F494528

General Info

Members Datasets Scaffolds Average Seq Length
1520 448 3040 133

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10729472|Ga0075370_107294722
Length 128
Sequence VIYGIGTDICDIRRIQASLDKHGERFAGKILSEAEMKTWRARSARVRYLATRFSAKEAFSKAVGLGMRMPMTWKLCEVGKLPSGKPVIVLHGVLKEWCEAKGLSAMVSVTDESDYAASFVVVEQKDPK

Samples

Sample ID Description Type Environment
1 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
89 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
106 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
123 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
195 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
196 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
198 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
205 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
208 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
211 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
212 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
225 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
226 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
227 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
228 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
229 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
252 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
253 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
254 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
255 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
256 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
257 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
258 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
259 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
260 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
261 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
262 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
263 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
264 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
265 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
266 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
267 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
268 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
269 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
270 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
271 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
272 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
273 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
274 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
275 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
276 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
277 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
278 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
279 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
280 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
281 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
282 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
283 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
284 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
285 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
286 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
287 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
288 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
289 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
290 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
291 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
292 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
293 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
294 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
295 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
296 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
297 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
298 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
299 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
300 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
301 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
302 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
303 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
304 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
305 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
306 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
307 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
308 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
309 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
310 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
311 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
312 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
313 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
314 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
315 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
316 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
317 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
318 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
319 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
320 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
321 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
322 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
323 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
324 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
325 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
326 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
327 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
328 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
329 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
330 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
331 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
332 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
333 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
334 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
335 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
336 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
337 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
338 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
339 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
340 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
341 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
342 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
343 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
344 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
345 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
346 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
347 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
348 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
349 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
350 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
351 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
352 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
353 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
354 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
355 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
356 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
357 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
358 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
359 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
360 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
361 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
362 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
363 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
364 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
365 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
366 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
367 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
368 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
369 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
370 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
371 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
372 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
373 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
374 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
375 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
376 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
377 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
378 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
379 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
380 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
381 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
382 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
383 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
384 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
385 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
386 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
387 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
388 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
389 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
390 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
391 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
392 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
393 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
394 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
395 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
400 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
401 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
403 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
404 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
405 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
406 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
407 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
408 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
409 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
410 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
411 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
412 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
413 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
414 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
415 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
416 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
417 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
418 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
419 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
420 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
421 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
422 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
423 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
424 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
425 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
426 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
427 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
428 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
429 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
430 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
431 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
432 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
433 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
434 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
435 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
436 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
437 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
438 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
439 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
440 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
441 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
442 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
443 2643221660 Methylibium sp. Root1272 Isolate Unclassified
444 2738543013 Variovorax sp. BT01 Isolate Unclassified
445 2842733646 Variovorax sp. R-72446 Isolate Unclassified
446 2842747753 Variovorax sp. R-72060 Isolate Unclassified
447 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
448 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.08
Nodule 0.26
Rhizoplane 4.28
Rhizosphere 74.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075370_10729472 3300006353 Bacteria 603
2 rootH1_10010129 3300003316 Bacteria 3033
3 rootH2_10039438 3300003320 Bacteria 6448
4 rootH2_10043347 3300003320 Bacteria 1683
5 rootL2_10013481 3300003322 Bacteria 10192
6 rootL2_10026887 3300003322 Bacteria 4953
7 rootH1_10044193 3300003323 Bacteria 6802
8 rootH1_10044196 3300003323 Bacteria 15532
9 rootH1_10161445 3300003323 Bacteria 2150
10 Ga0055525_1000004 3300003759 Bacteria 888039
11 Ga0055524_1003998 3300003775 Bacteria 6954
12 Ga0055530_10005573 3300003791 Bacteria 5931
13 Ga0055530_10034370 3300003791 Bacteria 1296
14 Ga0055530_10066829 3300003791 Bacteria 785
15 Ga0055540_1000001 3300003792 Bacteria 466834
16 Ga0055540_1023341 3300003792 Bacteria 1560
17 Ga0055540_1030847 3300003792 Bacteria 1238
18 Ga0055531_10000730 3300003794 Bacteria 27806
19 Ga0055531_10002938 3300003794 Bacteria 11090
20 Ga0055531_10012364 3300003794 Bacteria 4023
21 Ga0055531_10015992 3300003794 Bacteria 3267
22 Ga0055531_10065451 3300003794 Bacteria 864
23 Ga0055543_1004765 3300004625 Bacteria 3613
24 Ga0065165_1000016 3300005262 Bacteria 286248
25 Ga0065165_1030189 3300005262 Bacteria 1728
26 Ga0065165_1042849 3300005262 Bacteria 1333
27 Ga0065704_10470195 3300005289 Bacteria 690
28 Ga0065715_10384956 3300005293 Bacteria 902
29 Ga0065715_10786722 3300005293 Bacteria 615
30 Ga0065707_10602331 3300005295 Bacteria 689
31 Ga0065707_10765415 3300005295 Bacteria 612
32 Ga0070658_10514254 3300005327 Bacteria 1035
33 Ga0070676_10012789 3300005328 Bacteria 4592
34 Ga0070676_10021065 3300005328 Bacteria 3647
35 Ga0070676_10022439 3300005328 Bacteria 3539
36 Ga0070676_10071093 3300005328 Bacteria 2089
37 Ga0070676_10099440 3300005328 Bacteria 1795
38 Ga0070676_10121342 3300005328 Bacteria 1641
39 Ga0070676_10144140 3300005328 Bacteria 1519
40 Ga0070676_10736202 3300005328 Bacteria 723
41 Ga0070676_10807474 3300005328 Bacteria 693
42 Ga0070676_11366954 3300005328 Bacteria 542
43 Ga0070683_100186556 3300005329 Bacteria 1969
44 Ga0070690_100010179 3300005330 Bacteria 5463
45 Ga0070690_101072455 3300005330 Bacteria 638
46 Ga0070670_100003220 3300005331 Bacteria 13475
47 Ga0070670_100008161 3300005331 Bacteria 8917
48 Ga0070670_100057570 3300005331 Bacteria 3336
49 Ga0070670_100101782 3300005331 Bacteria 2473
50 Ga0070670_100107001 3300005331 Bacteria 2410
51 Ga0070670_100174034 3300005331 Bacteria 1868
52 Ga0070670_100240883 3300005331 Bacteria 1575
53 Ga0070670_100312486 3300005331 Bacteria 1376
54 Ga0070670_100332533 3300005331 Bacteria 1332
55 Ga0070670_100373467 3300005331 Bacteria 1255
56 Ga0070670_100525826 3300005331 Bacteria 1054
57 Ga0070677_10004653 3300005333 Bacteria 4489
58 Ga0070677_10014642 3300005333 Bacteria 2765
59 Ga0070677_10016371 3300005333 Bacteria 2638
60 Ga0070677_10036642 3300005333 Bacteria 1909
61 Ga0070677_10061088 3300005333 Bacteria 1555
62 Ga0070677_10074467 3300005333 Bacteria 1436
63 Ga0070677_10132128 3300005333 Bacteria 1141
64 Ga0070677_10149801 3300005333 Bacteria 1084
65 Ga0068869_100006018 3300005334 Bacteria 7673
66 Ga0068869_100009303 3300005334 Bacteria 6373
67 Ga0068869_100066966 3300005334 Bacteria 2648
68 Ga0068869_100068467 3300005334 Bacteria 2622
69 Ga0068869_100076582 3300005334 Bacteria 2487
70 Ga0068869_100164474 3300005334 Bacteria 1729
71 Ga0068869_101003464 3300005334 Bacteria 727
72 Ga0068869_101042123 3300005334 Bacteria 714
73 Ga0070666_10005842 3300005335 Bacteria 7558
74 Ga0070666_10023270 3300005335 Bacteria 4033
75 Ga0070666_10387518 3300005335 Bacteria 1004
76 Ga0070666_10746725 3300005335 Bacteria 719
77 Ga0070680_100478267 3300005336 Bacteria 1065
78 Ga0070680_100563978 3300005336 Bacteria 976
79 Ga0070682_100870299 3300005337 Bacteria 738
80 Ga0068868_100025650 3300005338 Bacteria 4486
81 Ga0068868_100044655 3300005338 Bacteria 3465
82 Ga0068868_100050975 3300005338 Bacteria 3253
83 Ga0068868_100053875 3300005338 Bacteria 3169
84 Ga0068868_100239582 3300005338 Bacteria 1524
85 Ga0068868_100372618 3300005338 Bacteria 1227
86 Ga0070660_100055247 3300005339 Bacteria 3068
87 Ga0070660_100073646 3300005339 Bacteria 2671
88 Ga0070660_100277980 3300005339 Bacteria 1370
89 Ga0070689_100054759 3300005340 Bacteria 3089
90 Ga0070691_10089834 3300005341 Bacteria 1513
91 Ga0070661_100091319 3300005344 Bacteria 2255
92 Ga0070661_100473966 3300005344 Bacteria 999
93 Ga0070661_100511107 3300005344 Bacteria 962
94 Ga0070692_10586297 3300005345 Bacteria 736
95 Ga0070668_100011100 3300005347 Bacteria 6705
96 Ga0070668_100038204 3300005347 Bacteria 3669
97 Ga0070668_100039496 3300005347 Bacteria 3609
98 Ga0070668_100080198 3300005347 Bacteria 2556
99 Ga0070668_101174531 3300005347 Bacteria 695
100 Ga0070669_100008914 3300005353 Bacteria 7156
101 Ga0070669_100129958 3300005353 Bacteria 1931
102 Ga0070669_100235220 3300005353 Bacteria 1453
103 Ga0070669_100306913 3300005353 Bacteria 1278
104 Ga0070669_100369101 3300005353 Bacteria 1168
105 Ga0070669_100413664 3300005353 Bacteria 1105
106 Ga0070669_100511489 3300005353 Bacteria 997
107 Ga0070669_100763692 3300005353 Bacteria 820
108 Ga0070675_100001865 3300005354 Bacteria 15533
109 Ga0070675_100004779 3300005354 Bacteria 10332
110 Ga0070675_100010417 3300005354 Bacteria 7263
111 Ga0070675_100011548 3300005354 Bacteria 6918
112 Ga0070675_100017314 3300005354 Bacteria 5725
113 Ga0070675_100025466 3300005354 Bacteria 4742
114 Ga0070675_100117455 3300005354 Bacteria 2257
115 Ga0070675_100185939 3300005354 Bacteria 1798
116 Ga0070675_100478502 3300005354 Bacteria 1120
117 Ga0070675_100520689 3300005354 Bacteria 1073
118 Ga0070675_100601051 3300005354 Bacteria 998
119 Ga0070671_100008478 3300005355 Bacteria 8238
120 Ga0070671_100012328 3300005355 Bacteria 6883
121 Ga0070671_100035021 3300005355 Bacteria 4158
122 Ga0070671_100044632 3300005355 Bacteria 3684
123 Ga0070671_100072731 3300005355 Bacteria 2871
124 Ga0070671_100114652 3300005355 Bacteria 2265
125 Ga0070671_100450904 3300005355 Bacteria 1104
126 Ga0070671_100540394 3300005355 Bacteria 1004
127 Ga0070671_100942887 3300005355 Bacteria 755
128 Ga0070671_101079295 3300005355 Bacteria 705
129 Ga0070674_100004964 3300005356 Bacteria 7624
130 Ga0070674_100023906 3300005356 Bacteria 3962
131 Ga0070674_100058113 3300005356 Bacteria 2687
132 Ga0070674_100086860 3300005356 Bacteria 2248
133 Ga0070674_100106645 3300005356 Bacteria 2050
134 Ga0070674_100151955 3300005356 Bacteria 1748
135 Ga0070674_100174927 3300005356 Bacteria 1640
136 Ga0070674_100449500 3300005356 Bacteria 1063
137 Ga0070673_100007810 3300005364 Bacteria 7083
138 Ga0070673_100034667 3300005364 Bacteria 3821
139 Ga0070673_100048394 3300005364 Bacteria 3314
140 Ga0070673_100050422 3300005364 Bacteria 3255
141 Ga0070673_100257087 3300005364 Bacteria 1524
142 Ga0070673_100349150 3300005364 Bacteria 1312
143 Ga0070673_100542472 3300005364 Bacteria 1056
144 Ga0070673_101388204 3300005364 Bacteria 661
145 Ga0070688_100486364 3300005365 Bacteria 929
146 Ga0070659_100005335 3300005366 Bacteria 9220
147 Ga0070659_100207367 3300005366 Bacteria 1614
148 Ga0070667_100002053 3300005367 Bacteria 17829
149 Ga0070667_100015048 3300005367 Bacteria 6392
150 Ga0070667_100016760 3300005367 Bacteria 6063
151 Ga0070667_100039535 3300005367 Bacteria 3954
152 Ga0070667_100042339 3300005367 Bacteria 3821
153 Ga0070667_100319074 3300005367 Bacteria 1402
154 Ga0070667_100341779 3300005367 Bacteria 1354
155 Ga0070667_101207418 3300005367 Bacteria 708
156 Ga0070667_101264923 3300005367 Bacteria 691
157 Ga0070667_101659328 3300005367 Bacteria 601
158 Ga0070705_101325848 3300005440 Bacteria 597
159 Ga0070700_100258326 3300005441 Bacteria 1253
160 Ga0070708_100520446 3300005445 Bacteria 1122
161 Ga0070663_100037006 3300005455 Bacteria 3394
162 Ga0070663_100049975 3300005455 Bacteria 2972
163 Ga0070663_100098399 3300005455 Bacteria 2179
164 Ga0070663_100193777 3300005455 Bacteria 1583
165 Ga0070663_100219994 3300005455 Bacteria 1490
166 Ga0070663_100229848 3300005455 Bacteria 1460
167 Ga0070663_100261169 3300005455 Bacteria 1374
168 Ga0070663_100705700 3300005455 Bacteria 858
169 Ga0070678_100035116 3300005456 Bacteria 3497
170 Ga0070678_100060993 3300005456 Bacteria 2779
171 Ga0070678_100067178 3300005456 Bacteria 2667
172 Ga0070678_100085234 3300005456 Bacteria 2407
173 Ga0070678_100092856 3300005456 Bacteria 2319
174 Ga0070678_100102135 3300005456 Bacteria 2224
175 Ga0070678_100223660 3300005456 Bacteria 1565
176 Ga0070678_100259381 3300005456 Bacteria 1461
177 Ga0070678_100302576 3300005456 Bacteria 1359
178 Ga0070678_100440511 3300005456 Bacteria 1139
179 Ga0070678_100593525 3300005456 Bacteria 988
180 Ga0070678_100690436 3300005456 Bacteria 919
181 Ga0070678_100691420 3300005456 Bacteria 918
182 Ga0070662_100012119 3300005457 Bacteria 5708
183 Ga0070662_100012323 3300005457 Bacteria 5667
184 Ga0070662_100028919 3300005457 Bacteria 3863
185 Ga0070662_100207991 3300005457 Bacteria 1556
186 Ga0070662_100262001 3300005457 Bacteria 1393
187 Ga0070662_100690746 3300005457 Bacteria 863
188 Ga0070681_10422995 3300005458 Bacteria 1244
189 Ga0068867_100003434 3300005459 Bacteria 11141
190 Ga0068867_100006721 3300005459 Bacteria 8131
191 Ga0068867_100020479 3300005459 Bacteria 4714
192 Ga0068867_100043063 3300005459 Bacteria 3304
193 Ga0068867_100046830 3300005459 Bacteria 3177
194 Ga0068867_100085295 3300005459 Bacteria 2387
195 Ga0068867_100141831 3300005459 Bacteria 1879
196 Ga0068867_100270551 3300005459 Bacteria 1389
197 Ga0068867_100511712 3300005459 Bacteria 1034
198 Ga0068867_100529327 3300005459 Bacteria 1018
199 Ga0068867_100577095 3300005459 Bacteria 977
200 Ga0068867_100728608 3300005459 Bacteria 878
201 Ga0068867_101252423 3300005459 Bacteria 683
202 Ga0068867_101751015 3300005459 Bacteria 583
203 Ga0070685_10973434 3300005466 Bacteria 635
204 Ga0070706_100016764 3300005467 Bacteria 6767
205 Ga0070706_100864366 3300005467 Bacteria 836
206 Ga0070698_100084012 3300005471 Bacteria 3173
207 Ga0070679_100042059 3300005530 Bacteria 4550
208 Ga0070684_100124826 3300005535 Bacteria 2318
209 Ga0070684_102177369 3300005535 Bacteria 523
210 Ga0068853_100056523 3300005539 Bacteria 3384
211 Ga0068853_100101997 3300005539 Bacteria 2539
212 Ga0068853_100109430 3300005539 Bacteria 2452
213 Ga0068853_100954154 3300005539 Bacteria 825
214 Ga0068853_101218879 3300005539 Bacteria 727
215 Ga0068853_101554761 3300005539 Bacteria 641
216 Ga0070672_100001038 3300005543 Bacteria 16915
217 Ga0070672_100002031 3300005543 Bacteria 12729
218 Ga0070672_100007063 3300005543 Bacteria 7594
219 Ga0070672_100010437 3300005543 Bacteria 6445
220 Ga0070672_100052288 3300005543 Bacteria 3189
221 Ga0070672_100080388 3300005543 Bacteria 2611
222 Ga0070672_100101071 3300005543 Bacteria 2339
223 Ga0070672_100174069 3300005543 Bacteria 1791
224 Ga0070672_100214114 3300005543 Bacteria 1614
225 Ga0070672_100380331 3300005543 Bacteria 1207
226 Ga0070672_100438759 3300005543 Bacteria 1123
227 Ga0070672_101358460 3300005543 Bacteria 635
228 Ga0070686_100378076 3300005544 Bacteria 1071
229 Ga0070693_100060705 3300005547 Bacteria 2195
230 Ga0070693_100289674 3300005547 Bacteria 1100
231 Ga0070665_100463074 3300005548 Bacteria 1278
232 Ga0070665_100632979 3300005548 Bacteria 1083
233 Ga0070665_101366806 3300005548 Bacteria 718
234 Ga0068855_100048944 3300005563 Bacteria 4987
235 Ga0068855_100963948 3300005563 Bacteria 898
236 Ga0068855_101691164 3300005563 Bacteria 645
237 Ga0070664_100025177 3300005564 Bacteria 4930
238 Ga0070664_100128859 3300005564 Bacteria 2222
239 Ga0070664_100221638 3300005564 Bacteria 1692
240 Ga0070664_100428714 3300005564 Bacteria 1212
241 Ga0070664_100815717 3300005564 Bacteria 873
242 Ga0070664_101072872 3300005564 Bacteria 758
243 Ga0068857_100107336 3300005577 Bacteria 2508
244 Ga0068857_100190966 3300005577 Bacteria 1865
245 Ga0068857_100614579 3300005577 Bacteria 1028
246 Ga0068857_100994918 3300005577 Bacteria 807
247 Ga0068854_100025152 3300005578 Bacteria 4085
248 Ga0068854_100035781 3300005578 Bacteria 3477
249 Ga0068854_100043140 3300005578 Bacteria 3195
250 Ga0068854_100695447 3300005578 Bacteria 877
251 Ga0068854_100760197 3300005578 Bacteria 841
252 Ga0068856_100164041 3300005614 Bacteria 2233
253 Ga0068856_100221898 3300005614 Bacteria 1905
254 Ga0070702_100013522 3300005615 Bacteria 4121
255 Ga0070702_100893751 3300005615 Bacteria 695
256 Ga0068852_100017004 3300005616 Bacteria 5694
257 Ga0068852_100037453 3300005616 Bacteria 4066
258 Ga0068852_100108424 3300005616 Bacteria 2520
259 Ga0068852_100138911 3300005616 Bacteria 2247
260 Ga0068852_100390209 3300005616 Bacteria 1367
261 Ga0068852_100408483 3300005616 Bacteria 1337
262 Ga0068852_100560713 3300005616 Bacteria 1143
263 Ga0068852_100668034 3300005616 Bacteria 1047
264 Ga0068852_101061037 3300005616 Bacteria 830
265 Ga0068852_101810053 3300005616 Bacteria 633
266 Ga0068852_102237965 3300005616 Bacteria 568
267 Ga0068859_100204443 3300005617 Bacteria 2060
268 Ga0068859_100413546 3300005617 Bacteria 1445
269 Ga0068859_100707430 3300005617 Bacteria 1098
270 Ga0068859_101427336 3300005617 Bacteria 764
271 Ga0068864_100009971 3300005618 Bacteria 7838
272 Ga0068864_100020710 3300005618 Bacteria 5504
273 Ga0068864_100032590 3300005618 Bacteria 4428
274 Ga0068864_100045557 3300005618 Bacteria 3762
275 Ga0068864_100055582 3300005618 Bacteria 3418
276 Ga0068864_100076344 3300005618 Bacteria 2928
277 Ga0068864_100456948 3300005618 Bacteria 1222
278 Ga0068864_100572644 3300005618 Bacteria 1094
279 Ga0068864_101122244 3300005618 Bacteria 783
280 Ga0068864_101291798 3300005618 Bacteria 730
281 Ga0068864_101839600 3300005618 Bacteria 611
282 Ga0068866_10002843 3300005718 Bacteria 7136
283 Ga0068861_100001754 3300005719 Bacteria 13938
284 Ga0068861_100043521 3300005719 Bacteria 3371
285 Ga0068861_100089193 3300005719 Bacteria 2430
286 Ga0068861_102070570 3300005719 Bacteria 569
287 Ga0068851_10019767 3300005834 Bacteria 3255
288 Ga0068851_10117892 3300005834 Bacteria 1424
289 Ga0068851_10140806 3300005834 Bacteria 1312
290 Ga0068851_10390952 3300005834 Bacteria 817
291 Ga0068870_10046087 3300005840 Bacteria 2285
292 Ga0068870_10065329 3300005840 Bacteria 1968
293 Ga0068870_10180092 3300005840 Bacteria 1268
294 Ga0068870_10602106 3300005840 Bacteria 747
295 Ga0068863_100008147 3300005841 Bacteria 10232
296 Ga0068863_100020787 3300005841 Bacteria 6269
297 Ga0068863_100071501 3300005841 Bacteria 3282
298 Ga0068863_100104364 3300005841 Bacteria 2696
299 Ga0068863_100182433 3300005841 Bacteria 2015
300 Ga0068863_100203348 3300005841 Bacteria 1906
301 Ga0068863_100351701 3300005841 Bacteria 1435
302 Ga0068863_100354544 3300005841 Bacteria 1429
303 Ga0068863_100603337 3300005841 Bacteria 1087
304 Ga0068858_100024249 3300005842 Bacteria 5653
305 Ga0068858_100029185 3300005842 Bacteria 5121
306 Ga0068858_100032464 3300005842 Bacteria 4847
307 Ga0068858_100035860 3300005842 Bacteria 4599
308 Ga0068858_100136571 3300005842 Bacteria 2301
309 Ga0068858_100556081 3300005842 Bacteria 1111
310 Ga0068858_101960431 3300005842 Bacteria 579
311 Ga0068860_100010210 3300005843 Bacteria 9293
312 Ga0068860_100012046 3300005843 Bacteria 8517
313 Ga0068860_100020052 3300005843 Bacteria 6477
314 Ga0068860_100147011 3300005843 Bacteria 2268
315 Ga0068860_100173567 3300005843 Bacteria 2083
316 Ga0068860_100662478 3300005843 Bacteria 1052
317 Ga0068860_101521563 3300005843 Bacteria 691
318 Ga0068862_100018209 3300005844 Bacteria 5848
319 Ga0068862_100075506 3300005844 Bacteria 2915
320 Ga0068862_100463582 3300005844 Bacteria 1196
321 Ga0068862_100526899 3300005844 Bacteria 1125
322 Ga0068862_102413030 3300005844 Bacteria 538
323 Ga0075365_10045821 3300006038 Bacteria 2870
324 Ga0075365_10050774 3300006038 Bacteria 2737
325 Ga0075365_10376216 3300006038 Bacteria 1002
326 Ga0075365_10499449 3300006038 Bacteria 860
327 Ga0075365_10598215 3300006038 Bacteria 780
328 Ga0075368_10004315 3300006042 Bacteria 4808
329 Ga0075368_10005763 3300006042 Bacteria 4283
330 Ga0075368_10005874 3300006042 Bacteria 4249
331 Ga0075368_10037262 3300006042 Bacteria 1901
332 Ga0075368_10225068 3300006042 Bacteria 798
333 Ga0075368_10475449 3300006042 Bacteria 556
334 Ga0075363_100009000 3300006048 Bacteria 4679
335 Ga0075363_100029084 3300006048 Bacteria 2849
336 Ga0075363_100046125 3300006048 Bacteria 2311
337 Ga0075363_100073619 3300006048 Bacteria 1859
338 Ga0075363_100177915 3300006048 Bacteria 1209
339 Ga0075363_100198374 3300006048 Bacteria 1146
340 Ga0075363_100254853 3300006048 Bacteria 1011
341 Ga0075363_100468302 3300006048 Bacteria 746
342 Ga0075364_10006775 3300006051 Bacteria 6756
343 Ga0075364_10063712 3300006051 Bacteria 2420
344 Ga0075362_10010920 3300006177 Bacteria 3563
345 Ga0075362_10015345 3300006177 Bacteria 3114
346 Ga0075362_10028345 3300006177 Bacteria 2404
347 Ga0075362_10035774 3300006177 Bacteria 2169
348 Ga0075362_10048964 3300006177 Bacteria 1886
349 Ga0075362_10162200 3300006177 Bacteria 1077
350 Ga0075367_10010036 3300006178 Bacteria 4963
351 Ga0075367_10013686 3300006178 Bacteria 4370
352 Ga0075367_10018851 3300006178 Bacteria 3814
353 Ga0075367_10286244 3300006178 Bacteria 1036
354 Ga0075367_10980424 3300006178 Bacteria 539
355 Ga0075369_10031398 3300006186 Bacteria 2242
356 Ga0075369_10081032 3300006186 Bacteria 1439
357 Ga0075366_10004389 3300006195 Bacteria 7569
358 Ga0075366_10006193 3300006195 Bacteria 6529
359 Ga0075366_10020276 3300006195 Bacteria 3856
360 Ga0075366_10021908 3300006195 Bacteria 3715
361 Ga0075366_10027485 3300006195 Bacteria 3338
362 Ga0075366_10032058 3300006195 Bacteria 3093
363 Ga0075366_10038291 3300006195 Bacteria 2832
364 Ga0075366_10041096 3300006195 Bacteria 2737
365 Ga0075366_10066259 3300006195 Bacteria 2148
366 Ga0075366_10067942 3300006195 Bacteria 2121
367 Ga0075366_10080306 3300006195 Bacteria 1947
368 Ga0075366_10110296 3300006195 Bacteria 1654
369 Ga0075366_10205748 3300006195 Bacteria 1197
370 Ga0075366_10212009 3300006195 Bacteria 1179
371 Ga0075366_10373179 3300006195 Bacteria 877
372 Ga0075366_10931422 3300006195 Bacteria 541
373 Ga0097621_100024414 3300006237 Bacteria 4720
374 Ga0097621_100041515 3300006237 Bacteria 3703
375 Ga0097621_100048189 3300006237 Bacteria 3456
376 Ga0097621_100303567 3300006237 Bacteria 1411
377 Ga0097621_100657890 3300006237 Bacteria 962
378 Ga0097621_100861690 3300006237 Bacteria 842
379 Ga0075370_10002177 3300006353 Bacteria 8992
380 Ga0075370_10006689 3300006353 Bacteria 5815
381 Ga0075370_10013105 3300006353 Bacteria 4398
382 Ga0075370_10015981 3300006353 Bacteria 4031
383 Ga0075370_10016103 3300006353 Bacteria 4018
384 Ga0075370_10045271 3300006353 Bacteria 2488
385 Ga0075370_10074890 3300006353 Bacteria 1940
386 Ga0075370_10959655 3300006353 Bacteria 523
387 Ga0075370_11011526 3300006353 Bacteria 509
388 Ga0068871_100003964 3300006358 Bacteria 10223
389 Ga0068871_100005973 3300006358 Bacteria 8569
390 Ga0068871_100006732 3300006358 Bacteria 8160
391 Ga0068871_100050006 3300006358 Bacteria 3380
392 Ga0068871_100294081 3300006358 Bacteria 1424
393 Ga0068871_100785498 3300006358 Bacteria 877
394 Ga0068871_101166639 3300006358 Bacteria 722
395 Ga0068871_101570543 3300006358 Bacteria 623
396 Ga0068865_100015793 3300006881 Bacteria 4818
397 Ga0068865_100051731 3300006881 Bacteria 2845
398 Ga0068865_100111950 3300006881 Bacteria 2015
399 Ga0068865_100145309 3300006881 Bacteria 1793
400 Ga0097620_100204432 3300006931 Bacteria 2060
401 Ga0097620_100413511 3300006931 Bacteria 1445
402 Ga0097620_100707473 3300006931 Bacteria 1098
403 Ga0097620_101427276 3300006931 Bacteria 764
404 Ga0099823_1000021 3300006944 Bacteria 76133
405 Ga0079104_1000001 3300006946 Bacteria 521847
406 Ga0105251_10356287 3300009011 Bacteria 668
407 Ga0105244_10042239 3300009036 Bacteria 2358
408 Ga0105240_10060597 3300009093 Bacteria 4718
409 Ga0105240_10148546 3300009093 Bacteria 2793
410 Ga0105240_11306551 3300009093 Bacteria 765
411 Ga0111539_10257504 3300009094 Bacteria 2032
412 Ga0111539_10422133 3300009094 Bacteria 1553
413 Ga0105245_10123515 3300009098 Bacteria 2421
414 Ga0105245_10226069 3300009098 Bacteria 1808
415 Ga0105245_10405021 3300009098 Bacteria 1364
416 Ga0105245_10482268 3300009098 Bacteria 1253
417 Ga0105245_10493458 3300009098 Bacteria 1239
418 Ga0105245_11221919 3300009098 Bacteria 800
419 Ga0105247_10792092 3300009101 Bacteria 722
420 Ga0105243_10037064 3300009148 Bacteria 3787
421 Ga0105243_10109870 3300009148 Bacteria 2304
422 Ga0105243_10171815 3300009148 Bacteria 1878
423 Ga0105243_10651208 3300009148 Bacteria 1021
424 Ga0105243_10825827 3300009148 Bacteria 916
425 Ga0105243_12073248 3300009148 Bacteria 604
426 Ga0105241_10344731 3300009174 Bacteria 1292
427 Ga0105241_11343903 3300009174 Bacteria 682
428 Ga0105241_11969803 3300009174 Bacteria 574
429 Ga0105242_10006564 3300009176 Bacteria 8960
430 Ga0105242_10594298 3300009176 Bacteria 1068
431 Ga0105242_10915127 3300009176 Bacteria 878
432 Ga0105242_11441553 3300009176 Bacteria 717
433 Ga0105242_11715097 3300009176 Bacteria 665
434 Ga0105248_10000563 3300009177 Bacteria 42070
435 Ga0105248_10010877 3300009177 Bacteria 10046
436 Ga0105248_10035875 3300009177 Bacteria 5547
437 Ga0105248_10201577 3300009177 Bacteria 2242
438 Ga0105248_10495712 3300009177 Bacteria 1377
439 Ga0105248_10605778 3300009177 Bacteria 1236
440 Ga0105248_10756754 3300009177 Bacteria 1096
441 Ga0105248_11189445 3300009177 Bacteria 862
442 Ga0105248_11555976 3300009177 Bacteria 749
443 Ga0105248_11952920 3300009177 Bacteria 666
444 Ga0105248_12597160 3300009177 Bacteria 577
445 Ga0105237_10341269 3300009545 Bacteria 1502
446 Ga0105237_10496657 3300009545 Bacteria 1227
447 Ga0105238_10038345 3300009551 Bacteria 4866
448 Ga0105238_11305587 3300009551 Bacteria 752
449 Ga0105238_12209097 3300009551 Bacteria 585
450 Ga0105249_10059930 3300009553 Bacteria 3491
451 Ga0105249_10245727 3300009553 Bacteria 1772
452 Ga0105249_11490389 3300009553 Bacteria 749
453 Ga0105249_12198012 3300009553 Bacteria 625
454 Ga0105249_12232673 3300009553 Bacteria 620
455 Ga0105239_10177521 3300010375 Bacteria 2382
456 Ga0105239_11003670 3300010375 Bacteria 960
457 Ga0105239_11496177 3300010375 Bacteria 780
458 Ga0105246_10335557 3300011119 Bacteria 1233
459 Ga0157319_1000008 3300012497 Bacteria 315600
460 Ga0157326_1033884 3300012513 Bacteria 688
461 Ga0157371_10065465 3300013102 Bacteria 2574
462 Ga0157370_10089028 3300013104 Bacteria 2899
463 Ga0157370_10358210 3300013104 Bacteria 1344
464 Ga0157369_10202627 3300013105 Bacteria 2082
465 Ga0157369_10381857 3300013105 Bacteria 1462
466 Ga0157369_11180845 3300013105 Bacteria 781
467 Ga0157374_10012674 3300013296 Bacteria 7342
468 Ga0157374_10086676 3300013296 Bacteria 2979
469 Ga0157374_10104497 3300013296 Bacteria 2719
470 Ga0157374_10259805 3300013296 Bacteria 1710
471 Ga0157374_10332302 3300013296 Bacteria 1508
472 Ga0157374_10947951 3300013296 Bacteria 879
473 Ga0157374_11209671 3300013296 Bacteria 777
474 Ga0157374_11762539 3300013296 Bacteria 644
475 Ga0157374_12158449 3300013296 Bacteria 584
476 Ga0157378_10070169 3300013297 Bacteria 3145
477 Ga0157378_10076073 3300013297 Bacteria 3024
478 Ga0157378_11039385 3300013297 Bacteria 855
479 Ga0157378_11261019 3300013297 Bacteria 779
480 Ga0157378_12583705 3300013297 Bacteria 560
481 Ga0163162_10006190 3300013306 Bacteria 11595
482 Ga0163162_10009814 3300013306 Bacteria 9317
483 Ga0163162_10015375 3300013306 Bacteria 7477
484 Ga0163162_10015380 3300013306 Bacteria 7475
485 Ga0163162_10072420 3300013306 Bacteria 3501
486 Ga0163162_10162788 3300013306 Bacteria 2353
487 Ga0163162_10181209 3300013306 Bacteria 2232
488 Ga0163162_10393855 3300013306 Bacteria 1518
489 Ga0163162_11814556 3300013306 Bacteria 697
490 Ga0157372_10075427 3300013307 Bacteria 3805
491 Ga0157372_10277248 3300013307 Bacteria 1949
492 Ga0157372_10358459 3300013307 Bacteria 1699
493 Ga0157375_10002731 3300013308 Bacteria 15254
494 Ga0157375_10039310 3300013308 Bacteria 4553
495 Ga0157375_10062939 3300013308 Bacteria 3689
496 Ga0157375_10093843 3300013308 Bacteria 3068
497 Ga0157375_10121655 3300013308 Bacteria 2720
498 Ga0157375_10262258 3300013308 Bacteria 1889
499 Ga0157375_10426748 3300013308 Bacteria 1492
500 Ga0157375_12238112 3300013308 Bacteria 651
501 Ga0157375_12512370 3300013308 Bacteria 615
502 Ga0157375_12632520 3300013308 Bacteria 601
503 Ga0163163_10037474 3300014325 Bacteria 4717
504 Ga0163163_10180996 3300014325 Bacteria 2155
505 Ga0163163_10288535 3300014325 Bacteria 1693
506 Ga0163163_10452574 3300014325 Bacteria 1344
507 Ga0163163_10453007 3300014325 Bacteria 1343
508 Ga0163163_10458485 3300014325 Bacteria 1335
509 Ga0163163_10855292 3300014325 Bacteria 973
510 Ga0163163_11116307 3300014325 Bacteria 851
511 Ga0163163_12445687 3300014325 Bacteria 580
512 Ga0157380_10012326 3300014326 Bacteria 6201
513 Ga0157380_10047810 3300014326 Bacteria 3367
514 Ga0157380_10158031 3300014326 Bacteria 1967
515 Ga0157380_10221504 3300014326 Bacteria 1693
516 Ga0157380_10506804 3300014326 Bacteria 1174
517 Ga0157380_10597499 3300014326 Bacteria 1091
518 Ga0157380_10712750 3300014326 Bacteria 1010
519 Ga0157380_10880485 3300014326 Bacteria 920
520 Ga0182008_10009910 3300014497 Bacteria 5123
521 Ga0182008_10322186 3300014497 Bacteria 813
522 Ga0182008_10343772 3300014497 Bacteria 790
523 Ga0182008_10518892 3300014497 Bacteria 658
524 Ga0157377_10002823 3300014745 Bacteria 7749
525 Ga0157377_10188773 3300014745 Bacteria 1301
526 Ga0157377_10201891 3300014745 Bacteria 1263
527 Ga0157379_10022800 3300014968 Bacteria 5548
528 Ga0157379_10030462 3300014968 Bacteria 4803
529 Ga0157379_10043791 3300014968 Bacteria 3996
530 Ga0157379_10046178 3300014968 Bacteria 3887
531 Ga0157379_10140733 3300014968 Bacteria 2175
532 Ga0157379_10278218 3300014968 Bacteria 1523
533 Ga0157379_10356949 3300014968 Bacteria 1339
534 Ga0157379_10374875 3300014968 Bacteria 1305
535 Ga0157379_10620088 3300014968 Bacteria 1011
536 Ga0157379_10704423 3300014968 Bacteria 948
537 Ga0157379_10722747 3300014968 Bacteria 936
538 Ga0157379_11002017 3300014968 Bacteria 796
539 Ga0157379_11294626 3300014968 Bacteria 704
540 Ga0157376_10010115 3300014969 Bacteria 6889
541 Ga0157376_10015391 3300014969 Bacteria 5777
542 Ga0157376_10117781 3300014969 Bacteria 2349
543 Ga0157376_10160682 3300014969 Bacteria 2036
544 Ga0157376_10164684 3300014969 Bacteria 2013
545 Ga0157376_10259272 3300014969 Bacteria 1628
546 Ga0157376_10305566 3300014969 Bacteria 1507
547 Ga0157376_10402674 3300014969 Bacteria 1324
548 Ga0157376_10825888 3300014969 Bacteria 941
549 Ga0157376_11189322 3300014969 Bacteria 790
550 Ga0157376_11453668 3300014969 Bacteria 718
551 Ga0157376_11935598 3300014969 Bacteria 627
552 Ga0157376_11947120 3300014969 Bacteria 625
553 Ga0182007_10007788 3300015262 Bacteria 4453
554 Ga0182007_10105205 3300015262 Bacteria 936
555 Ga0182007_10182845 3300015262 Bacteria 726
556 Ga0182005_1065665 3300015265 Bacteria 993
557 Ga0183362_10001 3300015683 Bacteria 2046624
558 Ga0163161_10017287 3300017792 Bacteria 5047
559 Ga0163161_10027884 3300017792 Bacteria 4007
560 Ga0163161_10044555 3300017792 Bacteria 3196
561 Ga0163161_10082389 3300017792 Bacteria 2370
562 Ga0163161_10133272 3300017792 Bacteria 1876
563 Ga0163161_10177024 3300017792 Bacteria 1633
564 Ga0163161_10395836 3300017792 Bacteria 1107
565 Ga0163161_10404016 3300017792 Bacteria 1096
566 Ga0163161_10475519 3300017792 Bacteria 1014
567 Ga0163161_10718575 3300017792 Bacteria 833
568 Ga0163161_11752938 3300017792 Bacteria 551
569 Ga0163161_11967308 3300017792 Bacteria 520
570 Ga0209563_100013 3300025230 Bacteria 941463
571 Ga0209565_1030525 3300025263 Bacteria 1052
572 Ga0207666_1026630 3300025271 Bacteria 872
573 Ga0209673_1011533 3300025273 Bacteria 3637
574 Ga0209673_1018659 3300025273 Bacteria 2514
575 Ga0209673_1041812 3300025273 Bacteria 1296
576 Ga0209673_1050438 3300025273 Bacteria 1105
577 Ga0209130_1013707 3300025284 Bacteria 2066
578 Ga0209675_1003161 3300025291 Bacteria 8001
579 Ga0209676_1013656 3300025292 Bacteria 3108
580 Ga0209025_1040474 3300025294 Bacteria 2015
581 Ga0209050_1000118 3300025298 Bacteria 202586
582 Ga0209050_1000934 3300025298 Bacteria 38215
583 Ga0209050_1002768 3300025298 Bacteria 14080
584 Ga0209050_1010184 3300025298 Bacteria 4672
585 Ga0209050_1017089 3300025298 Bacteria 2918
586 Ga0209256_1000015 3300025299 Bacteria 622953
587 Ga0209256_1001723 3300025299 Bacteria 20972
588 Ga0209256_1001935 3300025299 Bacteria 18873
589 Ga0209051_1000018 3300025303 Bacteria 527061
590 Ga0209051_1000244 3300025303 Bacteria 91505
591 Ga0209051_1002679 3300025303 Bacteria 12440
592 Ga0209051_1010982 3300025303 Bacteria 4516
593 Ga0209051_1017158 3300025303 Bacteria 3244
594 Ga0209257_1000084 3300025304 Bacteria 291502
595 Ga0209257_1000144 3300025304 Bacteria 197078
596 Ga0209257_1005717 3300025304 Bacteria 8532
597 Ga0209257_1012179 3300025304 Bacteria 4018
598 Ga0207697_10058485 3300025315 Bacteria 1601
599 Ga0207697_10075593 3300025315 Bacteria 1415
600 Ga0207697_10404887 3300025315 Bacteria 606
601 Ga0207656_10015851 3300025321 Bacteria 2923
602 Ga0207656_10032599 3300025321 Bacteria 2165
603 Ga0207656_10190419 3300025321 Bacteria 987
604 Ga0207656_10260518 3300025321 Bacteria 851
605 Ga0207682_10009133 3300025893 Bacteria 3917
606 Ga0207682_10009199 3300025893 Bacteria 3902
607 Ga0207682_10060510 3300025893 Bacteria 1584
608 Ga0207682_10097241 3300025893 Bacteria 1283
609 Ga0207682_10158600 3300025893 Bacteria 1024
610 Ga0207682_10213332 3300025893 Bacteria 891
611 Ga0207642_10004772 3300025899 Bacteria 4379
612 Ga0207688_10053063 3300025901 Bacteria 2273
613 Ga0207688_10077532 3300025901 Bacteria 1894
614 Ga0207688_10333193 3300025901 Bacteria 933
615 Ga0207680_10045362 3300025903 Bacteria 2591
616 Ga0207680_10126990 3300025903 Bacteria 1676
617 Ga0207680_10694631 3300025903 Bacteria 729
618 Ga0207645_10003842 3300025907 Bacteria 11246
619 Ga0207645_10007638 3300025907 Bacteria 7619
620 Ga0207645_10011283 3300025907 Bacteria 6107
621 Ga0207645_10023842 3300025907 Bacteria 3972
622 Ga0207645_10055716 3300025907 Bacteria 2524
623 Ga0207645_10098649 3300025907 Bacteria 1883
624 Ga0207645_10110245 3300025907 Bacteria 1781
625 Ga0207645_10124920 3300025907 Bacteria 1672
626 Ga0207645_10154385 3300025907 Bacteria 1499
627 Ga0207645_10434810 3300025907 Bacteria 885
628 Ga0207645_10514106 3300025907 Bacteria 811
629 Ga0207645_10778436 3300025907 Bacteria 650
630 Ga0207643_10050988 3300025908 Bacteria 2348
631 Ga0207643_10065217 3300025908 Bacteria 2085
632 Ga0207643_10094724 3300025908 Bacteria 1744
633 Ga0207643_10147137 3300025908 Bacteria 1410
634 Ga0207643_10402662 3300025908 Bacteria 865
635 Ga0207705_10122504 3300025909 Bacteria 1931
636 Ga0207705_10517026 3300025909 Bacteria 927
637 Ga0207705_10818856 3300025909 Bacteria 722
638 Ga0207705_10897859 3300025909 Bacteria 686
639 Ga0207705_10972720 3300025909 Bacteria 656
640 Ga0207705_11432990 3300025909 Bacteria 524
641 Ga0207684_10805431 3300025910 Bacteria 794
642 Ga0207654_10072257 3300025911 Bacteria 2053
643 Ga0207654_10191515 3300025911 Bacteria 1341
644 Ga0207707_10122228 3300025912 Bacteria 2276
645 Ga0207707_10254640 3300025912 Bacteria 1524
646 Ga0207695_10402094 3300025913 Bacteria 1254
647 Ga0207695_10403020 3300025913 Bacteria 1252
648 Ga0207695_10721763 3300025913 Bacteria 877
649 Ga0207671_11329844 3300025914 Bacteria 559
650 Ga0207660_10071448 3300025917 Bacteria 2525
651 Ga0207660_10415621 3300025917 Bacteria 1084
652 Ga0207662_10002309 3300025918 Bacteria 9551
653 Ga0207657_10017805 3300025919 Bacteria 6802
654 Ga0207657_10053780 3300025919 Bacteria 3486
655 Ga0207657_10278411 3300025919 Bacteria 1329
656 Ga0207649_10065775 3300025920 Bacteria 2296
657 Ga0207649_10580582 3300025920 Bacteria 860
658 Ga0207652_10539076 3300025921 Bacteria 1049
659 Ga0207652_10654276 3300025921 Bacteria 939
660 Ga0207681_10004142 3300025923 Bacteria 8988
661 Ga0207681_10007931 3300025923 Bacteria 6493
662 Ga0207681_10031186 3300025923 Bacteria 3479
663 Ga0207681_10144617 3300025923 Bacteria 1775
664 Ga0207681_10195247 3300025923 Bacteria 1551
665 Ga0207681_10366751 3300025923 Bacteria 1156
666 Ga0207681_10411250 3300025923 Bacteria 1094
667 Ga0207681_10495284 3300025923 Bacteria 1000
668 Ga0207694_10128368 3300025924 Bacteria 2030
669 Ga0207694_10269272 3300025924 Bacteria 1397
670 Ga0207694_10736555 3300025924 Bacteria 832
671 Ga0207650_10000587 3300025925 Bacteria 29198
672 Ga0207650_10003249 3300025925 Bacteria 11199
673 Ga0207650_10059716 3300025925 Bacteria 2843
674 Ga0207650_10099348 3300025925 Bacteria 2237
675 Ga0207650_10121601 3300025925 Bacteria 2033
676 Ga0207650_10132962 3300025925 Bacteria 1949
677 Ga0207650_10175603 3300025925 Bacteria 1705
678 Ga0207650_10366378 3300025925 Bacteria 1188
679 Ga0207650_10422154 3300025925 Bacteria 1107
680 Ga0207650_10552479 3300025925 Bacteria 965
681 Ga0207659_10000861 3300025926 Bacteria 18018
682 Ga0207659_10005359 3300025926 Bacteria 7772
683 Ga0207659_10009237 3300025926 Bacteria 6156
684 Ga0207659_10038145 3300025926 Bacteria 3340
685 Ga0207659_10099297 3300025926 Bacteria 2191
686 Ga0207659_10123971 3300025926 Bacteria 1984
687 Ga0207659_10439678 3300025926 Bacteria 1097
688 Ga0207659_10555689 3300025926 Bacteria 976
689 Ga0207659_10585031 3300025926 Bacteria 951
690 Ga0207659_11484244 3300025926 Bacteria 580
691 Ga0207687_10162880 3300025927 Bacteria 1713
692 Ga0207687_10275702 3300025927 Bacteria 1346
693 Ga0207687_10413778 3300025927 Bacteria 1111
694 Ga0207687_11283606 3300025927 Bacteria 629
695 Ga0207644_10001574 3300025931 Bacteria 14734
696 Ga0207644_10015626 3300025931 Bacteria 5099
697 Ga0207644_10024816 3300025931 Bacteria 4118
698 Ga0207644_10027140 3300025931 Bacteria 3955
699 Ga0207644_10042686 3300025931 Bacteria 3215
700 Ga0207644_10057128 3300025931 Bacteria 2817
701 Ga0207644_10082148 3300025931 Bacteria 2383
702 Ga0207644_10173111 3300025931 Bacteria 1687
703 Ga0207644_10309822 3300025931 Bacteria 1274
704 Ga0207690_10018071 3300025932 Bacteria 4319
705 Ga0207690_10206944 3300025932 Bacteria 1494
706 Ga0207690_10310583 3300025932 Bacteria 1236
707 Ga0207706_10004316 3300025933 Bacteria 13357
708 Ga0207706_10006686 3300025933 Bacteria 10663
709 Ga0207706_10044702 3300025933 Bacteria 3925
710 Ga0207706_10067354 3300025933 Bacteria 3150
711 Ga0207706_10076876 3300025933 Bacteria 2936
712 Ga0207706_10106205 3300025933 Bacteria 2471
713 Ga0207706_10363273 3300025933 Bacteria 1258
714 Ga0207706_10380176 3300025933 Bacteria 1225
715 Ga0207706_10481419 3300025933 Bacteria 1072
716 Ga0207706_11015684 3300025933 Bacteria 696
717 Ga0207686_10050077 3300025934 Bacteria 2596
718 Ga0207686_10149227 3300025934 Bacteria 1626
719 Ga0207686_11380962 3300025934 Bacteria 579
720 Ga0207709_10020180 3300025935 Bacteria 3756
721 Ga0207709_10032365 3300025935 Bacteria 3061
722 Ga0207709_10157944 3300025935 Bacteria 1578
723 Ga0207709_10186615 3300025935 Bacteria 1469
724 Ga0207709_10357219 3300025935 Bacteria 1105
725 Ga0207670_10305359 3300025936 Bacteria 1247
726 Ga0207669_10004732 3300025937 Bacteria 6026
727 Ga0207669_10022825 3300025937 Bacteria 3330
728 Ga0207669_10029113 3300025937 Bacteria 3049
729 Ga0207669_10224939 3300025937 Bacteria 1380
730 Ga0207669_10703851 3300025937 Bacteria 830
731 Ga0207669_10708264 3300025937 Bacteria 828
732 Ga0207669_10776976 3300025937 Bacteria 793
733 Ga0207669_10881573 3300025937 Bacteria 746
734 Ga0207704_10023865 3300025938 Bacteria 3305
735 Ga0207704_10026882 3300025938 Bacteria 3163
736 Ga0207704_10054952 3300025938 Bacteria 2431
737 Ga0207704_10203998 3300025938 Bacteria 1449
738 Ga0207665_11425115 3300025939 Bacteria 551
739 Ga0207691_10001498 3300025940 Bacteria 23269
740 Ga0207691_10006932 3300025940 Bacteria 10926
741 Ga0207691_10007996 3300025940 Bacteria 10168
742 Ga0207691_10036430 3300025940 Bacteria 4558
743 Ga0207691_10056404 3300025940 Bacteria 3578
744 Ga0207691_10180077 3300025940 Bacteria 1847
745 Ga0207691_10192637 3300025940 Bacteria 1777
746 Ga0207691_10214199 3300025940 Bacteria 1672
747 Ga0207691_10247986 3300025940 Bacteria 1538
748 Ga0207691_10426770 3300025940 Bacteria 1129
749 Ga0207691_10494497 3300025940 Bacteria 1039
750 Ga0207711_10016383 3300025941 Bacteria 6161
751 Ga0207711_10049043 3300025941 Bacteria 3614
752 Ga0207711_10061315 3300025941 Bacteria 3243
753 Ga0207711_10069139 3300025941 Bacteria 3060
754 Ga0207711_10085801 3300025941 Bacteria 2759
755 Ga0207711_10496351 3300025941 Bacteria 1137
756 Ga0207711_10543301 3300025941 Bacteria 1084
757 Ga0207711_10640907 3300025941 Bacteria 991
758 Ga0207711_10890358 3300025941 Bacteria 828
759 Ga0207689_10007087 3300025942 Bacteria 9854
760 Ga0207689_10009559 3300025942 Bacteria 8364
761 Ga0207689_10013353 3300025942 Bacteria 7009
762 Ga0207689_10023269 3300025942 Bacteria 5202
763 Ga0207689_10069220 3300025942 Bacteria 2900
764 Ga0207689_10080406 3300025942 Bacteria 2679
765 Ga0207689_10937593 3300025942 Bacteria 730
766 Ga0207689_10960194 3300025942 Bacteria 721
767 Ga0207689_11022507 3300025942 Bacteria 697
768 Ga0207689_11518898 3300025942 Bacteria 559
769 Ga0207661_10081303 3300025944 Bacteria 2676
770 Ga0207679_10040394 3300025945 Bacteria 3339
771 Ga0207679_10146320 3300025945 Bacteria 1917
772 Ga0207679_10257812 3300025945 Bacteria 1486
773 Ga0207679_10280104 3300025945 Bacteria 1430
774 Ga0207679_10286151 3300025945 Bacteria 1415
775 Ga0207679_10953654 3300025945 Bacteria 786
776 Ga0207679_11143793 3300025945 Bacteria 714
777 Ga0207679_11586993 3300025945 Bacteria 600
778 Ga0207679_11704485 3300025945 Bacteria 577
779 Ga0207667_10031271 3300025949 Bacteria 5747
780 Ga0207667_10170872 3300025949 Bacteria 2234
781 Ga0207667_10174518 3300025949 Bacteria 2209
782 Ga0207667_10310612 3300025949 Bacteria 1610
783 Ga0207651_10011230 3300025960 Bacteria 5004
784 Ga0207651_10040675 3300025960 Bacteria 3078
785 Ga0207651_10094594 3300025960 Bacteria 2197
786 Ga0207651_10181003 3300025960 Bacteria 1672
787 Ga0207651_10601363 3300025960 Bacteria 961
788 Ga0207651_10759426 3300025960 Bacteria 857
789 Ga0207651_10939867 3300025960 Bacteria 771
790 Ga0207651_11096387 3300025960 Bacteria 713
791 Ga0207712_10004623 3300025961 Bacteria 8693
792 Ga0207712_10150548 3300025961 Bacteria 1797
793 Ga0207712_11420224 3300025961 Bacteria 621
794 Ga0207668_10018589 3300025972 Bacteria 4378
795 Ga0207668_10029872 3300025972 Bacteria 3577
796 Ga0207668_10039383 3300025972 Bacteria 3181
797 Ga0207668_10247822 3300025972 Bacteria 1445
798 Ga0207640_10014714 3300025981 Bacteria 4510
799 Ga0207640_10026671 3300025981 Bacteria 3511
800 Ga0207640_11621072 3300025981 Bacteria 583
801 Ga0207658_10003013 3300025986 Bacteria 12045
802 Ga0207658_10003655 3300025986 Bacteria 10853
803 Ga0207658_10027918 3300025986 Bacteria 3970
804 Ga0207658_10033970 3300025986 Bacteria 3641
805 Ga0207658_10035280 3300025986 Bacteria 3581
806 Ga0207658_10179272 3300025986 Bacteria 1752
807 Ga0207658_10374645 3300025986 Bacteria 1245
808 Ga0207658_10471333 3300025986 Bacteria 1114
809 Ga0207658_10536830 3300025986 Bacteria 1045
810 Ga0207658_10608569 3300025986 Bacteria 982
811 Ga0207658_10627106 3300025986 Bacteria 967
812 Ga0207658_10916193 3300025986 Bacteria 798
813 Ga0207658_11567446 3300025986 Bacteria 602
814 Ga0207677_10055234 3300026023 Bacteria 2714
815 Ga0207677_10076814 3300026023 Bacteria 2379
816 Ga0207677_10085727 3300026023 Bacteria 2274
817 Ga0207677_10347322 3300026023 Bacteria 1242
818 Ga0207677_10367818 3300026023 Bacteria 1210
819 Ga0207677_10637998 3300026023 Bacteria 939
820 Ga0207703_10004035 3300026035 Bacteria 12135
821 Ga0207703_10014712 3300026035 Bacteria 6106
822 Ga0207703_10022609 3300026035 Bacteria 4935
823 Ga0207703_10227598 3300026035 Bacteria 1670
824 Ga0207703_10557327 3300026035 Bacteria 1081
825 Ga0207639_10056806 3300026041 Bacteria 3001
826 Ga0207639_10165295 3300026041 Bacteria 1869
827 Ga0207639_10397750 3300026041 Bacteria 1241
828 Ga0207639_10413200 3300026041 Bacteria 1218
829 Ga0207639_10487040 3300026041 Bacteria 1125
830 Ga0207639_10949822 3300026041 Bacteria 804
831 Ga0207639_11166013 3300026041 Bacteria 723
832 Ga0207678_10006013 3300026067 Bacteria 10798
833 Ga0207678_10157724 3300026067 Bacteria 1938
834 Ga0207678_10176045 3300026067 Bacteria 1827
835 Ga0207678_10193669 3300026067 Bacteria 1738
836 Ga0207678_10294669 3300026067 Bacteria 1394
837 Ga0207678_10320970 3300026067 Bacteria 1333
838 Ga0207678_10336654 3300026067 Bacteria 1300
839 Ga0207708_10179176 3300026075 Bacteria 1682
840 Ga0207708_10260705 3300026075 Bacteria 1399
841 Ga0207702_10212209 3300026078 Bacteria 1800
842 Ga0207702_10355937 3300026078 Bacteria 1402
843 Ga0207702_10526742 3300026078 Bacteria 1154
844 Ga0207641_10004568 3300026088 Bacteria 11965
845 Ga0207641_10015586 3300026088 Bacteria 6229
846 Ga0207641_10031300 3300026088 Bacteria 4412
847 Ga0207641_10037683 3300026088 Bacteria 4039
848 Ga0207641_10164400 3300026088 Bacteria 2020
849 Ga0207641_10191199 3300026088 Bacteria 1881
850 Ga0207641_10304109 3300026088 Bacteria 1507
851 Ga0207641_10474718 3300026088 Bacteria 1211
852 Ga0207641_11583593 3300026088 Bacteria 657
853 Ga0207641_12231683 3300026088 Bacteria 547
854 Ga0207648_10000823 3300026089 Bacteria 35061
855 Ga0207648_10002295 3300026089 Bacteria 20666
856 Ga0207648_10012908 3300026089 Bacteria 7801
857 Ga0207648_10015894 3300026089 Bacteria 6899
858 Ga0207648_10056196 3300026089 Bacteria 3436
859 Ga0207648_10061050 3300026089 Bacteria 3287
860 Ga0207648_10074405 3300026089 Bacteria 2960
861 Ga0207648_10284410 3300026089 Bacteria 1479
862 Ga0207648_10752882 3300026089 Bacteria 905
863 Ga0207676_10008687 3300026095 Bacteria 7223
864 Ga0207676_10015345 3300026095 Bacteria 5522
865 Ga0207676_10043099 3300026095 Bacteria 3472
866 Ga0207676_10069679 3300026095 Bacteria 2817
867 Ga0207676_10070418 3300026095 Bacteria 2805
868 Ga0207676_10076797 3300026095 Bacteria 2700
869 Ga0207676_10084831 3300026095 Bacteria 2583
870 Ga0207676_10143746 3300026095 Bacteria 2045
871 Ga0207676_10507279 3300026095 Bacteria 1146
872 Ga0207674_10072476 3300026116 Bacteria 3461
873 Ga0207674_10078380 3300026116 Bacteria 3309
874 Ga0207674_10093640 3300026116 Bacteria 2992
875 Ga0207674_10276408 3300026116 Bacteria 1627
876 Ga0207674_10763221 3300026116 Bacteria 933
877 Ga0207674_11200115 3300026116 Bacteria 728
878 Ga0207675_100002092 3300026118 Bacteria 19820
879 Ga0207675_100004056 3300026118 Bacteria 14185
880 Ga0207675_100031877 3300026118 Bacteria 4910
881 Ga0207675_100061552 3300026118 Bacteria 3504
882 Ga0207675_100238892 3300026118 Bacteria 1755
883 Ga0207675_101053265 3300026118 Bacteria 833
884 Ga0207683_10049353 3300026121 Bacteria 3684
885 Ga0207683_10051178 3300026121 Bacteria 3619
886 Ga0207683_10053057 3300026121 Bacteria 3554
887 Ga0207683_10058397 3300026121 Bacteria 3387
888 Ga0207683_10085867 3300026121 Bacteria 2798
889 Ga0207683_10088992 3300026121 Bacteria 2748
890 Ga0207683_10106762 3300026121 Bacteria 2504
891 Ga0207683_10119317 3300026121 Bacteria 2367
892 Ga0207683_10124770 3300026121 Bacteria 2313
893 Ga0207683_10153058 3300026121 Bacteria 2082
894 Ga0207683_10258442 3300026121 Bacteria 1590
895 Ga0207683_10355500 3300026121 Bacteria 1345
896 Ga0207683_10377590 3300026121 Bacteria 1303
897 Ga0207683_10464748 3300026121 Bacteria 1167
898 Ga0207683_10745793 3300026121 Bacteria 908
899 Ga0207698_10042779 3300026142 Bacteria 3388
900 Ga0207698_10064772 3300026142 Bacteria 2866
901 Ga0207698_10104707 3300026142 Bacteria 2355
902 Ga0207698_10170179 3300026142 Bacteria 1917
903 Ga0207698_10218396 3300026142 Bacteria 1721
904 Ga0207698_10271516 3300026142 Bacteria 1563
905 Ga0207698_10423631 3300026142 Bacteria 1278
906 Ga0207698_10528668 3300026142 Bacteria 1152
907 Ga0207698_10595140 3300026142 Bacteria 1090
908 Ga0207698_10788776 3300026142 Bacteria 951
909 Ga0207698_10943355 3300026142 Bacteria 872
910 Ga0209281_1000151 3300027111 Bacteria 167268
911 Ga0209389_1000341 3300027296 Bacteria 28381
912 Ga0209371_1010309 3300027312 Bacteria 2888
913 Ga0209813_10004823 3300027866 Bacteria 3241
914 Ga0209813_10010278 3300027866 Bacteria 2416
915 Ga0209813_10019065 3300027866 Bacteria 1903
916 Ga0209813_10041526 3300027866 Bacteria 1402
917 Ga0209813_10101373 3300027866 Bacteria 980
918 Ga0209813_10318374 3300027866 Bacteria 608
919 Ga0209974_10001355 3300027876 Bacteria 8817
920 Ga0209974_10106540 3300027876 Bacteria 984
921 Ga0268266_10044876 3300028379 Bacteria 3779
922 Ga0268266_10092469 3300028379 Bacteria 2654
923 Ga0268266_10177416 3300028379 Bacteria 1938
924 Ga0268266_10382575 3300028379 Bacteria 1328
925 Ga0268266_10449191 3300028379 Bacteria 1225
926 Ga0268266_10698005 3300028379 Bacteria 978
927 Ga0268266_10815884 3300028379 Bacteria 901
928 Ga0268266_11820225 3300028379 Bacteria 583
929 Ga0268265_10064219 3300028380 Bacteria 2827
930 Ga0268265_10081788 3300028380 Bacteria 2551
931 Ga0268265_10462756 3300028380 Bacteria 1187
932 Ga0268265_11567574 3300028380 Bacteria 663
933 Ga0268264_10003212 3300028381 Bacteria 14160
934 Ga0268264_10003786 3300028381 Bacteria 12976
935 Ga0268264_10059514 3300028381 Bacteria 3201
936 Ga0268264_10088646 3300028381 Bacteria 2663
937 Ga0268264_10091577 3300028381 Bacteria 2623
938 Ga0268264_10145189 3300028381 Bacteria 2121
939 Ga0268264_10516498 3300028381 Bacteria 1167
940 Ga0268264_12382014 3300028381 Bacteria 536
941 Ga0268264_12667247 3300028381 Bacteria 504
942 Ga0307517_10000174 3300028786 Bacteria 105578
943 Ga0307517_10114587 3300028786 Bacteria 2028
944 Ga0307517_10140152 3300028786 Bacteria 1701
945 Ga0307517_10283240 3300028786 Bacteria 943
946 Ga0307515_10000084 3300028794 Bacteria 221434
947 Ga0307515_10000265 3300028794 Bacteria 129554
948 Ga0307515_10002453 3300028794 Bacteria 40400
949 Ga0307515_10004018 3300028794 Bacteria 30712
950 Ga0307515_10040542 3300028794 Bacteria 7358
951 Ga0307515_10045204 3300028794 Bacteria 6772
952 Ga0307515_10058663 3300028794 Bacteria 5537
953 Ga0307515_10580104 3300028794 Bacteria 731
954 Ga0307512_10048289 3300030522 Bacteria 3448
955 Ga0307512_10099404 3300030522 Bacteria 1980
956 Ga0307512_10128276 3300030522 Bacteria 1602
957 Ga0307512_10165911 3300030522 Bacteria 1280
958 Ga0307512_10172833 3300030522 Bacteria 1234
959 Ga0265331_10003101 3300031250 Bacteria 10886
960 Ga0265327_10000012 3300031251 Bacteria 530403
961 Ga0265327_10002000 3300031251 Bacteria 23042
962 Ga0265327_10050233 3300031251 Bacteria 2183
963 Ga0265327_10213974 3300031251 Bacteria 869
964 Ga0307513_10000008 3300031456 Bacteria 442128
965 Ga0307513_10012364 3300031456 Bacteria 10551
966 Ga0307513_10016692 3300031456 Bacteria 8839
967 Ga0307513_10068505 3300031456 Bacteria 3717
968 Ga0307513_10096388 3300031456 Bacteria 2996
969 Ga0307513_10131033 3300031456 Bacteria 2453
970 Ga0307513_10144267 3300031456 Bacteria 2302
971 Ga0307513_10156808 3300031456 Bacteria 2175
972 Ga0307513_10265785 3300031456 Bacteria 1502
973 Ga0307513_10409585 3300031456 Bacteria 1088
974 Ga0307513_10422657 3300031456 Bacteria 1062
975 Ga0307509_10000225 3300031507 Bacteria 90913
976 Ga0307509_10022299 3300031507 Bacteria 7144
977 Ga0307509_10023360 3300031507 Bacteria 6947
978 Ga0307509_10055729 3300031507 Bacteria 4199
979 Ga0307509_10083968 3300031507 Bacteria 3281
980 Ga0307509_10166312 3300031507 Bacteria 2093
981 Ga0307408_100093037 3300031548 Bacteria 2280
982 Ga0307408_100195866 3300031548 Bacteria 1631
983 Ga0307408_100500811 3300031548 Bacteria 1063
984 Ga0307408_100639948 3300031548 Bacteria 949
985 Ga0307408_100714486 3300031548 Bacteria 902
986 Ga0307408_100813351 3300031548 Bacteria 849
987 Ga0307508_10000123 3300031616 Bacteria 92439
988 Ga0307508_10007788 3300031616 Bacteria 9948
989 Ga0307508_10030181 3300031616 Bacteria 4899
990 Ga0307508_10469540 3300031616 Bacteria 851
991 Ga0307514_10000319 3300031649 Bacteria 115327
992 Ga0307514_10003098 3300031649 Bacteria 16356
993 Ga0307514_10077519 3300031649 Bacteria 2471
994 Ga0307514_10086324 3300031649 Bacteria 2303
995 Ga0307516_10003862 3300031730 Bacteria 18937
996 Ga0307516_10047365 3300031730 Bacteria 4236
997 Ga0307516_10048869 3300031730 Bacteria 4161
998 Ga0307516_10085767 3300031730 Bacteria 2986
999 Ga0307516_10339052 3300031730 Bacteria 1171
1000 Ga0307516_10354510 3300031730 Bacteria 1132
1001 Ga0307405_10018710 3300031731 Bacteria 3829
1002 Ga0307405_10211064 3300031731 Bacteria 1417
1003 Ga0307405_11351830 3300031731 Bacteria 621
1004 Ga0307405_11774788 3300031731 Bacteria 548
1005 Ga0307413_10071140 3300031824 Bacteria 2191
1006 Ga0307413_10072869 3300031824 Bacteria 2169
1007 Ga0307413_10584274 3300031824 Bacteria 912
1008 Ga0307410_10000484 3300031852 Bacteria 16146
1009 Ga0307410_10072561 3300031852 Bacteria 2391
1010 Ga0307406_10016912 3300031901 Bacteria 4244
1011 Ga0307406_10300119 3300031901 Bacteria 1234
1012 Ga0307406_10454245 3300031901 Bacteria 1029
1013 Ga0307407_10206481 3300031903 Bacteria 1320
1014 Ga0307412_10036830 3300031911 Bacteria 3138
1015 Ga0307412_10047004 3300031911 Bacteria 2832
1016 Ga0307412_10441070 3300031911 Bacteria 1070
1017 Ga0307412_10516354 3300031911 Bacteria 997
1018 Ga0307412_10740774 3300031911 Bacteria 847
1019 Ga0307409_100009019 3300031995 Bacteria 6101
1020 Ga0307409_100026390 3300031995 Bacteria 4095
1021 Ga0307416_100001658 3300032002 Bacteria 12289
1022 Ga0307416_100026199 3300032002 Bacteria 4292
1023 Ga0307416_100336962 3300032002 Bacteria 1519
1024 Ga0307416_100409201 3300032002 Bacteria 1397
1025 Ga0307416_100481182 3300032002 Bacteria 1301
1026 Ga0307416_100908389 3300032002 Bacteria 981
1027 Ga0307416_101065772 3300032002 Bacteria 912
1028 Ga0307416_101425320 3300032002 Bacteria 798
1029 Ga0307416_102677828 3300032002 Bacteria 596
1030 Ga0307414_10067474 3300032004 Bacteria 2563
1031 Ga0307414_10150781 3300032004 Bacteria 1834
1032 Ga0307414_10911115 3300032004 Bacteria 806
1033 Ga0307414_10927145 3300032004 Bacteria 799
1034 Ga0307411_10371910 3300032005 Bacteria 1172
1035 Ga0307411_10451535 3300032005 Bacteria 1075
1036 Ga0307411_11142972 3300032005 Bacteria 704
1037 Ga0307411_11847637 3300032005 Bacteria 561
1038 Ga0307415_100006170 3300032126 Bacteria 6435
1039 Ga0307507_10076893 3300033179 Bacteria 2973
1040 Ga0307510_10008316 3300033180 Bacteria 12367
1041 Ga0307510_10034217 3300033180 Bacteria 5693
1042 Ga0307510_10109306 3300033180 Bacteria 2514
1043 Ga0307510_10183981 3300033180 Bacteria 1647
1044 Ga0307510_10331298 3300033180 Bacteria 977
1045 Ga0373938_0028174 3300034957 Bacteria 1186
1046 Ga0373926_0193115 3300035083 Bacteria 782
1047 Ga0373934_0185679 3300035086 Bacteria 855
1048 Ga0373923_0459103 3300035111 Bacteria 618
1049 Ga0373960_0174496 3300035121 Bacteria 747
1050 Ga0373943_0031632 3300035170 Bacteria 2512
1051 Ga0373946_0559030 3300035171 Bacteria 591
1052 Ga0373955_0169324 3300035172 Bacteria 1292
1053 Ga0373962_0340453 3300035242 Bacteria 540
1054 Ga0373924_0371622 3300035410 Bacteria 638
1055 Ga0373931_0012403 3300035691 Bacteria 4128
1056 Ga0373931_0331314 3300035691 Bacteria 948
1057 Ga0373935_1451335 3300035692 Bacteria 513
1058 Ga0373933_0871164 3300035724 Bacteria 593
1059 Ga0373933_1020612 3300035724 Bacteria 545
1060 Ga0373947_1244725 3300035725 Bacteria 507
1061 Ga0373937_0031134 3300036401 Bacteria 4831
1062 Ga0373937_0777057 3300036401 Bacteria 905
1063 Ga0373937_0923781 3300036401 Bacteria 821
1064 Ga0373925_0017081 3300037068 Bacteria 5253
1065 Ga0373925_0021911 3300037068 Bacteria 4658
1066 Ga0373925_0367322 3300037068 Bacteria 1170
1067 Ga0373925_0445844 3300037068 Bacteria 1059
1068 Ga0395899_0019534 3300037312 Bacteria 5146
1069 Ga0395900_0000050 3300037418 Bacteria 224616
1070 Ga0395900_0020449 3300037418 Bacteria 6757
1071 Ga0395900_0520696 3300037418 Bacteria 1137
1072 Ga0395898_0005390 3300037466 Bacteria 13826
1073 Ga0395898_0031352 3300037466 Bacteria 5312
1074 Ga0395898_0130946 3300037466 Bacteria 2403
1075 Ga0395898_0705175 3300037466 Bacteria 951
1076 Ga0395905_0000407 3300037471 Bacteria 60417
1077 Ga0395905_0017351 3300037471 Bacteria 6836
1078 Ga0395905_0090493 3300037471 Bacteria 2869
1079 Ga0395905_0132193 3300037471 Bacteria 2347
1080 Ga0395905_0261658 3300037471 Bacteria 1615
1081 Ga0395905_0492816 3300037471 Bacteria 1125
1082 Ga0395905_0709245 3300037471 Bacteria 908
1083 Ga0436364_1532384 3300037853 Bacteria 732
1084 Ga0395901_0128565 3300038443 Bacteria 2663
1085 Ga0395901_1782734 3300038443 Bacteria 565
1086 Ga0436365_0686369 3300039437 Bacteria 831
1087 Ga0436365_0978309 3300039437 Bacteria 4949
1088 Ga0436365_1867544 3300039437 Bacteria 739
1089 Ga0436361_0279495 3300039447 Bacteria 15969
1090 Ga0436363_0541503 3300039450 Bacteria 567
1091 Ga0436363_1358280 3300039450 Bacteria 1308
1092 Ga0439436_0004752 3300041404 Bacteria 4165
1093 Ga0439447_014914 3300041407 Bacteria 2168
1094 Ga0439447_042781 3300041407 Bacteria 1099
1095 Ga0439461_0010217 3300041410 Bacteria 1719
1096 Ga0439466_0010962 3300041411 Bacteria 3360
1097 Ga0439466_0042439 3300041411 Bacteria 1514
1098 Ga0439465_0000881 3300041413 Bacteria 9486
1099 Ga0439465_0023629 3300041413 Bacteria 1935
1100 Ga0451787_830888 3300041441 Bacteria 509
1101 Ga0451789_0500229 3300041443 Bacteria 513
1102 Ga0451791_0220690 3300041451 Bacteria 1479
1103 Ga0451791_1507368 3300041451 Bacteria 570
1104 Ga0451793_1886398 3300041452 Bacteria 611
1105 Ga0451797_0557698 3300041453 Bacteria 726
1106 Ga0451797_1338879 3300041453 Bacteria 1304
1107 Ga0451795_0084962 3300041456 Bacteria 562
1108 Ga0451795_0598759 3300041456 Bacteria 832
1109 Ga0451800_0518005 3300041459 Bacteria 696
1110 Ga0451800_0707869 3300041459 Bacteria 635
1111 Ga0451802_0416253 3300041460 Bacteria 607
1112 Ga0451806_766340 3300041462 Bacteria 1044
1113 Ga0451807_1607480 3300041486 Bacteria 666
1114 Ga0451807_2114126 3300041486 Bacteria 912
1115 Ga0451833_1136626 3300041491 Bacteria 597
1116 Ga0451835_0275592 3300041492 Bacteria 533
1117 Ga0451837_1577029 3300041494 Bacteria 522
1118 Ga0451841_1254413 3300041498 Bacteria 635
1119 Ga0451849_1118628 3300041505 Bacteria 541
1120 Ga0451843_0822940 3300041509 Bacteria 1031
1121 Ga0451855_1979706 3300041511 Bacteria 515
1122 Ga0451853_1115183 3300041512 Bacteria 548
1123 Ga0451853_1898289 3300041512 Bacteria 893
1124 Ga0451853_3246896 3300041512 Bacteria 711
1125 Ga0439431_0000136 3300041997 Bacteria 13215
1126 Ga0439431_0014084 3300041997 Bacteria 1851
1127 Ga0439431_0037407 3300041997 Bacteria 1225
1128 Ga0439433_0000676 3300041999 Bacteria 6577
1129 Ga0439433_0006006 3300041999 Bacteria 2610
1130 Ga0439442_002772 3300042002 Bacteria 3440
1131 Ga0439442_005065 3300042002 Bacteria 2634
1132 Ga0439445_0091426 3300042004 Bacteria 857
1133 Ga0439448_0176933 3300042005 Bacteria 745
1134 Ga0439432_001610 3300042006 Bacteria 8457
1135 Ga0439449_0000231 3300042007 Bacteria 20096
1136 Ga0439449_0001881 3300042007 Bacteria 8268
1137 Ga0439450_048229 3300042008 Bacteria 1005
1138 Ga0439452_001605 3300042010 Bacteria 8930
1139 Ga0439452_036468 3300042010 Bacteria 1177
1140 Ga0439454_008726 3300042011 Bacteria 1301
1141 Ga0439454_045835 3300042011 Bacteria 727
1142 Ga0439457_001194 3300042014 Bacteria 7822
1143 Ga0450911_000302 3300042115 Bacteria 17801
1144 Ga0450919_000922 3300042121 Bacteria 3809
1145 Ga0450921_001267 3300042123 Bacteria 1487
1146 Ga0450921_037348 3300042123 Bacteria 511
1147 Ga0450890_000923 3300042127 Bacteria 4246
1148 Ga0450894_002638 3300042131 Bacteria 2388
1149 Ga0450899_001703 3300042135 Bacteria 2432
1150 Ga0450899_029744 3300042135 Bacteria 661
1151 Ga0450902_095261 3300042137 Bacteria 527
1152 Ga0450910_081130 3300042147 Bacteria 567
1153 Ga0439446_0007098 3300042156 Bacteria 2937
1154 Ga0439446_0089707 3300042156 Bacteria 961
1155 Ga0450908_003584 3300042184 Bacteria 3023
1156 Ga0450909_003671 3300042185 Bacteria 2180
1157 Ga0439434_0002408 3300042435 Bacteria 5436
1158 Ga0439459_0005459 3300042438 Bacteria 2090
1159 Ga0439459_0063772 3300042438 Bacteria 838
1160 Ga0450918_000006 3300042531 Bacteria 48279
1161 Ga0450918_037991 3300042531 Bacteria 860
1162 Ga0450893_0019931 3300042532 Bacteria 1149
1163 Ga0450901_017245 3300042533 Bacteria 764
1164 Ga0451577_0007326 3300042876 Bacteria 10858
1165 Ga0451577_0048478 3300042876 Bacteria 3795
1166 Ga0451577_0292677 3300042876 Bacteria 1476
1167 Ga0451577_0355745 3300042876 Bacteria 1328
1168 Ga0466969_0000169 3300044656 Bacteria 35088
1169 Ga0466969_0005890 3300044656 Bacteria 6515
1170 Ga0466969_0047172 3300044656 Bacteria 2133
1171 Ga0466969_0067295 3300044656 Bacteria 1728
1172 Ga0466972_0036018 3300044658 Bacteria 2422
1173 Ga0466972_0577419 3300044658 Bacteria 531
1174 Ga0453683_0001628 3300044673 Bacteria 18851
1175 Ga0466965_0003093 3300044683 Bacteria 7252
1176 Ga0466965_0090608 3300044683 Bacteria 1555
1177 Ga0466965_0110819 3300044683 Bacteria 1410
1178 Ga0466965_0190954 3300044683 Bacteria 1083
1179 Ga0466965_0888115 3300044683 Bacteria 519
1180 Ga0466966_0011620 3300044684 Bacteria 5836
1181 Ga0466966_0016624 3300044684 Bacteria 4859
1182 Ga0466966_0175567 3300044684 Bacteria 1301
1183 Ga0466966_0313732 3300044684 Bacteria 942
1184 Ga0466961_0011795 3300044693 Bacteria 5585
1185 Ga0466961_0118210 3300044693 Bacteria 1665
1186 Ga0466961_0176095 3300044693 Bacteria 1329
1187 Ga0466963_0009105 3300044694 Bacteria 5967
1188 Ga0466964_0003357 3300044706 Bacteria 5833
1189 Ga0466964_0035719 3300044706 Bacteria 1989
1190 Ga0466964_0608570 3300044706 Bacteria 600
1191 Ga0453684_0229325 3300044712 Bacteria 2145
1192 Ga0453684_0472516 3300044712 Bacteria 1392
1193 Ga0453684_0905336 3300044712 Bacteria 944
1194 Ga0466971_0008205 3300044719 Bacteria 4554
1195 Ga0466971_0060520 3300044719 Bacteria 1711
1196 Ga0466971_0494576 3300044719 Bacteria 603
1197 Ga0466968_0015412 3300044735 Bacteria 3029
1198 Ga0466968_0069704 3300044735 Bacteria 1529
1199 Ga0466968_0745278 3300044735 Bacteria 502
1200 Ga0466970_0019655 3300044765 Bacteria 3503
1201 Ga0466970_0053291 3300044765 Bacteria 2160
1202 Ga0466970_0116179 3300044765 Bacteria 1463
1203 Ga0466970_0258574 3300044765 Bacteria 976
1204 Ga0466970_0460649 3300044765 Bacteria 730
1205 Ga0466957_0015588 3300044842 Bacteria 4438
1206 Ga0466957_0046630 3300044842 Bacteria 2632
1207 Ga0466957_0169164 3300044842 Bacteria 1423
1208 Ga0466957_0246038 3300044842 Bacteria 1188
1209 Ga0466960_0083500 3300044901 Bacteria 1614
1210 Ga0466960_0480915 3300044901 Bacteria 725
1211 Ga0466959_0003436 3300045049 Bacteria 10362
1212 Ga0466959_0042478 3300045049 Bacteria 3353
1213 Ga0466959_0101590 3300045049 Bacteria 2058
1214 Ga0466959_0105241 3300045049 Bacteria 2018
1215 Ga0466959_1149871 3300045049 Bacteria 516
1216 Ga0451576_0003704 3300045051 Bacteria 20672
1217 Ga0451576_0059421 3300045051 Bacteria 3990
1218 Ga0451576_0075029 3300045051 Bacteria 3519
1219 Ga0451576_0167776 3300045051 Bacteria 2291
1220 Ga0451576_0188831 3300045051 Bacteria 2152
1221 Ga0451576_0916681 3300045051 Bacteria 919
1222 Ga0451576_0972046 3300045051 Bacteria 890
1223 Ga0451576_1709068 3300045051 Bacteria 652
1224 Ga0466958_0167147 3300045836 Bacteria 1392
1225 Ga0466958_0523601 3300045836 Bacteria 770
1226 Ga0466958_0587861 3300045836 Bacteria 724
1227 Ga0466967_0043435 3300045976 Bacteria 3891
1228 Ga0495592_0000598 3300046454 Bacteria 25428
1229 Ga0495592_0589439 3300046454 Bacteria 679
1230 Ga0495592_0778426 3300046454 Bacteria 570
1231 Ga0495603_0446196 3300046455 Bacteria 741
1232 Ga0495590_0031721 3300046457 Bacteria 1849
1233 Ga0495590_0393564 3300046457 Bacteria 531
1234 Ga0495629_0222666 3300046459 Bacteria 1301
1235 Ga0495629_0365821 3300046459 Bacteria 982
1236 Ga0495638_0079627 3300046460 Bacteria 1992
1237 Ga0495651_0358253 3300046462 Bacteria 962
1238 Ga0495653_0299606 3300046463 Bacteria 1049
1239 Ga0495650_0003795 3300046471 Bacteria 10769
1240 Ga0495639_0004258 3300046475 Bacteria 6140
1241 Ga0495583_0072689 3300046506 Bacteria 1509
1242 Ga0495606_0089271 3300046507 Bacteria 1899
1243 Ga0495610_0024192 3300046512 Bacteria 3283
1244 Ga0495618_0276927 3300046514 Bacteria 1047
1245 Ga0495628_0567699 3300046516 Bacteria 813
1246 Ga0495630_0815817 3300046517 Bacteria 712
1247 Ga0495631_0081207 3300046518 Bacteria 1399
1248 Ga0495632_0003352 3300046519 Bacteria 11415
1249 Ga0495632_0070387 3300046519 Bacteria 1682
1250 Ga0495632_0080389 3300046519 Bacteria 1555
1251 Ga0495643_0117998 3300046522 Bacteria 1343
1252 Ga0495648_0267697 3300046524 Bacteria 816
1253 Ga0495666_0167164 3300046526 Bacteria 1018
1254 Ga0495642_0081560 3300046528 Bacteria 1363
1255 Ga0495642_0210539 3300046528 Bacteria 848
1256 Ga0495654_0261053 3300046530 Bacteria 718
1257 Ga0495598_0107874 3300046537 Bacteria 930
1258 Ga0495621_0005665 3300046539 Bacteria 3605
1259 Ga0495621_0044127 3300046539 Bacteria 1575
1260 Ga0495621_0298374 3300046539 Bacteria 667
1261 Ga0495597_0154824 3300046542 Bacteria 938
1262 Ga0495645_0153142 3300046543 Bacteria 1600
1263 Ga0495645_0195379 3300046543 Bacteria 1376
1264 Ga0495645_0311315 3300046543 Bacteria 1025
1265 Ga0495622_0062144 3300046557 Bacteria 1729
1266 Ga0495656_0001522 3300046615 Bacteria 7578
1267 Ga0495656_0136040 3300046615 Bacteria 1174
1268 Ga0495625_0002346 3300046660 Bacteria 20658
1269 Ga0495625_0132535 3300046660 Bacteria 1687
1270 Ga0495635_0113007 3300046663 Bacteria 1855
1271 Ga0495635_0855838 3300046663 Bacteria 584
1272 Ga0495659_0107046 3300046664 Bacteria 1089
1273 Ga0495588_0076705 3300046674 Bacteria 1742
1274 Ga0495588_0225367 3300046674 Bacteria 989
1275 Ga0495647_0215742 3300046681 Bacteria 845
1276 Ga0495647_0460918 3300046681 Bacteria 589
1277 Ga0495658_0023952 3300046683 Bacteria 3246
1278 Ga0495658_0029832 3300046683 Bacteria 2956
1279 Ga0495658_0079085 3300046683 Bacteria 1926
1280 Ga0495658_0169388 3300046683 Bacteria 1351
1281 Ga0495658_0173601 3300046683 Bacteria 1335
1282 Ga0495624_0029318 3300046690 Bacteria 3591
1283 Ga0495670_0142672 3300046691 Bacteria 1253
1284 Ga0495671_0118362 3300046692 Bacteria 1293
1285 Ga0495671_0135487 3300046692 Bacteria 1201
1286 Ga0495671_0152235 3300046692 Bacteria 1126
1287 Ga0495671_0280344 3300046692 Bacteria 803
1288 Ga0495649_0010955 3300046694 Bacteria 5340
1289 Ga0495589_0270715 3300046794 Bacteria 791
1290 Ga0495600_0238689 3300046809 Bacteria 1159
1291 Ga0495660_0005806 3300046810 Bacteria 7369
1292 Ga0495660_0222829 3300046810 Bacteria 888
1293 Ga0495674_0777439 3300047319 Bacteria 746
1294 Ga0495676_0280024 3300047321 Bacteria 1129
1295 Ga0495676_0484832 3300047321 Bacteria 813
1296 Ga0495680_0434302 3300047322 Bacteria 901
1297 Ga0495687_007410 3300047443 Bacteria 6462
1298 Ga0495687_011089 3300047443 Bacteria 4875
1299 Ga0495687_012143 3300047443 Bacteria 4572
1300 Ga0495686_0008561 3300047472 Bacteria 7493
1301 Ga0495686_0084169 3300047472 Bacteria 1939
1302 Ga0495593_0019618 3300047673 Bacteria 3790
1303 Ga0495602_0548017 3300048088 Bacteria 802
1304 Ga0495602_0859511 3300048088 Bacteria 606
1305 Ga0495614_0095062 3300048089 Bacteria 1299
1306 Ga0495614_0139265 3300048089 Bacteria 1078
1307 Ga0495615_0021284 3300048090 Bacteria 1462
1308 Ga0495615_0134208 3300048090 Bacteria 726
1309 Ga0495626_0066868 3300048091 Bacteria 1624
1310 Ga0495626_0178981 3300048091 Bacteria 880
1311 Ga0495626_0194746 3300048091 Bacteria 834
1312 Ga0496100_0009445 3300048903 Bacteria 5483
1313 Ga0496100_0278262 3300048903 Bacteria 1247
1314 Ga0496100_0600707 3300048903 Bacteria 854
1315 Ga0496101_0000603 3300048904 Bacteria 21918
1316 Ga0496101_0167019 3300048904 Bacteria 1690
1317 Ga0496101_0353665 3300048904 Bacteria 1155
1318 Ga0496102_0010766 3300048905 Bacteria 7878
1319 Ga0496102_0093120 3300048905 Bacteria 2791
1320 Ga0496102_0128835 3300048905 Bacteria 2367
1321 Ga0496102_0245203 3300048905 Bacteria 1689
1322 Ga0496103_0033763 3300048906 Bacteria 3126
1323 Ga0496104_0022206 3300048907 Bacteria 5828
1324 Ga0496104_0151219 3300048907 Bacteria 2228
1325 Ga0496104_0186315 3300048907 Bacteria 1986
1326 Ga0496104_0610183 3300048907 Bacteria 1001
1327 Ga0496105_0004127 3300048908 Bacteria 10888
1328 Ga0496105_0042258 3300048908 Bacteria 3757
1329 Ga0496106_0020542 3300048909 Bacteria 4903
1330 Ga0496106_0027853 3300048909 Bacteria 4207
1331 Ga0496106_0124740 3300048909 Bacteria 2015
1332 Ga0496107_0075914 3300048910 Bacteria 2447
1333 Ga0496107_0499964 3300048910 Bacteria 902
1334 Ga0496108_0052127 3300048911 Bacteria 3428
1335 Ga0496108_0082967 3300048911 Bacteria 2718
1336 Ga0496108_0085318 3300048911 Bacteria 2680
1337 Ga0496108_0231303 3300048911 Bacteria 1607
1338 Ga0496108_0666636 3300048911 Bacteria 904
1339 Ga0496108_0929454 3300048911 Bacteria 745
1340 Ga0496109_0120241 3300048912 Bacteria 2447
1341 Ga0496109_0271984 3300048912 Bacteria 1596
1342 Ga0496109_0323016 3300048912 Bacteria 1457
1343 Ga0496109_0360780 3300048912 Bacteria 1373
1344 Ga0496109_0831806 3300048912 Bacteria 861
1345 Ga0496109_0978809 3300048912 Bacteria 784
1346 Ga0496110_0115353 3300048913 Bacteria 2418
1347 Ga0496110_0822030 3300048913 Bacteria 834
1348 Ga0496110_0912796 3300048913 Bacteria 784
1349 Ga0496111_0041538 3300048914 Bacteria 3300
1350 Ga0496112_0017021 3300048915 Bacteria 6824
1351 Ga0496112_0408108 3300048915 Bacteria 1298
1352 Ga0496112_1654017 3300048915 Bacteria 553
1353 Ga0496113_0159428 3300048916 Bacteria 1783
1354 Ga0496113_0433996 3300048916 Bacteria 1055
1355 Ga0496114_0020191 3300048917 Bacteria 5406
1356 Ga0496114_0051490 3300048917 Bacteria 3428
1357 Ga0496114_0505729 3300048917 Bacteria 1069
1358 Ga0496114_0664154 3300048917 Bacteria 916
1359 Ga0496114_1114759 3300048917 Bacteria 674
1360 Ga0496115_0214779 3300048918 Bacteria 1588
1361 Ga0496115_0889226 3300048918 Bacteria 687
1362 Ga0496117_0148834 3300048920 Bacteria 1389
1363 Ga0496117_0593552 3300048920 Bacteria 519
1364 Ga0496121_0003789 3300048924 Bacteria 21095
1365 Ga0496121_0012542 3300048924 Bacteria 9224
1366 Ga0496121_0856665 3300048924 Bacteria 528
1367 Ga0496122_0000998 3300048925 Bacteria 50283
1368 Ga0496122_0304754 3300048925 Bacteria 857
1369 Ga0496123_0000045 3300048926 Bacteria 249294
1370 Ga0496123_0070966 3300048926 Bacteria 2176
1371 Ga0496124_0000596 3300048927 Bacteria 60853
1372 Ga0496124_0006265 3300048927 Bacteria 13019
1373 Ga0496124_0081642 3300048927 Bacteria 2656
1374 Ga0496124_0210660 3300048927 Bacteria 1471
1375 Ga0496125_0014698 3300048928 Bacteria 7607
1376 Ga0496125_0017503 3300048928 Bacteria 6828
1377 Ga0496125_0022653 3300048928 Bacteria 5826
1378 Ga0496125_0031594 3300048928 Bacteria 4716
1379 Ga0496126_0131458 3300048929 Bacteria 2162
1380 Ga0496126_0212866 3300048929 Bacteria 1626
1381 Ga0496126_0270030 3300048929 Bacteria 1412
1382 Ga0495682_0233713 3300049460 Bacteria 651
1383 Ga0501043_0000020 3300049579 Bacteria 155270
1384 Ga0501046_0000039 3300049580 Bacteria 155237
1385 Ga0501046_0629822 3300049580 Bacteria 759
1386 Ga0501047_0000028 3300049581 Bacteria 220279
1387 Ga0501047_0282531 3300049581 Bacteria 1504
1388 Ga0501048_0000484 3300049582 Bacteria 27870
1389 Ga0501257_134852 3300049686 Bacteria 671
1390 Ga0501264_016792 3300049761 Bacteria 748
1391 Ga0501035_0224700 3300049822 Bacteria 1602
1392 Ga0501045_0939156 3300049824 Bacteria 635
1393 nmdc:mga03683_230327_c1 3300050489 Bacteria 856
1394 nmdc:mga03683_25205_c1 3300050489 Bacteria 2334
1395 nmdc:mga03683_458355_c1 3300050489 Bacteria 614
1396 nmdc:mga03683_45866_c1 3300050489 Bacteria 1810
1397 nmdc:mga03683_609_c1 3300050489 Bacteria 10290
1398 nmdc:mga03683_8148_c1 3300050489 Bacteria 3671
1399 nmdc:mga03n38_139189_c1 3300050490 Bacteria 1211
1400 nmdc:mga03n38_163148_c1 3300050490 Bacteria 1130
1401 nmdc:mga03n38_164582_c1 3300050490 Bacteria 1125
1402 nmdc:mga03n38_330015_c1 3300050490 Bacteria 826
1403 nmdc:mga03n38_6656_c1 3300050490 Bacteria 4034
1404 nmdc:mga03n38_6905_c1 3300050490 Bacteria 3984
1405 nmdc:mga03n38_7237_c1 3300050490 Bacteria 3916
1406 nmdc:mga03n38_947741_c1 3300050490 Bacteria 508
1407 nmdc:mga00v17_907021_c1 3300050491 Bacteria 558
1408 nmdc:mga00v17_92917_c1 3300050491 Bacteria 1897
1409 nmdc:mga0yw44_205157_c1 3300050492 Bacteria 1303
1410 nmdc:mga0yw44_3930_c1 3300050492 Bacteria 6709
1411 nmdc:mga0yw44_444174_c1 3300050492 Bacteria 879
1412 nmdc:mga0yw44_551800_c1 3300050492 Bacteria 782
1413 nmdc:mga0yw44_587766_c1 3300050492 Bacteria 756
1414 nmdc:mga0k408_106905_c1 3300050493 Bacteria 1653
1415 nmdc:mga0k408_10994_c1 3300050493 Bacteria 4914
1416 nmdc:mga0k408_12667_c1 3300050493 Bacteria 4202
1417 nmdc:mga0k408_1297_c1 3300050493 Bacteria 3992
1418 nmdc:mga0k408_135764_c2 3300050493 Bacteria 1105
1419 nmdc:mga0k408_136693_c1 3300050493 Bacteria 1456
1420 nmdc:mga0k408_157737_c1 3300050493 Bacteria 1352
1421 nmdc:mga0k408_16726_c1 3300050493 Bacteria 4076
1422 nmdc:mga0k408_17400_c1 3300050493 Bacteria 4005
1423 nmdc:mga0k408_254447_c1 3300050493 Bacteria 1049
1424 nmdc:mga0k408_318212_c1 3300050493 Bacteria 928
1425 nmdc:mga0k408_335424_c1 3300050493 Bacteria 902
1426 nmdc:mga0k408_33712_c1 3300050493 Bacteria 2929
1427 nmdc:mga0k408_347893_c1 3300050493 Bacteria 884
1428 nmdc:mga0k408_37821_c1 3300050493 Bacteria 2771
1429 nmdc:mga0k408_396054_c1 3300050493 Bacteria 822
1430 nmdc:mga0k408_4344_c1 3300050493 Bacteria 7530
1431 nmdc:mga0k408_436230_c1 3300050493 Bacteria 778
1432 nmdc:mga0k408_444657_c1 3300050493 Bacteria 770
1433 nmdc:mga0k408_53264_c1 3300050493 Bacteria 2345
1434 nmdc:mga0k408_570015_c1 3300050493 Bacteria 669
1435 nmdc:mga0k408_616034_c1 3300050493 Bacteria 640
1436 nmdc:mga0k408_620946_c1 3300050493 Bacteria 637
1437 nmdc:mga0k408_63717_c1 3300050493 Bacteria 2145
1438 nmdc:mga0k408_77561_c1 3300050493 Bacteria 1943
1439 nmdc:mga0k408_935_c1 3300050493 Bacteria 15996
1440 nmdc:mga06z11_103293_c1 3300050494 Bacteria 1567
1441 nmdc:mga06z11_1427_c1 3300050494 Bacteria 8882
1442 nmdc:mga06z11_145940_c1 3300050494 Bacteria 783
1443 nmdc:mga06z11_165443_c1 3300050494 Bacteria 1267
1444 nmdc:mga06z11_264594_c1 3300050494 Bacteria 1015
1445 nmdc:mga06z11_29430_c1 3300050494 Bacteria 2646
1446 nmdc:mga06z11_46276_c1 3300050494 Bacteria 2204
1447 nmdc:mga06z11_693691_c1 3300050494 Bacteria 620
1448 nmdc:mga04h51_109356_c1 3300050495 Bacteria 1017
1449 nmdc:mga04h51_11196_c1 3300050495 Bacteria 2484
1450 nmdc:mga04h51_220977_c1 3300050495 Bacteria 751
1451 nmdc:mga04h51_41362_c1 3300050495 Bacteria 1506
1452 nmdc:mga04h51_49843_c1 3300050495 Bacteria 1401
1453 nmdc:mga07m45_231369_c1 3300050496 Bacteria 1076
1454 nmdc:mga07m45_23824_c1 3300050496 Bacteria 3348
1455 nmdc:mga07m45_24323_c1 3300050496 Bacteria 3316
1456 nmdc:mga07m45_277825_c1 3300050496 Bacteria 974
1457 nmdc:mga07m45_30562_c1 3300050496 Bacteria 2984
1458 nmdc:mga07m45_312026_c1 3300050496 Bacteria 914
1459 nmdc:mga07m45_33638_c1 3300050496 Bacteria 2848
1460 nmdc:mga07m45_355_c1 3300050496 Bacteria 18707
1461 nmdc:mga07m45_43921_c1 3300050496 Bacteria 2507
1462 nmdc:mga07m45_44702_c1 3300050496 Bacteria 2486
1463 nmdc:mga07m45_52189_c1 3300050496 Bacteria 2308
1464 nmdc:mga07m45_553667_c1 3300050496 Bacteria 665
1465 nmdc:mga07m45_58954_c1 3300050496 Bacteria 2172
1466 nmdc:mga07m45_75397_c1 3300050496 Bacteria 1922
1467 nmdc:mga07m45_9617_c1 3300050496 Bacteria 5024
1468 nmdc:mga05p37_1533142_c1 3300050507 Bacteria 661
1469 nmdc:mga08y16_1193187_c1 3300050511 Bacteria 732
1470 nmdc:mga0n895_646864_c1 3300050512 Bacteria 1056
1471 nmdc:mga0rr50_88694_c1 3300050513 Bacteria 2403
1472 nmdc:mga0a205_361369_c1 3300050515 Bacteria 1318
1473 Ga0495601_0211148 3300053077 Bacteria 1268
1474 Ga0495601_0616831 3300053077 Bacteria 695
1475 Ga0495612_0121501 3300053078 Bacteria 1124
1476 Ga0495619_0112224 3300053085 Bacteria 1864
1477 Ga0495619_0535573 3300053085 Bacteria 804
1478 Ga0500578_0000079 3300053086 Bacteria 107137
1479 Ga0500578_0060596 3300053086 Bacteria 2417
1480 Ga0500578_0755318 3300053086 Bacteria 518
1481 Ga0500644_0135926 3300053088 Bacteria 972
1482 Ga0500646_0015569 3300053090 Bacteria 1982
1483 Ga0500646_0022185 3300053090 Bacteria 1697
1484 Ga0500651_0036349 3300053093 Bacteria 3103
1485 Ga0500651_0482079 3300053093 Bacteria 686
1486 Ga0500651_0743272 3300053093 Bacteria 521
1487 Ga0500594_0002669 3300053118 Bacteria 3878
1488 Ga0500594_0012360 3300053118 Bacteria 2010
1489 Ga0500607_346407 3300053121 Bacteria 516
1490 Ga0500618_043335 3300053125 Bacteria 1029
1491 Ga0500621_075493 3300053126 Bacteria 1356
1492 Ga0500623_147597 3300053127 Bacteria 974
1493 Ga0500658_0010178 3300053134 Bacteria 3467
1494 Ga0500658_0021949 3300053134 Bacteria 2421
1495 Ga0500559_0000128 3300053136 Bacteria 58877
1496 Ga0500559_0004716 3300053136 Bacteria 6416
1497 Ga0500559_0028097 3300053136 Bacteria 2402
1498 Ga0500568_0006808 3300053139 Bacteria 5696
1499 Ga0500568_0181002 3300053139 Bacteria 775
1500 Ga0500619_000016 3300053154 Bacteria 54289
1501 Ga0500622_0000053 3300053156 Bacteria 145070
1502 Ga0500622_0000347 3300053156 Bacteria 45247
1503 Ga0500567_178793 3300053723 Bacteria 744
1504 Ga0500570_066850 3300053724 Bacteria 1703
1505 Ga0500587_000682 3300053739 Bacteria 4320
1506 Ga0500587_000706 3300053739 Bacteria 4266
1507 Ga0590071_082287 3300059421 Bacteria 801
1508 Ga0466962_0215036 3300061719 Bacteria 940
1509 Ga0466962_0223356 3300061719 Bacteria 923
1510 2587759304 2585428062 Bacteria 6842168
1511 2643972274 2643221592 Bacteria 6608788
1512 2644141615 2643221625 Bacteria 6512927
1513 2644275614 2643221648 Bacteria 6521465
1514 2644302872 2643221654 Bacteria 5273570
1515 2644341016 2643221660 Bacteria 4208257
1516 2739248173 2738543013 Bacteria 5618633
1517 2842734314 2842733646 Bacteria 5716726
1518 2842749435 2842747753 Bacteria 5578255
1519 2881105458 2881101125 Bacteria 4590519
1520 2904483482 2904479285 Bacteria 5073931
1521 Ga0075370_10729472
1522 rootH1_10010129
1523 rootH2_10039438
1524 rootH2_10043347
1525 rootL2_10013481
1526 rootL2_10026887
1527 rootH1_10044193
1528 rootH1_10044196
1529 rootH1_10161445
1530 Ga0055525_1000004
1531 Ga0055524_1003998
1532 Ga0055530_10005573
1533 Ga0055530_10034370
1534 Ga0055530_10066829
1535 Ga0055540_1000001
1536 Ga0055540_1023341
1537 Ga0055540_1030847
1538 Ga0055531_10000730
1539 Ga0055531_10002938
1540 Ga0055531_10012364
1541 Ga0055531_10015992
1542 Ga0055531_10065451
1543 Ga0055543_1004765
1544 Ga0065165_1000016
1545 Ga0065165_1030189
1546 Ga0065165_1042849
1547 Ga0065704_10470195
1548 Ga0065715_10384956
1549 Ga0065715_10786722
1550 Ga0065707_10602331
1551 Ga0065707_10765415
1552 Ga0070658_10514254
1553 Ga0070676_10012789
1554 Ga0070676_10021065
1555 Ga0070676_10022439
1556 Ga0070676_10071093
1557 Ga0070676_10099440
1558 Ga0070676_10121342
1559 Ga0070676_10144140
1560 Ga0070676_10736202
1561 Ga0070676_10807474
1562 Ga0070676_11366954
1563 Ga0070683_100186556
1564 Ga0070690_100010179
1565 Ga0070690_101072455
1566 Ga0070670_100003220
1567 Ga0070670_100008161
1568 Ga0070670_100057570
1569 Ga0070670_100101782
1570 Ga0070670_100107001
1571 Ga0070670_100174034
1572 Ga0070670_100240883
1573 Ga0070670_100312486
1574 Ga0070670_100332533
1575 Ga0070670_100373467
1576 Ga0070670_100525826
1577 Ga0070677_10004653
1578 Ga0070677_10014642
1579 Ga0070677_10016371
1580 Ga0070677_10036642
1581 Ga0070677_10061088
1582 Ga0070677_10074467
1583 Ga0070677_10132128
1584 Ga0070677_10149801
1585 Ga0068869_100006018
1586 Ga0068869_100009303
1587 Ga0068869_100066966
1588 Ga0068869_100068467
1589 Ga0068869_100076582
1590 Ga0068869_100164474
1591 Ga0068869_101003464
1592 Ga0068869_101042123
1593 Ga0070666_10005842
1594 Ga0070666_10023270
1595 Ga0070666_10387518
1596 Ga0070666_10746725
1597 Ga0070680_100478267
1598 Ga0070680_100563978
1599 Ga0070682_100870299
1600 Ga0068868_100025650
1601 Ga0068868_100044655
1602 Ga0068868_100050975
1603 Ga0068868_100053875
1604 Ga0068868_100239582
1605 Ga0068868_100372618
1606 Ga0070660_100055247
1607 Ga0070660_100073646
1608 Ga0070660_100277980
1609 Ga0070689_100054759
1610 Ga0070691_10089834
1611 Ga0070661_100091319
1612 Ga0070661_100473966
1613 Ga0070661_100511107
1614 Ga0070692_10586297
1615 Ga0070668_100011100
1616 Ga0070668_100038204
1617 Ga0070668_100039496
1618 Ga0070668_100080198
1619 Ga0070668_101174531
1620 Ga0070669_100008914
1621 Ga0070669_100129958
1622 Ga0070669_100235220
1623 Ga0070669_100306913
1624 Ga0070669_100369101
1625 Ga0070669_100413664
1626 Ga0070669_100511489
1627 Ga0070669_100763692
1628 Ga0070675_100001865
1629 Ga0070675_100004779
1630 Ga0070675_100010417
1631 Ga0070675_100011548
1632 Ga0070675_100017314
1633 Ga0070675_100025466
1634 Ga0070675_100117455
1635 Ga0070675_100185939
1636 Ga0070675_100478502
1637 Ga0070675_100520689
1638 Ga0070675_100601051
1639 Ga0070671_100008478
1640 Ga0070671_100012328
1641 Ga0070671_100035021
1642 Ga0070671_100044632
1643 Ga0070671_100072731
1644 Ga0070671_100114652
1645 Ga0070671_100450904
1646 Ga0070671_100540394
1647 Ga0070671_100942887
1648 Ga0070671_101079295
1649 Ga0070674_100004964
1650 Ga0070674_100023906
1651 Ga0070674_100058113
1652 Ga0070674_100086860
1653 Ga0070674_100106645
1654 Ga0070674_100151955
1655 Ga0070674_100174927
1656 Ga0070674_100449500
1657 Ga0070673_100007810
1658 Ga0070673_100034667
1659 Ga0070673_100048394
1660 Ga0070673_100050422
1661 Ga0070673_100257087
1662 Ga0070673_100349150
1663 Ga0070673_100542472
1664 Ga0070673_101388204
1665 Ga0070688_100486364
1666 Ga0070659_100005335
1667 Ga0070659_100207367
1668 Ga0070667_100002053
1669 Ga0070667_100015048
1670 Ga0070667_100016760
1671 Ga0070667_100039535
1672 Ga0070667_100042339
1673 Ga0070667_100319074
1674 Ga0070667_100341779
1675 Ga0070667_101207418
1676 Ga0070667_101264923
1677 Ga0070667_101659328
1678 Ga0070705_101325848
1679 Ga0070700_100258326
1680 Ga0070708_100520446
1681 Ga0070663_100037006
1682 Ga0070663_100049975
1683 Ga0070663_100098399
1684 Ga0070663_100193777
1685 Ga0070663_100219994
1686 Ga0070663_100229848
1687 Ga0070663_100261169
1688 Ga0070663_100705700
1689 Ga0070678_100035116
1690 Ga0070678_100060993
1691 Ga0070678_100067178
1692 Ga0070678_100085234
1693 Ga0070678_100092856
1694 Ga0070678_100102135
1695 Ga0070678_100223660
1696 Ga0070678_100259381
1697 Ga0070678_100302576
1698 Ga0070678_100440511
1699 Ga0070678_100593525
1700 Ga0070678_100690436
1701 Ga0070678_100691420
1702 Ga0070662_100012119
1703 Ga0070662_100012323
1704 Ga0070662_100028919
1705 Ga0070662_100207991
1706 Ga0070662_100262001
1707 Ga0070662_100690746
1708 Ga0070681_10422995
1709 Ga0068867_100003434
1710 Ga0068867_100006721
1711 Ga0068867_100020479
1712 Ga0068867_100043063
1713 Ga0068867_100046830
1714 Ga0068867_100085295
1715 Ga0068867_100141831
1716 Ga0068867_100270551
1717 Ga0068867_100511712
1718 Ga0068867_100529327
1719 Ga0068867_100577095
1720 Ga0068867_100728608
1721 Ga0068867_101252423
1722 Ga0068867_101751015
1723 Ga0070685_10973434
1724 Ga0070706_100016764
1725 Ga0070706_100864366
1726 Ga0070698_100084012
1727 Ga0070679_100042059
1728 Ga0070684_100124826
1729 Ga0070684_102177369
1730 Ga0068853_100056523
1731 Ga0068853_100101997
1732 Ga0068853_100109430
1733 Ga0068853_100954154
1734 Ga0068853_101218879
1735 Ga0068853_101554761
1736 Ga0070672_100001038
1737 Ga0070672_100002031
1738 Ga0070672_100007063
1739 Ga0070672_100010437
1740 Ga0070672_100052288
1741 Ga0070672_100080388
1742 Ga0070672_100101071
1743 Ga0070672_100174069
1744 Ga0070672_100214114
1745 Ga0070672_100380331
1746 Ga0070672_100438759
1747 Ga0070672_101358460
1748 Ga0070686_100378076
1749 Ga0070693_100060705
1750 Ga0070693_100289674
1751 Ga0070665_100463074
1752 Ga0070665_100632979
1753 Ga0070665_101366806
1754 Ga0068855_100048944
1755 Ga0068855_100963948
1756 Ga0068855_101691164
1757 Ga0070664_100025177
1758 Ga0070664_100128859
1759 Ga0070664_100221638
1760 Ga0070664_100428714
1761 Ga0070664_100815717
1762 Ga0070664_101072872
1763 Ga0068857_100107336
1764 Ga0068857_100190966
1765 Ga0068857_100614579
1766 Ga0068857_100994918
1767 Ga0068854_100025152
1768 Ga0068854_100035781
1769 Ga0068854_100043140
1770 Ga0068854_100695447
1771 Ga0068854_100760197
1772 Ga0068856_100164041
1773 Ga0068856_100221898
1774 Ga0070702_100013522
1775 Ga0070702_100893751
1776 Ga0068852_100017004
1777 Ga0068852_100037453
1778 Ga0068852_100108424
1779 Ga0068852_100138911
1780 Ga0068852_100390209
1781 Ga0068852_100408483
1782 Ga0068852_100560713
1783 Ga0068852_100668034
1784 Ga0068852_101061037
1785 Ga0068852_101810053
1786 Ga0068852_102237965
1787 Ga0068859_100204443
1788 Ga0068859_100413546
1789 Ga0068859_100707430
1790 Ga0068859_101427336
1791 Ga0068864_100009971
1792 Ga0068864_100020710
1793 Ga0068864_100032590
1794 Ga0068864_100045557
1795 Ga0068864_100055582
1796 Ga0068864_100076344
1797 Ga0068864_100456948
1798 Ga0068864_100572644
1799 Ga0068864_101122244
1800 Ga0068864_101291798
1801 Ga0068864_101839600
1802 Ga0068866_10002843
1803 Ga0068861_100001754
1804 Ga0068861_100043521
1805 Ga0068861_100089193
1806 Ga0068861_102070570
1807 Ga0068851_10019767
1808 Ga0068851_10117892
1809 Ga0068851_10140806
1810 Ga0068851_10390952
1811 Ga0068870_10046087
1812 Ga0068870_10065329
1813 Ga0068870_10180092
1814 Ga0068870_10602106
1815 Ga0068863_100008147
1816 Ga0068863_100020787
1817 Ga0068863_100071501
1818 Ga0068863_100104364
1819 Ga0068863_100182433
1820 Ga0068863_100203348
1821 Ga0068863_100351701
1822 Ga0068863_100354544
1823 Ga0068863_100603337
1824 Ga0068858_100024249
1825 Ga0068858_100029185
1826 Ga0068858_100032464
1827 Ga0068858_100035860
1828 Ga0068858_100136571
1829 Ga0068858_100556081
1830 Ga0068858_101960431
1831 Ga0068860_100010210
1832 Ga0068860_100012046
1833 Ga0068860_100020052
1834 Ga0068860_100147011
1835 Ga0068860_100173567
1836 Ga0068860_100662478
1837 Ga0068860_101521563
1838 Ga0068862_100018209
1839 Ga0068862_100075506
1840 Ga0068862_100463582
1841 Ga0068862_100526899
1842 Ga0068862_102413030
1843 Ga0075365_10045821
1844 Ga0075365_10050774
1845 Ga0075365_10376216
1846 Ga0075365_10499449
1847 Ga0075365_10598215
1848 Ga0075368_10004315
1849 Ga0075368_10005763
1850 Ga0075368_10005874
1851 Ga0075368_10037262
1852 Ga0075368_10225068
1853 Ga0075368_10475449
1854 Ga0075363_100009000
1855 Ga0075363_100029084
1856 Ga0075363_100046125
1857 Ga0075363_100073619
1858 Ga0075363_100177915
1859 Ga0075363_100198374
1860 Ga0075363_100254853
1861 Ga0075363_100468302
1862 Ga0075364_10006775
1863 Ga0075364_10063712
1864 Ga0075362_10010920
1865 Ga0075362_10015345
1866 Ga0075362_10028345
1867 Ga0075362_10035774
1868 Ga0075362_10048964
1869 Ga0075362_10162200
1870 Ga0075367_10010036
1871 Ga0075367_10013686
1872 Ga0075367_10018851
1873 Ga0075367_10286244
1874 Ga0075367_10980424
1875 Ga0075369_10031398
1876 Ga0075369_10081032
1877 Ga0075366_10004389
1878 Ga0075366_10006193
1879 Ga0075366_10020276
1880 Ga0075366_10021908
1881 Ga0075366_10027485
1882 Ga0075366_10032058
1883 Ga0075366_10038291
1884 Ga0075366_10041096
1885 Ga0075366_10066259
1886 Ga0075366_10067942
1887 Ga0075366_10080306
1888 Ga0075366_10110296
1889 Ga0075366_10205748
1890 Ga0075366_10212009
1891 Ga0075366_10373179
1892 Ga0075366_10931422
1893 Ga0097621_100024414
1894 Ga0097621_100041515
1895 Ga0097621_100048189
1896 Ga0097621_100303567
1897 Ga0097621_100657890
1898 Ga0097621_100861690
1899 Ga0075370_10002177
1900 Ga0075370_10006689
1901 Ga0075370_10013105
1902 Ga0075370_10015981
1903 Ga0075370_10016103
1904 Ga0075370_10045271
1905 Ga0075370_10074890
1906 Ga0075370_10959655
1907 Ga0075370_11011526
1908 Ga0068871_100003964
1909 Ga0068871_100005973
1910 Ga0068871_100006732
1911 Ga0068871_100050006
1912 Ga0068871_100294081
1913 Ga0068871_100785498
1914 Ga0068871_101166639
1915 Ga0068871_101570543
1916 Ga0068865_100015793
1917 Ga0068865_100051731
1918 Ga0068865_100111950
1919 Ga0068865_100145309
1920 Ga0097620_100204432
1921 Ga0097620_100413511
1922 Ga0097620_100707473
1923 Ga0097620_101427276
1924 Ga0099823_1000021
1925 Ga0079104_1000001
1926 Ga0105251_10356287
1927 Ga0105244_10042239
1928 Ga0105240_10060597
1929 Ga0105240_10148546
1930 Ga0105240_11306551
1931 Ga0111539_10257504
1932 Ga0111539_10422133
1933 Ga0105245_10123515
1934 Ga0105245_10226069
1935 Ga0105245_10405021
1936 Ga0105245_10482268
1937 Ga0105245_10493458
1938 Ga0105245_11221919
1939 Ga0105247_10792092
1940 Ga0105243_10037064
1941 Ga0105243_10109870
1942 Ga0105243_10171815
1943 Ga0105243_10651208
1944 Ga0105243_10825827
1945 Ga0105243_12073248
1946 Ga0105241_10344731
1947 Ga0105241_11343903
1948 Ga0105241_11969803
1949 Ga0105242_10006564
1950 Ga0105242_10594298
1951 Ga0105242_10915127
1952 Ga0105242_11441553
1953 Ga0105242_11715097
1954 Ga0105248_10000563
1955 Ga0105248_10010877
1956 Ga0105248_10035875
1957 Ga0105248_10201577
1958 Ga0105248_10495712
1959 Ga0105248_10605778
1960 Ga0105248_10756754
1961 Ga0105248_11189445
1962 Ga0105248_11555976
1963 Ga0105248_11952920
1964 Ga0105248_12597160
1965 Ga0105237_10341269
1966 Ga0105237_10496657
1967 Ga0105238_10038345
1968 Ga0105238_11305587
1969 Ga0105238_12209097
1970 Ga0105249_10059930
1971 Ga0105249_10245727
1972 Ga0105249_11490389
1973 Ga0105249_12198012
1974 Ga0105249_12232673
1975 Ga0105239_10177521
1976 Ga0105239_11003670
1977 Ga0105239_11496177
1978 Ga0105246_10335557
1979 Ga0157319_1000008
1980 Ga0157326_1033884
1981 Ga0157371_10065465
1982 Ga0157370_10089028
1983 Ga0157370_10358210
1984 Ga0157369_10202627
1985 Ga0157369_10381857
1986 Ga0157369_11180845
1987 Ga0157374_10012674
1988 Ga0157374_10086676
1989 Ga0157374_10104497
1990 Ga0157374_10259805
1991 Ga0157374_10332302
1992 Ga0157374_10947951
1993 Ga0157374_11209671
1994 Ga0157374_11762539
1995 Ga0157374_12158449
1996 Ga0157378_10070169
1997 Ga0157378_10076073
1998 Ga0157378_11039385
1999 Ga0157378_11261019
2000 Ga0157378_12583705
2001 Ga0163162_10006190
2002 Ga0163162_10009814
2003 Ga0163162_10015375
2004 Ga0163162_10015380
2005 Ga0163162_10072420
2006 Ga0163162_10162788
2007 Ga0163162_10181209
2008 Ga0163162_10393855
2009 Ga0163162_11814556
2010 Ga0157372_10075427
2011 Ga0157372_10277248
2012 Ga0157372_10358459
2013 Ga0157375_10002731
2014 Ga0157375_10039310
2015 Ga0157375_10062939
2016 Ga0157375_10093843
2017 Ga0157375_10121655
2018 Ga0157375_10262258
2019 Ga0157375_10426748
2020 Ga0157375_12238112
2021 Ga0157375_12512370
2022 Ga0157375_12632520
2023 Ga0163163_10037474
2024 Ga0163163_10180996
2025 Ga0163163_10288535
2026 Ga0163163_10452574
2027 Ga0163163_10453007
2028 Ga0163163_10458485
2029 Ga0163163_10855292
2030 Ga0163163_11116307
2031 Ga0163163_12445687
2032 Ga0157380_10012326
2033 Ga0157380_10047810
2034 Ga0157380_10158031
2035 Ga0157380_10221504
2036 Ga0157380_10506804
2037 Ga0157380_10597499
2038 Ga0157380_10712750
2039 Ga0157380_10880485
2040 Ga0182008_10009910
2041 Ga0182008_10322186
2042 Ga0182008_10343772
2043 Ga0182008_10518892
2044 Ga0157377_10002823
2045 Ga0157377_10188773
2046 Ga0157377_10201891
2047 Ga0157379_10022800
2048 Ga0157379_10030462
2049 Ga0157379_10043791
2050 Ga0157379_10046178
2051 Ga0157379_10140733
2052 Ga0157379_10278218
2053 Ga0157379_10356949
2054 Ga0157379_10374875
2055 Ga0157379_10620088
2056 Ga0157379_10704423
2057 Ga0157379_10722747
2058 Ga0157379_11002017
2059 Ga0157379_11294626
2060 Ga0157376_10010115
2061 Ga0157376_10015391
2062 Ga0157376_10117781
2063 Ga0157376_10160682
2064 Ga0157376_10164684
2065 Ga0157376_10259272
2066 Ga0157376_10305566
2067 Ga0157376_10402674
2068 Ga0157376_10825888
2069 Ga0157376_11189322
2070 Ga0157376_11453668
2071 Ga0157376_11935598
2072 Ga0157376_11947120
2073 Ga0182007_10007788
2074 Ga0182007_10105205
2075 Ga0182007_10182845
2076 Ga0182005_1065665
2077 Ga0183362_10001
2078 Ga0163161_10017287
2079 Ga0163161_10027884
2080 Ga0163161_10044555
2081 Ga0163161_10082389
2082 Ga0163161_10133272
2083 Ga0163161_10177024
2084 Ga0163161_10395836
2085 Ga0163161_10404016
2086 Ga0163161_10475519
2087 Ga0163161_10718575
2088 Ga0163161_11752938
2089 Ga0163161_11967308
2090 Ga0209563_100013
2091 Ga0209565_1030525
2092 Ga0207666_1026630
2093 Ga0209673_1011533
2094 Ga0209673_1018659
2095 Ga0209673_1041812
2096 Ga0209673_1050438
2097 Ga0209130_1013707
2098 Ga0209675_1003161
2099 Ga0209676_1013656
2100 Ga0209025_1040474
2101 Ga0209050_1000118
2102 Ga0209050_1000934
2103 Ga0209050_1002768
2104 Ga0209050_1010184
2105 Ga0209050_1017089
2106 Ga0209256_1000015
2107 Ga0209256_1001723
2108 Ga0209256_1001935
2109 Ga0209051_1000018
2110 Ga0209051_1000244
2111 Ga0209051_1002679
2112 Ga0209051_1010982
2113 Ga0209051_1017158
2114 Ga0209257_1000084
2115 Ga0209257_1000144
2116 Ga0209257_1005717
2117 Ga0209257_1012179
2118 Ga0207697_10058485
2119 Ga0207697_10075593
2120 Ga0207697_10404887
2121 Ga0207656_10015851
2122 Ga0207656_10032599
2123 Ga0207656_10190419
2124 Ga0207656_10260518
2125 Ga0207682_10009133
2126 Ga0207682_10009199
2127 Ga0207682_10060510
2128 Ga0207682_10097241
2129 Ga0207682_10158600
2130 Ga0207682_10213332
2131 Ga0207642_10004772
2132 Ga0207688_10053063
2133 Ga0207688_10077532
2134 Ga0207688_10333193
2135 Ga0207680_10045362
2136 Ga0207680_10126990
2137 Ga0207680_10694631
2138 Ga0207645_10003842
2139 Ga0207645_10007638
2140 Ga0207645_10011283
2141 Ga0207645_10023842
2142 Ga0207645_10055716
2143 Ga0207645_10098649
2144 Ga0207645_10110245
2145 Ga0207645_10124920
2146 Ga0207645_10154385
2147 Ga0207645_10434810
2148 Ga0207645_10514106
2149 Ga0207645_10778436
2150 Ga0207643_10050988
2151 Ga0207643_10065217
2152 Ga0207643_10094724
2153 Ga0207643_10147137
2154 Ga0207643_10402662
2155 Ga0207705_10122504
2156 Ga0207705_10517026
2157 Ga0207705_10818856
2158 Ga0207705_10897859
2159 Ga0207705_10972720
2160 Ga0207705_11432990
2161 Ga0207684_10805431
2162 Ga0207654_10072257
2163 Ga0207654_10191515
2164 Ga0207707_10122228
2165 Ga0207707_10254640
2166 Ga0207695_10402094
2167 Ga0207695_10403020
2168 Ga0207695_10721763
2169 Ga0207671_11329844
2170 Ga0207660_10071448
2171 Ga0207660_10415621
2172 Ga0207662_10002309
2173 Ga0207657_10017805
2174 Ga0207657_10053780
2175 Ga0207657_10278411
2176 Ga0207649_10065775
2177 Ga0207649_10580582
2178 Ga0207652_10539076
2179 Ga0207652_10654276
2180 Ga0207681_10004142
2181 Ga0207681_10007931
2182 Ga0207681_10031186
2183 Ga0207681_10144617
2184 Ga0207681_10195247
2185 Ga0207681_10366751
2186 Ga0207681_10411250
2187 Ga0207681_10495284
2188 Ga0207694_10128368
2189 Ga0207694_10269272
2190 Ga0207694_10736555
2191 Ga0207650_10000587
2192 Ga0207650_10003249
2193 Ga0207650_10059716
2194 Ga0207650_10099348
2195 Ga0207650_10121601
2196 Ga0207650_10132962
2197 Ga0207650_10175603
2198 Ga0207650_10366378
2199 Ga0207650_10422154
2200 Ga0207650_10552479
2201 Ga0207659_10000861
2202 Ga0207659_10005359
2203 Ga0207659_10009237
2204 Ga0207659_10038145
2205 Ga0207659_10099297
2206 Ga0207659_10123971
2207 Ga0207659_10439678
2208 Ga0207659_10555689
2209 Ga0207659_10585031
2210 Ga0207659_11484244
2211 Ga0207687_10162880
2212 Ga0207687_10275702
2213 Ga0207687_10413778
2214 Ga0207687_11283606
2215 Ga0207644_10001574
2216 Ga0207644_10015626
2217 Ga0207644_10024816
2218 Ga0207644_10027140
2219 Ga0207644_10042686
2220 Ga0207644_10057128
2221 Ga0207644_10082148
2222 Ga0207644_10173111
2223 Ga0207644_10309822
2224 Ga0207690_10018071
2225 Ga0207690_10206944
2226 Ga0207690_10310583
2227 Ga0207706_10004316
2228 Ga0207706_10006686
2229 Ga0207706_10044702
2230 Ga0207706_10067354
2231 Ga0207706_10076876
2232 Ga0207706_10106205
2233 Ga0207706_10363273
2234 Ga0207706_10380176
2235 Ga0207706_10481419
2236 Ga0207706_11015684
2237 Ga0207686_10050077
2238 Ga0207686_10149227
2239 Ga0207686_11380962
2240 Ga0207709_10020180
2241 Ga0207709_10032365
2242 Ga0207709_10157944
2243 Ga0207709_10186615
2244 Ga0207709_10357219
2245 Ga0207670_10305359
2246 Ga0207669_10004732
2247 Ga0207669_10022825
2248 Ga0207669_10029113
2249 Ga0207669_10224939
2250 Ga0207669_10703851
2251 Ga0207669_10708264
2252 Ga0207669_10776976
2253 Ga0207669_10881573
2254 Ga0207704_10023865
2255 Ga0207704_10026882
2256 Ga0207704_10054952
2257 Ga0207704_10203998
2258 Ga0207665_11425115
2259 Ga0207691_10001498
2260 Ga0207691_10006932
2261 Ga0207691_10007996
2262 Ga0207691_10036430
2263 Ga0207691_10056404
2264 Ga0207691_10180077
2265 Ga0207691_10192637
2266 Ga0207691_10214199
2267 Ga0207691_10247986
2268 Ga0207691_10426770
2269 Ga0207691_10494497
2270 Ga0207711_10016383
2271 Ga0207711_10049043
2272 Ga0207711_10061315
2273 Ga0207711_10069139
2274 Ga0207711_10085801
2275 Ga0207711_10496351
2276 Ga0207711_10543301
2277 Ga0207711_10640907
2278 Ga0207711_10890358
2279 Ga0207689_10007087
2280 Ga0207689_10009559
2281 Ga0207689_10013353
2282 Ga0207689_10023269
2283 Ga0207689_10069220
2284 Ga0207689_10080406
2285 Ga0207689_10937593
2286 Ga0207689_10960194
2287 Ga0207689_11022507
2288 Ga0207689_11518898
2289 Ga0207661_10081303
2290 Ga0207679_10040394
2291 Ga0207679_10146320
2292 Ga0207679_10257812
2293 Ga0207679_10280104
2294 Ga0207679_10286151
2295 Ga0207679_10953654
2296 Ga0207679_11143793
2297 Ga0207679_11586993
2298 Ga0207679_11704485
2299 Ga0207667_10031271
2300 Ga0207667_10170872
2301 Ga0207667_10174518
2302 Ga0207667_10310612
2303 Ga0207651_10011230
2304 Ga0207651_10040675
2305 Ga0207651_10094594
2306 Ga0207651_10181003
2307 Ga0207651_10601363
2308 Ga0207651_10759426
2309 Ga0207651_10939867
2310 Ga0207651_11096387
2311 Ga0207712_10004623
2312 Ga0207712_10150548
2313 Ga0207712_11420224
2314 Ga0207668_10018589
2315 Ga0207668_10029872
2316 Ga0207668_10039383
2317 Ga0207668_10247822
2318 Ga0207640_10014714
2319 Ga0207640_10026671
2320 Ga0207640_11621072
2321 Ga0207658_10003013
2322 Ga0207658_10003655
2323 Ga0207658_10027918
2324 Ga0207658_10033970
2325 Ga0207658_10035280
2326 Ga0207658_10179272
2327 Ga0207658_10374645
2328 Ga0207658_10471333
2329 Ga0207658_10536830
2330 Ga0207658_10608569
2331 Ga0207658_10627106
2332 Ga0207658_10916193
2333 Ga0207658_11567446
2334 Ga0207677_10055234
2335 Ga0207677_10076814
2336 Ga0207677_10085727
2337 Ga0207677_10347322
2338 Ga0207677_10367818
2339 Ga0207677_10637998
2340 Ga0207703_10004035
2341 Ga0207703_10014712
2342 Ga0207703_10022609
2343 Ga0207703_10227598
2344 Ga0207703_10557327
2345 Ga0207639_10056806
2346 Ga0207639_10165295
2347 Ga0207639_10397750
2348 Ga0207639_10413200
2349 Ga0207639_10487040
2350 Ga0207639_10949822
2351 Ga0207639_11166013
2352 Ga0207678_10006013
2353 Ga0207678_10157724
2354 Ga0207678_10176045
2355 Ga0207678_10193669
2356 Ga0207678_10294669
2357 Ga0207678_10320970
2358 Ga0207678_10336654
2359 Ga0207708_10179176
2360 Ga0207708_10260705
2361 Ga0207702_10212209
2362 Ga0207702_10355937
2363 Ga0207702_10526742
2364 Ga0207641_10004568
2365 Ga0207641_10015586
2366 Ga0207641_10031300
2367 Ga0207641_10037683
2368 Ga0207641_10164400
2369 Ga0207641_10191199
2370 Ga0207641_10304109
2371 Ga0207641_10474718
2372 Ga0207641_11583593
2373 Ga0207641_12231683
2374 Ga0207648_10000823
2375 Ga0207648_10002295
2376 Ga0207648_10012908
2377 Ga0207648_10015894
2378 Ga0207648_10056196
2379 Ga0207648_10061050
2380 Ga0207648_10074405
2381 Ga0207648_10284410
2382 Ga0207648_10752882
2383 Ga0207676_10008687
2384 Ga0207676_10015345
2385 Ga0207676_10043099
2386 Ga0207676_10069679
2387 Ga0207676_10070418
2388 Ga0207676_10076797
2389 Ga0207676_10084831
2390 Ga0207676_10143746
2391 Ga0207676_10507279
2392 Ga0207674_10072476
2393 Ga0207674_10078380
2394 Ga0207674_10093640
2395 Ga0207674_10276408
2396 Ga0207674_10763221
2397 Ga0207674_11200115
2398 Ga0207675_100002092
2399 Ga0207675_100004056
2400 Ga0207675_100031877
2401 Ga0207675_100061552
2402 Ga0207675_100238892
2403 Ga0207675_101053265
2404 Ga0207683_10049353
2405 Ga0207683_10051178
2406 Ga0207683_10053057
2407 Ga0207683_10058397
2408 Ga0207683_10085867
2409 Ga0207683_10088992
2410 Ga0207683_10106762
2411 Ga0207683_10119317
2412 Ga0207683_10124770
2413 Ga0207683_10153058
2414 Ga0207683_10258442
2415 Ga0207683_10355500
2416 Ga0207683_10377590
2417 Ga0207683_10464748
2418 Ga0207683_10745793
2419 Ga0207698_10042779
2420 Ga0207698_10064772
2421 Ga0207698_10104707
2422 Ga0207698_10170179
2423 Ga0207698_10218396
2424 Ga0207698_10271516
2425 Ga0207698_10423631
2426 Ga0207698_10528668
2427 Ga0207698_10595140
2428 Ga0207698_10788776
2429 Ga0207698_10943355
2430 Ga0209281_1000151
2431 Ga0209389_1000341
2432 Ga0209371_1010309
2433 Ga0209813_10004823
2434 Ga0209813_10010278
2435 Ga0209813_10019065
2436 Ga0209813_10041526
2437 Ga0209813_10101373
2438 Ga0209813_10318374
2439 Ga0209974_10001355
2440 Ga0209974_10106540
2441 Ga0268266_10044876
2442 Ga0268266_10092469
2443 Ga0268266_10177416
2444 Ga0268266_10382575
2445 Ga0268266_10449191
2446 Ga0268266_10698005
2447 Ga0268266_10815884
2448 Ga0268266_11820225
2449 Ga0268265_10064219
2450 Ga0268265_10081788
2451 Ga0268265_10462756
2452 Ga0268265_11567574
2453 Ga0268264_10003212
2454 Ga0268264_10003786
2455 Ga0268264_10059514
2456 Ga0268264_10088646
2457 Ga0268264_10091577
2458 Ga0268264_10145189
2459 Ga0268264_10516498
2460 Ga0268264_12382014
2461 Ga0268264_12667247
2462 Ga0307517_10000174
2463 Ga0307517_10114587
2464 Ga0307517_10140152
2465 Ga0307517_10283240
2466 Ga0307515_10000084
2467 Ga0307515_10000265
2468 Ga0307515_10002453
2469 Ga0307515_10004018
2470 Ga0307515_10040542
2471 Ga0307515_10045204
2472 Ga0307515_10058663
2473 Ga0307515_10580104
2474 Ga0307512_10048289
2475 Ga0307512_10099404
2476 Ga0307512_10128276
2477 Ga0307512_10165911
2478 Ga0307512_10172833
2479 Ga0265331_10003101
2480 Ga0265327_10000012
2481 Ga0265327_10002000
2482 Ga0265327_10050233
2483 Ga0265327_10213974
2484 Ga0307513_10000008
2485 Ga0307513_10012364
2486 Ga0307513_10016692
2487 Ga0307513_10068505
2488 Ga0307513_10096388
2489 Ga0307513_10131033
2490 Ga0307513_10144267
2491 Ga0307513_10156808
2492 Ga0307513_10265785
2493 Ga0307513_10409585
2494 Ga0307513_10422657
2495 Ga0307509_10000225
2496 Ga0307509_10022299
2497 Ga0307509_10023360
2498 Ga0307509_10055729
2499 Ga0307509_10083968
2500 Ga0307509_10166312
2501 Ga0307408_100093037
2502 Ga0307408_100195866
2503 Ga0307408_100500811
2504 Ga0307408_100639948
2505 Ga0307408_100714486
2506 Ga0307408_100813351
2507 Ga0307508_10000123
2508 Ga0307508_10007788
2509 Ga0307508_10030181
2510 Ga0307508_10469540
2511 Ga0307514_10000319
2512 Ga0307514_10003098
2513 Ga0307514_10077519
2514 Ga0307514_10086324
2515 Ga0307516_10003862
2516 Ga0307516_10047365
2517 Ga0307516_10048869
2518 Ga0307516_10085767
2519 Ga0307516_10339052
2520 Ga0307516_10354510
2521 Ga0307405_10018710
2522 Ga0307405_10211064
2523 Ga0307405_11351830
2524 Ga0307405_11774788
2525 Ga0307413_10071140
2526 Ga0307413_10072869
2527 Ga0307413_10584274
2528 Ga0307410_10000484
2529 Ga0307410_10072561
2530 Ga0307406_10016912
2531 Ga0307406_10300119
2532 Ga0307406_10454245
2533 Ga0307407_10206481
2534 Ga0307412_10036830
2535 Ga0307412_10047004
2536 Ga0307412_10441070
2537 Ga0307412_10516354
2538 Ga0307412_10740774
2539 Ga0307409_100009019
2540 Ga0307409_100026390
2541 Ga0307416_100001658
2542 Ga0307416_100026199
2543 Ga0307416_100336962
2544 Ga0307416_100409201
2545 Ga0307416_100481182
2546 Ga0307416_100908389
2547 Ga0307416_101065772
2548 Ga0307416_101425320
2549 Ga0307416_102677828
2550 Ga0307414_10067474
2551 Ga0307414_10150781
2552 Ga0307414_10911115
2553 Ga0307414_10927145
2554 Ga0307411_10371910
2555 Ga0307411_10451535
2556 Ga0307411_11142972
2557 Ga0307411_11847637
2558 Ga0307415_100006170
2559 Ga0307507_10076893
2560 Ga0307510_10008316
2561 Ga0307510_10034217
2562 Ga0307510_10109306
2563 Ga0307510_10183981
2564 Ga0307510_10331298
2565 Ga0373938_0028174
2566 Ga0373926_0193115
2567 Ga0373934_0185679
2568 Ga0373923_0459103
2569 Ga0373960_0174496
2570 Ga0373943_0031632
2571 Ga0373946_0559030
2572 Ga0373955_0169324
2573 Ga0373962_0340453
2574 Ga0373924_0371622
2575 Ga0373931_0012403
2576 Ga0373931_0331314
2577 Ga0373935_1451335
2578 Ga0373933_0871164
2579 Ga0373933_1020612
2580 Ga0373947_1244725
2581 Ga0373937_0031134
2582 Ga0373937_0777057
2583 Ga0373937_0923781
2584 Ga0373925_0017081
2585 Ga0373925_0021911
2586 Ga0373925_0367322
2587 Ga0373925_0445844
2588 Ga0395899_0019534
2589 Ga0395900_0000050
2590 Ga0395900_0020449
2591 Ga0395900_0520696
2592 Ga0395898_0005390
2593 Ga0395898_0031352
2594 Ga0395898_0130946
2595 Ga0395898_0705175
2596 Ga0395905_0000407
2597 Ga0395905_0017351
2598 Ga0395905_0090493
2599 Ga0395905_0132193
2600 Ga0395905_0261658
2601 Ga0395905_0492816
2602 Ga0395905_0709245
2603 Ga0436364_1532384
2604 Ga0395901_0128565
2605 Ga0395901_1782734
2606 Ga0436365_0686369
2607 Ga0436365_0978309
2608 Ga0436365_1867544
2609 Ga0436361_0279495
2610 Ga0436363_0541503
2611 Ga0436363_1358280
2612 Ga0439436_0004752
2613 Ga0439447_014914
2614 Ga0439447_042781
2615 Ga0439461_0010217
2616 Ga0439466_0010962
2617 Ga0439466_0042439
2618 Ga0439465_0000881
2619 Ga0439465_0023629
2620 Ga0451787_830888
2621 Ga0451789_0500229
2622 Ga0451791_0220690
2623 Ga0451791_1507368
2624 Ga0451793_1886398
2625 Ga0451797_0557698
2626 Ga0451797_1338879
2627 Ga0451795_0084962
2628 Ga0451795_0598759
2629 Ga0451800_0518005
2630 Ga0451800_0707869
2631 Ga0451802_0416253
2632 Ga0451806_766340
2633 Ga0451807_1607480
2634 Ga0451807_2114126
2635 Ga0451833_1136626
2636 Ga0451835_0275592
2637 Ga0451837_1577029
2638 Ga0451841_1254413
2639 Ga0451849_1118628
2640 Ga0451843_0822940
2641 Ga0451855_1979706
2642 Ga0451853_1115183
2643 Ga0451853_1898289
2644 Ga0451853_3246896
2645 Ga0439431_0000136
2646 Ga0439431_0014084
2647 Ga0439431_0037407
2648 Ga0439433_0000676
2649 Ga0439433_0006006
2650 Ga0439442_002772
2651 Ga0439442_005065
2652 Ga0439445_0091426
2653 Ga0439448_0176933
2654 Ga0439432_001610
2655 Ga0439449_0000231
2656 Ga0439449_0001881
2657 Ga0439450_048229
2658 Ga0439452_001605
2659 Ga0439452_036468
2660 Ga0439454_008726
2661 Ga0439454_045835
2662 Ga0439457_001194
2663 Ga0450911_000302
2664 Ga0450919_000922
2665 Ga0450921_001267
2666 Ga0450921_037348
2667 Ga0450890_000923
2668 Ga0450894_002638
2669 Ga0450899_001703
2670 Ga0450899_029744
2671 Ga0450902_095261
2672 Ga0450910_081130
2673 Ga0439446_0007098
2674 Ga0439446_0089707
2675 Ga0450908_003584
2676 Ga0450909_003671
2677 Ga0439434_0002408
2678 Ga0439459_0005459
2679 Ga0439459_0063772
2680 Ga0450918_000006
2681 Ga0450918_037991
2682 Ga0450893_0019931
2683 Ga0450901_017245
2684 Ga0451577_0007326
2685 Ga0451577_0048478
2686 Ga0451577_0292677
2687 Ga0451577_0355745
2688 Ga0466969_0000169
2689 Ga0466969_0005890
2690 Ga0466969_0047172
2691 Ga0466969_0067295
2692 Ga0466972_0036018
2693 Ga0466972_0577419
2694 Ga0453683_0001628
2695 Ga0466965_0003093
2696 Ga0466965_0090608
2697 Ga0466965_0110819
2698 Ga0466965_0190954
2699 Ga0466965_0888115
2700 Ga0466966_0011620
2701 Ga0466966_0016624
2702 Ga0466966_0175567
2703 Ga0466966_0313732
2704 Ga0466961_0011795
2705 Ga0466961_0118210
2706 Ga0466961_0176095
2707 Ga0466963_0009105
2708 Ga0466964_0003357
2709 Ga0466964_0035719
2710 Ga0466964_0608570
2711 Ga0453684_0229325
2712 Ga0453684_0472516
2713 Ga0453684_0905336
2714 Ga0466971_0008205
2715 Ga0466971_0060520
2716 Ga0466971_0494576
2717 Ga0466968_0015412
2718 Ga0466968_0069704
2719 Ga0466968_0745278
2720 Ga0466970_0019655
2721 Ga0466970_0053291
2722 Ga0466970_0116179
2723 Ga0466970_0258574
2724 Ga0466970_0460649
2725 Ga0466957_0015588
2726 Ga0466957_0046630
2727 Ga0466957_0169164
2728 Ga0466957_0246038
2729 Ga0466960_0083500
2730 Ga0466960_0480915
2731 Ga0466959_0003436
2732 Ga0466959_0042478
2733 Ga0466959_0101590
2734 Ga0466959_0105241
2735 Ga0466959_1149871
2736 Ga0451576_0003704
2737 Ga0451576_0059421
2738 Ga0451576_0075029
2739 Ga0451576_0167776
2740 Ga0451576_0188831
2741 Ga0451576_0916681
2742 Ga0451576_0972046
2743 Ga0451576_1709068
2744 Ga0466958_0167147
2745 Ga0466958_0523601
2746 Ga0466958_0587861
2747 Ga0466967_0043435
2748 Ga0495592_0000598
2749 Ga0495592_0589439
2750 Ga0495592_0778426
2751 Ga0495603_0446196
2752 Ga0495590_0031721
2753 Ga0495590_0393564
2754 Ga0495629_0222666
2755 Ga0495629_0365821
2756 Ga0495638_0079627
2757 Ga0495651_0358253
2758 Ga0495653_0299606
2759 Ga0495650_0003795
2760 Ga0495639_0004258
2761 Ga0495583_0072689
2762 Ga0495606_0089271
2763 Ga0495610_0024192
2764 Ga0495618_0276927
2765 Ga0495628_0567699
2766 Ga0495630_0815817
2767 Ga0495631_0081207
2768 Ga0495632_0003352
2769 Ga0495632_0070387
2770 Ga0495632_0080389
2771 Ga0495643_0117998
2772 Ga0495648_0267697
2773 Ga0495666_0167164
2774 Ga0495642_0081560
2775 Ga0495642_0210539
2776 Ga0495654_0261053
2777 Ga0495598_0107874
2778 Ga0495621_0005665
2779 Ga0495621_0044127
2780 Ga0495621_0298374
2781 Ga0495597_0154824
2782 Ga0495645_0153142
2783 Ga0495645_0195379
2784 Ga0495645_0311315
2785 Ga0495622_0062144
2786 Ga0495656_0001522
2787 Ga0495656_0136040
2788 Ga0495625_0002346
2789 Ga0495625_0132535
2790 Ga0495635_0113007
2791 Ga0495635_0855838
2792 Ga0495659_0107046
2793 Ga0495588_0076705
2794 Ga0495588_0225367
2795 Ga0495647_0215742
2796 Ga0495647_0460918
2797 Ga0495658_0023952
2798 Ga0495658_0029832
2799 Ga0495658_0079085
2800 Ga0495658_0169388
2801 Ga0495658_0173601
2802 Ga0495624_0029318
2803 Ga0495670_0142672
2804 Ga0495671_0118362
2805 Ga0495671_0135487
2806 Ga0495671_0152235
2807 Ga0495671_0280344
2808 Ga0495649_0010955
2809 Ga0495589_0270715
2810 Ga0495600_0238689
2811 Ga0495660_0005806
2812 Ga0495660_0222829
2813 Ga0495674_0777439
2814 Ga0495676_0280024
2815 Ga0495676_0484832
2816 Ga0495680_0434302
2817 Ga0495687_007410
2818 Ga0495687_011089
2819 Ga0495687_012143
2820 Ga0495686_0008561
2821 Ga0495686_0084169
2822 Ga0495593_0019618
2823 Ga0495602_0548017
2824 Ga0495602_0859511
2825 Ga0495614_0095062
2826 Ga0495614_0139265
2827 Ga0495615_0021284
2828 Ga0495615_0134208
2829 Ga0495626_0066868
2830 Ga0495626_0178981
2831 Ga0495626_0194746
2832 Ga0496100_0009445
2833 Ga0496100_0278262
2834 Ga0496100_0600707
2835 Ga0496101_0000603
2836 Ga0496101_0167019
2837 Ga0496101_0353665
2838 Ga0496102_0010766
2839 Ga0496102_0093120
2840 Ga0496102_0128835
2841 Ga0496102_0245203
2842 Ga0496103_0033763
2843 Ga0496104_0022206
2844 Ga0496104_0151219
2845 Ga0496104_0186315
2846 Ga0496104_0610183
2847 Ga0496105_0004127
2848 Ga0496105_0042258
2849 Ga0496106_0020542
2850 Ga0496106_0027853
2851 Ga0496106_0124740
2852 Ga0496107_0075914
2853 Ga0496107_0499964
2854 Ga0496108_0052127
2855 Ga0496108_0082967
2856 Ga0496108_0085318
2857 Ga0496108_0231303
2858 Ga0496108_0666636
2859 Ga0496108_0929454
2860 Ga0496109_0120241
2861 Ga0496109_0271984
2862 Ga0496109_0323016
2863 Ga0496109_0360780
2864 Ga0496109_0831806
2865 Ga0496109_0978809
2866 Ga0496110_0115353
2867 Ga0496110_0822030
2868 Ga0496110_0912796
2869 Ga0496111_0041538
2870 Ga0496112_0017021
2871 Ga0496112_0408108
2872 Ga0496112_1654017
2873 Ga0496113_0159428
2874 Ga0496113_0433996
2875 Ga0496114_0020191
2876 Ga0496114_0051490
2877 Ga0496114_0505729
2878 Ga0496114_0664154
2879 Ga0496114_1114759
2880 Ga0496115_0214779
2881 Ga0496115_0889226
2882 Ga0496117_0148834
2883 Ga0496117_0593552
2884 Ga0496121_0003789
2885 Ga0496121_0012542
2886 Ga0496121_0856665
2887 Ga0496122_0000998
2888 Ga0496122_0304754
2889 Ga0496123_0000045
2890 Ga0496123_0070966
2891 Ga0496124_0000596
2892 Ga0496124_0006265
2893 Ga0496124_0081642
2894 Ga0496124_0210660
2895 Ga0496125_0014698
2896 Ga0496125_0017503
2897 Ga0496125_0022653
2898 Ga0496125_0031594
2899 Ga0496126_0131458
2900 Ga0496126_0212866
2901 Ga0496126_0270030
2902 Ga0495682_0233713
2903 Ga0501043_0000020
2904 Ga0501046_0000039
2905 Ga0501046_0629822
2906 Ga0501047_0000028
2907 Ga0501047_0282531
2908 Ga0501048_0000484
2909 Ga0501257_134852
2910 Ga0501264_016792
2911 Ga0501035_0224700
2912 Ga0501045_0939156
2913 nmdc:mga03683_230327_c1
2914 nmdc:mga03683_25205_c1
2915 nmdc:mga03683_458355_c1
2916 nmdc:mga03683_45866_c1
2917 nmdc:mga03683_609_c1
2918 nmdc:mga03683_8148_c1
2919 nmdc:mga03n38_139189_c1
2920 nmdc:mga03n38_163148_c1
2921 nmdc:mga03n38_164582_c1
2922 nmdc:mga03n38_330015_c1
2923 nmdc:mga03n38_6656_c1
2924 nmdc:mga03n38_6905_c1
2925 nmdc:mga03n38_7237_c1
2926 nmdc:mga03n38_947741_c1
2927 nmdc:mga00v17_907021_c1
2928 nmdc:mga00v17_92917_c1
2929 nmdc:mga0yw44_205157_c1
2930 nmdc:mga0yw44_3930_c1
2931 nmdc:mga0yw44_444174_c1
2932 nmdc:mga0yw44_551800_c1
2933 nmdc:mga0yw44_587766_c1
2934 nmdc:mga0k408_106905_c1
2935 nmdc:mga0k408_10994_c1
2936 nmdc:mga0k408_12667_c1
2937 nmdc:mga0k408_1297_c1
2938 nmdc:mga0k408_135764_c2
2939 nmdc:mga0k408_136693_c1
2940 nmdc:mga0k408_157737_c1
2941 nmdc:mga0k408_16726_c1
2942 nmdc:mga0k408_17400_c1
2943 nmdc:mga0k408_254447_c1
2944 nmdc:mga0k408_318212_c1
2945 nmdc:mga0k408_335424_c1
2946 nmdc:mga0k408_33712_c1
2947 nmdc:mga0k408_347893_c1
2948 nmdc:mga0k408_37821_c1
2949 nmdc:mga0k408_396054_c1
2950 nmdc:mga0k408_4344_c1
2951 nmdc:mga0k408_436230_c1
2952 nmdc:mga0k408_444657_c1
2953 nmdc:mga0k408_53264_c1
2954 nmdc:mga0k408_570015_c1
2955 nmdc:mga0k408_616034_c1
2956 nmdc:mga0k408_620946_c1
2957 nmdc:mga0k408_63717_c1
2958 nmdc:mga0k408_77561_c1
2959 nmdc:mga0k408_935_c1
2960 nmdc:mga06z11_103293_c1
2961 nmdc:mga06z11_1427_c1
2962 nmdc:mga06z11_145940_c1
2963 nmdc:mga06z11_165443_c1
2964 nmdc:mga06z11_264594_c1
2965 nmdc:mga06z11_29430_c1
2966 nmdc:mga06z11_46276_c1
2967 nmdc:mga06z11_693691_c1
2968 nmdc:mga04h51_109356_c1
2969 nmdc:mga04h51_11196_c1
2970 nmdc:mga04h51_220977_c1
2971 nmdc:mga04h51_41362_c1
2972 nmdc:mga04h51_49843_c1
2973 nmdc:mga07m45_231369_c1
2974 nmdc:mga07m45_23824_c1
2975 nmdc:mga07m45_24323_c1
2976 nmdc:mga07m45_277825_c1
2977 nmdc:mga07m45_30562_c1
2978 nmdc:mga07m45_312026_c1
2979 nmdc:mga07m45_33638_c1
2980 nmdc:mga07m45_355_c1
2981 nmdc:mga07m45_43921_c1
2982 nmdc:mga07m45_44702_c1
2983 nmdc:mga07m45_52189_c1
2984 nmdc:mga07m45_553667_c1
2985 nmdc:mga07m45_58954_c1
2986 nmdc:mga07m45_75397_c1
2987 nmdc:mga07m45_9617_c1
2988 nmdc:mga05p37_1533142_c1
2989 nmdc:mga08y16_1193187_c1
2990 nmdc:mga0n895_646864_c1
2991 nmdc:mga0rr50_88694_c1
2992 nmdc:mga0a205_361369_c1
2993 Ga0495601_0211148
2994 Ga0495601_0616831
2995 Ga0495612_0121501
2996 Ga0495619_0112224
2997 Ga0495619_0535573
2998 Ga0500578_0000079
2999 Ga0500578_0060596
3000 Ga0500578_0755318
3001 Ga0500644_0135926
3002 Ga0500646_0015569
3003 Ga0500646_0022185
3004 Ga0500651_0036349
3005 Ga0500651_0482079
3006 Ga0500651_0743272
3007 Ga0500594_0002669
3008 Ga0500594_0012360
3009 Ga0500607_346407
3010 Ga0500618_043335
3011 Ga0500621_075493
3012 Ga0500623_147597
3013 Ga0500658_0010178
3014 Ga0500658_0021949
3015 Ga0500559_0000128
3016 Ga0500559_0004716
3017 Ga0500559_0028097
3018 Ga0500568_0006808
3019 Ga0500568_0181002
3020 Ga0500619_000016
3021 Ga0500622_0000053
3022 Ga0500622_0000347
3023 Ga0500567_178793
3024 Ga0500570_066850
3025 Ga0500587_000682
3026 Ga0500587_000706
3027 Ga0590071_082287
3028 Ga0466962_0215036
3029 Ga0466962_0223356
3030 2587759304
3031 2643972274
3032 2644141615
3033 2644275614
3034 2644302872
3035 2644341016
3036 2739248173
3037 2842734314
3038 2842749435
3039 2881105458
3040 2904483482

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

4

120

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cmo-assembly1.cif.gz_B crystal structure of holo-[acyl-carrier-protein] synthase (acps) from neisseria meningitidis 0.9518 1 129
5cmo-assembly1.cif.gz_B crystal structure of holo-[acyl-carrier-protein] synthase (acps) from neisseria meningitidis 0.9444 1 129
4jm7-assembly1.cif.gz_A 1.82 angstrom resolution crystal structure of holo-(acyl-carrier-protein) synthase (acps) from staphylococcus aureus 0.9411 1 130
3hyk-assembly1.cif.gz_B 2.31 angstrom resolution crystal structure of a holo-(acyl-carrier-protein) synthase from bacillus anthracis str. ames in complex with coa (3',5'-adp) 0.9384 1 130
5xuh-assembly1.cif.gz_B crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) d9a mutant in complex with coa 0.9375 1 129
ID Description Score Start End Superfamily
5cmoC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9482 1 129 3.90.470.20
4jm7A01 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9412 1 130 3.90.470.20
5cmoC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9409 1 129 3.90.470.20
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9376 1 129 3.90.470.20
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9299 1 129 3.90.470.20
ID Description Score Start End GO Terms
AF-A0A328Z6X6-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9971 1 131 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-B1XZM3-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.996 1 131 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A2M8VZA3-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9951 1 130 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A239H1S7-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9945 1 130 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A1Y2R9I0-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.994 1 130 GO:0000287
GO:0005737
GO:0006633
GO:0008897

Map