1030525 | 3300025263 | Bacteria | 1052 |
| 572 | Ga0207666_1026630 | 3300025271 | Bacteria | 872 |
| 573 | Ga0209673_1011533 | 3300025273 | Bacteria | 3637 |
| 574 | Ga0209673_1018659 | 3300025273 | Bacteria | 2514 |
| 575 | Ga0209673_1041812 | 3300025273 | Bacteria | 1296 |
| 576 | Ga0209673_1050438 | 3300025273 | Bacteria | 1105 |
| 577 | Ga0209130_1013707 | 3300025284 | Bacteria | 2066 |
| 578 | Ga0209675_1003161 | 3300025291 | Bacteria | 8001 |
| 579 | Ga0209676_1013656 | 3300025292 | Bacteria | 3108 |
| 580 | Ga0209025_1040474 | 3300025294 | Bacteria | 2015 |
| 581 | Ga0209050_1000118 | 3300025298 | Bacteria | 202586 |
| 582 | Ga0209050_1000934 | 3300025298 | Bacteria | 38215 |
| 583 | Ga0209050_1002768 | 3300025298 | Bacteria | 14080 |
| 584 | Ga0209050_1010184 | 3300025298 | Bacteria | 4672 |
| 585 | Ga0209050_1017089 | 3300025298 | Bacteria | 2918 |
| 586 | Ga0209256_1000015 | 3300025299 | Bacteria | 622953 |
| 587 | Ga0209256_1001723 | 3300025299 | Bacteria | 20972 |
| 588 | Ga0209256_1001935 | 3300025299 | Bacteria | 18873 |
| 589 | Ga0209051_1000018 | 3300025303 | Bacteria | 527061 |
| 590 | Ga0209051_1000244 | 3300025303 | Bacteria | 91505 |
| 591 | Ga0209051_1002679 | 3300025303 | Bacteria | 12440 |
| 592 | Ga0209051_1010982 | 3300025303 | Bacteria | 4516 |
| 593 | Ga0209051_1017158 | 3300025303 | Bacteria | 3244 |
| 594 | Ga0209257_1000084 | 3300025304 | Bacteria | 291502 |
| 595 | Ga0209257_1000144 | 3300025304 | Bacteria | 197078 |
| 596 | Ga0209257_1005717 | 3300025304 | Bacteria | 8532 |
| 597 | Ga0209257_1012179 | 3300025304 | Bacteria | 4018 |
| 598 | Ga0207697_10058485 | 3300025315 | Bacteria | 1601 |
| 599 | Ga0207697_10075593 | 3300025315 | Bacteria | 1415 |
| 600 | Ga0207697_10404887 | 3300025315 | Bacteria | 606 |
| 601 | Ga0207656_10015851 | 3300025321 | Bacteria | 2923 |
| 602 | Ga0207656_10032599 | 3300025321 | Bacteria | 2165 |
| 603 | Ga0207656_10190419 | 3300025321 | Bacteria | 987 |
| 604 | Ga0207656_10260518 | 3300025321 | Bacteria | 851 |
| 605 | Ga0207682_10009133 | 3300025893 | Bacteria | 3917 |
| 606 | Ga0207682_10009199 | 3300025893 | Bacteria | 3902 |
| 607 | Ga0207682_10060510 | 3300025893 | Bacteria | 1584 |
| 608 | Ga0207682_10097241 | 3300025893 | Bacteria | 1283 |
| 609 | Ga0207682_10158600 | 3300025893 | Bacteria | 1024 |
| 610 | Ga0207682_10213332 | 3300025893 | Bacteria | 891 |
| 611 | Ga0207642_10004772 | 3300025899 | Bacteria | 4379 |
| 612 | Ga0207688_10053063 | 3300025901 | Bacteria | 2273 |
| 613 | Ga0207688_10077532 | 3300025901 | Bacteria | 1894 |
| 614 | Ga0207688_10333193 | 3300025901 | Bacteria | 933 |
| 615 | Ga0207680_10045362 | 3300025903 | Bacteria | 2591 |
| 616 | Ga0207680_10126990 | 3300025903 | Bacteria | 1676 |
| 617 | Ga0207680_10694631 | 3300025903 | Bacteria | 729 |
| 618 | Ga0207645_10003842 | 3300025907 | Bacteria | 11246 |
| 619 | Ga0207645_10007638 | 3300025907 | Bacteria | 7619 |
| 620 | Ga0207645_10011283 | 3300025907 | Bacteria | 6107 |
| 621 | Ga0207645_10023842 | 3300025907 | Bacteria | 3972 |
| 622 | Ga0207645_10055716 | 3300025907 | Bacteria | 2524 |
| 623 | Ga0207645_10098649 | 3300025907 | Bacteria | 1883 |
| 624 | Ga0207645_10110245 | 3300025907 | Bacteria | 1781 |
| 625 | Ga0207645_10124920 | 3300025907 | Bacteria | 1672 |
| 626 | Ga0207645_10154385 | 3300025907 | Bacteria | 1499 |
| 627 | Ga0207645_10434810 | 3300025907 | Bacteria | 885 |
| 628 | Ga0207645_10514106 | 3300025907 | Bacteria | 811 |
| 629 | Ga0207645_10778436 | 3300025907 | Bacteria | 650 |
| 630 | Ga0207643_10050988 | 3300025908 | Bacteria | 2348 |
| 631 | Ga0207643_10065217 | 3300025908 | Bacteria | 2085 |
| 632 | Ga0207643_10094724 | 3300025908 | Bacteria | 1744 |
| 633 | Ga0207643_10147137 | 3300025908 | Bacteria | 1410 |
| 634 | Ga0207643_10402662 | 3300025908 | Bacteria | 865 |
| 635 | Ga0207705_10122504 | 3300025909 | Bacteria | 1931 |
| 636 | Ga0207705_10517026 | 3300025909 | Bacteria | 927 |
| 637 | Ga0207705_10818856 | 3300025909 | Bacteria | 722 |
| 638 | Ga0207705_10897859 | 3300025909 | Bacteria | 686 |
| 639 | Ga0207705_10972720 | 3300025909 | Bacteria | 656 |
| 640 | Ga0207705_11432990 | 3300025909 | Bacteria | 524 |
| 641 | Ga0207684_10805431 | 3300025910 | Bacteria | 794 |
| 642 | Ga0207654_10072257 | 3300025911 | Bacteria | 2053 |
| 643 | Ga0207654_10191515 | 3300025911 | Bacteria | 1341 |
| 644 | Ga0207707_10122228 | 3300025912 | Bacteria | 2276 |
| 645 | Ga0207707_10254640 | 3300025912 | Bacteria | 1524 |
| 646 | Ga0207695_10402094 | 3300025913 | Bacteria | 1254 |
| 647 | Ga0207695_10403020 | 3300025913 | Bacteria | 1252 |
| 648 | Ga0207695_10721763 | 3300025913 | Bacteria | 877 |
| 649 | Ga0207671_11329844 | 3300025914 | Bacteria | 559 |
| 650 | Ga0207660_10071448 | 3300025917 | Bacteria | 2525 |
| 651 | Ga0207660_10415621 | 3300025917 | Bacteria | 1084 |
| 652 | Ga0207662_10002309 | 3300025918 | Bacteria | 9551 |
| 653 | Ga0207657_10017805 | 3300025919 | Bacteria | 6802 |
| 654 | Ga0207657_10053780 | 3300025919 | Bacteria | 3486 |
| 655 | Ga0207657_10278411 | 3300025919 | Bacteria | 1329 |
| 656 | Ga0207649_10065775 | 3300025920 | Bacteria | 2296 |
| 657 | Ga0207649_10580582 | 3300025920 | Bacteria | 860 |
| 658 | Ga0207652_10539076 | 3300025921 | Bacteria | 1049 |
| 659 | Ga0207652_10654276 | 3300025921 | Bacteria | 939 |
| 660 | Ga0207681_10004142 | 3300025923 | Bacteria | 8988 |
| 661 | Ga0207681_10007931 | 3300025923 | Bacteria | 6493 |
| 662 | Ga0207681_10031186 | 3300025923 | Bacteria | 3479 |
| 663 | Ga0207681_10144617 | 3300025923 | Bacteria | 1775 |
| 664 | Ga0207681_10195247 | 3300025923 | Bacteria | 1551 |
| 665 | Ga0207681_10366751 | 3300025923 | Bacteria | 1156 |
| 666 | Ga0207681_10411250 | 3300025923 | Bacteria | 1094 |
| 667 | Ga0207681_10495284 | 3300025923 | Bacteria | 1000 |
| 668 | Ga0207694_10128368 | 3300025924 | Bacteria | 2030 |
| 669 | Ga0207694_10269272 | 3300025924 | Bacteria | 1397 |
| 670 | Ga0207694_10736555 | 3300025924 | Bacteria | 832 |
| 671 | Ga0207650_10000587 | 3300025925 | Bacteria | 29198 |
| 672 | Ga0207650_10003249 | 3300025925 | Bacteria | 11199 |
| 673 | Ga0207650_10059716 | 3300025925 | Bacteria | 2843 |
| 674 | Ga0207650_10099348 | 3300025925 | Bacteria | 2237 |
| 675 | Ga0207650_10121601 | 3300025925 | Bacteria | 2033 |
| 676 | Ga0207650_10132962 | 3300025925 | Bacteria | 1949 |
| 677 | Ga0207650_10175603 | 3300025925 | Bacteria | 1705 |
| 678 | Ga0207650_10366378 | 3300025925 | Bacteria | 1188 |
| 679 | Ga0207650_10422154 | 3300025925 | Bacteria | 1107 |
| 680 | Ga0207650_10552479 | 3300025925 | Bacteria | 965 |
| 681 | Ga0207659_10000861 | 3300025926 | Bacteria | 18018 |
| 682 | Ga0207659_10005359 | 3300025926 | Bacteria | 7772 |
| 683 | Ga0207659_10009237 | 3300025926 | Bacteria | 6156 |
| 684 | Ga0207659_10038145 | 3300025926 | Bacteria | 3340 |
| 685 | Ga0207659_10099297 | 3300025926 | Bacteria | 2191 |
| 686 | Ga0207659_10123971 | 3300025926 | Bacteria | 1984 |
| 687 | Ga0207659_10439678 | 3300025926 | Bacteria | 1097 |
| 688 | Ga0207659_10555689 | 3300025926 | Bacteria | 976 |
| 689 | Ga0207659_10585031 | 3300025926 | Bacteria | 951 |
| 690 | Ga0207659_11484244 | 3300025926 | Bacteria | 580 |
| 691 | Ga0207687_10162880 | 3300025927 | Bacteria | 1713 |
| 692 | Ga0207687_10275702 | 3300025927 | Bacteria | 1346 |
| 693 | Ga0207687_10413778 | 3300025927 | Bacteria | 1111 |
| 694 | Ga0207687_11283606 | 3300025927 | Bacteria | 629 |
| 695 | Ga0207644_10001574 | 3300025931 | Bacteria | 14734 |
| 696 | Ga0207644_10015626 | 3300025931 | Bacteria | 5099 |
| 697 | Ga0207644_10024816 | 3300025931 | Bacteria | 4118 |
| 698 | Ga0207644_10027140 | 3300025931 | Bacteria | 3955 |
| 699 | Ga0207644_10042686 | 3300025931 | Bacteria | 3215 |
| 700 | Ga0207644_10057128 | 3300025931 | Bacteria | 2817 |
| 701 | Ga0207644_10082148 | 3300025931 | Bacteria | 2383 |
| 702 | Ga0207644_10173111 | 3300025931 | Bacteria | 1687 |
| 703 | Ga0207644_10309822 | 3300025931 | Bacteria | 1274 |
| 704 | Ga0207690_10018071 | 3300025932 | Bacteria | 4319 |
| 705 | Ga0207690_10206944 | 3300025932 | Bacteria | 1494 |
| 706 | Ga0207690_10310583 | 3300025932 | Bacteria | 1236 |
| 707 | Ga0207706_10004316 | 3300025933 | Bacteria | 13357 |
| 708 | Ga0207706_10006686 | 3300025933 | Bacteria | 10663 |
| 709 | Ga0207706_10044702 | 3300025933 | Bacteria | 3925 |
| 710 | Ga0207706_10067354 | 3300025933 | Bacteria | 3150 |
| 711 | Ga0207706_10076876 | 3300025933 | Bacteria | 2936 |
| 712 | Ga0207706_10106205 | 3300025933 | Bacteria | 2471 |
| 713 | Ga0207706_10363273 | 3300025933 | Bacteria | 1258 |
| 714 | Ga0207706_10380176 | 3300025933 | Bacteria | 1225 |
| 715 | Ga0207706_10481419 | 3300025933 | Bacteria | 1072 |
| 716 | Ga0207706_11015684 | 3300025933 | Bacteria | 696 |
| 717 | Ga0207686_10050077 | 3300025934 | Bacteria | 2596 |
| 718 | Ga0207686_10149227 | 3300025934 | Bacteria | 1626 |
| 719 | Ga0207686_11380962 | 3300025934 | Bacteria | 579 |
| 720 | Ga0207709_10020180 | 3300025935 | Bacteria | 3756 |
| 721 | Ga0207709_10032365 | 3300025935 | Bacteria | 3061 |
| 722 | Ga0207709_10157944 | 3300025935 | Bacteria | 1578 |
| 723 | Ga0207709_10186615 | 3300025935 | Bacteria | 1469 |
| 724 | Ga0207709_10357219 | 3300025935 | Bacteria | 1105 |
| 725 | Ga0207670_10305359 | 3300025936 | Bacteria | 1247 |
| 726 | Ga0207669_10004732 | 3300025937 | Bacteria | 6026 |
| 727 | Ga0207669_10022825 | 3300025937 | Bacteria | 3330 |
| 728 | Ga0207669_10029113 | 3300025937 | Bacteria | 3049 |
| 729 | Ga0207669_10224939 | 3300025937 | Bacteria | 1380 |
| 730 | Ga0207669_10703851 | 3300025937 | Bacteria | 830 |
| 731 | Ga0207669_10708264 | 3300025937 | Bacteria | 828 |
| 732 | Ga0207669_10776976 | 3300025937 | Bacteria | 793 |
| 733 | Ga0207669_10881573 | 3300025937 | Bacteria | 746 |
| 734 | Ga0207704_10023865 | 3300025938 | Bacteria | 3305 |
| 735 | Ga0207704_10026882 | 3300025938 | Bacteria | 3163 |
| 736 | Ga0207704_10054952 | 3300025938 | Bacteria | 2431 |
| 737 | Ga0207704_10203998 | 3300025938 | Bacteria | 1449 |
| 738 | Ga0207665_11425115 | 3300025939 | Bacteria | 551 |
| 739 | Ga0207691_10001498 | 3300025940 | Bacteria | 23269 |
| 740 | Ga0207691_10006932 | 3300025940 | Bacteria | 10926 |
| 741 | Ga0207691_10007996 | 3300025940 | Bacteria | 10168 |
| 742 | Ga0207691_10036430 | 3300025940 | Bacteria | 4558 |
| 743 | Ga0207691_10056404 | 3300025940 | Bacteria | 3578 |
| 744 | Ga0207691_10180077 | 3300025940 | Bacteria | 1847 |
| 745 | Ga0207691_10192637 | 3300025940 | Bacteria | 1777 |
| 746 | Ga0207691_10214199 | 3300025940 | Bacteria | 1672 |
| 747 | Ga0207691_10247986 | 3300025940 | Bacteria | 1538 |
| 748 | Ga0207691_10426770 | 3300025940 | Bacteria | 1129 |
| 749 | Ga0207691_10494497 | 3300025940 | Bacteria | 1039 |
| 750 | Ga0207711_10016383 | 3300025941 | Bacteria | 6161 |
| 751 | Ga0207711_10049043 | 3300025941 | Bacteria | 3614 |
| 752 | Ga0207711_10061315 | 3300025941 | Bacteria | 3243 |
| 753 | Ga0207711_10069139 | 3300025941 | Bacteria | 3060 |
| 754 | Ga0207711_10085801 | 3300025941 | Bacteria | 2759 |
| 755 | Ga0207711_10496351 | 3300025941 | Bacteria | 1137 |
| 756 | Ga0207711_10543301 | 3300025941 | Bacteria | 1084 |
| 757 | Ga0207711_10640907 | 3300025941 | Bacteria | 991 |
| 758 | Ga0207711_10890358 | 3300025941 | Bacteria | 828 |
| 759 | Ga0207689_10007087 | 3300025942 | Bacteria | 9854 |
| 760 | Ga0207689_10009559 | 3300025942 | Bacteria | 8364 |
| 761 | Ga0207689_10013353 | 3300025942 | Bacteria | 7009 |
| 762 | Ga0207689_10023269 | 3300025942 | Bacteria | 5202 |
| 763 | Ga0207689_10069220 | 3300025942 | Bacteria | 2900 |
| 764 | Ga0207689_10080406 | 3300025942 | Bacteria | 2679 |
| 765 | Ga0207689_10937593 | 3300025942 | Bacteria | 730 |
| 766 | Ga0207689_10960194 | 3300025942 | Bacteria | 721 |
| 767 | Ga0207689_11022507 | 3300025942 | Bacteria | 697 |
| 768 | Ga0207689_11518898 | 3300025942 | Bacteria | 559 |
| 769 | Ga0207661_10081303 | 3300025944 | Bacteria | 2676 |
| 770 | Ga0207679_10040394 | 3300025945 | Bacteria | 3339 |
| 771 | Ga0207679_10146320 | 3300025945 | Bacteria | 1917 |
| 772 | Ga0207679_10257812 | 3300025945 | Bacteria | 1486 |
| 773 | Ga0207679_10280104 | 3300025945 | Bacteria | 1430 |
| 774 | Ga0207679_10286151 | 3300025945 | Bacteria | 1415 |
| 775 | Ga0207679_10953654 | 3300025945 | Bacteria | 786 |
| 776 | Ga0207679_11143793 | 3300025945 | Bacteria | 714 |
| 777 | Ga0207679_11586993 | 3300025945 | Bacteria | 600 |
| 778 | Ga0207679_11704485 | 3300025945 | Bacteria | 577 |
| 779 | Ga0207667_10031271 | 3300025949 | Bacteria | 5747 |
| 780 | Ga0207667_10170872 | 3300025949 | Bacteria | 2234 |
| 781 | Ga0207667_10174518 | 3300025949 | Bacteria | 2209 |
| 782 | Ga0207667_10310612 | 3300025949 | Bacteria | 1610 |
| 783 | Ga0207651_10011230 | 3300025960 | Bacteria | 5004 |
| 784 | Ga0207651_10040675 | 3300025960 | Bacteria | 3078 |
| 785 | Ga0207651_10094594 | 3300025960 | Bacteria | 2197 |
| 786 | Ga0207651_10181003 | 3300025960 | Bacteria | 1672 |
| 787 | Ga0207651_10601363 | 3300025960 | Bacteria | 961 |
| 788 | Ga0207651_10759426 | 3300025960 | Bacteria | 857 |
| 789 | Ga0207651_10939867 | 3300025960 | Bacteria | 771 |
| 790 | Ga0207651_11096387 | 3300025960 | Bacteria | 713 |
| 791 | Ga0207712_10004623 | 3300025961 | Bacteria | 8693 |
| 792 | Ga0207712_10150548 | 3300025961 | Bacteria | 1797 |
| 793 | Ga0207712_11420224 | 3300025961 | Bacteria | 621 |
| 794 | Ga0207668_10018589 | 3300025972 | Bacteria | 4378 |
| 795 | Ga0207668_10029872 | 3300025972 | Bacteria | 3577 |
| 796 | Ga0207668_10039383 | 3300025972 | Bacteria | 3181 |
| 797 | Ga0207668_10247822 | 3300025972 | Bacteria | 1445 |
| 798 | Ga0207640_10014714 | 3300025981 | Bacteria | 4510 |
| 799 | Ga0207640_10026671 | 3300025981 | Bacteria | 3511 |
| 800 | Ga0207640_11621072 | 3300025981 | Bacteria | 583 |
| 801 | Ga0207658_10003013 | 3300025986 | Bacteria | 12045 |
| 802 | Ga0207658_10003655 | 3300025986 | Bacteria | 10853 |
| 803 | Ga0207658_10027918 | 3300025986 | Bacteria | 3970 |
| 804 | Ga0207658_10033970 | 3300025986 | Bacteria | 3641 |
| 805 | Ga0207658_10035280 | 3300025986 | Bacteria | 3581 |
| 806 | Ga0207658_10179272 | 3300025986 | Bacteria | 1752 |
| 807 | Ga0207658_10374645 | 3300025986 | Bacteria | 1245 |
| 808 | Ga0207658_10471333 | 3300025986 | Bacteria | 1114 |
| 809 | Ga0207658_10536830 | 3300025986 | Bacteria | 1045 |
| 810 | Ga0207658_10608569 | 3300025986 | Bacteria | 982 |
| 811 | Ga0207658_10627106 | 3300025986 | Bacteria | 967 |
| 812 | Ga0207658_10916193 | 3300025986 | Bacteria | 798 |
| 813 | Ga0207658_11567446 | 3300025986 | Bacteria | 602 |
| 814 | Ga0207677_10055234 | 3300026023 | Bacteria | 2714 |
| 815 | Ga0207677_10076814 | 3300026023 | Bacteria | 2379 |
| 816 | Ga0207677_10085727 | 3300026023 | Bacteria | 2274 |
| 817 | Ga0207677_10347322 | 3300026023 | Bacteria | 1242 |
| 818 | Ga0207677_10367818 | 3300026023 | Bacteria | 1210 |
| 819 | Ga0207677_10637998 | 3300026023 | Bacteria | 939 |
| 820 | Ga0207703_10004035 | 3300026035 | Bacteria | 12135 |
| 821 | Ga0207703_10014712 | 3300026035 | Bacteria | 6106 |
| 822 | Ga0207703_10022609 | 3300026035 | Bacteria | 4935 |
| 823 | Ga0207703_10227598 | 3300026035 | Bacteria | 1670 |
| 824 | Ga0207703_10557327 | 3300026035 | Bacteria | 1081 |
| 825 | Ga0207639_10056806 | 3300026041 | Bacteria | 3001 |
| 826 | Ga0207639_10165295 | 3300026041 | Bacteria | 1869 |
| 827 | Ga0207639_10397750 | 3300026041 | Bacteria | 1241 |
| 828 | Ga0207639_10413200 | 3300026041 | Bacteria | 1218 |
| 829 | Ga0207639_10487040 | 3300026041 | Bacteria | 1125 |
| 830 | Ga0207639_10949822 | 3300026041 | Bacteria | 804 |
| 831 | Ga0207639_11166013 | 3300026041 | Bacteria | 723 |
| 832 | Ga0207678_10006013 | 3300026067 | Bacteria | 10798 |
| 833 | Ga0207678_10157724 | 3300026067 | Bacteria | 1938 |
| 834 | Ga0207678_10176045 | 3300026067 | Bacteria | 1827 |
| 835 | Ga0207678_10193669 | 3300026067 | Bacteria | 1738 |
| 836 | Ga0207678_10294669 | 3300026067 | Bacteria | 1394 |
| 837 | Ga0207678_10320970 | 3300026067 | Bacteria | 1333 |
| 838 | Ga0207678_10336654 | 3300026067 | Bacteria | 1300 |
| 839 | Ga0207708_10179176 | 3300026075 | Bacteria | 1682 |
| 840 | Ga0207708_10260705 | 3300026075 | Bacteria | 1399 |
| 841 | Ga0207702_10212209 | 3300026078 | Bacteria | 1800 |
| 842 | Ga0207702_10355937 | 3300026078 | Bacteria | 1402 |
| 843 | Ga0207702_10526742 | 3300026078 | Bacteria | 1154 |
| 844 | Ga0207641_10004568 | 3300026088 | Bacteria | 11965 |
| 845 | Ga0207641_10015586 | 3300026088 | Bacteria | 6229 |
| 846 | Ga0207641_10031300 | 3300026088 | Bacteria | 4412 |
| 847 | Ga0207641_10037683 | 3300026088 | Bacteria | 4039 |
| 848 | Ga0207641_10164400 | 3300026088 | Bacteria | 2020 |
| 849 | Ga0207641_10191199 | 3300026088 | Bacteria | 1881 |
| 850 | Ga0207641_10304109 | 3300026088 | Bacteria | 1507 |
| 851 | Ga0207641_10474718 | 3300026088 | Bacteria | 1211 |
| 852 | Ga0207641_11583593 | 3300026088 | Bacteria | 657 |
| 853 | Ga0207641_12231683 | 3300026088 | Bacteria | 547 |
| 854 | Ga0207648_10000823 | 3300026089 | Bacteria | 35061 |
| 855 | Ga0207648_10002295 | 3300026089 | Bacteria | 20666 |
| 856 | Ga0207648_10012908 | 3300026089 | Bacteria | 7801 |
| 857 | Ga0207648_10015894 | 3300026089 | Bacteria | 6899 |
| 858 | Ga0207648_10056196 | 3300026089 | Bacteria | 3436 |
| 859 | Ga0207648_10061050 | 3300026089 | Bacteria | 3287 |
| 860 | Ga0207648_10074405 | 3300026089 | Bacteria | 2960 |
| 861 | Ga0207648_10284410 | 3300026089 | Bacteria | 1479 |
| 862 | Ga0207648_10752882 | 3300026089 | Bacteria | 905 |
| 863 | Ga0207676_10008687 | 3300026095 | Bacteria | 7223 |
| 864 | Ga0207676_10015345 | 3300026095 | Bacteria | 5522 |
| 865 | Ga0207676_10043099 | 3300026095 | Bacteria | 3472 |
| 866 | Ga0207676_10069679 | 3300026095 | Bacteria | 2817 |
| 867 | Ga0207676_10070418 | 3300026095 | Bacteria | 2805 |
| 868 | Ga0207676_10076797 | 3300026095 | Bacteria | 2700 |
| 869 | Ga0207676_10084831 | 3300026095 | Bacteria | 2583 |
| 870 | Ga0207676_10143746 | 3300026095 | Bacteria | 2045 |
| 871 | Ga0207676_10507279 | 3300026095 | Bacteria | 1146 |
| 872 | Ga0207674_10072476 | 3300026116 | Bacteria | 3461 |
| 873 | Ga0207674_10078380 | 3300026116 | Bacteria | 3309 |
| 874 | Ga0207674_10093640 | 3300026116 | Bacteria | 2992 |
| 875 | Ga0207674_10276408 | 3300026116 | Bacteria | 1627 |
| 876 | Ga0207674_10763221 | 3300026116 | Bacteria | 933 |
| 877 | Ga0207674_11200115 | 3300026116 | Bacteria | 728 |
| 878 | Ga0207675_100002092 | 3300026118 | Bacteria | 19820 |
| 879 | Ga0207675_100004056 | 3300026118 | Bacteria | 14185 |
| 880 | Ga0207675_100031877 | 3300026118 | Bacteria | 4910 |
| 881 | Ga0207675_100061552 | 3300026118 | Bacteria | 3504 |
| 882 | Ga0207675_100238892 | 3300026118 | Bacteria | 1755 |
| 883 | Ga0207675_101053265 | 3300026118 | Bacteria | 833 |
| 884 | Ga0207683_10049353 | 3300026121 | Bacteria | 3684 |
| 885 | Ga0207683_10051178 | 3300026121 | Bacteria | 3619 |
| 886 | Ga0207683_10053057 | 3300026121 | Bacteria | 3554 |
| 887 | Ga0207683_10058397 | 3300026121 | Bacteria | 3387 |
| 888 | Ga0207683_10085867 | 3300026121 | Bacteria | 2798 |
| 889 | Ga0207683_10088992 | 3300026121 | Bacteria | 2748 |
| 890 | Ga0207683_10106762 | 3300026121 | Bacteria | 2504 |
| 891 | Ga0207683_10119317 | 3300026121 | Bacteria | 2367 |
| 892 | Ga0207683_10124770 | 3300026121 | Bacteria | 2313 |
| 893 | Ga0207683_10153058 | 3300026121 | Bacteria | 2082 |
| 894 | Ga0207683_10258442 | 3300026121 | Bacteria | 1590 |
| 895 | Ga0207683_10355500 | 3300026121 | Bacteria | 1345 |
| 896 | Ga0207683_10377590 | 3300026121 | Bacteria | 1303 |
| 897 | Ga0207683_10464748 | 3300026121 | Bacteria | 1167 |
| 898 | Ga0207683_10745793 | 3300026121 | Bacteria | 908 |
| 899 | Ga0207698_10042779 | 3300026142 | Bacteria | 3388 |
| 900 | Ga0207698_10064772 | 3300026142 | Bacteria | 2866 |
| 901 | Ga0207698_10104707 | 3300026142 | Bacteria | 2355 |
| 902 | Ga0207698_10170179 | 3300026142 | Bacteria | 1917 |
| 903 | Ga0207698_10218396 | 3300026142 | Bacteria | 1721 |
| 904 | Ga0207698_10271516 | 3300026142 | Bacteria | 1563 |
| 905 | Ga0207698_10423631 | 3300026142 | Bacteria | 1278 |
| 906 | Ga0207698_10528668 | 3300026142 | Bacteria | 1152 |
| 907 | Ga0207698_10595140 | 3300026142 | Bacteria | 1090 |
| 908 | Ga0207698_10788776 | 3300026142 | Bacteria | 951 |
| 909 | Ga0207698_10943355 | 3300026142 | Bacteria | 872 |
| 910 | Ga0209281_1000151 | 3300027111 | Bacteria | 167268 |
| 911 | Ga0209389_1000341 | 3300027296 | Bacteria | 28381 |
| 912 | Ga0209371_1010309 | 3300027312 | Bacteria | 2888 |
| 913 | Ga0209813_10004823 | 3300027866 | Bacteria | 3241 |
| 914 | Ga0209813_10010278 | 3300027866 | Bacteria | 2416 |
| 915 | Ga0209813_10019065 | 3300027866 | Bacteria | 1903 |
| 916 | Ga0209813_10041526 | 3300027866 | Bacteria | 1402 |
| 917 | Ga0209813_10101373 | 3300027866 | Bacteria | 980 |
| 918 | Ga0209813_10318374 | 3300027866 | Bacteria | 608 |
| 919 | Ga0209974_10001355 | 3300027876 | Bacteria | 8817 |
| 920 | Ga0209974_10106540 | 3300027876 | Bacteria | 984 |
| 921 | Ga0268266_10044876 | 3300028379 | Bacteria | 3779 |
| 922 | Ga0268266_10092469 | 3300028379 | Bacteria | 2654 |
| 923 | Ga0268266_10177416 | 3300028379 | Bacteria | 1938 |
| 924 | Ga0268266_10382575 | 3300028379 | Bacteria | 1328 |
| 925 | Ga0268266_10449191 | 3300028379 | Bacteria | 1225 |
| 926 | Ga0268266_10698005 | 3300028379 | Bacteria | 978 |
| 927 | Ga0268266_10815884 | 3300028379 | Bacteria | 901 |
| 928 | Ga0268266_11820225 | 3300028379 | Bacteria | 583 |
| 929 | Ga0268265_10064219 | 3300028380 | Bacteria | 2827 |
| 930 | Ga0268265_10081788 | 3300028380 | Bacteria | 2551 |
| 931 | Ga0268265_10462756 | 3300028380 | Bacteria | 1187 |
| 932 | Ga0268265_11567574 | 3300028380 | Bacteria | 663 |
| 933 | Ga0268264_10003212 | 3300028381 | Bacteria | 14160 |
| 934 | Ga0268264_10003786 | 3300028381 | Bacteria | 12976 |
| 935 | Ga0268264_10059514 | 3300028381 | Bacteria | 3201 |
| 936 | Ga0268264_10088646 | 3300028381 | Bacteria | 2663 |
| 937 | Ga0268264_10091577 | 3300028381 | Bacteria | 2623 |
| 938 | Ga0268264_10145189 | 3300028381 | Bacteria | 2121 |
| 939 | Ga0268264_10516498 | 3300028381 | Bacteria | 1167 |
| 940 | Ga0268264_12382014 | 3300028381 | Bacteria | 536 |
| 941 | Ga0268264_12667247 | 3300028381 | Bacteria | 504 |
| 942 | Ga0307517_10000174 | 3300028786 | Bacteria | 105578 |
| 943 | Ga0307517_10114587 | 3300028786 | Bacteria | 2028 |
| 944 | Ga0307517_10140152 | 3300028786 | Bacteria | 1701 |
| 945 | Ga0307517_10283240 | 3300028786 | Bacteria | 943 |
| 946 | Ga0307515_10000084 | 3300028794 | Bacteria | 221434 |
| 947 | Ga0307515_10000265 | 3300028794 | Bacteria | 129554 |
| 948 | Ga0307515_10002453 | 3300028794 | Bacteria | 40400 |
| 949 | Ga0307515_10004018 | 3300028794 | Bacteria | 30712 |
| 950 | Ga0307515_10040542 | 3300028794 | Bacteria | 7358 |
| 951 | Ga0307515_10045204 | 3300028794 | Bacteria | 6772 |
| 952 | Ga0307515_10058663 | 3300028794 | Bacteria | 5537 |
| 953 | Ga0307515_10580104 | 3300028794 | Bacteria | 731 |
| 954 | Ga0307512_10048289 | 3300030522 | Bacteria | 3448 |
| 955 | Ga0307512_10099404 | 3300030522 | Bacteria | 1980 |
| 956 | Ga0307512_10128276 | 3300030522 | Bacteria | 1602 |
| 957 | Ga0307512_10165911 | 3300030522 | Bacteria | 1280 |
| 958 | Ga0307512_10172833 | 3300030522 | Bacteria | 1234 |
| 959 | Ga0265331_10003101 | 3300031250 | Bacteria | 10886 |
| 960 | Ga0265327_10000012 | 3300031251 | Bacteria | 530403 |
| 961 | Ga0265327_10002000 | 3300031251 | Bacteria | 23042 |
| 962 | Ga0265327_10050233 | 3300031251 | Bacteria | 2183 |
| 963 | Ga0265327_10213974 | 3300031251 | Bacteria | 869 |
| 964 | Ga0307513_10000008 | 3300031456 | Bacteria | 442128 |
| 965 | Ga0307513_10012364 | 3300031456 | Bacteria | 10551 |
| 966 | Ga0307513_10016692 | 3300031456 | Bacteria | 8839 |
| 967 | Ga0307513_10068505 | 3300031456 | Bacteria | 3717 |
| 968 | Ga0307513_10096388 | 3300031456 | Bacteria | 2996 |
| 969 | Ga0307513_10131033 | 3300031456 | Bacteria | 2453 |
| 970 | Ga0307513_10144267 | 3300031456 | Bacteria | 2302 |
| 971 | Ga0307513_10156808 | 3300031456 | Bacteria | 2175 |
| 972 | Ga0307513_10265785 | 3300031456 | Bacteria | 1502 |
| 973 | Ga0307513_10409585 | 3300031456 | Bacteria | 1088 |
| 974 | Ga0307513_10422657 | 3300031456 | Bacteria | 1062 |
| 975 | Ga0307509_10000225 | 3300031507 | Bacteria | 90913 |
| 976 | Ga0307509_10022299 | 3300031507 | Bacteria | 7144 |
| 977 | Ga0307509_10023360 | 3300031507 | Bacteria | 6947 |
| 978 | Ga0307509_10055729 | 3300031507 | Bacteria | 4199 |
| 979 | Ga0307509_10083968 | 3300031507 | Bacteria | 3281 |
| 980 | Ga0307509_10166312 | 3300031507 | Bacteria | 2093 |
| 981 | Ga0307408_100093037 | 3300031548 | Bacteria | 2280 |
| 982 | Ga0307408_100195866 | 3300031548 | Bacteria | 1631 |
| 983 | Ga0307408_100500811 | 3300031548 | Bacteria | 1063 |
| 984 | Ga0307408_100639948 | 3300031548 | Bacteria | 949 |
| 985 | Ga0307408_100714486 | 3300031548 | Bacteria | 902 |
| 986 | Ga0307408_100813351 | 3300031548 | Bacteria | 849 |
| 987 | Ga0307508_10000123 | 3300031616 | Bacteria | 92439 |
| 988 | Ga0307508_10007788 | 3300031616 | Bacteria | 9948 |
| 989 | Ga0307508_10030181 | 3300031616 | Bacteria | 4899 |
| 990 | Ga0307508_10469540 | 3300031616 | Bacteria | 851 |
| 991 | Ga0307514_10000319 | 3300031649 | Bacteria | 115327 |
| 992 | Ga0307514_10003098 | 3300031649 | Bacteria | 16356 |
| 993 | Ga0307514_10077519 | 3300031649 | Bacteria | 2471 |
| 994 | Ga0307514_10086324 | 3300031649 | Bacteria | 2303 |
| 995 | Ga0307516_10003862 | 3300031730 | Bacteria | 18937 |
| 996 | Ga0307516_10047365 | 3300031730 | Bacteria | 4236 |
| 997 | Ga0307516_10048869 | 3300031730 | Bacteria | 4161 |
| 998 | Ga0307516_10085767 | 3300031730 | Bacteria | 2986 |
| 999 | Ga0307516_10339052 | 3300031730 | Bacteria | 1171 |
| 1000 | Ga0307516_10354510 | 3300031730 | Bacteria | 1132 |
| 1001 | Ga0307405_10018710 | 3300031731 | Bacteria | 3829 |
| 1002 | Ga0307405_10211064 | 3300031731 | Bacteria | 1417 |
| 1003 | Ga0307405_11351830 | 3300031731 | Bacteria | 621 |
| 1004 | Ga0307405_11774788 | 3300031731 | Bacteria | 548 |
| 1005 | Ga0307413_10071140 | 3300031824 | Bacteria | 2191 |
| 1006 | Ga0307413_10072869 | 3300031824 | Bacteria | 2169 |
| 1007 | Ga0307413_10584274 | 3300031824 | Bacteria | 912 |
| 1008 | Ga0307410_10000484 | 3300031852 | Bacteria | 16146 |
| 1009 | Ga0307410_10072561 | 3300031852 | Bacteria | 2391 |
| 1010 | Ga0307406_10016912 | 3300031901 | Bacteria | 4244 |
| 1011 | Ga0307406_10300119 | 3300031901 | Bacteria | 1234 |
| 1012 | Ga0307406_10454245 | 3300031901 | Bacteria | 1029 |
| 1013 | Ga0307407_10206481 | 3300031903 | Bacteria | 1320 |
| 1014 | Ga0307412_10036830 | 3300031911 | Bacteria | 3138 |
| 1015 | Ga0307412_10047004 | 3300031911 | Bacteria | 2832 |
| 1016 | Ga0307412_10441070 | 3300031911 | Bacteria | 1070 |
| 1017 | Ga0307412_10516354 | 3300031911 | Bacteria | 997 |
| 1018 | Ga0307412_10740774 | 3300031911 | Bacteria | 847 |
| 1019 | Ga0307409_100009019 | 3300031995 | Bacteria | 6101 |
| 1020 | Ga0307409_100026390 | 3300031995 | Bacteria | 4095 |
| 1021 | Ga0307416_100001658 | 3300032002 | Bacteria | 12289 |
| 1022 | Ga0307416_100026199 | 3300032002 | Bacteria | 4292 |
| 1023 | Ga0307416_100336962 | 3300032002 | Bacteria | 1519 |
| 1024 | Ga0307416_100409201 | 3300032002 | Bacteria | 1397 |
| 1025 | Ga0307416_100481182 | 3300032002 | Bacteria | 1301 |
| 1026 | Ga0307416_100908389 | 3300032002 | Bacteria | 981 |
| 1027 | Ga0307416_101065772 | 3300032002 | Bacteria | 912 |
| 1028 | Ga0307416_101425320 | 3300032002 | Bacteria | 798 |
| 1029 | Ga0307416_102677828 | 3300032002 | Bacteria | 596 |
| 1030 | Ga0307414_10067474 | 3300032004 | Bacteria | 2563 |
| 1031 | Ga0307414_10150781 | 3300032004 | Bacteria | 1834 |
| 1032 | Ga0307414_10911115 | 3300032004 | Bacteria | 806 |
| 1033 | Ga0307414_10927145 | 3300032004 | Bacteria | 799 |
| 1034 | Ga0307411_10371910 | 3300032005 | Bacteria | 1172 |
| 1035 | Ga0307411_10451535 | 3300032005 | Bacteria | 1075 |
| 1036 | Ga0307411_11142972 | 3300032005 | Bacteria | 704 |
| 1037 | Ga0307411_11847637 | 3300032005 | Bacteria | 561 |
| 1038 | Ga0307415_100006170 | 3300032126 | Bacteria | 6435 |
| 1039 | Ga0307507_10076893 | 3300033179 | Bacteria | 2973 |
| 1040 | Ga0307510_10008316 | 3300033180 | Bacteria | 12367 |
| 1041 | Ga0307510_10034217 | 3300033180 | Bacteria | 5693 |
| 1042 | Ga0307510_10109306 | 3300033180 | Bacteria | 2514 |
| 1043 | Ga0307510_10183981 | 3300033180 | Bacteria | 1647 |
| 1044 | Ga0307510_10331298 | 3300033180 | Bacteria | 977 |
| 1045 | Ga0373938_0028174 | 3300034957 | Bacteria | 1186 |
| 1046 | Ga0373926_0193115 | 3300035083 | Bacteria | 782 |
| 1047 | Ga0373934_0185679 | 3300035086 | Bacteria | 855 |
| 1048 | Ga0373923_0459103 | 3300035111 | Bacteria | 618 |
| 1049 | Ga0373960_0174496 | 3300035121 | Bacteria | 747 |
| 1050 | Ga0373943_0031632 | 3300035170 | Bacteria | 2512 |
| 1051 | Ga0373946_0559030 | 3300035171 | Bacteria | 591 |
| 1052 | Ga0373955_0169324 | 3300035172 | Bacteria | 1292 |
| 1053 | Ga0373962_0340453 | 3300035242 | Bacteria | 540 |
| 1054 | Ga0373924_0371622 | 3300035410 | Bacteria | 638 |
| 1055 | Ga0373931_0012403 | 3300035691 | Bacteria | 4128 |
| 1056 | Ga0373931_0331314 | 3300035691 | Bacteria | 948 |
| 1057 | Ga0373935_1451335 | 3300035692 | Bacteria | 513 |
| 1058 | Ga0373933_0871164 | 3300035724 | Bacteria | 593 |
| 1059 | Ga0373933_1020612 | 3300035724 | Bacteria | 545 |
| 1060 | Ga0373947_1244725 | 3300035725 | Bacteria | 507 |
| 1061 | Ga0373937_0031134 | 3300036401 | Bacteria | 4831 |
| 1062 | Ga0373937_0777057 | 3300036401 | Bacteria | 905 |
| 1063 | Ga0373937_0923781 | 3300036401 | Bacteria | 821 |
| 1064 | Ga0373925_0017081 | 3300037068 | Bacteria | 5253 |
| 1065 | Ga0373925_0021911 | 3300037068 | Bacteria | 4658 |
| 1066 | Ga0373925_0367322 | 3300037068 | Bacteria | 1170 |
| 1067 | Ga0373925_0445844 | 3300037068 | Bacteria | 1059 |
| 1068 | Ga0395899_0019534 | 3300037312 | Bacteria | 5146 |
| 1069 | Ga0395900_0000050 | 3300037418 | Bacteria | 224616 |
| 1070 | Ga0395900_0020449 | 3300037418 | Bacteria | 6757 |
| 1071 | Ga0395900_0520696 | 3300037418 | Bacteria | 1137 |
| 1072 | Ga0395898_0005390 | 3300037466 | Bacteria | 13826 |
| 1073 | Ga0395898_0031352 | 3300037466 | Bacteria | 5312 |
| 1074 | Ga0395898_0130946 | 3300037466 | Bacteria | 2403 |
| 1075 | Ga0395898_0705175 | 3300037466 | Bacteria | 951 |
| 1076 | Ga0395905_0000407 | 3300037471 | Bacteria | 60417 |
| 1077 | Ga0395905_0017351 | 3300037471 | Bacteria | 6836 |
| 1078 | Ga0395905_0090493 | 3300037471 | Bacteria | 2869 |
| 1079 | Ga0395905_0132193 | 3300037471 | Bacteria | 2347 |
| 1080 | Ga0395905_0261658 | 3300037471 | Bacteria | 1615 |
| 1081 | Ga0395905_0492816 | 3300037471 | Bacteria | 1125 |
| 1082 | Ga0395905_0709245 | 3300037471 | Bacteria | 908 |
| 1083 | Ga0436364_1532384 | 3300037853 | Bacteria | 732 |
| 1084 | Ga0395901_0128565 | 3300038443 | Bacteria | 2663 |
| 1085 | Ga0395901_1782734 | 3300038443 | Bacteria | 565 |
| 1086 | Ga0436365_0686369 | 3300039437 | Bacteria | 831 |
| 1087 | Ga0436365_0978309 | 3300039437 | Bacteria | 4949 |
| 1088 | Ga0436365_1867544 | 3300039437 | Bacteria | 739 |
| 1089 | Ga0436361_0279495 | 3300039447 | Bacteria | 15969 |
| 1090 | Ga0436363_0541503 | 3300039450 | Bacteria | 567 |
| 1091 | Ga0436363_1358280 | 3300039450 | Bacteria | 1308 |
| 1092 | Ga0439436_0004752 | 3300041404 | Bacteria | 4165 |
| 1093 | Ga0439447_014914 | 3300041407 | Bacteria | 2168 |
| 1094 | Ga0439447_042781 | 3300041407 | Bacteria | 1099 |
| 1095 | Ga0439461_0010217 | 3300041410 | Bacteria | 1719 |
| 1096 | Ga0439466_0010962 | 3300041411 | Bacteria | 3360 |
| 1097 | Ga0439466_0042439 | 3300041411 | Bacteria | 1514 |
| 1098 | Ga0439465_0000881 | 3300041413 | Bacteria | 9486 |
| 1099 | Ga0439465_0023629 | 3300041413 | Bacteria | 1935 |
| 1100 | Ga0451787_830888 | 3300041441 | Bacteria | 509 |
| 1101 | Ga0451789_0500229 | 3300041443 | Bacteria | 513 |
| 1102 | Ga0451791_0220690 | 3300041451 | Bacteria | 1479 |
| 1103 | Ga0451791_1507368 | 3300041451 | Bacteria | 570 |
| 1104 | Ga0451793_1886398 | 3300041452 | Bacteria | 611 |
| 1105 | Ga0451797_0557698 | 3300041453 | Bacteria | 726 |
| 1106 | Ga0451797_1338879 | 3300041453 | Bacteria | 1304 |
| 1107 | Ga0451795_0084962 | 3300041456 | Bacteria | 562 |
| 1108 | Ga0451795_0598759 | 3300041456 | Bacteria | 832 |
| 1109 | Ga0451800_0518005 | 3300041459 | Bacteria | 696 |
| 1110 | Ga0451800_0707869 | 3300041459 | Bacteria | 635 |
| 1111 | Ga0451802_0416253 | 3300041460 | Bacteria | 607 |
| 1112 | Ga0451806_766340 | 3300041462 | Bacteria | 1044 |
| 1113 | Ga0451807_1607480 | 3300041486 | Bacteria | 666 |
| 1114 | Ga0451807_2114126 | 3300041486 | Bacteria | 912 |
| 1115 | Ga0451833_1136626 | 3300041491 | Bacteria | 597 |
| 1116 | Ga0451835_0275592 | 3300041492 | Bacteria | 533 |
| 1117 | Ga0451837_1577029 | 3300041494 | Bacteria | 522 |
| 1118 | Ga0451841_1254413 | 3300041498 | Bacteria | 635 |
| 1119 | Ga0451849_1118628 | 3300041505 | Bacteria | 541 |
| 1120 | Ga0451843_0822940 | 3300041509 | Bacteria | 1031 |
| 1121 | Ga0451855_1979706 | 3300041511 | Bacteria | 515 |
| 1122 | Ga0451853_1115183 | 3300041512 | Bacteria | 548 |
| 1123 | Ga0451853_1898289 | 3300041512 | Bacteria | 893 |
| 1124 | Ga0451853_3246896 | 3300041512 | Bacteria | 711 |
| 1125 | Ga0439431_0000136 | 3300041997 | Bacteria | 13215 |
| 1126 | Ga0439431_0014084 | 3300041997 | Bacteria | 1851 |
| 1127 | Ga0439431_0037407 | 3300041997 | Bacteria | 1225 |
| 1128 | Ga0439433_0000676 | 3300041999 | Bacteria | 6577 |
| 1129 | Ga0439433_0006006 | 3300041999 | Bacteria | 2610 |
| 1130 | Ga0439442_002772 | 3300042002 | Bacteria | 3440 |
| 1131 | Ga0439442_005065 | 3300042002 | Bacteria | 2634 |
| 1132 | Ga0439445_0091426 | 3300042004 | Bacteria | 857 |
| 1133 | Ga0439448_0176933 | 3300042005 | Bacteria | 745 |
| 1134 | Ga0439432_001610 | 3300042006 | Bacteria | 8457 |
| 1135 | Ga0439449_0000231 | 3300042007 | Bacteria | 20096 |
| 1136 | Ga0439449_0001881 | 3300042007 | Bacteria | 8268 |
| 1137 | Ga0439450_048229 | 3300042008 | Bacteria | 1005 |
| 1138 | Ga0439452_001605 | 3300042010 | Bacteria | 8930 |
| 1139 | Ga0439452_036468 | 3300042010 | Bacteria | 1177 |
| 1140 | Ga0439454_008726 | 3300042011 | Bacteria | 1301 |
| 1141 | Ga0439454_045835 | 3300042011 | Bacteria | 727 |
| 1142 | Ga0439457_001194 | 3300042014 | Bacteria | 7822 |
| 1143 | Ga0450911_000302 | 3300042115 | Bacteria | 17801 |
| 1144 | Ga0450919_000922 | 3300042121 | Bacteria | 3809 |
| 1145 | Ga0450921_001267 | 3300042123 | Bacteria | 1487 |
| 1146 | Ga0450921_037348 | 3300042123 | Bacteria | 511 |
| 1147 | Ga0450890_000923 | 3300042127 | Bacteria | 4246 |
| 1148 | Ga0450894_002638 | 3300042131 | Bacteria | 2388 |
| 1149 | Ga0450899_001703 | 3300042135 | Bacteria | 2432 |
| 1150 | Ga0450899_029744 | 3300042135 | Bacteria | 661 |
| 1151 | Ga0450902_095261 | 3300042137 | Bacteria | 527 |
| 1152 | Ga0450910_081130 | 3300042147 | Bacteria | 567 |
| 1153 | Ga0439446_0007098 | 3300042156 | Bacteria | 2937 |
| 1154 | Ga0439446_0089707 | 3300042156 | Bacteria | 961 |
| 1155 | Ga0450908_003584 | 3300042184 | Bacteria | 3023 |
| 1156 | Ga0450909_003671 | 3300042185 | Bacteria | 2180 |
| 1157 | Ga0439434_0002408 | 3300042435 | Bacteria | 5436 |
| 1158 | Ga0439459_0005459 | 3300042438 | Bacteria | 2090 |
| 1159 | Ga0439459_0063772 | 3300042438 | Bacteria | 838 |
| 1160 | Ga0450918_000006 | 3300042531 | Bacteria | 48279 |
| 1161 | Ga0450918_037991 | 3300042531 | Bacteria | 860 |
| 1162 | Ga0450893_0019931 | 3300042532 | Bacteria | 1149 |
| 1163 | Ga0450901_017245 | 3300042533 | Bacteria | 764 |
| 1164 | Ga0451577_0007326 | 3300042876 | Bacteria | 10858 |
| 1165 | Ga0451577_0048478 | 3300042876 | Bacteria | 3795 |
| 1166 | Ga0451577_0292677 | 3300042876 | Bacteria | 1476 |
| 1167 | Ga0451577_0355745 | 3300042876 | Bacteria | 1328 |
| 1168 | Ga0466969_0000169 | 3300044656 | Bacteria | 35088 |
| 1169 | Ga0466969_0005890 | 3300044656 | Bacteria | 6515 |
| 1170 | Ga0466969_0047172 | 3300044656 | Bacteria | 2133 |
| 1171 | Ga0466969_0067295 | 3300044656 | Bacteria | 1728 |
| 1172 | Ga0466972_0036018 | 3300044658 | Bacteria | 2422 |
| 1173 | Ga0466972_0577419 | 3300044658 | Bacteria | 531 |
| 1174 | Ga0453683_0001628 | 3300044673 | Bacteria | 18851 |
| 1175 | Ga0466965_0003093 | 3300044683 | Bacteria | 7252 |
| 1176 | Ga0466965_0090608 | 3300044683 | Bacteria | 1555 |
| 1177 | Ga0466965_0110819 | 3300044683 | Bacteria | 1410 |
| 1178 | Ga0466965_0190954 | 3300044683 | Bacteria | 1083 |
| 1179 | Ga0466965_0888115 | 3300044683 | Bacteria | 519 |
| 1180 | Ga0466966_0011620 | 3300044684 | Bacteria | 5836 |
| 1181 | Ga0466966_0016624 | 3300044684 | Bacteria | 4859 |
| 1182 | Ga0466966_0175567 | 3300044684 | Bacteria | 1301 |
| 1183 | Ga0466966_0313732 | 3300044684 | Bacteria | 942 |
| 1184 | Ga0466961_0011795 | 3300044693 | Bacteria | 5585 |
| 1185 | Ga0466961_0118210 | 3300044693 | Bacteria | 1665 |
| 1186 | Ga0466961_0176095 | 3300044693 | Bacteria | 1329 |
| 1187 | Ga0466963_0009105 | 3300044694 | Bacteria | 5967 |
| 1188 | Ga0466964_0003357 | 3300044706 | Bacteria | 5833 |
| 1189 | Ga0466964_0035719 | 3300044706 | Bacteria | 1989 |
| 1190 | Ga0466964_0608570 | 3300044706 | Bacteria | 600 |
| 1191 | Ga0453684_0229325 | 3300044712 | Bacteria | 2145 |
| 1192 | Ga0453684_0472516 | 3300044712 | Bacteria | 1392 |
| 1193 | Ga0453684_0905336 | 3300044712 | Bacteria | 944 |
| 1194 | Ga0466971_0008205 | 3300044719 | Bacteria | 4554 |
| 1195 | Ga0466971_0060520 | 3300044719 | Bacteria | 1711 |
| 1196 | Ga0466971_0494576 | 3300044719 | Bacteria | 603 |
| 1197 | Ga0466968_0015412 | 3300044735 | Bacteria | 3029 |
| 1198 | Ga0466968_0069704 | 3300044735 | Bacteria | 1529 |
| 1199 | Ga0466968_0745278 | 3300044735 | Bacteria | 502 |
| 1200 | Ga0466970_0019655 | 3300044765 | Bacteria | 3503 |
| 1201 | Ga0466970_0053291 | 3300044765 | Bacteria | 2160 |
| 1202 | Ga0466970_0116179 | 3300044765 | Bacteria | 1463 |
| 1203 | Ga0466970_0258574 | 3300044765 | Bacteria | 976 |
| 1204 | Ga0466970_0460649 | 3300044765 | Bacteria | 730 |
| 1205 | Ga0466957_0015588 | 3300044842 | Bacteria | 4438 |
| 1206 | Ga0466957_0046630 | 3300044842 | Bacteria | 2632 |
| 1207 | Ga0466957_0169164 | 3300044842 | Bacteria | 1423 |
| 1208 | Ga0466957_0246038 | 3300044842 | Bacteria | 1188 |
| 1209 | Ga0466960_0083500 | 3300044901 | Bacteria | 1614 |
| 1210 | Ga0466960_0480915 | 3300044901 | Bacteria | 725 |
| 1211 | Ga0466959_0003436 | 3300045049 | Bacteria | 10362 |
| 1212 | Ga0466959_0042478 | 3300045049 | Bacteria | 3353 |
| 1213 | Ga0466959_0101590 | 3300045049 | Bacteria | 2058 |
| 1214 | Ga0466959_0105241 | 3300045049 | Bacteria | 2018 |
| 1215 | Ga0466959_1149871 | 3300045049 | Bacteria | 516 |
| 1216 | Ga0451576_0003704 | 3300045051 | Bacteria | 20672 |
| 1217 | Ga0451576_0059421 | 3300045051 | Bacteria | 3990 |
| 1218 | Ga0451576_0075029 | 3300045051 | Bacteria | 3519 |
| 1219 | Ga0451576_0167776 | 3300045051 | Bacteria | 2291 |
| 1220 | Ga0451576_0188831 | 3300045051 | Bacteria | 2152 |
| 1221 | Ga0451576_0916681 | 3300045051 | Bacteria | 919 |
| 1222 | Ga0451576_0972046 | 3300045051 | Bacteria | 890 |
| 1223 | Ga0451576_1709068 | 3300045051 | Bacteria | 652 |
| 1224 | Ga0466958_0167147 | 3300045836 | Bacteria | 1392 |
| 1225 | Ga0466958_0523601 | 3300045836 | Bacteria | 770 |
| 1226 | Ga0466958_0587861 | 3300045836 | Bacteria | 724 |
| 1227 | Ga0466967_0043435 | 3300045976 | Bacteria | 3891 |
| 1228 | Ga0495592_0000598 | 3300046454 | Bacteria | 25428 |
| 1229 | Ga0495592_0589439 | 3300046454 | Bacteria | 679 |
| 1230 | Ga0495592_0778426 | 3300046454 | Bacteria | 570 |
| 1231 | Ga0495603_0446196 | 3300046455 | Bacteria | 741 |
| 1232 | Ga0495590_0031721 | 3300046457 | Bacteria | 1849 |
| 1233 | Ga0495590_0393564 | 3300046457 | Bacteria | 531 |
| 1234 | Ga0495629_0222666 | 3300046459 | Bacteria | 1301 |
| 1235 | Ga0495629_0365821 | 3300046459 | Bacteria | 982 |
| 1236 | Ga0495638_0079627 | 3300046460 | Bacteria | 1992 |
| 1237 | Ga0495651_0358253 | 3300046462 | Bacteria | 962 |
| 1238 | Ga0495653_0299606 | 3300046463 | Bacteria | 1049 |
| 1239 | Ga0495650_0003795 | 3300046471 | Bacteria | 10769 |
| 1240 | Ga0495639_0004258 | 3300046475 | Bacteria | 6140 |
| 1241 | Ga0495583_0072689 | 3300046506 | Bacteria | 1509 |
| 1242 | Ga0495606_0089271 | 3300046507 | Bacteria | 1899 |
| 1243 | Ga0495610_0024192 | 3300046512 | Bacteria | 3283 |
| 1244 | Ga0495618_0276927 | 3300046514 | Bacteria | 1047 |
| 1245 | Ga0495628_0567699 | 3300046516 | Bacteria | 813 |
| 1246 | Ga0495630_0815817 | 3300046517 | Bacteria | 712 |
| 1247 | Ga0495631_0081207 | 3300046518 | Bacteria | 1399 |
| 1248 | Ga0495632_0003352 | 3300046519 | Bacteria | 11415 |
| 1249 | Ga0495632_0070387 | 3300046519 | Bacteria | 1682 |
| 1250 | Ga0495632_0080389 | 3300046519 | Bacteria | 1555 |
| 1251 | Ga0495643_0117998 | 3300046522 | Bacteria | 1343 |
| 1252 | Ga0495648_0267697 | 3300046524 | Bacteria | 816 |
| 1253 | Ga0495666_0167164 | 3300046526 | Bacteria | 1018 |
| 1254 | Ga0495642_0081560 | 3300046528 | Bacteria | 1363 |
| 1255 | Ga0495642_0210539 | 3300046528 | Bacteria | 848 |
| 1256 | Ga0495654_0261053 | 3300046530 | Bacteria | 718 |
| 1257 | Ga0495598_0107874 | 3300046537 | Bacteria | 930 |
| 1258 | Ga0495621_0005665 | 3300046539 | Bacteria | 3605 |
| 1259 | Ga0495621_0044127 | 3300046539 | Bacteria | 1575 |
| 1260 | Ga0495621_0298374 | 3300046539 | Bacteria | 667 |
| 1261 | Ga0495597_0154824 | 3300046542 | Bacteria | 938 |
| 1262 | Ga0495645_0153142 | 3300046543 | Bacteria | 1600 |
| 1263 | Ga0495645_0195379 | 3300046543 | Bacteria | 1376 |
| 1264 | Ga0495645_0311315 | 3300046543 | Bacteria | 1025 |
| 1265 | Ga0495622_0062144 | 3300046557 | Bacteria | 1729 |
| 1266 | Ga0495656_0001522 | 3300046615 | Bacteria | 7578 |
| 1267 | Ga0495656_0136040 | 3300046615 | Bacteria | 1174 |
| 1268 | Ga0495625_0002346 | 3300046660 | Bacteria | 20658 |
| 1269 | Ga0495625_0132535 | 3300046660 | Bacteria | 1687 |
| 1270 | Ga0495635_0113007 | 3300046663 | Bacteria | 1855 |
| 1271 | Ga0495635_0855838 | 3300046663 | Bacteria | 584 |
| 1272 | Ga0495659_0107046 | 3300046664 | Bacteria | 1089 |
| 1273 | Ga0495588_0076705 | 3300046674 | Bacteria | 1742 |
| 1274 | Ga0495588_0225367 | 3300046674 | Bacteria | 989 |
| 1275 | Ga0495647_0215742 | 3300046681 | Bacteria | 845 |
| 1276 | Ga0495647_0460918 | 3300046681 | Bacteria | 589 |
| 1277 | Ga0495658_0023952 | 3300046683 | Bacteria | 3246 |
| 1278 | Ga0495658_0029832 | 3300046683 | Bacteria | 2956 |
| 1279 | Ga0495658_0079085 | 3300046683 | Bacteria | 1926 |
| 1280 | Ga0495658_0169388 | 3300046683 | Bacteria | 1351 |
| 1281 | Ga0495658_0173601 | 3300046683 | Bacteria | 1335 |
| 1282 | Ga0495624_0029318 | 3300046690 | Bacteria | 3591 |
| 1283 | Ga0495670_0142672 | 3300046691 | Bacteria | 1253 |
| 1284 | Ga0495671_0118362 | 3300046692 | Bacteria | 1293 |
| 1285 | Ga0495671_0135487 | 3300046692 | Bacteria | 1201 |
| 1286 | Ga0495671_0152235 | 3300046692 | Bacteria | 1126 |
| 1287 | Ga0495671_0280344 | 3300046692 | Bacteria | 803 |
| 1288 | Ga0495649_0010955 | 3300046694 | Bacteria | 5340 |
| 1289 | Ga0495589_0270715 | 3300046794 | Bacteria | 791 |
| 1290 | Ga0495600_0238689 | 3300046809 | Bacteria | 1159 |
| 1291 | Ga0495660_0005806 | 3300046810 | Bacteria | 7369 |
| 1292 | Ga0495660_0222829 | 3300046810 | Bacteria | 888 |
| 1293 | Ga0495674_0777439 | 3300047319 | Bacteria | 746 |
| 1294 | Ga0495676_0280024 | 3300047321 | Bacteria | 1129 |
| 1295 | Ga0495676_0484832 | 3300047321 | Bacteria | 813 |
| 1296 | Ga0495680_0434302 | 3300047322 | Bacteria | 901 |
| 1297 | Ga0495687_007410 | 3300047443 | Bacteria | 6462 |
| 1298 | Ga0495687_011089 | 3300047443 | Bacteria | 4875 |
| 1299 | Ga0495687_012143 | 3300047443 | Bacteria | 4572 |
| 1300 | Ga0495686_0008561 | 3300047472 | Bacteria | 7493 |
| 1301 | Ga0495686_0084169 | 3300047472 | Bacteria | 1939 |
| 1302 | Ga0495593_0019618 | 3300047673 | Bacteria | 3790 |
| 1303 | Ga0495602_0548017 | 3300048088 | Bacteria | 802 |
| 1304 | Ga0495602_0859511 | 3300048088 | Bacteria | 606 |
| 1305 | Ga0495614_0095062 | 3300048089 | Bacteria | 1299 |
| 1306 | Ga0495614_0139265 | 3300048089 | Bacteria | 1078 |
| 1307 | Ga0495615_0021284 | 3300048090 | Bacteria | 1462 |
| 1308 | Ga0495615_0134208 | 3300048090 | Bacteria | 726 |
| 1309 | Ga0495626_0066868 | 3300048091 | Bacteria | 1624 |
| 1310 | Ga0495626_0178981 | 3300048091 | Bacteria | 880 |
| 1311 | Ga0495626_0194746 | 3300048091 | Bacteria | 834 |
| 1312 | Ga0496100_0009445 | 3300048903 | Bacteria | 5483 |
| 1313 | Ga0496100_0278262 | 3300048903 | Bacteria | 1247 |
| 1314 | Ga0496100_0600707 | 3300048903 | Bacteria | 854 |
| 1315 | Ga0496101_0000603 | 3300048904 | Bacteria | 21918 |
| 1316 | Ga0496101_0167019 | 3300048904 | Bacteria | 1690 |
| 1317 | Ga0496101_0353665 | 3300048904 | Bacteria | 1155 |
| 1318 | Ga0496102_0010766 | 3300048905 | Bacteria | 7878 |
| 1319 | Ga0496102_0093120 | 3300048905 | Bacteria | 2791 |
| 1320 | Ga0496102_0128835 | 3300048905 | Bacteria | 2367 |
| 1321 | Ga0496102_0245203 | 3300048905 | Bacteria | 1689 |
| 1322 | Ga0496103_0033763 | 3300048906 | Bacteria | 3126 |
| 1323 | Ga0496104_0022206 | 3300048907 | Bacteria | 5828 |
| 1324 | Ga0496104_0151219 | 3300048907 | Bacteria | 2228 |
| 1325 | Ga0496104_0186315 | 3300048907 | Bacteria | 1986 |
| 1326 | Ga0496104_0610183 | 3300048907 | Bacteria | 1001 |
| 1327 | Ga0496105_0004127 | 3300048908 | Bacteria | 10888 |
| 1328 | Ga0496105_0042258 | 3300048908 | Bacteria | 3757 |
| 1329 | Ga0496106_0020542 | 3300048909 | Bacteria | 4903 |
| 1330 | Ga0496106_0027853 | 3300048909 | Bacteria | 4207 |
| 1331 | Ga0496106_0124740 | 3300048909 | Bacteria | 2015 |
| 1332 | Ga0496107_0075914 | 3300048910 | Bacteria | 2447 |
| 1333 | Ga0496107_0499964 | 3300048910 | Bacteria | 902 |
| 1334 | Ga0496108_0052127 | 3300048911 | Bacteria | 3428 |
| 1335 | Ga0496108_0082967 | 3300048911 | Bacteria | 2718 |
| 1336 | Ga0496108_0085318 | 3300048911 | Bacteria | 2680 |
| 1337 | Ga0496108_0231303 | 3300048911 | Bacteria | 1607 |
| 1338 | Ga0496108_0666636 | 3300048911 | Bacteria | 904 |
| 1339 | Ga0496108_0929454 | 3300048911 | Bacteria | 745 |
| 1340 | Ga0496109_0120241 | 3300048912 | Bacteria | 2447 |
| 1341 | Ga0496109_0271984 | 3300048912 | Bacteria | 1596 |
| 1342 | Ga0496109_0323016 | 3300048912 | Bacteria | 1457 |
| 1343 | Ga0496109_0360780 | 3300048912 | Bacteria | 1373 |
| 1344 | Ga0496109_0831806 | 3300048912 | Bacteria | 861 |
| 1345 | Ga0496109_0978809 | 3300048912 | Bacteria | 784 |
| 1346 | Ga0496110_0115353 | 3300048913 | Bacteria | 2418 |
| 1347 | Ga0496110_0822030 | 3300048913 | Bacteria | 834 |
| 1348 | Ga0496110_0912796 | 3300048913 | Bacteria | 784 |
| 1349 | Ga0496111_0041538 | 3300048914 | Bacteria | 3300 |
| 1350 | Ga0496112_0017021 | 3300048915 | Bacteria | 6824 |
| 1351 | Ga0496112_0408108 | 3300048915 | Bacteria | 1298 |
| 1352 | Ga0496112_1654017 | 3300048915 | Bacteria | 553 |
| 1353 | Ga0496113_0159428 | 3300048916 | Bacteria | 1783 |
| 1354 | Ga0496113_0433996 | 3300048916 | Bacteria | 1055 |
| 1355 | Ga0496114_0020191 | 3300048917 | Bacteria | 5406 |
| 1356 | Ga0496114_0051490 | 3300048917 | Bacteria | 3428 |
| 1357 | Ga0496114_0505729 | 3300048917 | Bacteria | 1069 |
| 1358 | Ga0496114_0664154 | 3300048917 | Bacteria | 916 |
| 1359 | Ga0496114_1114759 | 3300048917 | Bacteria | 674 |
| 1360 | Ga0496115_0214779 | 3300048918 | Bacteria | 1588 |
| 1361 | Ga0496115_0889226 | 3300048918 | Bacteria | 687 |
| 1362 | Ga0496117_0148834 | 3300048920 | Bacteria | 1389 |
| 1363 | Ga0496117_0593552 | 3300048920 | Bacteria | 519 |
| 1364 | Ga0496121_0003789 | 3300048924 | Bacteria | 21095 |
| 1365 | Ga0496121_0012542 | 3300048924 | Bacteria | 9224 |
| 1366 | Ga0496121_0856665 | 3300048924 | Bacteria | 528 |
| 1367 | Ga0496122_0000998 | 3300048925 | Bacteria | 50283 |
| 1368 | Ga0496122_0304754 | 3300048925 | Bacteria | 857 |
| 1369 | Ga0496123_0000045 | 3300048926 | Bacteria | 249294 |
| 1370 | Ga0496123_0070966 | 3300048926 | Bacteria | 2176 |
| 1371 | Ga0496124_0000596 | 3300048927 | Bacteria | 60853 |
| 1372 | Ga0496124_0006265 | 3300048927 | Bacteria | 13019 |
| 1373 | Ga0496124_0081642 | 3300048927 | Bacteria | 2656 |
| 1374 | Ga0496124_0210660 | 3300048927 | Bacteria | 1471 |
| 1375 | Ga0496125_0014698 | 3300048928 | Bacteria | 7607 |
| 1376 | Ga0496125_0017503 | 3300048928 | Bacteria | 6828 |
| 1377 | Ga0496125_0022653 | 3300048928 | Bacteria | 5826 |
| 1378 | Ga0496125_0031594 | 3300048928 | Bacteria | 4716 |
| 1379 | Ga0496126_0131458 | 3300048929 | Bacteria | 2162 |
| 1380 | Ga0496126_0212866 | 3300048929 | Bacteria | 1626 |
| 1381 | Ga0496126_0270030 | 3300048929 | Bacteria | 1412 |
| 1382 | Ga0495682_0233713 | 3300049460 | Bacteria | 651 |
| 1383 | Ga0501043_0000020 | 3300049579 | Bacteria | 155270 |
| 1384 | Ga0501046_0000039 | 3300049580 | Bacteria | 155237 |
| 1385 | Ga0501046_0629822 | 3300049580 | Bacteria | 759 |
| 1386 | Ga0501047_0000028 | 3300049581 | Bacteria | 220279 |
| 1387 | Ga0501047_0282531 | 3300049581 | Bacteria | 1504 |
| 1388 | Ga0501048_0000484 | 3300049582 | Bacteria | 27870 |
| 1389 | Ga0501257_134852 | 3300049686 | Bacteria | 671 |
| 1390 | Ga0501264_016792 | 3300049761 | Bacteria | 748 |
| 1391 | Ga0501035_0224700 | 3300049822 | Bacteria | 1602 |
| 1392 | Ga0501045_0939156 | 3300049824 | Bacteria | 635 |
| 1393 | nmdc:mga03683_230327_c1 | 3300050489 | Bacteria | 856 |
| 1394 | nmdc:mga03683_25205_c1 | 3300050489 | Bacteria | 2334 |
| 1395 | nmdc:mga03683_458355_c1 | 3300050489 | Bacteria | 614 |
| 1396 | nmdc:mga03683_45866_c1 | 3300050489 | Bacteria | 1810 |
| 1397 | nmdc:mga03683_609_c1 | 3300050489 | Bacteria | 10290 |
| 1398 | nmdc:mga03683_8148_c1 | 3300050489 | Bacteria | 3671 |
| 1399 | nmdc:mga03n38_139189_c1 | 3300050490 | Bacteria | 1211 |
| 1400 | nmdc:mga03n38_163148_c1 | 3300050490 | Bacteria | 1130 |
| 1401 | nmdc:mga03n38_164582_c1 | 3300050490 | Bacteria | 1125 |
| 1402 | nmdc:mga03n38_330015_c1 | 3300050490 | Bacteria | 826 |
| 1403 | nmdc:mga03n38_6656_c1 | 3300050490 | Bacteria | 4034 |
| 1404 | nmdc:mga03n38_6905_c1 | 3300050490 | Bacteria | 3984 |
| 1405 | nmdc:mga03n38_7237_c1 | 3300050490 | Bacteria | 3916 |
| 1406 | nmdc:mga03n38_947741_c1 | 3300050490 | Bacteria | 508 |
| 1407 | nmdc:mga00v17_907021_c1 | 3300050491 | Bacteria | 558 |
| 1408 | nmdc:mga00v17_92917_c1 | 3300050491 | Bacteria | 1897 |
| 1409 | nmdc:mga0yw44_205157_c1 | 3300050492 | Bacteria | 1303 |
| 1410 | nmdc:mga0yw44_3930_c1 | 3300050492 | Bacteria | 6709 |
| 1411 | nmdc:mga0yw44_444174_c1 | 3300050492 | Bacteria | 879 |
| 1412 | nmdc:mga0yw44_551800_c1 | 3300050492 | Bacteria | 782 |
| 1413 | nmdc:mga0yw44_587766_c1 | 3300050492 | Bacteria | 756 |
| 1414 | nmdc:mga0k408_106905_c1 | 3300050493 | Bacteria | 1653 |
| 1415 | nmdc:mga0k408_10994_c1 | 3300050493 | Bacteria | 4914 |
| 1416 | nmdc:mga0k408_12667_c1 | 3300050493 | Bacteria | 4202 |
| 1417 | nmdc:mga0k408_1297_c1 | 3300050493 | Bacteria | 3992 |
| 1418 | nmdc:mga0k408_135764_c2 | 3300050493 | Bacteria | 1105 |
| 1419 | nmdc:mga0k408_136693_c1 | 3300050493 | Bacteria | 1456 |
| 1420 | nmdc:mga0k408_157737_c1 | 3300050493 | Bacteria | 1352 |
| 1421 | nmdc:mga0k408_16726_c1 | 3300050493 | Bacteria | 4076 |
| 1422 | nmdc:mga0k408_17400_c1 | 3300050493 | Bacteria | 4005 |
| 1423 | nmdc:mga0k408_254447_c1 | 3300050493 | Bacteria | 1049 |
| 1424 | nmdc:mga0k408_318212_c1 | 3300050493 | Bacteria | 928 |
| 1425 | nmdc:mga0k408_335424_c1 | 3300050493 | Bacteria | 902 |
| 1426 | nmdc:mga0k408_33712_c1 | 3300050493 | Bacteria | 2929 |
| 1427 | nmdc:mga0k408_347893_c1 | 3300050493 | Bacteria | 884 |
| 1428 | nmdc:mga0k408_37821_c1 | 3300050493 | Bacteria | 2771 |
| 1429 | nmdc:mga0k408_396054_c1 | 3300050493 | Bacteria | 822 |
| 1430 | nmdc:mga0k408_4344_c1 | 3300050493 | Bacteria | 7530 |
| 1431 | nmdc:mga0k408_436230_c1 | 3300050493 | Bacteria | 778 |
| 1432 | nmdc:mga0k408_444657_c1 | 3300050493 | Bacteria | 770 |
| 1433 | nmdc:mga0k408_53264_c1 | 3300050493 | Bacteria | 2345 |
| 1434 | nmdc:mga0k408_570015_c1 | 3300050493 | Bacteria | 669 |
| 1435 | nmdc:mga0k408_616034_c1 | 3300050493 | Bacteria | 640 |
| 1436 | nmdc:mga0k408_620946_c1 | 3300050493 | Bacteria | 637 |
| 1437 | nmdc:mga0k408_63717_c1 | 3300050493 | Bacteria | 2145 |
| 1438 | nmdc:mga0k408_77561_c1 | 3300050493 | Bacteria | 1943 |
| 1439 | nmdc:mga0k408_935_c1 | 3300050493 | Bacteria | 15996 |
| 1440 | nmdc:mga06z11_103293_c1 | 3300050494 | Bacteria | 1567 |
| 1441 | nmdc:mga06z11_1427_c1 | 3300050494 | Bacteria | 8882 |
| 1442 | nmdc:mga06z11_145940_c1 | 3300050494 | Bacteria | 783 |
| 1443 | nmdc:mga06z11_165443_c1 | 3300050494 | Bacteria | 1267 |
| 1444 | nmdc:mga06z11_264594_c1 | 3300050494 | Bacteria | 1015 |
| 1445 | nmdc:mga06z11_29430_c1 | 3300050494 | Bacteria | 2646 |
| 1446 | nmdc:mga06z11_46276_c1 | 3300050494 | Bacteria | 2204 |
| 1447 | nmdc:mga06z11_693691_c1 | 3300050494 | Bacteria | 620 |
| 1448 | nmdc:mga04h51_109356_c1 | 3300050495 | Bacteria | 1017 |
| 1449 | nmdc:mga04h51_11196_c1 | 3300050495 | Bacteria | 2484 |
| 1450 | nmdc:mga04h51_220977_c1 | 3300050495 | Bacteria | 751 |
| 1451 | nmdc:mga04h51_41362_c1 | 3300050495 | Bacteria | 1506 |
| 1452 | nmdc:mga04h51_49843_c1 | 3300050495 | Bacteria | 1401 |
| 1453 | nmdc:mga07m45_231369_c1 | 3300050496 | Bacteria | 1076 |
| 1454 | nmdc:mga07m45_23824_c1 | 3300050496 | Bacteria | 3348 |
| 1455 | nmdc:mga07m45_24323_c1 | 3300050496 | Bacteria | 3316 |
| 1456 | nmdc:mga07m45_277825_c1 | 3300050496 | Bacteria | 974 |
| 1457 | nmdc:mga07m45_30562_c1 | 3300050496 | Bacteria | 2984 |
| 1458 | nmdc:mga07m45_312026_c1 | 3300050496 | Bacteria | 914 |
| 1459 | nmdc:mga07m45_33638_c1 | 3300050496 | Bacteria | 2848 |
| 1460 | nmdc:mga07m45_355_c1 | 3300050496 | Bacteria | 18707 |
| 1461 | nmdc:mga07m45_43921_c1 | 3300050496 | Bacteria | 2507 |
| 1462 | nmdc:mga07m45_44702_c1 | 3300050496 | Bacteria | 2486 |
| 1463 | nmdc:mga07m45_52189_c1 | 3300050496 | Bacteria | 2308 |
| 1464 | nmdc:mga07m45_553667_c1 | 3300050496 | Bacteria | 665 |
| 1465 | nmdc:mga07m45_58954_c1 | 3300050496 | Bacteria | 2172 |
| 1466 | nmdc:mga07m45_75397_c1 | 3300050496 | Bacteria | 1922 |
| 1467 | nmdc:mga07m45_9617_c1 | 3300050496 | Bacteria | 5024 |
| 1468 | nmdc:mga05p37_1533142_c1 | 3300050507 | Bacteria | 661 |
| 1469 | nmdc:mga08y16_1193187_c1 | 3300050511 | Bacteria | 732 |
| 1470 | nmdc:mga0n895_646864_c1 | 3300050512 | Bacteria | 1056 |
| 1471 | nmdc:mga0rr50_88694_c1 | 3300050513 | Bacteria | 2403 |
| 1472 | nmdc:mga0a205_361369_c1 | 3300050515 | Bacteria | 1318 |
| 1473 | Ga0495601_0211148 | 3300053077 | Bacteria | 1268 |
| 1474 | Ga0495601_0616831 | 3300053077 | Bacteria | 695 |
| 1475 | Ga0495612_0121501 | 3300053078 | Bacteria | 1124 |
| 1476 | Ga0495619_0112224 | 3300053085 | Bacteria | 1864 |
| 1477 | Ga0495619_0535573 | 3300053085 | Bacteria | 804 |
| 1478 | Ga0500578_0000079 | 3300053086 | Bacteria | 107137 |
| 1479 | Ga0500578_0060596 | 3300053086 | Bacteria | 2417 |
| 1480 | Ga0500578_0755318 | 3300053086 | Bacteria | 518 |
| 1481 | Ga0500644_0135926 | 3300053088 | Bacteria | 972 |
| 1482 | Ga0500646_0015569 | 3300053090 | Bacteria | 1982 |
| 1483 | Ga0500646_0022185 | 3300053090 | Bacteria | 1697 |
| 1484 | Ga0500651_0036349 | 3300053093 | Bacteria | 3103 |
| 1485 | Ga0500651_0482079 | 3300053093 | Bacteria | 686 |
| 1486 | Ga0500651_0743272 | 3300053093 | Bacteria | 521 |
| 1487 | Ga0500594_0002669 | 3300053118 | Bacteria | 3878 |
| 1488 | Ga0500594_0012360 | 3300053118 | Bacteria | 2010 |
| 1489 | Ga0500607_346407 | 3300053121 | Bacteria | 516 |
| 1490 | Ga0500618_043335 | 3300053125 | Bacteria | 1029 |
| 1491 | Ga0500621_075493 | 3300053126 | Bacteria | 1356 |
| 1492 | Ga0500623_147597 | 3300053127 | Bacteria | 974 |
| 1493 | Ga0500658_0010178 | 3300053134 | Bacteria | 3467 |
| 1494 | Ga0500658_0021949 | 3300053134 | Bacteria | 2421 |
| 1495 | Ga0500559_0000128 | 3300053136 | Bacteria | 58877 |
| 1496 | Ga0500559_0004716 | 3300053136 | Bacteria | 6416 |
| 1497 | Ga0500559_0028097 | 3300053136 | Bacteria | 2402 |
| 1498 | Ga0500568_0006808 | 3300053139 | Bacteria | 5696 |
| 1499 | Ga0500568_0181002 | 3300053139 | Bacteria | 775 |
| 1500 | Ga0500619_000016 | 3300053154 | Bacteria | 54289 |
| 1501 | Ga0500622_0000053 | 3300053156 | Bacteria | 145070 |
| 1502 | Ga0500622_0000347 | 3300053156 | Bacteria | 45247 |
| 1503 | Ga0500567_178793 | 3300053723 | Bacteria | 744 |
| 1504 | Ga0500570_066850 | 3300053724 | Bacteria | 1703 |
| 1505 | Ga0500587_000682 | 3300053739 | Bacteria | 4320 |
| 1506 | Ga0500587_000706 | 3300053739 | Bacteria | 4266 |
| 1507 | Ga0590071_082287 | 3300059421 | Bacteria | 801 |
| 1508 | Ga0466962_0215036 | 3300061719 | Bacteria | 940 |
| 1509 | Ga0466962_0223356 | 3300061719 | Bacteria | 923 |
| 1510 | 2587759304 | 2585428062 | Bacteria | 6842168 |
| 1511 | 2643972274 | 2643221592 | Bacteria | 6608788 |
| 1512 | 2644141615 | 2643221625 | Bacteria | 6512927 |
| 1513 | 2644275614 | 2643221648 | Bacteria | 6521465 |
| 1514 | 2644302872 | 2643221654 | Bacteria | 5273570 |
| 1515 | 2644341016 | 2643221660 | Bacteria | 4208257 |
| 1516 | 2739248173 | 2738543013 | Bacteria | 5618633 |
| 1517 | 2842734314 | 2842733646 | Bacteria | 5716726 |
| 1518 | 2842749435 | 2842747753 | Bacteria | 5578255 |
| 1519 | 2881105458 | 2881101125 | Bacteria | 4590519 |
| 1520 | 2904483482 | 2904479285 | Bacteria | 5073931 |
| 1521 | Ga0075370_10729472 | |||
| 1522 | rootH1_10010129 | |||
| 1523 | rootH2_10039438 | |||
| 1524 | rootH2_10043347 | |||
| 1525 | rootL2_10013481 | |||
| 1526 | rootL2_10026887 | |||
| 1527 | rootH1_10044193 | |||
| 1528 | rootH1_10044196 | |||
| 1529 | rootH1_10161445 | |||
| 1530 | Ga0055525_1000004 | |||
| 1531 | Ga0055524_1003998 | |||
| 1532 | Ga0055530_10005573 | |||
| 1533 | Ga0055530_10034370 | |||
| 1534 | Ga0055530_10066829 | |||
| 1535 | Ga0055540_1000001 | |||
| 1536 | Ga0055540_1023341 | |||
| 1537 | Ga0055540_1030847 | |||
| 1538 | Ga0055531_10000730 | |||
| 1539 | Ga0055531_10002938 | |||
| 1540 | Ga0055531_10012364 | |||
| 1541 | Ga0055531_10015992 | |||
| 1542 | Ga0055531_10065451 | |||
| 1543 | Ga0055543_1004765 | |||
| 1544 | Ga0065165_1000016 | |||
| 1545 | Ga0065165_1030189 | |||
| 1546 | Ga0065165_1042849 | |||
| 1547 | Ga0065704_10470195 | |||
| 1548 | Ga0065715_10384956 | |||
| 1549 | Ga0065715_10786722 | |||
| 1550 | Ga0065707_10602331 | |||
| 1551 | Ga0065707_10765415 | |||
| 1552 | Ga0070658_10514254 | |||
| 1553 | Ga0070676_10012789 | |||
| 1554 | Ga0070676_10021065 | |||
| 1555 | Ga0070676_10022439 | |||
| 1556 | Ga0070676_10071093 | |||
| 1557 | Ga0070676_10099440 | |||
| 1558 | Ga0070676_10121342 | |||
| 1559 | Ga0070676_10144140 | |||
| 1560 | Ga0070676_10736202 | |||
| 1561 | Ga0070676_10807474 | |||
| 1562 | Ga0070676_11366954 | |||
| 1563 | Ga0070683_100186556 | |||
| 1564 | Ga0070690_100010179 | |||
| 1565 | Ga0070690_101072455 | |||
| 1566 | Ga0070670_100003220 | |||
| 1567 | Ga0070670_100008161 | |||
| 1568 | Ga0070670_100057570 | |||
| 1569 | Ga0070670_100101782 | |||
| 1570 | Ga0070670_100107001 | |||
| 1571 | Ga0070670_100174034 | |||
| 1572 | Ga0070670_100240883 | |||
| 1573 | Ga0070670_100312486 | |||
| 1574 | Ga0070670_100332533 | |||
| 1575 | Ga0070670_100373467 | |||
| 1576 | Ga0070670_100525826 | |||
| 1577 | Ga0070677_10004653 | |||
| 1578 | Ga0070677_10014642 | |||
| 1579 | Ga0070677_10016371 | |||
| 1580 | Ga0070677_10036642 | |||
| 1581 | Ga0070677_10061088 | |||
| 1582 | Ga0070677_10074467 | |||
| 1583 | Ga0070677_10132128 | |||
| 1584 | Ga0070677_10149801 | |||
| 1585 | Ga0068869_100006018 | |||
| 1586 | Ga0068869_100009303 | |||
| 1587 | Ga0068869_100066966 | |||
| 1588 | Ga0068869_100068467 | |||
| 1589 | Ga0068869_100076582 | |||
| 1590 | Ga0068869_100164474 | |||
| 1591 | Ga0068869_101003464 | |||
| 1592 | Ga0068869_101042123 | |||
| 1593 | Ga0070666_10005842 | |||
| 1594 | Ga0070666_10023270 | |||
| 1595 | Ga0070666_10387518 | |||
| 1596 | Ga0070666_10746725 | |||
| 1597 | Ga0070680_100478267 | |||
| 1598 | Ga0070680_100563978 | |||
| 1599 | Ga0070682_100870299 | |||
| 1600 | Ga0068868_100025650 | |||
| 1601 | Ga0068868_100044655 | |||
| 1602 | Ga0068868_100050975 | |||
| 1603 | Ga0068868_100053875 | |||
| 1604 | Ga0068868_100239582 | |||
| 1605 | Ga0068868_100372618 | |||
| 1606 | Ga0070660_100055247 | |||
| 1607 | Ga0070660_100073646 | |||
| 1608 | Ga0070660_100277980 | |||
| 1609 | Ga0070689_100054759 | |||
| 1610 | Ga0070691_10089834 | |||
| 1611 | Ga0070661_100091319 | |||
| 1612 | Ga0070661_100473966 | |||
| 1613 | Ga0070661_100511107 | |||
| 1614 | Ga0070692_10586297 | |||
| 1615 | Ga0070668_100011100 | |||
| 1616 | Ga0070668_100038204 | |||
| 1617 | Ga0070668_100039496 | |||
| 1618 | Ga0070668_100080198 | |||
| 1619 | Ga0070668_101174531 | |||
| 1620 | Ga0070669_100008914 | |||
| 1621 | Ga0070669_100129958 | |||
| 1622 | Ga0070669_100235220 | |||
| 1623 | Ga0070669_100306913 | |||
| 1624 | Ga0070669_100369101 | |||
| 1625 | Ga0070669_100413664 | |||
| 1626 | Ga0070669_100511489 | |||
| 1627 | Ga0070669_100763692 | |||
| 1628 | Ga0070675_100001865 | |||
| 1629 | Ga0070675_100004779 | |||
| 1630 | Ga0070675_100010417 | |||
| 1631 | Ga0070675_100011548 | |||
| 1632 | Ga0070675_100017314 | |||
| 1633 | Ga0070675_100025466 | |||
| 1634 | Ga0070675_100117455 | |||
| 1635 | Ga0070675_100185939 | |||
| 1636 | Ga0070675_100478502 | |||
| 1637 | Ga0070675_100520689 | |||
| 1638 | Ga0070675_100601051 | |||
| 1639 | Ga0070671_100008478 | |||
| 1640 | Ga0070671_100012328 | |||
| 1641 | Ga0070671_100035021 | |||
| 1642 | Ga0070671_100044632 | |||
| 1643 | Ga0070671_100072731 | |||
| 1644 | Ga0070671_100114652 | |||
| 1645 | Ga0070671_100450904 | |||
| 1646 | Ga0070671_100540394 | |||
| 1647 | Ga0070671_100942887 | |||
| 1648 | Ga0070671_101079295 | |||
| 1649 | Ga0070674_100004964 | |||
| 1650 | Ga0070674_100023906 | |||
| 1651 | Ga0070674_100058113 | |||
| 1652 | Ga0070674_100086860 | |||
| 1653 | Ga0070674_100106645 | |||
| 1654 | Ga0070674_100151955 | |||
| 1655 | Ga0070674_100174927 | |||
| 1656 | Ga0070674_100449500 | |||
| 1657 | Ga0070673_100007810 | |||
| 1658 | Ga0070673_100034667 | |||
| 1659 | Ga0070673_100048394 | |||
| 1660 | Ga0070673_100050422 | |||
| 1661 | Ga0070673_100257087 | |||
| 1662 | Ga0070673_100349150 | |||
| 1663 | Ga0070673_100542472 | |||
| 1664 | Ga0070673_101388204 | |||
| 1665 | Ga0070688_100486364 | |||
| 1666 | Ga0070659_100005335 | |||
| 1667 | Ga0070659_100207367 | |||
| 1668 | Ga0070667_100002053 | |||
| 1669 | Ga0070667_100015048 | |||
| 1670 | Ga0070667_100016760 | |||
| 1671 | Ga0070667_100039535 | |||
| 1672 | Ga0070667_100042339 | |||
| 1673 | Ga0070667_100319074 | |||
| 1674 | Ga0070667_100341779 | |||
| 1675 | Ga0070667_101207418 | |||
| 1676 | Ga0070667_101264923 | |||
| 1677 | Ga0070667_101659328 | |||
| 1678 | Ga0070705_101325848 | |||
| 1679 | Ga0070700_100258326 | |||
| 1680 | Ga0070708_100520446 | |||
| 1681 | Ga0070663_100037006 | |||
| 1682 | Ga0070663_100049975 | |||
| 1683 | Ga0070663_100098399 | |||
| 1684 | Ga0070663_100193777 | |||
| 1685 | Ga0070663_100219994 | |||
| 1686 | Ga0070663_100229848 | |||
| 1687 | Ga0070663_100261169 | |||
| 1688 | Ga0070663_100705700 | |||
| 1689 | Ga0070678_100035116 | |||
| 1690 | Ga0070678_100060993 | |||
| 1691 | Ga0070678_100067178 | |||
| 1692 | Ga0070678_100085234 | |||
| 1693 | Ga0070678_100092856 | |||
| 1694 | Ga0070678_100102135 | |||
| 1695 | Ga0070678_100223660 | |||
| 1696 | Ga0070678_100259381 | |||
| 1697 | Ga0070678_100302576 | |||
| 1698 | Ga0070678_100440511 | |||
| 1699 | Ga0070678_100593525 | |||
| 1700 | Ga0070678_100690436 | |||
| 1701 | Ga0070678_100691420 | |||
| 1702 | Ga0070662_100012119 | |||
| 1703 | Ga0070662_100012323 | |||
| 1704 | Ga0070662_100028919 | |||
| 1705 | Ga0070662_100207991 | |||
| 1706 | Ga0070662_100262001 | |||
| 1707 | Ga0070662_100690746 | |||
| 1708 | Ga0070681_10422995 | |||
| 1709 | Ga0068867_100003434 | |||
| 1710 | Ga0068867_100006721 | |||
| 1711 | Ga0068867_100020479 | |||
| 1712 | Ga0068867_100043063 | |||
| 1713 | Ga0068867_100046830 | |||
| 1714 | Ga0068867_100085295 | |||
| 1715 | Ga0068867_100141831 | |||
| 1716 | Ga0068867_100270551 | |||
| 1717 | Ga0068867_100511712 | |||
| 1718 | Ga0068867_100529327 | |||
| 1719 | Ga0068867_100577095 | |||
| 1720 | Ga0068867_100728608 | |||
| 1721 | Ga0068867_101252423 | |||
| 1722 | Ga0068867_101751015 | |||
| 1723 | Ga0070685_10973434 | |||
| 1724 | Ga0070706_100016764 | |||
| 1725 | Ga0070706_100864366 | |||
| 1726 | Ga0070698_100084012 | |||
| 1727 | Ga0070679_100042059 | |||
| 1728 | Ga0070684_100124826 | |||
| 1729 | Ga0070684_102177369 | |||
| 1730 | Ga0068853_100056523 | |||
| 1731 | Ga0068853_100101997 | |||
| 1732 | Ga0068853_100109430 | |||
| 1733 | Ga0068853_100954154 | |||
| 1734 | Ga0068853_101218879 | |||
| 1735 | Ga0068853_101554761 | |||
| 1736 | Ga0070672_100001038 | |||
| 1737 | Ga0070672_100002031 | |||
| 1738 | Ga0070672_100007063 | |||
| 1739 | Ga0070672_100010437 | |||
| 1740 | Ga0070672_100052288 | |||
| 1741 | Ga0070672_100080388 | |||
| 1742 | Ga0070672_100101071 | |||
| 1743 | Ga0070672_100174069 | |||
| 1744 | Ga0070672_100214114 | |||
| 1745 | Ga0070672_100380331 | |||
| 1746 | Ga0070672_100438759 | |||
| 1747 | Ga0070672_101358460 | |||
| 1748 | Ga0070686_100378076 | |||
| 1749 | Ga0070693_100060705 | |||
| 1750 | Ga0070693_100289674 | |||
| 1751 | Ga0070665_100463074 | |||
| 1752 | Ga0070665_100632979 | |||
| 1753 | Ga0070665_101366806 | |||
| 1754 | Ga0068855_100048944 | |||
| 1755 | Ga0068855_100963948 | |||
| 1756 | Ga0068855_101691164 | |||
| 1757 | Ga0070664_100025177 | |||
| 1758 | Ga0070664_100128859 | |||
| 1759 | Ga0070664_100221638 | |||
| 1760 | Ga0070664_100428714 | |||
| 1761 | Ga0070664_100815717 | |||
| 1762 | Ga0070664_101072872 | |||
| 1763 | Ga0068857_100107336 | |||
| 1764 | Ga0068857_100190966 | |||
| 1765 | Ga0068857_100614579 | |||
| 1766 | Ga0068857_100994918 | |||
| 1767 | Ga0068854_100025152 | |||
| 1768 | Ga0068854_100035781 | |||
| 1769 | Ga0068854_100043140 | |||
| 1770 | Ga0068854_100695447 | |||
| 1771 | Ga0068854_100760197 | |||
| 1772 | Ga0068856_100164041 | |||
| 1773 | Ga0068856_100221898 | |||
| 1774 | Ga0070702_100013522 | |||
| 1775 | Ga0070702_100893751 | |||
| 1776 | Ga0068852_100017004 | |||
| 1777 | Ga0068852_100037453 | |||
| 1778 | Ga0068852_100108424 | |||
| 1779 | Ga0068852_100138911 | |||
| 1780 | Ga0068852_100390209 | |||
| 1781 | Ga0068852_100408483 | |||
| 1782 | Ga0068852_100560713 | |||
| 1783 | Ga0068852_100668034 | |||
| 1784 | Ga0068852_101061037 | |||
| 1785 | Ga0068852_101810053 | |||
| 1786 | Ga0068852_102237965 | |||
| 1787 | Ga0068859_100204443 | |||
| 1788 | Ga0068859_100413546 | |||
| 1789 | Ga0068859_100707430 | |||
| 1790 | Ga0068859_101427336 | |||
| 1791 | Ga0068864_100009971 | |||
| 1792 | Ga0068864_100020710 | |||
| 1793 | Ga0068864_100032590 | |||
| 1794 | Ga0068864_100045557 | |||
| 1795 | Ga0068864_100055582 | |||
| 1796 | Ga0068864_100076344 | |||
| 1797 | Ga0068864_100456948 | |||
| 1798 | Ga0068864_100572644 | |||
| 1799 | Ga0068864_101122244 | |||
| 1800 | Ga0068864_101291798 | |||
| 1801 | Ga0068864_101839600 | |||
| 1802 | Ga0068866_10002843 | |||
| 1803 | Ga0068861_100001754 | |||
| 1804 | Ga0068861_100043521 | |||
| 1805 | Ga0068861_100089193 | |||
| 1806 | Ga0068861_102070570 | |||
| 1807 | Ga0068851_10019767 | |||
| 1808 | Ga0068851_10117892 | |||
| 1809 | Ga0068851_10140806 | |||
| 1810 | Ga0068851_10390952 | |||
| 1811 | Ga0068870_10046087 | |||
| 1812 | Ga0068870_10065329 | |||
| 1813 | Ga0068870_10180092 | |||
| 1814 | Ga0068870_10602106 | |||
| 1815 | Ga0068863_100008147 | |||
| 1816 | Ga0068863_100020787 | |||
| 1817 | Ga0068863_100071501 | |||
| 1818 | Ga0068863_100104364 | |||
| 1819 | Ga0068863_100182433 | |||
| 1820 | Ga0068863_100203348 | |||
| 1821 | Ga0068863_100351701 | |||
| 1822 | Ga0068863_100354544 | |||
| 1823 | Ga0068863_100603337 | |||
| 1824 | Ga0068858_100024249 | |||
| 1825 | Ga0068858_100029185 | |||
| 1826 | Ga0068858_100032464 | |||
| 1827 | Ga0068858_100035860 | |||
| 1828 | Ga0068858_100136571 | |||
| 1829 | Ga0068858_100556081 | |||
| 1830 | Ga0068858_101960431 | |||
| 1831 | Ga0068860_100010210 | |||
| 1832 | Ga0068860_100012046 | |||
| 1833 | Ga0068860_100020052 | |||
| 1834 | Ga0068860_100147011 | |||
| 1835 | Ga0068860_100173567 | |||
| 1836 | Ga0068860_100662478 | |||
| 1837 | Ga0068860_101521563 | |||
| 1838 | Ga0068862_100018209 | |||
| 1839 | Ga0068862_100075506 | |||
| 1840 | Ga0068862_100463582 | |||
| 1841 | Ga0068862_100526899 | |||
| 1842 | Ga0068862_102413030 | |||
| 1843 | Ga0075365_10045821 | |||
| 1844 | Ga0075365_10050774 | |||
| 1845 | Ga0075365_10376216 | |||
| 1846 | Ga0075365_10499449 | |||
| 1847 | Ga0075365_10598215 | |||
| 1848 | Ga0075368_10004315 | |||
| 1849 | Ga0075368_10005763 | |||
| 1850 | Ga0075368_10005874 | |||
| 1851 | Ga0075368_10037262 | |||
| 1852 | Ga0075368_10225068 | |||
| 1853 | Ga0075368_10475449 | |||
| 1854 | Ga0075363_100009000 | |||
| 1855 | Ga0075363_100029084 | |||
| 1856 | Ga0075363_100046125 | |||
| 1857 | Ga0075363_100073619 | |||
| 1858 | Ga0075363_100177915 | |||
| 1859 | Ga0075363_100198374 | |||
| 1860 | Ga0075363_100254853 | |||
| 1861 | Ga0075363_100468302 | |||
| 1862 | Ga0075364_10006775 | |||
| 1863 | Ga0075364_10063712 | |||
| 1864 | Ga0075362_10010920 | |||
| 1865 | Ga0075362_10015345 | |||
| 1866 | Ga0075362_10028345 | |||
| 1867 | Ga0075362_10035774 | |||
| 1868 | Ga0075362_10048964 | |||
| 1869 | Ga0075362_10162200 | |||
| 1870 | Ga0075367_10010036 | |||
| 1871 | Ga0075367_10013686 | |||
| 1872 | Ga0075367_10018851 | |||
| 1873 | Ga0075367_10286244 | |||
| 1874 | Ga0075367_10980424 | |||
| 1875 | Ga0075369_10031398 | |||
| 1876 | Ga0075369_10081032 | |||
| 1877 | Ga0075366_10004389 | |||
| 1878 | Ga0075366_10006193 | |||
| 1879 | Ga0075366_10020276 | |||
| 1880 | Ga0075366_10021908 | |||
| 1881 | Ga0075366_10027485 | |||
| 1882 | Ga0075366_10032058 | |||
| 1883 | Ga0075366_10038291 | |||
| 1884 | Ga0075366_10041096 | |||
| 1885 | Ga0075366_10066259 | |||
| 1886 | Ga0075366_10067942 | |||
| 1887 | Ga0075366_10080306 | |||
| 1888 | Ga0075366_10110296 | |||
| 1889 | Ga0075366_10205748 | |||
| 1890 | Ga0075366_10212009 | |||
| 1891 | Ga0075366_10373179 | |||
| 1892 | Ga0075366_10931422 | |||
| 1893 | Ga0097621_100024414 | |||
| 1894 | Ga0097621_100041515 | |||
| 1895 | Ga0097621_100048189 | |||
| 1896 | Ga0097621_100303567 | |||
| 1897 | Ga0097621_100657890 | |||
| 1898 | Ga0097621_100861690 | |||
| 1899 | Ga0075370_10002177 | |||
| 1900 | Ga0075370_10006689 | |||
| 1901 | Ga0075370_10013105 | |||
| 1902 | Ga0075370_10015981 | |||
| 1903 | Ga0075370_10016103 | |||
| 1904 | Ga0075370_10045271 | |||
| 1905 | Ga0075370_10074890 | |||
| 1906 | Ga0075370_10959655 | |||
| 1907 | Ga0075370_11011526 | |||
| 1908 | Ga0068871_100003964 | |||
| 1909 | Ga0068871_100005973 | |||
| 1910 | Ga0068871_100006732 | |||
| 1911 | Ga0068871_100050006 | |||
| 1912 | Ga0068871_100294081 | |||
| 1913 | Ga0068871_100785498 | |||
| 1914 | Ga0068871_101166639 | |||
| 1915 | Ga0068871_101570543 | |||
| 1916 | Ga0068865_100015793 | |||
| 1917 | Ga0068865_100051731 | |||
| 1918 | Ga0068865_100111950 | |||
| 1919 | Ga0068865_100145309 | |||
| 1920 | Ga0097620_100204432 | |||
| 1921 | Ga0097620_100413511 | |||
| 1922 | Ga0097620_100707473 | |||
| 1923 | Ga0097620_101427276 | |||
| 1924 | Ga0099823_1000021 | |||
| 1925 | Ga0079104_1000001 | |||
| 1926 | Ga0105251_10356287 | |||
| 1927 | Ga0105244_10042239 | |||
| 1928 | Ga0105240_10060597 | |||
| 1929 | Ga0105240_10148546 | |||
| 1930 | Ga0105240_11306551 | |||
| 1931 | Ga0111539_10257504 | |||
| 1932 | Ga0111539_10422133 | |||
| 1933 | Ga0105245_10123515 | |||
| 1934 | Ga0105245_10226069 | |||
| 1935 | Ga0105245_10405021 | |||
| 1936 | Ga0105245_10482268 | |||
| 1937 | Ga0105245_10493458 | |||
| 1938 | Ga0105245_11221919 | |||
| 1939 | Ga0105247_10792092 | |||
| 1940 | Ga0105243_10037064 | |||
| 1941 | Ga0105243_10109870 | |||
| 1942 | Ga0105243_10171815 | |||
| 1943 | Ga0105243_10651208 | |||
| 1944 | Ga0105243_10825827 | |||
| 1945 | Ga0105243_12073248 | |||
| 1946 | Ga0105241_10344731 | |||
| 1947 | Ga0105241_11343903 | |||
| 1948 | Ga0105241_11969803 | |||
| 1949 | Ga0105242_10006564 | |||
| 1950 | Ga0105242_10594298 | |||
| 1951 | Ga0105242_10915127 | |||
| 1952 | Ga0105242_11441553 | |||
| 1953 | Ga0105242_11715097 | |||
| 1954 | Ga0105248_10000563 | |||
| 1955 | Ga0105248_10010877 | |||
| 1956 | Ga0105248_10035875 | |||
| 1957 | Ga0105248_10201577 | |||
| 1958 | Ga0105248_10495712 | |||
| 1959 | Ga0105248_10605778 | |||
| 1960 | Ga0105248_10756754 | |||
| 1961 | Ga0105248_11189445 | |||
| 1962 | Ga0105248_11555976 | |||
| 1963 | Ga0105248_11952920 | |||
| 1964 | Ga0105248_12597160 | |||
| 1965 | Ga0105237_10341269 | |||
| 1966 | Ga0105237_10496657 | |||
| 1967 | Ga0105238_10038345 | |||
| 1968 | Ga0105238_11305587 | |||
| 1969 | Ga0105238_12209097 | |||
| 1970 | Ga0105249_10059930 | |||
| 1971 | Ga0105249_10245727 | |||
| 1972 | Ga0105249_11490389 | |||
| 1973 | Ga0105249_12198012 | |||
| 1974 | Ga0105249_12232673 | |||
| 1975 | Ga0105239_10177521 | |||
| 1976 | Ga0105239_11003670 | |||
| 1977 | Ga0105239_11496177 | |||
| 1978 | Ga0105246_10335557 | |||
| 1979 | Ga0157319_1000008 | |||
| 1980 | Ga0157326_1033884 | |||
| 1981 | Ga0157371_10065465 | |||
| 1982 | Ga0157370_10089028 | |||
| 1983 | Ga0157370_10358210 | |||
| 1984 | Ga0157369_10202627 | |||
| 1985 | Ga0157369_10381857 | |||
| 1986 | Ga0157369_11180845 | |||
| 1987 | Ga0157374_10012674 | |||
| 1988 | Ga0157374_10086676 | |||
| 1989 | Ga0157374_10104497 | |||
| 1990 | Ga0157374_10259805 | |||
| 1991 | Ga0157374_10332302 | |||
| 1992 | Ga0157374_10947951 | |||
| 1993 | Ga0157374_11209671 | |||
| 1994 | Ga0157374_11762539 | |||
| 1995 | Ga0157374_12158449 | |||
| 1996 | Ga0157378_10070169 | |||
| 1997 | Ga0157378_10076073 | |||
| 1998 | Ga0157378_11039385 | |||
| 1999 | Ga0157378_11261019 | |||
| 2000 | Ga0157378_12583705 | |||
| 2001 | Ga0163162_10006190 | |||
| 2002 | Ga0163162_10009814 | |||
| 2003 | Ga0163162_10015375 | |||
| 2004 | Ga0163162_10015380 | |||
| 2005 | Ga0163162_10072420 | |||
| 2006 | Ga0163162_10162788 | |||
| 2007 | Ga0163162_10181209 | |||
| 2008 | Ga0163162_10393855 | |||
| 2009 | Ga0163162_11814556 | |||
| 2010 | Ga0157372_10075427 | |||
| 2011 | Ga0157372_10277248 | |||
| 2012 | Ga0157372_10358459 | |||
| 2013 | Ga0157375_10002731 | |||
| 2014 | Ga0157375_10039310 | |||
| 2015 | Ga0157375_10062939 | |||
| 2016 | Ga0157375_10093843 | |||
| 2017 | Ga0157375_10121655 | |||
| 2018 | Ga0157375_10262258 | |||
| 2019 | Ga0157375_10426748 | |||
| 2020 | Ga0157375_12238112 | |||
| 2021 | Ga0157375_12512370 | |||
| 2022 | Ga0157375_12632520 | |||
| 2023 | Ga0163163_10037474 | |||
| 2024 | Ga0163163_10180996 | |||
| 2025 | Ga0163163_10288535 | |||
| 2026 | Ga0163163_10452574 | |||
| 2027 | Ga0163163_10453007 | |||
| 2028 | Ga0163163_10458485 | |||
| 2029 | Ga0163163_10855292 | |||
| 2030 | Ga0163163_11116307 | |||
| 2031 | Ga0163163_12445687 | |||
| 2032 | Ga0157380_10012326 | |||
| 2033 | Ga0157380_10047810 | |||
| 2034 | Ga0157380_10158031 | |||
| 2035 | Ga0157380_10221504 | |||
| 2036 | Ga0157380_10506804 | |||
| 2037 | Ga0157380_10597499 | |||
| 2038 | Ga0157380_10712750 | |||
| 2039 | Ga0157380_10880485 | |||
| 2040 | Ga0182008_10009910 | |||
| 2041 | Ga0182008_10322186 | |||
| 2042 | Ga0182008_10343772 | |||
| 2043 | Ga0182008_10518892 | |||
| 2044 | Ga0157377_10002823 | |||
| 2045 | Ga0157377_10188773 | |||
| 2046 | Ga0157377_10201891 | |||
| 2047 | Ga0157379_10022800 | |||
| 2048 | Ga0157379_10030462 | |||
| 2049 | Ga0157379_10043791 | |||
| 2050 | Ga0157379_10046178 | |||
| 2051 | Ga0157379_10140733 | |||
| 2052 | Ga0157379_10278218 | |||
| 2053 | Ga0157379_10356949 | |||
| 2054 | Ga0157379_10374875 | |||
| 2055 | Ga0157379_10620088 | |||
| 2056 | Ga0157379_10704423 | |||
| 2057 | Ga0157379_10722747 | |||
| 2058 | Ga0157379_11002017 | |||
| 2059 | Ga0157379_11294626 | |||
| 2060 | Ga0157376_10010115 | |||
| 2061 | Ga0157376_10015391 | |||
| 2062 | Ga0157376_10117781 | |||
| 2063 | Ga0157376_10160682 | |||
| 2064 | Ga0157376_10164684 | |||
| 2065 | Ga0157376_10259272 | |||
| 2066 | Ga0157376_10305566 | |||
| 2067 | Ga0157376_10402674 | |||
| 2068 | Ga0157376_10825888 | |||
| 2069 | Ga0157376_11189322 | |||
| 2070 | Ga0157376_11453668 | |||
| 2071 | Ga0157376_11935598 | |||
| 2072 | Ga0157376_11947120 | |||
| 2073 | Ga0182007_10007788 | |||
| 2074 | Ga0182007_10105205 | |||
| 2075 | Ga0182007_10182845 | |||
| 2076 | Ga0182005_1065665 | |||
| 2077 | Ga0183362_10001 | |||
| 2078 | Ga0163161_10017287 | |||
| 2079 | Ga0163161_10027884 | |||
| 2080 | Ga0163161_10044555 | |||
| 2081 | Ga0163161_10082389 | |||
| 2082 | Ga0163161_10133272 | |||
| 2083 | Ga0163161_10177024 | |||
| 2084 | Ga0163161_10395836 | |||
| 2085 | Ga0163161_10404016 | |||
| 2086 | Ga0163161_10475519 | |||
| 2087 | Ga0163161_10718575 | |||
| 2088 | Ga0163161_11752938 | |||
| 2089 | Ga0163161_11967308 | |||
| 2090 | Ga0209563_100013 | |||
| 2091 | Ga0209565_1030525 | |||
| 2092 | Ga0207666_1026630 | |||
| 2093 | Ga0209673_1011533 | |||
| 2094 | Ga0209673_1018659 | |||
| 2095 | Ga0209673_1041812 | |||
| 2096 | Ga0209673_1050438 | |||
| 2097 | Ga0209130_1013707 | |||
| 2098 | Ga0209675_1003161 | |||
| 2099 | Ga0209676_1013656 | |||
| 2100 | Ga0209025_1040474 | |||
| 2101 | Ga0209050_1000118 | |||
| 2102 | Ga0209050_1000934 | |||
| 2103 | Ga0209050_1002768 | |||
| 2104 | Ga0209050_1010184 | |||
| 2105 | Ga0209050_1017089 | |||
| 2106 | Ga0209256_1000015 | |||
| 2107 | Ga0209256_1001723 | |||
| 2108 | Ga0209256_1001935 | |||
| 2109 | Ga0209051_1000018 | |||
| 2110 | Ga0209051_1000244 | |||
| 2111 | Ga0209051_1002679 | |||
| 2112 | Ga0209051_1010982 | |||
| 2113 | Ga0209051_1017158 | |||
| 2114 | Ga0209257_1000084 | |||
| 2115 | Ga0209257_1000144 | |||
| 2116 | Ga0209257_1005717 | |||
| 2117 | Ga0209257_1012179 | |||
| 2118 | Ga0207697_10058485 | |||
| 2119 | Ga0207697_10075593 | |||
| 2120 | Ga0207697_10404887 | |||
| 2121 | Ga0207656_10015851 | |||
| 2122 | Ga0207656_10032599 | |||
| 2123 | Ga0207656_10190419 | |||
| 2124 | Ga0207656_10260518 | |||
| 2125 | Ga0207682_10009133 | |||
| 2126 | Ga0207682_10009199 | |||
| 2127 | Ga0207682_10060510 | |||
| 2128 | Ga0207682_10097241 | |||
| 2129 | Ga0207682_10158600 | |||
| 2130 | Ga0207682_10213332 | |||
| 2131 | Ga0207642_10004772 | |||
| 2132 | Ga0207688_10053063 | |||
| 2133 | Ga0207688_10077532 | |||
| 2134 | Ga0207688_10333193 | |||
| 2135 | Ga0207680_10045362 | |||
| 2136 | Ga0207680_10126990 | |||
| 2137 | Ga0207680_10694631 | |||
| 2138 | Ga0207645_10003842 | |||
| 2139 | Ga0207645_10007638 | |||
| 2140 | Ga0207645_10011283 | |||
| 2141 | Ga0207645_10023842 | |||
| 2142 | Ga0207645_10055716 | |||
| 2143 | Ga0207645_10098649 | |||
| 2144 | Ga0207645_10110245 | |||
| 2145 | Ga0207645_10124920 | |||
| 2146 | Ga0207645_10154385 | |||
| 2147 | Ga0207645_10434810 | |||
| 2148 | Ga0207645_10514106 | |||
| 2149 | Ga0207645_10778436 | |||
| 2150 | Ga0207643_10050988 | |||
| 2151 | Ga0207643_10065217 | |||
| 2152 | Ga0207643_10094724 | |||
| 2153 | Ga0207643_10147137 | |||
| 2154 | Ga0207643_10402662 | |||
| 2155 | Ga0207705_10122504 | |||
| 2156 | Ga0207705_10517026 | |||
| 2157 | Ga0207705_10818856 | |||
| 2158 | Ga0207705_10897859 | |||
| 2159 | Ga0207705_10972720 | |||
| 2160 | Ga0207705_11432990 | |||
| 2161 | Ga0207684_10805431 | |||
| 2162 | Ga0207654_10072257 | |||
| 2163 | Ga0207654_10191515 | |||
| 2164 | Ga0207707_10122228 | |||
| 2165 | Ga0207707_10254640 | |||
| 2166 | Ga0207695_10402094 | |||
| 2167 | Ga0207695_10403020 | |||
| 2168 | Ga0207695_10721763 | |||
| 2169 | Ga0207671_11329844 | |||
| 2170 | Ga0207660_10071448 | |||
| 2171 | Ga0207660_10415621 | |||
| 2172 | Ga0207662_10002309 | |||
| 2173 | Ga0207657_10017805 | |||
| 2174 | Ga0207657_10053780 | |||
| 2175 | Ga0207657_10278411 | |||
| 2176 | Ga0207649_10065775 | |||
| 2177 | Ga0207649_10580582 | |||
| 2178 | Ga0207652_10539076 | |||
| 2179 | Ga0207652_10654276 | |||
| 2180 | Ga0207681_10004142 | |||
| 2181 | Ga0207681_10007931 | |||
| 2182 | Ga0207681_10031186 | |||
| 2183 | Ga0207681_10144617 | |||
| 2184 | Ga0207681_10195247 | |||
| 2185 | Ga0207681_10366751 | |||
| 2186 | Ga0207681_10411250 | |||
| 2187 | Ga0207681_10495284 | |||
| 2188 | Ga0207694_10128368 | |||
| 2189 | Ga0207694_10269272 | |||
| 2190 | Ga0207694_10736555 | |||
| 2191 | Ga0207650_10000587 | |||
| 2192 | Ga0207650_10003249 | |||
| 2193 | Ga0207650_10059716 | |||
| 2194 | Ga0207650_10099348 | |||
| 2195 | Ga0207650_10121601 | |||
| 2196 | Ga0207650_10132962 | |||
| 2197 | Ga0207650_10175603 | |||
| 2198 | Ga0207650_10366378 | |||
| 2199 | Ga0207650_10422154 | |||
| 2200 | Ga0207650_10552479 | |||
| 2201 | Ga0207659_10000861 | |||
| 2202 | Ga0207659_10005359 | |||
| 2203 | Ga0207659_10009237 | |||
| 2204 | Ga0207659_10038145 | |||
| 2205 | Ga0207659_10099297 | |||
| 2206 | Ga0207659_10123971 | |||
| 2207 | Ga0207659_10439678 | |||
| 2208 | Ga0207659_10555689 | |||
| 2209 | Ga0207659_10585031 | |||
| 2210 | Ga0207659_11484244 | |||
| 2211 | Ga0207687_10162880 | |||
| 2212 | Ga0207687_10275702 | |||
| 2213 | Ga0207687_10413778 | |||
| 2214 | Ga0207687_11283606 | |||
| 2215 | Ga0207644_10001574 | |||
| 2216 | Ga0207644_10015626 | |||
| 2217 | Ga0207644_10024816 | |||
| 2218 | Ga0207644_10027140 | |||
| 2219 | Ga0207644_10042686 | |||
| 2220 | Ga0207644_10057128 | |||
| 2221 | Ga0207644_10082148 | |||
| 2222 | Ga0207644_10173111 | |||
| 2223 | Ga0207644_10309822 | |||
| 2224 | Ga0207690_10018071 | |||
| 2225 | Ga0207690_10206944 | |||
| 2226 | Ga0207690_10310583 | |||
| 2227 | Ga0207706_10004316 | |||
| 2228 | Ga0207706_10006686 | |||
| 2229 | Ga0207706_10044702 | |||
| 2230 | Ga0207706_10067354 | |||
| 2231 | Ga0207706_10076876 | |||
| 2232 | Ga0207706_10106205 | |||
| 2233 | Ga0207706_10363273 | |||
| 2234 | Ga0207706_10380176 | |||
| 2235 | Ga0207706_10481419 | |||
| 2236 | Ga0207706_11015684 | |||
| 2237 | Ga0207686_10050077 | |||
| 2238 | Ga0207686_10149227 | |||
| 2239 | Ga0207686_11380962 | |||
| 2240 | Ga0207709_10020180 | |||
| 2241 | Ga0207709_10032365 | |||
| 2242 | Ga0207709_10157944 | |||
| 2243 | Ga0207709_10186615 | |||
| 2244 | Ga0207709_10357219 | |||
| 2245 | Ga0207670_10305359 | |||
| 2246 | Ga0207669_10004732 | |||
| 2247 | Ga0207669_10022825 | |||
| 2248 | Ga0207669_10029113 | |||
| 2249 | Ga0207669_10224939 | |||
| 2250 | Ga0207669_10703851 | |||
| 2251 | Ga0207669_10708264 | |||
| 2252 | Ga0207669_10776976 | |||
| 2253 | Ga0207669_10881573 | |||
| 2254 | Ga0207704_10023865 | |||
| 2255 | Ga0207704_10026882 | |||
| 2256 | Ga0207704_10054952 | |||
| 2257 | Ga0207704_10203998 | |||
| 2258 | Ga0207665_11425115 | |||
| 2259 | Ga0207691_10001498 | |||
| 2260 | Ga0207691_10006932 | |||
| 2261 | Ga0207691_10007996 | |||
| 2262 | Ga0207691_10036430 | |||
| 2263 | Ga0207691_10056404 | |||
| 2264 | Ga0207691_10180077 | |||
| 2265 | Ga0207691_10192637 | |||
| 2266 | Ga0207691_10214199 | |||
| 2267 | Ga0207691_10247986 | |||
| 2268 | Ga0207691_10426770 | |||
| 2269 | Ga0207691_10494497 | |||
| 2270 | Ga0207711_10016383 | |||
| 2271 | Ga0207711_10049043 | |||
| 2272 | Ga0207711_10061315 | |||
| 2273 | Ga0207711_10069139 | |||
| 2274 | Ga0207711_10085801 | |||
| 2275 | Ga0207711_10496351 | |||
| 2276 | Ga0207711_10543301 | |||
| 2277 | Ga0207711_10640907 | |||
| 2278 | Ga0207711_10890358 | |||
| 2279 | Ga0207689_10007087 | |||
| 2280 | Ga0207689_10009559 | |||
| 2281 | Ga0207689_10013353 | |||
| 2282 | Ga0207689_10023269 | |||
| 2283 | Ga0207689_10069220 | |||
| 2284 | Ga0207689_10080406 | |||
| 2285 | Ga0207689_10937593 | |||
| 2286 | Ga0207689_10960194 | |||
| 2287 | Ga0207689_11022507 | |||
| 2288 | Ga0207689_11518898 | |||
| 2289 | Ga0207661_10081303 | |||
| 2290 | Ga0207679_10040394 | |||
| 2291 | Ga0207679_10146320 | |||
| 2292 | Ga0207679_10257812 | |||
| 2293 | Ga0207679_10280104 | |||
| 2294 | Ga0207679_10286151 | |||
| 2295 | Ga0207679_10953654 | |||
| 2296 | Ga0207679_11143793 | |||
| 2297 | Ga0207679_11586993 | |||
| 2298 | Ga0207679_11704485 | |||
| 2299 | Ga0207667_10031271 | |||
| 2300 | Ga0207667_10170872 | |||
| 2301 | Ga0207667_10174518 | |||
| 2302 | Ga0207667_10310612 | |||
| 2303 | Ga0207651_10011230 | |||
| 2304 | Ga0207651_10040675 | |||
| 2305 | Ga0207651_10094594 | |||
| 2306 | Ga0207651_10181003 | |||
| 2307 | Ga0207651_10601363 | |||
| 2308 | Ga0207651_10759426 | |||
| 2309 | Ga0207651_10939867 | |||
| 2310 | Ga0207651_11096387 | |||
| 2311 | Ga0207712_10004623 | |||
| 2312 | Ga0207712_10150548 | |||
| 2313 | Ga0207712_11420224 | |||
| 2314 | Ga0207668_10018589 | |||
| 2315 | Ga0207668_10029872 | |||
| 2316 | Ga0207668_10039383 | |||
| 2317 | Ga0207668_10247822 | |||
| 2318 | Ga0207640_10014714 | |||
| 2319 | Ga0207640_10026671 | |||
| 2320 | Ga0207640_11621072 | |||
| 2321 | Ga0207658_10003013 | |||
| 2322 | Ga0207658_10003655 | |||
| 2323 | Ga0207658_10027918 | |||
| 2324 | Ga0207658_10033970 | |||
| 2325 | Ga0207658_10035280 | |||
| 2326 | Ga0207658_10179272 | |||
| 2327 | Ga0207658_10374645 | |||
| 2328 | Ga0207658_10471333 | |||
| 2329 | Ga0207658_10536830 | |||
| 2330 | Ga0207658_10608569 | |||
| 2331 | Ga0207658_10627106 | |||
| 2332 | Ga0207658_10916193 | |||
| 2333 | Ga0207658_11567446 | |||
| 2334 | Ga0207677_10055234 | |||
| 2335 | Ga0207677_10076814 | |||
| 2336 | Ga0207677_10085727 | |||
| 2337 | Ga0207677_10347322 | |||
| 2338 | Ga0207677_10367818 | |||
| 2339 | Ga0207677_10637998 | |||
| 2340 | Ga0207703_10004035 | |||
| 2341 | Ga0207703_10014712 | |||
| 2342 | Ga0207703_10022609 | |||
| 2343 | Ga0207703_10227598 | |||
| 2344 | Ga0207703_10557327 | |||
| 2345 | Ga0207639_10056806 | |||
| 2346 | Ga0207639_10165295 | |||
| 2347 | Ga0207639_10397750 | |||
| 2348 | Ga0207639_10413200 | |||
| 2349 | Ga0207639_10487040 | |||
| 2350 | Ga0207639_10949822 | |||
| 2351 | Ga0207639_11166013 | |||
| 2352 | Ga0207678_10006013 | |||
| 2353 | Ga0207678_10157724 | |||
| 2354 | Ga0207678_10176045 | |||
| 2355 | Ga0207678_10193669 | |||
| 2356 | Ga0207678_10294669 | |||
| 2357 | Ga0207678_10320970 | |||
| 2358 | Ga0207678_10336654 | |||
| 2359 | Ga0207708_10179176 | |||
| 2360 | Ga0207708_10260705 | |||
| 2361 | Ga0207702_10212209 | |||
| 2362 | Ga0207702_10355937 | |||
| 2363 | Ga0207702_10526742 | |||
| 2364 | Ga0207641_10004568 | |||
| 2365 | Ga0207641_10015586 | |||
| 2366 | Ga0207641_10031300 | |||
| 2367 | Ga0207641_10037683 | |||
| 2368 | Ga0207641_10164400 | |||
| 2369 | Ga0207641_10191199 | |||
| 2370 | Ga0207641_10304109 | |||
| 2371 | Ga0207641_10474718 | |||
| 2372 | Ga0207641_11583593 | |||
| 2373 | Ga0207641_12231683 | |||
| 2374 | Ga0207648_10000823 | |||
| 2375 | Ga0207648_10002295 | |||
| 2376 | Ga0207648_10012908 | |||
| 2377 | Ga0207648_10015894 | |||
| 2378 | Ga0207648_10056196 | |||
| 2379 | Ga0207648_10061050 | |||
| 2380 | Ga0207648_10074405 | |||
| 2381 | Ga0207648_10284410 | |||
| 2382 | Ga0207648_10752882 | |||
| 2383 | Ga0207676_10008687 | |||
| 2384 | Ga0207676_10015345 | |||
| 2385 | Ga0207676_10043099 | |||
| 2386 | Ga0207676_10069679 | |||
| 2387 | Ga0207676_10070418 | |||
| 2388 | Ga0207676_10076797 | |||
| 2389 | Ga0207676_10084831 | |||
| 2390 | Ga0207676_10143746 | |||
| 2391 | Ga0207676_10507279 | |||
| 2392 | Ga0207674_10072476 | |||
| 2393 | Ga0207674_10078380 | |||
| 2394 | Ga0207674_10093640 | |||
| 2395 | Ga0207674_10276408 | |||
| 2396 | Ga0207674_10763221 | |||
| 2397 | Ga0207674_11200115 | |||
| 2398 | Ga0207675_100002092 | |||
| 2399 | Ga0207675_100004056 | |||
| 2400 | Ga0207675_100031877 | |||
| 2401 | Ga0207675_100061552 | |||
| 2402 | Ga0207675_100238892 | |||
| 2403 | Ga0207675_101053265 | |||
| 2404 | Ga0207683_10049353 | |||
| 2405 | Ga0207683_10051178 | |||
| 2406 | Ga0207683_10053057 | |||
| 2407 | Ga0207683_10058397 | |||
| 2408 | Ga0207683_10085867 | |||
| 2409 | Ga0207683_10088992 | |||
| 2410 | Ga0207683_10106762 | |||
| 2411 | Ga0207683_10119317 | |||
| 2412 | Ga0207683_10124770 | |||
| 2413 | Ga0207683_10153058 | |||
| 2414 | Ga0207683_10258442 | |||
| 2415 | Ga0207683_10355500 | |||
| 2416 | Ga0207683_10377590 | |||
| 2417 | Ga0207683_10464748 | |||
| 2418 | Ga0207683_10745793 | |||
| 2419 | Ga0207698_10042779 | |||
| 2420 | Ga0207698_10064772 | |||
| 2421 | Ga0207698_10104707 | |||
| 2422 | Ga0207698_10170179 | |||
| 2423 | Ga0207698_10218396 | |||
| 2424 | Ga0207698_10271516 | |||
| 2425 | Ga0207698_10423631 | |||
| 2426 | Ga0207698_10528668 | |||
| 2427 | Ga0207698_10595140 | |||
| 2428 | Ga0207698_10788776 | |||
| 2429 | Ga0207698_10943355 | |||
| 2430 | Ga0209281_1000151 | |||
| 2431 | Ga0209389_1000341 | |||
| 2432 | Ga0209371_1010309 | |||
| 2433 | Ga0209813_10004823 | |||
| 2434 | Ga0209813_10010278 | |||
| 2435 | Ga0209813_10019065 | |||
| 2436 | Ga0209813_10041526 | |||
| 2437 | Ga0209813_10101373 | |||
| 2438 | Ga0209813_10318374 | |||
| 2439 | Ga0209974_10001355 | |||
| 2440 | Ga0209974_10106540 | |||
| 2441 | Ga0268266_10044876 | |||
| 2442 | Ga0268266_10092469 | |||
| 2443 | Ga0268266_10177416 | |||
| 2444 | Ga0268266_10382575 | |||
| 2445 | Ga0268266_10449191 | |||
| 2446 | Ga0268266_10698005 | |||
| 2447 | Ga0268266_10815884 | |||
| 2448 | Ga0268266_11820225 | |||
| 2449 | Ga0268265_10064219 | |||
| 2450 | Ga0268265_10081788 | |||
| 2451 | Ga0268265_10462756 | |||
| 2452 | Ga0268265_11567574 | |||
| 2453 | Ga0268264_10003212 | |||
| 2454 | Ga0268264_10003786 | |||
| 2455 | Ga0268264_10059514 | |||
| 2456 | Ga0268264_10088646 | |||
| 2457 | Ga0268264_10091577 | |||
| 2458 | Ga0268264_10145189 | |||
| 2459 | Ga0268264_10516498 | |||
| 2460 | Ga0268264_12382014 | |||
| 2461 | Ga0268264_12667247 | |||
| 2462 | Ga0307517_10000174 | |||
| 2463 | Ga0307517_10114587 | |||
| 2464 | Ga0307517_10140152 | |||
| 2465 | Ga0307517_10283240 | |||
| 2466 | Ga0307515_10000084 | |||
| 2467 | Ga0307515_10000265 | |||
| 2468 | Ga0307515_10002453 | |||
| 2469 | Ga0307515_10004018 | |||
| 2470 | Ga0307515_10040542 | |||
| 2471 | Ga0307515_10045204 | |||
| 2472 | Ga0307515_10058663 | |||
| 2473 | Ga0307515_10580104 | |||
| 2474 | Ga0307512_10048289 | |||
| 2475 | Ga0307512_10099404 | |||
| 2476 | Ga0307512_10128276 | |||
| 2477 | Ga0307512_10165911 | |||
| 2478 | Ga0307512_10172833 | |||
| 2479 | Ga0265331_10003101 | |||
| 2480 | Ga0265327_10000012 | |||
| 2481 | Ga0265327_10002000 | |||
| 2482 | Ga0265327_10050233 | |||
| 2483 | Ga0265327_10213974 | |||
| 2484 | Ga0307513_10000008 | |||
| 2485 | Ga0307513_10012364 | |||
| 2486 | Ga0307513_10016692 | |||
| 2487 | Ga0307513_10068505 | |||
| 2488 | Ga0307513_10096388 | |||
| 2489 | Ga0307513_10131033 | |||
| 2490 | Ga0307513_10144267 | |||
| 2491 | Ga0307513_10156808 | |||
| 2492 | Ga0307513_10265785 | |||
| 2493 | Ga0307513_10409585 | |||
| 2494 | Ga0307513_10422657 | |||
| 2495 | Ga0307509_10000225 | |||
| 2496 | Ga0307509_10022299 | |||
| 2497 | Ga0307509_10023360 | |||
| 2498 | Ga0307509_10055729 | |||
| 2499 | Ga0307509_10083968 | |||
| 2500 | Ga0307509_10166312 | |||
| 2501 | Ga0307408_100093037 | |||
| 2502 | Ga0307408_100195866 | |||
| 2503 | Ga0307408_100500811 | |||
| 2504 | Ga0307408_100639948 | |||
| 2505 | Ga0307408_100714486 | |||
| 2506 | Ga0307408_100813351 | |||
| 2507 | Ga0307508_10000123 | |||
| 2508 | Ga0307508_10007788 | |||
| 2509 | Ga0307508_10030181 | |||
| 2510 | Ga0307508_10469540 | |||
| 2511 | Ga0307514_10000319 | |||
| 2512 | Ga0307514_10003098 | |||
| 2513 | Ga0307514_10077519 | |||
| 2514 | Ga0307514_10086324 | |||
| 2515 | Ga0307516_10003862 | |||
| 2516 | Ga0307516_10047365 | |||
| 2517 | Ga0307516_10048869 | |||
| 2518 | Ga0307516_10085767 | |||
| 2519 | Ga0307516_10339052 | |||
| 2520 | Ga0307516_10354510 | |||
| 2521 | Ga0307405_10018710 | |||
| 2522 | Ga0307405_10211064 | |||
| 2523 | Ga0307405_11351830 | |||
| 2524 | Ga0307405_11774788 | |||
| 2525 | Ga0307413_10071140 | |||
| 2526 | Ga0307413_10072869 | |||
| 2527 | Ga0307413_10584274 | |||
| 2528 | Ga0307410_10000484 | |||
| 2529 | Ga0307410_10072561 | |||
| 2530 | Ga0307406_10016912 | |||
| 2531 | Ga0307406_10300119 | |||
| 2532 | Ga0307406_10454245 | |||
| 2533 | Ga0307407_10206481 | |||
| 2534 | Ga0307412_10036830 | |||
| 2535 | Ga0307412_10047004 | |||
| 2536 | Ga0307412_10441070 | |||
| 2537 | Ga0307412_10516354 | |||
| 2538 | Ga0307412_10740774 | |||
| 2539 | Ga0307409_100009019 | |||
| 2540 | Ga0307409_100026390 | |||
| 2541 | Ga0307416_100001658 | |||
| 2542 | Ga0307416_100026199 | |||
| 2543 | Ga0307416_100336962 | |||
| 2544 | Ga0307416_100409201 | |||
| 2545 | Ga0307416_100481182 | |||
| 2546 | Ga0307416_100908389 | |||
| 2547 | Ga0307416_101065772 | |||
| 2548 | Ga0307416_101425320 | |||
| 2549 | Ga0307416_102677828 | |||
| 2550 | Ga0307414_10067474 | |||
| 2551 | Ga0307414_10150781 | |||
| 2552 | Ga0307414_10911115 | |||
| 2553 | Ga0307414_10927145 | |||
| 2554 | Ga0307411_10371910 | |||
| 2555 | Ga0307411_10451535 | |||
| 2556 | Ga0307411_11142972 | |||
| 2557 | Ga0307411_11847637 | |||
| 2558 | Ga0307415_100006170 | |||
| 2559 | Ga0307507_10076893 | |||
| 2560 | Ga0307510_10008316 | |||
| 2561 | Ga0307510_10034217 | |||
| 2562 | Ga0307510_10109306 | |||
| 2563 | Ga0307510_10183981 | |||
| 2564 | Ga0307510_10331298 | |||
| 2565 | Ga0373938_0028174 | |||
| 2566 | Ga0373926_0193115 | |||
| 2567 | Ga0373934_0185679 | |||
| 2568 | Ga0373923_0459103 | |||
| 2569 | Ga0373960_0174496 | |||
| 2570 | Ga0373943_0031632 | |||
| 2571 | Ga0373946_0559030 | |||
| 2572 | Ga0373955_0169324 | |||
| 2573 | Ga0373962_0340453 | |||
| 2574 | Ga0373924_0371622 | |||
| 2575 | Ga0373931_0012403 | |||
| 2576 | Ga0373931_0331314 | |||
| 2577 | Ga0373935_1451335 | |||
| 2578 | Ga0373933_0871164 | |||
| 2579 | Ga0373933_1020612 | |||
| 2580 | Ga0373947_1244725 | |||
| 2581 | Ga0373937_0031134 | |||
| 2582 | Ga0373937_0777057 | |||
| 2583 | Ga0373937_0923781 | |||
| 2584 | Ga0373925_0017081 | |||
| 2585 | Ga0373925_0021911 | |||
| 2586 | Ga0373925_0367322 | |||
| 2587 | Ga0373925_0445844 | |||
| 2588 | Ga0395899_0019534 | |||
| 2589 | Ga0395900_0000050 | |||
| 2590 | Ga0395900_0020449 | |||
| 2591 | Ga0395900_0520696 | |||
| 2592 | Ga0395898_0005390 | |||
| 2593 | Ga0395898_0031352 | |||
| 2594 | Ga0395898_0130946 | |||
| 2595 | Ga0395898_0705175 | |||
| 2596 | Ga0395905_0000407 | |||
| 2597 | Ga0395905_0017351 | |||
| 2598 | Ga0395905_0090493 | |||
| 2599 | Ga0395905_0132193 | |||
| 2600 | Ga0395905_0261658 | |||
| 2601 | Ga0395905_0492816 | |||
| 2602 | Ga0395905_0709245 | |||
| 2603 | Ga0436364_1532384 | |||
| 2604 | Ga0395901_0128565 | |||
| 2605 | Ga0395901_1782734 | |||
| 2606 | Ga0436365_0686369 | |||
| 2607 | Ga0436365_0978309 | |||
| 2608 | Ga0436365_1867544 | |||
| 2609 | Ga0436361_0279495 | |||
| 2610 | Ga0436363_0541503 | |||
| 2611 | Ga0436363_1358280 | |||
| 2612 | Ga0439436_0004752 | |||
| 2613 | Ga0439447_014914 | |||
| 2614 | Ga0439447_042781 | |||
| 2615 | Ga0439461_0010217 | |||
| 2616 | Ga0439466_0010962 | |||
| 2617 | Ga0439466_0042439 | |||
| 2618 | Ga0439465_0000881 | |||
| 2619 | Ga0439465_0023629 | |||
| 2620 | Ga0451787_830888 | |||
| 2621 | Ga0451789_0500229 | |||
| 2622 | Ga0451791_0220690 | |||
| 2623 | Ga0451791_1507368 | |||
| 2624 | Ga0451793_1886398 | |||
| 2625 | Ga0451797_0557698 | |||
| 2626 | Ga0451797_1338879 | |||
| 2627 | Ga0451795_0084962 | |||
| 2628 | Ga0451795_0598759 | |||
| 2629 | Ga0451800_0518005 | |||
| 2630 | Ga0451800_0707869 | |||
| 2631 | Ga0451802_0416253 | |||
| 2632 | Ga0451806_766340 | |||
| 2633 | Ga0451807_1607480 | |||
| 2634 | Ga0451807_2114126 | |||
| 2635 | Ga0451833_1136626 | |||
| 2636 | Ga0451835_0275592 | |||
| 2637 | Ga0451837_1577029 | |||
| 2638 | Ga0451841_1254413 | |||
| 2639 | Ga0451849_1118628 | |||
| 2640 | Ga0451843_0822940 | |||
| 2641 | Ga0451855_1979706 | |||
| 2642 | Ga0451853_1115183 | |||
| 2643 | Ga0451853_1898289 | |||
| 2644 | Ga0451853_3246896 | |||
| 2645 | Ga0439431_0000136 | |||
| 2646 | Ga0439431_0014084 | |||
| 2647 | Ga0439431_0037407 | |||
| 2648 | Ga0439433_0000676 | |||
| 2649 | Ga0439433_0006006 | |||
| 2650 | Ga0439442_002772 | |||
| 2651 | Ga0439442_005065 | |||
| 2652 | Ga0439445_0091426 | |||
| 2653 | Ga0439448_0176933 | |||
| 2654 | Ga0439432_001610 | |||
| 2655 | Ga0439449_0000231 | |||
| 2656 | Ga0439449_0001881 | |||
| 2657 | Ga0439450_048229 | |||
| 2658 | Ga0439452_001605 | |||
| 2659 | Ga0439452_036468 | |||
| 2660 | Ga0439454_008726 | |||
| 2661 | Ga0439454_045835 | |||
| 2662 | Ga0439457_001194 | |||
| 2663 | Ga0450911_000302 | |||
| 2664 | Ga0450919_000922 | |||
| 2665 | Ga0450921_001267 | |||
| 2666 | Ga0450921_037348 | |||
| 2667 | Ga0450890_000923 | |||
| 2668 | Ga0450894_002638 | |||
| 2669 | Ga0450899_001703 | |||
| 2670 | Ga0450899_029744 | |||
| 2671 | Ga0450902_095261 | |||
| 2672 | Ga0450910_081130 | |||
| 2673 | Ga0439446_0007098 | |||
| 2674 | Ga0439446_0089707 | |||
| 2675 | Ga0450908_003584 | |||
| 2676 | Ga0450909_003671 | |||
| 2677 | Ga0439434_0002408 | |||
| 2678 | Ga0439459_0005459 | |||
| 2679 | Ga0439459_0063772 | |||
| 2680 | Ga0450918_000006 | |||
| 2681 | Ga0450918_037991 | |||
| 2682 | Ga0450893_0019931 | |||
| 2683 | Ga0450901_017245 | |||
| 2684 | Ga0451577_0007326 | |||
| 2685 | Ga0451577_0048478 | |||
| 2686 | Ga0451577_0292677 | |||
| 2687 | Ga0451577_0355745 | |||
| 2688 | Ga0466969_0000169 | |||
| 2689 | Ga0466969_0005890 | |||
| 2690 | Ga0466969_0047172 | |||
| 2691 | Ga0466969_0067295 | |||
| 2692 | Ga0466972_0036018 | |||
| 2693 | Ga0466972_0577419 | |||
| 2694 | Ga0453683_0001628 | |||
| 2695 | Ga0466965_0003093 | |||
| 2696 | Ga0466965_0090608 | |||
| 2697 | Ga0466965_0110819 | |||
| 2698 | Ga0466965_0190954 | |||
| 2699 | Ga0466965_0888115 | |||
| 2700 | Ga0466966_0011620 | |||
| 2701 | Ga0466966_0016624 | |||
| 2702 | Ga0466966_0175567 | |||
| 2703 | Ga0466966_0313732 | |||
| 2704 | Ga0466961_0011795 | |||
| 2705 | Ga0466961_0118210 | |||
| 2706 | Ga0466961_0176095 | |||
| 2707 | Ga0466963_0009105 | |||
| 2708 | Ga0466964_0003357 | |||
| 2709 | Ga0466964_0035719 | |||
| 2710 | Ga0466964_0608570 | |||
| 2711 | Ga0453684_0229325 | |||
| 2712 | Ga0453684_0472516 | |||
| 2713 | Ga0453684_0905336 | |||
| 2714 | Ga0466971_0008205 | |||
| 2715 | Ga0466971_0060520 | |||
| 2716 | Ga0466971_0494576 | |||
| 2717 | Ga0466968_0015412 | |||
| 2718 | Ga0466968_0069704 | |||
| 2719 | Ga0466968_0745278 | |||
| 2720 | Ga0466970_0019655 | |||
| 2721 | Ga0466970_0053291 | |||
| 2722 | Ga0466970_0116179 | |||
| 2723 | Ga0466970_0258574 | |||
| 2724 | Ga0466970_0460649 | |||
| 2725 | Ga0466957_0015588 | |||
| 2726 | Ga0466957_0046630 | |||
| 2727 | Ga0466957_0169164 | |||
| 2728 | Ga0466957_0246038 | |||
| 2729 | Ga0466960_0083500 | |||
| 2730 | Ga0466960_0480915 | |||
| 2731 | Ga0466959_0003436 | |||
| 2732 | Ga0466959_0042478 | |||
| 2733 | Ga0466959_0101590 | |||
| 2734 | Ga0466959_0105241 | |||
| 2735 | Ga0466959_1149871 | |||
| 2736 | Ga0451576_0003704 | |||
| 2737 | Ga0451576_0059421 | |||
| 2738 | Ga0451576_0075029 | |||
| 2739 | Ga0451576_0167776 | |||
| 2740 | Ga0451576_0188831 | |||
| 2741 | Ga0451576_0916681 | |||
| 2742 | Ga0451576_0972046 | |||
| 2743 | Ga0451576_1709068 | |||
| 2744 | Ga0466958_0167147 | |||
| 2745 | Ga0466958_0523601 | |||
| 2746 | Ga0466958_0587861 | |||
| 2747 | Ga0466967_0043435 | |||
| 2748 | Ga0495592_0000598 | |||
| 2749 | Ga0495592_0589439 | |||
| 2750 | Ga0495592_0778426 | |||
| 2751 | Ga0495603_0446196 | |||
| 2752 | Ga0495590_0031721 | |||
| 2753 | Ga0495590_0393564 | |||
| 2754 | Ga0495629_0222666 | |||
| 2755 | Ga0495629_0365821 | |||
| 2756 | Ga0495638_0079627 | |||
| 2757 | Ga0495651_0358253 | |||
| 2758 | Ga0495653_0299606 | |||
| 2759 | Ga0495650_0003795 | |||
| 2760 | Ga0495639_0004258 | |||
| 2761 | Ga0495583_0072689 | |||
| 2762 | Ga0495606_0089271 | |||
| 2763 | Ga0495610_0024192 | |||
| 2764 | Ga0495618_0276927 | |||
| 2765 | Ga0495628_0567699 | |||
| 2766 | Ga0495630_0815817 | |||
| 2767 | Ga0495631_0081207 | |||
| 2768 | Ga0495632_0003352 | |||
| 2769 | Ga0495632_0070387 | |||
| 2770 | Ga0495632_0080389 | |||
| 2771 | Ga0495643_0117998 | |||
| 2772 | Ga0495648_0267697 | |||
| 2773 | Ga0495666_0167164 | |||
| 2774 | Ga0495642_0081560 | |||
| 2775 | Ga0495642_0210539 | |||
| 2776 | Ga0495654_0261053 | |||
| 2777 | Ga0495598_0107874 | |||
| 2778 | Ga0495621_0005665 | |||
| 2779 | Ga0495621_0044127 | |||
| 2780 | Ga0495621_0298374 | |||
| 2781 | Ga0495597_0154824 | |||
| 2782 | Ga0495645_0153142 | |||
| 2783 | Ga0495645_0195379 | |||
| 2784 | Ga0495645_0311315 | |||
| 2785 | Ga0495622_0062144 | |||
| 2786 | Ga0495656_0001522 | |||
| 2787 | Ga0495656_0136040 | |||
| 2788 | Ga0495625_0002346 | |||
| 2789 | Ga0495625_0132535 | |||
| 2790 | Ga0495635_0113007 | |||
| 2791 | Ga0495635_0855838 | |||
| 2792 | Ga0495659_0107046 | |||
| 2793 | Ga0495588_0076705 | |||
| 2794 | Ga0495588_0225367 | |||
| 2795 | Ga0495647_0215742 | |||
| 2796 | Ga0495647_0460918 | |||
| 2797 | Ga0495658_0023952 | |||
| 2798 | Ga0495658_0029832 | |||
| 2799 | Ga0495658_0079085 | |||
| 2800 | Ga0495658_0169388 | |||
| 2801 | Ga0495658_0173601 | |||
| 2802 | Ga0495624_0029318 | |||
| 2803 | Ga0495670_0142672 | |||
| 2804 | Ga0495671_0118362 | |||
| 2805 | Ga0495671_0135487 | |||
| 2806 | Ga0495671_0152235 | |||
| 2807 | Ga0495671_0280344 | |||
| 2808 | Ga0495649_0010955 | |||
| 2809 | Ga0495589_0270715 | |||
| 2810 | Ga0495600_0238689 | |||
| 2811 | Ga0495660_0005806 | |||
| 2812 | Ga0495660_0222829 | |||
| 2813 | Ga0495674_0777439 | |||
| 2814 | Ga0495676_0280024 | |||
| 2815 | Ga0495676_0484832 | |||
| 2816 | Ga0495680_0434302 | |||
| 2817 | Ga0495687_007410 | |||
| 2818 | Ga0495687_011089 | |||
| 2819 | Ga0495687_012143 | |||
| 2820 | Ga0495686_0008561 | |||
| 2821 | Ga0495686_0084169 | |||
| 2822 | Ga0495593_0019618 | |||
| 2823 | Ga0495602_0548017 | |||
| 2824 | Ga0495602_0859511 | |||
| 2825 | Ga0495614_0095062 | |||
| 2826 | Ga0495614_0139265 | |||
| 2827 | Ga0495615_0021284 | |||
| 2828 | Ga0495615_0134208 | |||
| 2829 | Ga0495626_0066868 | |||
| 2830 | Ga0495626_0178981 | |||
| 2831 | Ga0495626_0194746 | |||
| 2832 | Ga0496100_0009445 | |||
| 2833 | Ga0496100_0278262 | |||
| 2834 | Ga0496100_0600707 | |||
| 2835 | Ga0496101_0000603 | |||
| 2836 | Ga0496101_0167019 | |||
| 2837 | Ga0496101_0353665 | |||
| 2838 | Ga0496102_0010766 | |||
| 2839 | Ga0496102_0093120 | |||
| 2840 | Ga0496102_0128835 | |||
| 2841 | Ga0496102_0245203 | |||
| 2842 | Ga0496103_0033763 | |||
| 2843 | Ga0496104_0022206 | |||
| 2844 | Ga0496104_0151219 | |||
| 2845 | Ga0496104_0186315 | |||
| 2846 | Ga0496104_0610183 | |||
| 2847 | Ga0496105_0004127 | |||
| 2848 | Ga0496105_0042258 | |||
| 2849 | Ga0496106_0020542 | |||
| 2850 | Ga0496106_0027853 | |||
| 2851 | Ga0496106_0124740 | |||
| 2852 | Ga0496107_0075914 | |||
| 2853 | Ga0496107_0499964 | |||
| 2854 | Ga0496108_0052127 | |||
| 2855 | Ga0496108_0082967 | |||
| 2856 | Ga0496108_0085318 | |||
| 2857 | Ga0496108_0231303 | |||
| 2858 | Ga0496108_0666636 | |||
| 2859 | Ga0496108_0929454 | |||
| 2860 | Ga0496109_0120241 | |||
| 2861 | Ga0496109_0271984 | |||
| 2862 | Ga0496109_0323016 | |||
| 2863 | Ga0496109_0360780 | |||
| 2864 | Ga0496109_0831806 | |||
| 2865 | Ga0496109_0978809 | |||
| 2866 | Ga0496110_0115353 | |||
| 2867 | Ga0496110_0822030 | |||
| 2868 | Ga0496110_0912796 | |||
| 2869 | Ga0496111_0041538 | |||
| 2870 | Ga0496112_0017021 | |||
| 2871 | Ga0496112_0408108 | |||
| 2872 | Ga0496112_1654017 | |||
| 2873 | Ga0496113_0159428 | |||
| 2874 | Ga0496113_0433996 | |||
| 2875 | Ga0496114_0020191 | |||
| 2876 | Ga0496114_0051490 | |||
| 2877 | Ga0496114_0505729 | |||
| 2878 | Ga0496114_0664154 | |||
| 2879 | Ga0496114_1114759 | |||
| 2880 | Ga0496115_0214779 | |||
| 2881 | Ga0496115_0889226 | |||
| 2882 | Ga0496117_0148834 | |||
| 2883 | Ga0496117_0593552 | |||
| 2884 | Ga0496121_0003789 | |||
| 2885 | Ga0496121_0012542 | |||
| 2886 | Ga0496121_0856665 | |||
| 2887 | Ga0496122_0000998 | |||
| 2888 | Ga0496122_0304754 | |||
| 2889 | Ga0496123_0000045 | |||
| 2890 | Ga0496123_0070966 | |||
| 2891 | Ga0496124_0000596 | |||
| 2892 | Ga0496124_0006265 | |||
| 2893 | Ga0496124_0081642 | |||
| 2894 | Ga0496124_0210660 | |||
| 2895 | Ga0496125_0014698 | |||
| 2896 | Ga0496125_0017503 | |||
| 2897 | Ga0496125_0022653 | |||
| 2898 | Ga0496125_0031594 | |||
| 2899 | Ga0496126_0131458 | |||
| 2900 | Ga0496126_0212866 | |||
| 2901 | Ga0496126_0270030 | |||
| 2902 | Ga0495682_0233713 | |||
| 2903 | Ga0501043_0000020 | |||
| 2904 | Ga0501046_0000039 | |||
| 2905 | Ga0501046_0629822 | |||
| 2906 | Ga0501047_0000028 | |||
| 2907 | Ga0501047_0282531 | |||
| 2908 | Ga0501048_0000484 | |||
| 2909 | Ga0501257_134852 | |||
| 2910 | Ga0501264_016792 | |||
| 2911 | Ga0501035_0224700 | |||
| 2912 | Ga0501045_0939156 | |||
| 2913 | nmdc:mga03683_230327_c1 | |||
| 2914 | nmdc:mga03683_25205_c1 | |||
| 2915 | nmdc:mga03683_458355_c1 | |||
| 2916 | nmdc:mga03683_45866_c1 | |||
| 2917 | nmdc:mga03683_609_c1 | |||
| 2918 | nmdc:mga03683_8148_c1 | |||
| 2919 | nmdc:mga03n38_139189_c1 | |||
| 2920 | nmdc:mga03n38_163148_c1 | |||
| 2921 | nmdc:mga03n38_164582_c1 | |||
| 2922 | nmdc:mga03n38_330015_c1 | |||
| 2923 | nmdc:mga03n38_6656_c1 | |||
| 2924 | nmdc:mga03n38_6905_c1 | |||
| 2925 | nmdc:mga03n38_7237_c1 | |||
| 2926 | nmdc:mga03n38_947741_c1 | |||
| 2927 | nmdc:mga00v17_907021_c1 | |||
| 2928 | nmdc:mga00v17_92917_c1 | |||
| 2929 | nmdc:mga0yw44_205157_c1 | |||
| 2930 | nmdc:mga0yw44_3930_c1 | |||
| 2931 | nmdc:mga0yw44_444174_c1 | |||
| 2932 | nmdc:mga0yw44_551800_c1 | |||
| 2933 | nmdc:mga0yw44_587766_c1 | |||
| 2934 | nmdc:mga0k408_106905_c1 | |||
| 2935 | nmdc:mga0k408_10994_c1 | |||
| 2936 | nmdc:mga0k408_12667_c1 | |||
| 2937 | nmdc:mga0k408_1297_c1 | |||
| 2938 | nmdc:mga0k408_135764_c2 | |||
| 2939 | nmdc:mga0k408_136693_c1 | |||
| 2940 | nmdc:mga0k408_157737_c1 | |||
| 2941 | nmdc:mga0k408_16726_c1 | |||
| 2942 | nmdc:mga0k408_17400_c1 | |||
| 2943 | nmdc:mga0k408_254447_c1 | |||
| 2944 | nmdc:mga0k408_318212_c1 | |||
| 2945 | nmdc:mga0k408_335424_c1 | |||
| 2946 | nmdc:mga0k408_33712_c1 | |||
| 2947 | nmdc:mga0k408_347893_c1 | |||
| 2948 | nmdc:mga0k408_37821_c1 | |||
| 2949 | nmdc:mga0k408_396054_c1 | |||
| 2950 | nmdc:mga0k408_4344_c1 | |||
| 2951 | nmdc:mga0k408_436230_c1 | |||
| 2952 | nmdc:mga0k408_444657_c1 | |||
| 2953 | nmdc:mga0k408_53264_c1 | |||
| 2954 | nmdc:mga0k408_570015_c1 | |||
| 2955 | nmdc:mga0k408_616034_c1 | |||
| 2956 | nmdc:mga0k408_620946_c1 | |||
| 2957 | nmdc:mga0k408_63717_c1 | |||
| 2958 | nmdc:mga0k408_77561_c1 | |||
| 2959 | nmdc:mga0k408_935_c1 | |||
| 2960 | nmdc:mga06z11_103293_c1 | |||
| 2961 | nmdc:mga06z11_1427_c1 | |||
| 2962 | nmdc:mga06z11_145940_c1 | |||
| 2963 | nmdc:mga06z11_165443_c1 | |||
| 2964 | nmdc:mga06z11_264594_c1 | |||
| 2965 | nmdc:mga06z11_29430_c1 | |||
| 2966 | nmdc:mga06z11_46276_c1 | |||
| 2967 | nmdc:mga06z11_693691_c1 | |||
| 2968 | nmdc:mga04h51_109356_c1 | |||
| 2969 | nmdc:mga04h51_11196_c1 | |||
| 2970 | nmdc:mga04h51_220977_c1 | |||
| 2971 | nmdc:mga04h51_41362_c1 | |||
| 2972 | nmdc:mga04h51_49843_c1 | |||
| 2973 | nmdc:mga07m45_231369_c1 | |||
| 2974 | nmdc:mga07m45_23824_c1 | |||
| 2975 | nmdc:mga07m45_24323_c1 | |||
| 2976 | nmdc:mga07m45_277825_c1 | |||
| 2977 | nmdc:mga07m45_30562_c1 | |||
| 2978 | nmdc:mga07m45_312026_c1 | |||
| 2979 | nmdc:mga07m45_33638_c1 | |||
| 2980 | nmdc:mga07m45_355_c1 | |||
| 2981 | nmdc:mga07m45_43921_c1 | |||
| 2982 | nmdc:mga07m45_44702_c1 | |||
| 2983 | nmdc:mga07m45_52189_c1 | |||
| 2984 | nmdc:mga07m45_553667_c1 | |||
| 2985 | nmdc:mga07m45_58954_c1 | |||
| 2986 | nmdc:mga07m45_75397_c1 | |||
| 2987 | nmdc:mga07m45_9617_c1 | |||
| 2988 | nmdc:mga05p37_1533142_c1 | |||
| 2989 | nmdc:mga08y16_1193187_c1 | |||
| 2990 | nmdc:mga0n895_646864_c1 | |||
| 2991 | nmdc:mga0rr50_88694_c1 | |||
| 2992 | nmdc:mga0a205_361369_c1 | |||
| 2993 | Ga0495601_0211148 | |||
| 2994 | Ga0495601_0616831 | |||
| 2995 | Ga0495612_0121501 | |||
| 2996 | Ga0495619_0112224 | |||
| 2997 | Ga0495619_0535573 | |||
| 2998 | Ga0500578_0000079 | |||
| 2999 | Ga0500578_0060596 | |||
| 3000 | Ga0500578_0755318 | |||
| 3001 | Ga0500644_0135926 | |||
| 3002 | Ga0500646_0015569 | |||
| 3003 | Ga0500646_0022185 | |||
| 3004 | Ga0500651_0036349 | |||
| 3005 | Ga0500651_0482079 | |||
| 3006 | Ga0500651_0743272 | |||
| 3007 | Ga0500594_0002669 | |||
| 3008 | Ga0500594_0012360 | |||
| 3009 | Ga0500607_346407 | |||
| 3010 | Ga0500618_043335 | |||
| 3011 | Ga0500621_075493 | |||
| 3012 | Ga0500623_147597 | |||
| 3013 | Ga0500658_0010178 | |||
| 3014 | Ga0500658_0021949 | |||
| 3015 | Ga0500559_0000128 | |||
| 3016 | Ga0500559_0004716 | |||
| 3017 | Ga0500559_0028097 | |||
| 3018 | Ga0500568_0006808 | |||
| 3019 | Ga0500568_0181002 | |||
| 3020 | Ga0500619_000016 | |||
| 3021 | Ga0500622_0000053 | |||
| 3022 | Ga0500622_0000347 | |||
| 3023 | Ga0500567_178793 | |||
| 3024 | Ga0500570_066850 | |||
| 3025 | Ga0500587_000682 | |||
| 3026 | Ga0500587_000706 | |||
| 3027 | Ga0590071_082287 | |||
| 3028 | Ga0466962_0215036 | |||
| 3029 | Ga0466962_0223356 | |||
| 3030 | 2587759304 | |||
| 3031 | 2643972274 | |||
| 3032 | 2644141615 | |||
| 3033 | 2644275614 | |||
| 3034 | 2644302872 | |||
| 3035 | 2644341016 | |||
| 3036 | 2739248173 | |||
| 3037 | 2842734314 | |||
| 3038 | 2842749435 | |||
| 3039 | 2881105458 | |||
| 3040 | 2904483482 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5cmo-assembly1.cif.gz_B | crystal structure of holo-[acyl-carrier-protein] synthase (acps) from neisseria meningitidis | 0.9518 | 1 | 129 |
| 5cmo-assembly1.cif.gz_B | crystal structure of holo-[acyl-carrier-protein] synthase (acps) from neisseria meningitidis | 0.9444 | 1 | 129 |
| 4jm7-assembly1.cif.gz_A | 1.82 angstrom resolution crystal structure of holo-(acyl-carrier-protein) synthase (acps) from staphylococcus aureus | 0.9411 | 1 | 130 |
| 3hyk-assembly1.cif.gz_B | 2.31 angstrom resolution crystal structure of a holo-(acyl-carrier-protein) synthase from bacillus anthracis str. ames in complex with coa (3',5'-adp) | 0.9384 | 1 | 130 |
| 5xuh-assembly1.cif.gz_B | crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) d9a mutant in complex with coa | 0.9375 | 1 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5cmoC00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.9482 | 1 | 129 | 3.90.470.20 |
| 4jm7A01 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.9412 | 1 | 130 | 3.90.470.20 |
| 5cmoC00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.9409 | 1 | 129 | 3.90.470.20 |
| 5xuhB00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.9376 | 1 | 129 | 3.90.470.20 |
| 5xuhB00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.9299 | 1 | 129 | 3.90.470.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A328Z6X6-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9971 | 1 | 131 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
| AF-B1XZM3-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.996 | 1 | 131 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
| AF-A0A2M8VZA3-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9951 | 1 | 130 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
| AF-A0A239H1S7-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9945 | 1 | 130 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
| AF-A0A1Y2R9I0-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.994 | 1 | 130 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |