F494529
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1520 | 578 | 3040 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10192663|Ga0105239_101926631 |
| Length | 213 |
| Sequence | MSRKDVYLAKAREMLARGAEIPGPIAESVLSRKTARSAGSLVEGYDPECHDPYFDGVSQQLADKGFITAAADDLITWARTGSLMWMTFGLACCAIEMMQASMPRYDLERFGFAPRGSPRQSDVMIVAGTLVNKMAPALRKVYDQMAEPRYVISMGSCANGGXXXXFSYSTVRGCDRIVPVDIYVPGCPPTAEALVYGVLQLQKKIRRTGTIVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 28 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 29 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 30 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 93 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 108 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 139 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 146 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 147 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 148 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 149 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 150 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 227 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 243 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 244 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 245 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 247 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 248 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 249 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 250 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 251 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 252 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 255 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 256 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 257 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 258 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 259 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 260 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 261 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 262 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 263 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 264 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 265 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 266 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 267 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 268 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 269 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 270 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 271 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 272 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 273 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 274 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 275 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 276 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 277 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 278 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 279 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 280 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 281 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 282 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 283 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 284 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 285 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 286 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 287 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 289 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 291 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 292 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 293 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 294 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 295 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 296 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 297 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 298 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 299 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 300 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 301 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 303 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 304 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 305 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 306 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 307 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 308 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 309 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 310 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 311 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 312 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 313 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 314 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 315 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 316 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 317 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 318 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 319 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 320 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 322 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 323 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 324 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 325 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 326 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 327 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 328 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 329 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 330 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 331 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 332 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 333 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 334 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 335 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 336 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 337 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 338 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 339 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 340 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 387 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 388 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 389 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 390 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 391 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 392 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 395 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 396 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 397 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 398 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 399 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 400 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 401 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 402 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 403 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 404 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 405 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 406 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 407 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 408 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 436 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 437 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 438 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 439 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 440 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 441 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 446 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 447 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 448 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 449 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 450 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 451 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 455 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 456 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 457 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 458 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 466 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 469 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 470 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 471 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 472 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 473 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 474 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 475 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 476 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 477 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 478 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 479 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 480 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 481 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 482 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 483 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 484 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 485 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 486 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 487 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 488 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 489 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 490 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 491 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 492 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 493 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 494 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 495 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 496 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 498 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 499 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 505 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 506 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 507 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 508 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 509 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 510 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 511 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 512 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 513 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 514 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 515 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 516 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 517 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 518 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 519 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 520 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 521 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 522 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 523 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 524 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 525 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 526 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 527 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 528 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 529 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 530 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 531 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 532 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 533 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 534 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 535 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 536 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 537 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 538 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 539 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 540 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 541 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 542 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 543 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 544 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 545 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 546 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 547 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 548 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 549 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 550 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 551 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 552 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 553 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 554 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 555 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 556 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 557 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 558 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 559 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 560 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 561 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 562 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 563 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 564 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 565 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 566 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 567 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 568 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 569 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 570 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 571 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 572 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 573 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 574 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 575 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 576 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 577 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 578 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.96 |
| Metatranscriptomes | 2.24 |
| Isolates | 4.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.83 |
| Nodule | 0.2 |
| Rhizoplane | 3.62 |
| Rhizosphere | 81.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105239_10192663 | 3300010375 | Bacteria | 2282 |
| 2 | JGI24736J21556_1002298 | 3300001904 | Bacteria | 3377 |
| 3 | JGI24741J21665_1000556 | 3300001915 | Bacteria | 11393 |
| 4 | JGI24741J21665_1005287 | 3300001915 | Bacteria | 2727 |
| 5 | JGI24741J21665_1008390 | 3300001915 | Bacteria | 1950 |
| 6 | JGI24741J21665_1009734 | 3300001915 | Bacteria | 1751 |
| 7 | JGI24740J21852_10000237 | 3300001979 | Bacteria | 23259 |
| 8 | JGI24740J21852_10002033 | 3300001979 | Bacteria | 9248 |
| 9 | JGI24744J21845_10003452 | 3300002077 | Bacteria | 3250 |
| 10 | JGI25152J39213_1000106 | 3300002773 | Bacteria | 58139 |
| 11 | JGI25150J39212_1000114 | 3300002774 | Bacteria | 45745 |
| 12 | Ga0006778J45830_1040800 | 3300003162 | Bacteria | 1085 |
| 13 | Ga0006759J45824_1036463 | 3300003163 | Bacteria | 1590 |
| 14 | JGI25151J46595_10001018 | 3300003187 | Bacteria | 21057 |
| 15 | JGI25151J46595_10036957 | 3300003187 | Bacteria | 1836 |
| 16 | JGI25153J46596_10000012 | 3300003215 | Bacteria | 308056 |
| 17 | JGI25153J46596_10000089 | 3300003215 | Bacteria | 106651 |
| 18 | JGI25153J46596_10027450 | 3300003215 | Bacteria | 1994 |
| 19 | JGI25153J46596_10088969 | 3300003215 | Bacteria | 751 |
| 20 | Ga0007417J51691_1031998 | 3300003544 | Bacteria | 1776 |
| 21 | Ga0007410J51695_1037931 | 3300003574 | Bacteria | 1686 |
| 22 | Ga0007409J51694_1038867 | 3300003575 | Bacteria | 731 |
| 23 | Ga0007416J51690_1041424 | 3300003577 | Bacteria | 1447 |
| 24 | Ga0007429J51699_1034950 | 3300003579 | Bacteria | 1025 |
| 25 | Ga0006780_1015555 | 3300003735 | Bacteria | 1133 |
| 26 | Ga0055529_1005071 | 3300003763 | Bacteria | 1946 |
| 27 | Ga0055526_1000021 | 3300003771 | Bacteria | 180007 |
| 28 | Ga0055526_1005919 | 3300003771 | Bacteria | 6823 |
| 29 | Ga0055537_1002606 | 3300003773 | Bacteria | 5904 |
| 30 | Ga0055524_1000128 | 3300003775 | Bacteria | 88986 |
| 31 | Ga0055524_1026098 | 3300003775 | Bacteria | 1815 |
| 32 | Ga0055524_1047667 | 3300003775 | Bacteria | 1007 |
| 33 | Ga0055536_1007116 | 3300003781 | Bacteria | 5073 |
| 34 | Ga0055536_1015149 | 3300003781 | Bacteria | 2658 |
| 35 | Ga0055534_1000054 | 3300003784 | Bacteria | 88986 |
| 36 | Ga0055528_1000009 | 3300003790 | Bacteria | 224150 |
| 37 | Ga0055528_1016808 | 3300003790 | Bacteria | 2566 |
| 38 | Ga0055530_10002317 | 3300003791 | Bacteria | 12445 |
| 39 | Ga0055530_10006557 | 3300003791 | Bacteria | 5166 |
| 40 | Ga0055531_10002979 | 3300003794 | Bacteria | 11005 |
| 41 | Ga0055531_10007070 | 3300003794 | Bacteria | 6205 |
| 42 | Ga0055531_10017501 | 3300003794 | Bacteria | 3021 |
| 43 | Ga0055531_10022544 | 3300003794 | Bacteria | 2395 |
| 44 | Ga0058692_1000024 | 3300003856 | Bacteria | 219702 |
| 45 | Ga0058863_11597900 | 3300004799 | Bacteria | 612 |
| 46 | Ga0058861_11717822 | 3300004800 | Bacteria | 809 |
| 47 | Ga0058862_12307887 | 3300004803 | Bacteria | 958 |
| 48 | Ga0065165_1001554 | 3300005262 | Bacteria | 23852 |
| 49 | Ga0065165_1059051 | 3300005262 | Bacteria | 1057 |
| 50 | Ga0065714_10072044 | 3300005288 | Bacteria | 3430 |
| 51 | Ga0065704_10071703 | 3300005289 | Bacteria | 10200 |
| 52 | Ga0065715_10697927 | 3300005293 | Bacteria | 654 |
| 53 | Ga0065707_10129451 | 3300005295 | Bacteria | 1947 |
| 54 | Ga0070658_10210018 | 3300005327 | Bacteria | 1644 |
| 55 | Ga0070658_10243198 | 3300005327 | Bacteria | 1525 |
| 56 | Ga0070683_100038721 | 3300005329 | Bacteria | 4372 |
| 57 | Ga0070683_100512303 | 3300005329 | Bacteria | 1146 |
| 58 | Ga0070683_100758811 | 3300005329 | Bacteria | 929 |
| 59 | Ga0070690_100465756 | 3300005330 | Bacteria | 940 |
| 60 | Ga0070670_100004329 | 3300005331 | Bacteria | 11886 |
| 61 | Ga0070670_100042556 | 3300005331 | Bacteria | 3905 |
| 62 | Ga0070670_100081542 | 3300005331 | Bacteria | 2779 |
| 63 | Ga0070670_100112308 | 3300005331 | Bacteria | 2348 |
| 64 | Ga0070670_100114411 | 3300005331 | Bacteria | 2326 |
| 65 | Ga0070670_100449637 | 3300005331 | Bacteria | 1142 |
| 66 | Ga0068869_100442765 | 3300005334 | Bacteria | 1076 |
| 67 | Ga0070666_10013056 | 3300005335 | Bacteria | 5261 |
| 68 | Ga0070680_100010109 | 3300005336 | Bacteria | 7274 |
| 69 | Ga0070680_100024779 | 3300005336 | Bacteria | 4795 |
| 70 | Ga0070680_100036225 | 3300005336 | Bacteria | 3985 |
| 71 | Ga0070680_100048158 | 3300005336 | Bacteria | 3473 |
| 72 | Ga0070680_100054964 | 3300005336 | Bacteria | 3252 |
| 73 | Ga0070680_100056628 | 3300005336 | Bacteria | 3204 |
| 74 | Ga0070680_100416210 | 3300005336 | Bacteria | 1146 |
| 75 | Ga0070682_100002762 | 3300005337 | Bacteria | 9720 |
| 76 | Ga0070682_100197942 | 3300005337 | Bacteria | 1415 |
| 77 | Ga0068868_100029245 | 3300005338 | Bacteria | 4219 |
| 78 | Ga0068868_100153783 | 3300005338 | Bacteria | 1896 |
| 79 | Ga0070660_100036785 | 3300005339 | Bacteria | 3709 |
| 80 | Ga0070660_100045702 | 3300005339 | Bacteria | 3353 |
| 81 | Ga0070660_100115723 | 3300005339 | Bacteria | 2138 |
| 82 | Ga0070660_100178618 | 3300005339 | Bacteria | 1717 |
| 83 | Ga0070660_100178816 | 3300005339 | Bacteria | 1716 |
| 84 | Ga0070660_100308897 | 3300005339 | Bacteria | 1297 |
| 85 | Ga0070660_100549373 | 3300005339 | Bacteria | 963 |
| 86 | Ga0070689_100100904 | 3300005340 | Bacteria | 2284 |
| 87 | Ga0070691_10019829 | 3300005341 | Bacteria | 3104 |
| 88 | Ga0070691_10022624 | 3300005341 | Bacteria | 2917 |
| 89 | Ga0070691_10135627 | 3300005341 | Bacteria | 1250 |
| 90 | Ga0070661_100013911 | 3300005344 | Bacteria | 5655 |
| 91 | Ga0070661_100057307 | 3300005344 | Bacteria | 2855 |
| 92 | Ga0070661_100110352 | 3300005344 | Bacteria | 2053 |
| 93 | Ga0070661_100151454 | 3300005344 | Bacteria | 1753 |
| 94 | Ga0070661_100781395 | 3300005344 | Bacteria | 782 |
| 95 | Ga0070692_10013129 | 3300005345 | Bacteria | 3854 |
| 96 | Ga0070692_10017420 | 3300005345 | Bacteria | 3435 |
| 97 | Ga0070692_10032873 | 3300005345 | Bacteria | 2611 |
| 98 | Ga0070692_10090285 | 3300005345 | Bacteria | 1665 |
| 99 | Ga0070668_100005311 | 3300005347 | Bacteria | 9564 |
| 100 | Ga0070668_100006755 | 3300005347 | Bacteria | 8503 |
| 101 | Ga0070668_100015688 | 3300005347 | Bacteria | 5666 |
| 102 | Ga0070668_100027457 | 3300005347 | Bacteria | 4322 |
| 103 | Ga0070668_100182783 | 3300005347 | Bacteria | 1714 |
| 104 | Ga0070669_100060577 | 3300005353 | Bacteria | 2781 |
| 105 | Ga0070669_100337906 | 3300005353 | Bacteria | 1220 |
| 106 | Ga0070675_100028198 | 3300005354 | Bacteria | 4518 |
| 107 | Ga0070675_100296528 | 3300005354 | Bacteria | 1424 |
| 108 | Ga0070671_100009370 | 3300005355 | Bacteria | 7863 |
| 109 | Ga0070671_100187836 | 3300005355 | Bacteria | 1751 |
| 110 | Ga0070671_100338823 | 3300005355 | Bacteria | 1282 |
| 111 | Ga0070674_100011872 | 3300005356 | Bacteria | 5324 |
| 112 | Ga0070674_100311976 | 3300005356 | Bacteria | 1258 |
| 113 | Ga0070674_100414335 | 3300005356 | Bacteria | 1104 |
| 114 | Ga0070673_100234225 | 3300005364 | Bacteria | 1594 |
| 115 | Ga0070673_100496917 | 3300005364 | Bacteria | 1103 |
| 116 | Ga0070688_100013063 | 3300005365 | Bacteria | 4675 |
| 117 | Ga0070688_100293372 | 3300005365 | Bacteria | 1173 |
| 118 | Ga0070659_100000373 | 3300005366 | Bacteria | 33795 |
| 119 | Ga0070659_100053199 | 3300005366 | Bacteria | 3186 |
| 120 | Ga0070659_100182994 | 3300005366 | Bacteria | 1720 |
| 121 | Ga0070659_100202028 | 3300005366 | Bacteria | 1636 |
| 122 | Ga0070667_100004615 | 3300005367 | Bacteria | 11569 |
| 123 | Ga0070667_100018296 | 3300005367 | Bacteria | 5808 |
| 124 | Ga0070667_100023082 | 3300005367 | Bacteria | 5161 |
| 125 | Ga0070667_100026123 | 3300005367 | Bacteria | 4856 |
| 126 | Ga0070667_100074598 | 3300005367 | Bacteria | 2894 |
| 127 | Ga0070667_100259841 | 3300005367 | Bacteria | 1554 |
| 128 | Ga0070709_10052725 | 3300005434 | Bacteria | 2558 |
| 129 | Ga0070711_100115857 | 3300005439 | Bacteria | 1974 |
| 130 | Ga0070711_100630972 | 3300005439 | Bacteria | 897 |
| 131 | Ga0070694_100175963 | 3300005444 | Bacteria | 1580 |
| 132 | Ga0070663_100005151 | 3300005455 | Bacteria | 7738 |
| 133 | Ga0070663_100015377 | 3300005455 | Bacteria | 4938 |
| 134 | Ga0070663_100044354 | 3300005455 | Bacteria | 3134 |
| 135 | Ga0070663_100054066 | 3300005455 | Bacteria | 2869 |
| 136 | Ga0070663_100220979 | 3300005455 | Bacteria | 1487 |
| 137 | Ga0070663_100364850 | 3300005455 | Bacteria | 1172 |
| 138 | Ga0070663_101007016 | 3300005455 | Bacteria | 725 |
| 139 | Ga0070678_100030828 | 3300005456 | Bacteria | 3691 |
| 140 | Ga0070678_100052641 | 3300005456 | Bacteria | 2957 |
| 141 | Ga0070678_100124704 | 3300005456 | Bacteria | 2036 |
| 142 | Ga0070678_100134534 | 3300005456 | Bacteria | 1970 |
| 143 | Ga0070678_100398044 | 3300005456 | Bacteria | 1196 |
| 144 | Ga0070662_100016039 | 3300005457 | Bacteria | 5026 |
| 145 | Ga0070662_100154392 | 3300005457 | Bacteria | 1790 |
| 146 | Ga0070662_100248548 | 3300005457 | Bacteria | 1429 |
| 147 | Ga0070681_10004072 | 3300005458 | Bacteria | 13805 |
| 148 | Ga0070681_10005676 | 3300005458 | Bacteria | 12065 |
| 149 | Ga0070681_10006381 | 3300005458 | Bacteria | 11465 |
| 150 | Ga0070681_10025312 | 3300005458 | Bacteria | 5969 |
| 151 | Ga0070681_10049802 | 3300005458 | Bacteria | 4181 |
| 152 | Ga0070681_10105833 | 3300005458 | Bacteria | 2755 |
| 153 | Ga0070681_10248428 | 3300005458 | Bacteria | 1692 |
| 154 | Ga0070681_10329812 | 3300005458 | Bacteria | 1436 |
| 155 | Ga0070681_10555017 | 3300005458 | Bacteria | 1062 |
| 156 | Ga0070681_10980946 | 3300005458 | Bacteria | 764 |
| 157 | Ga0068867_100163109 | 3300005459 | Bacteria | 1759 |
| 158 | Ga0068867_100422182 | 3300005459 | Bacteria | 1130 |
| 159 | Ga0070685_10014339 | 3300005466 | Bacteria | 4197 |
| 160 | Ga0070685_10048841 | 3300005466 | Bacteria | 2439 |
| 161 | Ga0070685_10355403 | 3300005466 | Bacteria | 1003 |
| 162 | Ga0070685_10553226 | 3300005466 | Bacteria | 822 |
| 163 | Ga0070679_100001932 | 3300005530 | Bacteria | 18615 |
| 164 | Ga0070679_100003983 | 3300005530 | Bacteria | 13603 |
| 165 | Ga0070679_100004827 | 3300005530 | Bacteria | 12431 |
| 166 | Ga0070679_100067870 | 3300005530 | Bacteria | 3557 |
| 167 | Ga0070679_100124618 | 3300005530 | Bacteria | 2559 |
| 168 | Ga0070679_100281810 | 3300005530 | Bacteria | 1615 |
| 169 | Ga0070679_100582425 | 3300005530 | Bacteria | 1062 |
| 170 | Ga0070679_101013285 | 3300005530 | Bacteria | 774 |
| 171 | Ga0070684_100020471 | 3300005535 | Bacteria | 5489 |
| 172 | Ga0070684_100028365 | 3300005535 | Bacteria | 4735 |
| 173 | Ga0070684_100087520 | 3300005535 | Bacteria | 2766 |
| 174 | Ga0070684_100097461 | 3300005535 | Bacteria | 2622 |
| 175 | Ga0068853_100005378 | 3300005539 | Bacteria | 10025 |
| 176 | Ga0068853_100051673 | 3300005539 | Bacteria | 3538 |
| 177 | Ga0068853_100055523 | 3300005539 | Bacteria | 3414 |
| 178 | Ga0068853_100117662 | 3300005539 | Bacteria | 2367 |
| 179 | Ga0068853_100188555 | 3300005539 | Bacteria | 1873 |
| 180 | Ga0068853_100217037 | 3300005539 | Bacteria | 1745 |
| 181 | Ga0068853_100263775 | 3300005539 | Bacteria | 1584 |
| 182 | Ga0068853_100685963 | 3300005539 | Bacteria | 976 |
| 183 | Ga0068853_100840129 | 3300005539 | Bacteria | 880 |
| 184 | Ga0070672_100015500 | 3300005543 | Bacteria | 5430 |
| 185 | Ga0070672_100038838 | 3300005543 | Bacteria | 3641 |
| 186 | Ga0070672_100215492 | 3300005543 | Bacteria | 1609 |
| 187 | Ga0070696_100002369 | 3300005546 | Bacteria | 12458 |
| 188 | Ga0070696_100588838 | 3300005546 | Bacteria | 895 |
| 189 | Ga0070693_100003121 | 3300005547 | Bacteria | 7687 |
| 190 | Ga0070693_100018579 | 3300005547 | Bacteria | 3634 |
| 191 | Ga0070665_100000116 | 3300005548 | Bacteria | 150141 |
| 192 | Ga0070665_100000249 | 3300005548 | Bacteria | 89011 |
| 193 | Ga0070665_100007181 | 3300005548 | Bacteria | 11322 |
| 194 | Ga0070665_100007348 | 3300005548 | Bacteria | 11206 |
| 195 | Ga0070665_100007471 | 3300005548 | Bacteria | 11109 |
| 196 | Ga0070665_100021052 | 3300005548 | Bacteria | 6557 |
| 197 | Ga0070665_100038139 | 3300005548 | Bacteria | 4830 |
| 198 | Ga0070665_100194256 | 3300005548 | Bacteria | 2030 |
| 199 | Ga0070665_100321505 | 3300005548 | Bacteria | 1552 |
| 200 | Ga0070665_100591325 | 3300005548 | Bacteria | 1123 |
| 201 | Ga0068855_100001777 | 3300005563 | Bacteria | 26951 |
| 202 | Ga0068855_100017140 | 3300005563 | Bacteria | 8715 |
| 203 | Ga0068855_100034551 | 3300005563 | Bacteria | 6028 |
| 204 | Ga0068855_100061023 | 3300005563 | Bacteria | 4406 |
| 205 | Ga0068855_100180792 | 3300005563 | Bacteria | 2384 |
| 206 | Ga0068855_100354640 | 3300005563 | Bacteria | 1615 |
| 207 | Ga0068855_100394886 | 3300005563 | Bacteria | 1517 |
| 208 | Ga0068855_100480498 | 3300005563 | Bacteria | 1352 |
| 209 | Ga0068855_100507767 | 3300005563 | Bacteria | 1309 |
| 210 | Ga0068855_101065844 | 3300005563 | Bacteria | 846 |
| 211 | Ga0070664_100030391 | 3300005564 | Bacteria | 4507 |
| 212 | Ga0070664_100142775 | 3300005564 | Bacteria | 2109 |
| 213 | Ga0070664_100152235 | 3300005564 | Bacteria | 2043 |
| 214 | Ga0070664_100231123 | 3300005564 | Bacteria | 1658 |
| 215 | Ga0070664_100386317 | 3300005564 | Bacteria | 1278 |
| 216 | Ga0070664_100632776 | 3300005564 | Bacteria | 994 |
| 217 | Ga0068857_100029718 | 3300005577 | Bacteria | 4823 |
| 218 | Ga0068857_100162111 | 3300005577 | Bacteria | 2029 |
| 219 | Ga0068857_100173201 | 3300005577 | Bacteria | 1962 |
| 220 | Ga0068857_100221467 | 3300005577 | Bacteria | 1728 |
| 221 | Ga0068854_100000634 | 3300005578 | Bacteria | 20800 |
| 222 | Ga0068854_100023231 | 3300005578 | Bacteria | 4233 |
| 223 | Ga0068854_100023771 | 3300005578 | Bacteria | 4189 |
| 224 | Ga0068854_100030522 | 3300005578 | Bacteria | 3739 |
| 225 | Ga0068854_100209340 | 3300005578 | Bacteria | 1537 |
| 226 | Ga0068856_100004755 | 3300005614 | Bacteria | 13478 |
| 227 | Ga0068856_100139272 | 3300005614 | Bacteria | 2433 |
| 228 | Ga0068856_100183444 | 3300005614 | Bacteria | 2106 |
| 229 | Ga0068856_100186813 | 3300005614 | Bacteria | 2086 |
| 230 | Ga0068856_100243742 | 3300005614 | Bacteria | 1812 |
| 231 | Ga0068856_100860991 | 3300005614 | Bacteria | 925 |
| 232 | Ga0068852_100037351 | 3300005616 | Bacteria | 4071 |
| 233 | Ga0068852_100045678 | 3300005616 | Bacteria | 3727 |
| 234 | Ga0068852_100065175 | 3300005616 | Bacteria | 3177 |
| 235 | Ga0068852_100105921 | 3300005616 | Bacteria | 2548 |
| 236 | Ga0068852_100136581 | 3300005616 | Bacteria | 2264 |
| 237 | Ga0068852_100246934 | 3300005616 | Bacteria | 1708 |
| 238 | Ga0068852_100456037 | 3300005616 | Bacteria | 1266 |
| 239 | Ga0068859_100027752 | 3300005617 | Bacteria | 5678 |
| 240 | Ga0068859_100355077 | 3300005617 | Bacteria | 1561 |
| 241 | Ga0068859_100916530 | 3300005617 | Bacteria | 961 |
| 242 | Ga0068864_100000116 | 3300005618 | Bacteria | 79213 |
| 243 | Ga0068864_100001947 | 3300005618 | Bacteria | 16966 |
| 244 | Ga0068864_100283712 | 3300005618 | Bacteria | 1546 |
| 245 | Ga0068864_100559058 | 3300005618 | Bacteria | 1107 |
| 246 | Ga0068864_100658698 | 3300005618 | Bacteria | 1020 |
| 247 | Ga0068864_100696063 | 3300005618 | Bacteria | 992 |
| 248 | Ga0068866_10097460 | 3300005718 | Bacteria | 1615 |
| 249 | Ga0068866_10577226 | 3300005718 | Bacteria | 756 |
| 250 | Ga0068861_100040693 | 3300005719 | Bacteria | 3478 |
| 251 | Ga0068861_100121297 | 3300005719 | Bacteria | 2109 |
| 252 | Ga0068861_100316572 | 3300005719 | Bacteria | 1358 |
| 253 | Ga0068861_100346400 | 3300005719 | Bacteria | 1302 |
| 254 | Ga0068851_10366198 | 3300005834 | Bacteria | 841 |
| 255 | Ga0068863_100000007 | 3300005841 | Bacteria | 257578 |
| 256 | Ga0068863_100005571 | 3300005841 | Bacteria | 12375 |
| 257 | Ga0068863_100005779 | 3300005841 | Bacteria | 12127 |
| 258 | Ga0068863_100019811 | 3300005841 | Bacteria | 6434 |
| 259 | Ga0068863_100025344 | 3300005841 | Bacteria | 5654 |
| 260 | Ga0068863_100047100 | 3300005841 | Bacteria | 4091 |
| 261 | Ga0068863_100103052 | 3300005841 | Bacteria | 2714 |
| 262 | Ga0068863_100204646 | 3300005841 | Bacteria | 1899 |
| 263 | Ga0068863_100423293 | 3300005841 | Bacteria | 1305 |
| 264 | Ga0068858_100000853 | 3300005842 | Bacteria | 31569 |
| 265 | Ga0068858_100002098 | 3300005842 | Bacteria | 20252 |
| 266 | Ga0068858_100120006 | 3300005842 | Bacteria | 2458 |
| 267 | Ga0068858_100161534 | 3300005842 | Bacteria | 2109 |
| 268 | Ga0068860_100000139 | 3300005843 | Bacteria | 119188 |
| 269 | Ga0068860_100002623 | 3300005843 | Bacteria | 18693 |
| 270 | Ga0068860_100006335 | 3300005843 | Bacteria | 11884 |
| 271 | Ga0068860_100178147 | 3300005843 | Bacteria | 2055 |
| 272 | Ga0068860_101212912 | 3300005843 | Bacteria | 775 |
| 273 | Ga0068862_100002233 | 3300005844 | Bacteria | 17368 |
| 274 | Ga0068862_100008229 | 3300005844 | Bacteria | 8627 |
| 275 | Ga0068862_100056398 | 3300005844 | Bacteria | 3366 |
| 276 | Ga0068862_100057322 | 3300005844 | Bacteria | 3340 |
| 277 | Ga0068862_100171336 | 3300005844 | Bacteria | 1943 |
| 278 | Ga0068862_100208173 | 3300005844 | Bacteria | 1766 |
| 279 | Ga0068862_100450311 | 3300005844 | Bacteria | 1214 |
| 280 | Ga0081538_10022046 | 3300005981 | Bacteria | 4626 |
| 281 | Ga0081539_10000076 | 3300005985 | Bacteria | 229037 |
| 282 | Ga0081539_10041204 | 3300005985 | Bacteria | 2701 |
| 283 | Ga0075365_10121153 | 3300006038 | Bacteria | 1805 |
| 284 | Ga0075368_10002153 | 3300006042 | Bacteria | 6364 |
| 285 | Ga0075363_100151003 | 3300006048 | Bacteria | 1311 |
| 286 | Ga0075364_10001061 | 3300006051 | Bacteria | 14636 |
| 287 | Ga0075364_10129025 | 3300006051 | Bacteria | 1696 |
| 288 | Ga0070716_100105867 | 3300006173 | Bacteria | 1734 |
| 289 | Ga0070712_100062640 | 3300006175 | Bacteria | 2631 |
| 290 | Ga0075367_10003935 | 3300006178 | Bacteria | 7168 |
| 291 | Ga0075366_10099835 | 3300006195 | Bacteria | 1742 |
| 292 | Ga0097621_100038886 | 3300006237 | Bacteria | 3819 |
| 293 | Ga0097621_100148569 | 3300006237 | Bacteria | 2008 |
| 294 | Ga0097621_100160668 | 3300006237 | Bacteria | 1931 |
| 295 | Ga0097621_100514489 | 3300006237 | Bacteria | 1086 |
| 296 | Ga0075370_10062773 | 3300006353 | Bacteria | 2117 |
| 297 | Ga0075370_10233064 | 3300006353 | Bacteria | 1089 |
| 298 | Ga0068871_100009120 | 3300006358 | Bacteria | 7169 |
| 299 | Ga0068871_100010471 | 3300006358 | Bacteria | 6770 |
| 300 | Ga0068871_100068879 | 3300006358 | Bacteria | 2905 |
| 301 | Ga0068871_100562746 | 3300006358 | Bacteria | 1034 |
| 302 | Ga0075434_100180390 | 3300006871 | Bacteria | 2131 |
| 303 | Ga0075429_100659611 | 3300006880 | Bacteria | 916 |
| 304 | Ga0068865_100013928 | 3300006881 | Bacteria | 5099 |
| 305 | Ga0068865_100016336 | 3300006881 | Bacteria | 4749 |
| 306 | Ga0097620_100027754 | 3300006931 | Bacteria | 5678 |
| 307 | Ga0097620_100355077 | 3300006931 | Bacteria | 1561 |
| 308 | Ga0097620_100916445 | 3300006931 | Bacteria | 961 |
| 309 | Ga0079104_1014548 | 3300006946 | Bacteria | 2369 |
| 310 | Ga0105251_10003611 | 3300009011 | Bacteria | 11123 |
| 311 | Ga0105240_10000535 | 3300009093 | Bacteria | 70216 |
| 312 | Ga0105240_10000627 | 3300009093 | Bacteria | 65150 |
| 313 | Ga0105240_10005884 | 3300009093 | Bacteria | 18159 |
| 314 | Ga0105240_10061357 | 3300009093 | Bacteria | 4686 |
| 315 | Ga0105240_10096562 | 3300009093 | Bacteria | 3601 |
| 316 | Ga0105240_10169059 | 3300009093 | Bacteria | 2591 |
| 317 | Ga0105240_10239207 | 3300009093 | Bacteria | 2106 |
| 318 | Ga0105240_10276024 | 3300009093 | Bacteria | 1933 |
| 319 | Ga0105240_10486834 | 3300009093 | Bacteria | 1374 |
| 320 | Ga0105240_10524783 | 3300009093 | Bacteria | 1313 |
| 321 | Ga0105240_10539709 | 3300009093 | Bacteria | 1292 |
| 322 | Ga0105240_10867684 | 3300009093 | Bacteria | 973 |
| 323 | Ga0105240_11520493 | 3300009093 | Bacteria | 701 |
| 324 | Ga0111539_10000445 | 3300009094 | Bacteria | 52233 |
| 325 | Ga0111539_10339064 | 3300009094 | Bacteria | 1750 |
| 326 | Ga0105247_10050617 | 3300009101 | Bacteria | 2557 |
| 327 | Ga0105247_10338635 | 3300009101 | Bacteria | 1054 |
| 328 | Ga0105243_10004934 | 3300009148 | Bacteria | 10454 |
| 329 | Ga0105243_10085115 | 3300009148 | Bacteria | 2591 |
| 330 | Ga0105243_10380656 | 3300009148 | Bacteria | 1305 |
| 331 | Ga0105241_10001710 | 3300009174 | Bacteria | 16696 |
| 332 | Ga0105241_10028138 | 3300009174 | Bacteria | 4186 |
| 333 | Ga0105241_10386589 | 3300009174 | Bacteria | 1224 |
| 334 | Ga0105241_10986632 | 3300009174 | Bacteria | 787 |
| 335 | Ga0105242_10026078 | 3300009176 | Bacteria | 4630 |
| 336 | Ga0105242_10185260 | 3300009176 | Bacteria | 1839 |
| 337 | Ga0105248_10006146 | 3300009177 | Bacteria | 13168 |
| 338 | Ga0105248_10043319 | 3300009177 | Bacteria | 5046 |
| 339 | Ga0105248_10073578 | 3300009177 | Bacteria | 3840 |
| 340 | Ga0105248_10261830 | 3300009177 | Bacteria | 1947 |
| 341 | Ga0105248_10280172 | 3300009177 | Bacteria | 1877 |
| 342 | Ga0105248_10578076 | 3300009177 | Bacteria | 1268 |
| 343 | Ga0105248_11128470 | 3300009177 | Bacteria | 886 |
| 344 | Ga0105248_11282184 | 3300009177 | Bacteria | 829 |
| 345 | Ga0105237_10087512 | 3300009545 | Bacteria | 3104 |
| 346 | Ga0105237_10172904 | 3300009545 | Bacteria | 2160 |
| 347 | Ga0105237_10365081 | 3300009545 | Bacteria | 1448 |
| 348 | Ga0105237_10444739 | 3300009545 | Bacteria | 1302 |
| 349 | Ga0105237_10784996 | 3300009545 | Bacteria | 959 |
| 350 | Ga0105237_11107592 | 3300009545 | Bacteria | 799 |
| 351 | Ga0105238_10000920 | 3300009551 | Bacteria | 30091 |
| 352 | Ga0105238_10001614 | 3300009551 | Bacteria | 22566 |
| 353 | Ga0105238_10009795 | 3300009551 | Bacteria | 9593 |
| 354 | Ga0105238_10012488 | 3300009551 | Bacteria | 8567 |
| 355 | Ga0105238_10021470 | 3300009551 | Bacteria | 6576 |
| 356 | Ga0105238_10055579 | 3300009551 | Bacteria | 3973 |
| 357 | Ga0105238_10160666 | 3300009551 | Bacteria | 2222 |
| 358 | Ga0105238_10209872 | 3300009551 | Bacteria | 1923 |
| 359 | Ga0105238_10430041 | 3300009551 | Bacteria | 1316 |
| 360 | Ga0105249_10008230 | 3300009553 | Bacteria | 9081 |
| 361 | Ga0105249_10017312 | 3300009553 | Bacteria | 6398 |
| 362 | Ga0105249_10100249 | 3300009553 | Bacteria | 2723 |
| 363 | Ga0105249_10147697 | 3300009553 | Bacteria | 2260 |
| 364 | Ga0105239_10035918 | 3300010375 | Bacteria | 5441 |
| 365 | Ga0105239_10267801 | 3300010375 | Bacteria | 1921 |
| 366 | Ga0105239_10498292 | 3300010375 | Bacteria | 1384 |
| 367 | Ga0105239_10531914 | 3300010375 | Bacteria | 1338 |
| 368 | Ga0105239_11122747 | 3300010375 | Bacteria | 905 |
| 369 | Ga0105246_10114347 | 3300011119 | Bacteria | 1988 |
| 370 | Ga0157373_10029820 | 3300013100 | Bacteria | 3927 |
| 371 | Ga0157373_10083347 | 3300013100 | Bacteria | 2253 |
| 372 | Ga0157373_10112131 | 3300013100 | Bacteria | 1917 |
| 373 | Ga0157373_10135969 | 3300013100 | Bacteria | 1728 |
| 374 | Ga0157373_10145897 | 3300013100 | Bacteria | 1664 |
| 375 | Ga0157373_10610902 | 3300013100 | Bacteria | 794 |
| 376 | Ga0157371_10009996 | 3300013102 | Bacteria | 7425 |
| 377 | Ga0157371_10160552 | 3300013102 | Bacteria | 1605 |
| 378 | Ga0157371_10174543 | 3300013102 | Bacteria | 1536 |
| 379 | Ga0157371_10525277 | 3300013102 | Bacteria | 876 |
| 380 | Ga0157370_10002653 | 3300013104 | Bacteria | 21474 |
| 381 | Ga0157370_10012599 | 3300013104 | Bacteria | 8763 |
| 382 | Ga0157370_10203964 | 3300013104 | Bacteria | 1834 |
| 383 | Ga0157370_10204346 | 3300013104 | Bacteria | 1832 |
| 384 | Ga0157370_10327171 | 3300013104 | Bacteria | 1413 |
| 385 | Ga0157370_10331173 | 3300013104 | Bacteria | 1404 |
| 386 | Ga0157370_10376156 | 3300013104 | Bacteria | 1308 |
| 387 | Ga0157370_11066015 | 3300013104 | Bacteria | 731 |
| 388 | Ga0157369_10000604 | 3300013105 | Bacteria | 46765 |
| 389 | Ga0157369_10009635 | 3300013105 | Bacteria | 11046 |
| 390 | Ga0157369_10100054 | 3300013105 | Bacteria | 3090 |
| 391 | Ga0157369_10153859 | 3300013105 | Bacteria | 2430 |
| 392 | Ga0157369_10183873 | 3300013105 | Bacteria | 2198 |
| 393 | Ga0157369_10306546 | 3300013105 | Bacteria | 1651 |
| 394 | Ga0157369_10393660 | 3300013105 | Bacteria | 1437 |
| 395 | Ga0157369_10403367 | 3300013105 | Bacteria | 1418 |
| 396 | Ga0157369_11744061 | 3300013105 | Bacteria | 632 |
| 397 | Ga0157374_10078441 | 3300013296 | Bacteria | 3128 |
| 398 | Ga0157374_10151348 | 3300013296 | Bacteria | 2256 |
| 399 | Ga0157374_10164751 | 3300013296 | Bacteria | 2160 |
| 400 | Ga0157374_10636689 | 3300013296 | Bacteria | 1078 |
| 401 | Ga0157378_10001163 | 3300013297 | Bacteria | 23938 |
| 402 | Ga0157378_10531467 | 3300013297 | Bacteria | 1179 |
| 403 | Ga0157378_11069854 | 3300013297 | Bacteria | 843 |
| 404 | Ga0163162_10001478 | 3300013306 | Bacteria | 21868 |
| 405 | Ga0163162_10025041 | 3300013306 | Bacteria | 5896 |
| 406 | Ga0163162_10027156 | 3300013306 | Bacteria | 5660 |
| 407 | Ga0163162_10208324 | 3300013306 | Bacteria | 2084 |
| 408 | Ga0163162_10216834 | 3300013306 | Bacteria | 2044 |
| 409 | Ga0157372_10007838 | 3300013307 | Bacteria | 11346 |
| 410 | Ga0157372_10009659 | 3300013307 | Bacteria | 10255 |
| 411 | Ga0157372_10014305 | 3300013307 | Bacteria | 8483 |
| 412 | Ga0157372_10019180 | 3300013307 | Bacteria | 7364 |
| 413 | Ga0157372_10064416 | 3300013307 | Bacteria | 4113 |
| 414 | Ga0157372_10113775 | 3300013307 | Bacteria | 3101 |
| 415 | Ga0157372_10259383 | 3300013307 | Bacteria | 2018 |
| 416 | Ga0157372_10343926 | 3300013307 | Bacteria | 1737 |
| 417 | Ga0157372_10736844 | 3300013307 | Bacteria | 1146 |
| 418 | Ga0157372_11212630 | 3300013307 | Bacteria | 872 |
| 419 | Ga0157372_11336942 | 3300013307 | Bacteria | 827 |
| 420 | Ga0157372_12579362 | 3300013307 | Bacteria | 583 |
| 421 | Ga0157375_10000156 | 3300013308 | Bacteria | 66009 |
| 422 | Ga0157375_10024911 | 3300013308 | Bacteria | 5547 |
| 423 | Ga0157375_10066299 | 3300013308 | Bacteria | 3603 |
| 424 | Ga0157375_10076006 | 3300013308 | Bacteria | 3384 |
| 425 | Ga0163163_10000143 | 3300014325 | Bacteria | 74622 |
| 426 | Ga0163163_10003585 | 3300014325 | Bacteria | 13189 |
| 427 | Ga0163163_10045235 | 3300014325 | Bacteria | 4320 |
| 428 | Ga0163163_11069381 | 3300014325 | Bacteria | 870 |
| 429 | Ga0182008_10160547 | 3300014497 | Bacteria | 1131 |
| 430 | Ga0157379_10010914 | 3300014968 | Bacteria | 7920 |
| 431 | Ga0157379_10053694 | 3300014968 | Bacteria | 3600 |
| 432 | Ga0157379_10053963 | 3300014968 | Bacteria | 3591 |
| 433 | Ga0157379_10187538 | 3300014968 | Bacteria | 1869 |
| 434 | Ga0157376_10002106 | 3300014969 | Bacteria | 13384 |
| 435 | Ga0157376_10018145 | 3300014969 | Bacteria | 5386 |
| 436 | Ga0157376_10031879 | 3300014969 | Bacteria | 4226 |
| 437 | Ga0157376_10055048 | 3300014969 | Bacteria | 3318 |
| 438 | Ga0182006_1045159 | 3300015261 | Bacteria | 1716 |
| 439 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 440 | Ga0163161_10096300 | 3300017792 | Bacteria | 2197 |
| 441 | Ga0163161_10254579 | 3300017792 | Bacteria | 1369 |
| 442 | Ga0197907_11347143 | 3300020069 | Bacteria | 1407 |
| 443 | Ga0206356_10554173 | 3300020070 | Bacteria | 12811 |
| 444 | Ga0206355_1326977 | 3300020076 | Bacteria | 1473 |
| 445 | Ga0206351_10077469 | 3300020077 | Bacteria | 2855 |
| 446 | Ga0206352_10199513 | 3300020078 | Bacteria | 1747 |
| 447 | Ga0206350_10412008 | 3300020080 | Bacteria | 976 |
| 448 | Ga0206354_10454696 | 3300020081 | Bacteria | 2355 |
| 449 | Ga0206354_10876343 | 3300020081 | Bacteria | 2276 |
| 450 | Ga0206354_10969686 | 3300020081 | Bacteria | 7400 |
| 451 | Ga0206353_10489060 | 3300020082 | Bacteria | 2953 |
| 452 | Ga0206353_11806100 | 3300020082 | Bacteria | 897 |
| 453 | Ga0154015_1038310 | 3300020610 | Bacteria | 2412 |
| 454 | Ga0154015_1247783 | 3300020610 | Bacteria | 4776 |
| 455 | Ga0213873_10025338 | 3300021358 | Bacteria | 1431 |
| 456 | Ga0213873_10053926 | 3300021358 | Bacteria | 1072 |
| 457 | Ga0213872_10000438 | 3300021361 | Bacteria | 34149 |
| 458 | Ga0213872_10001168 | 3300021361 | Bacteria | 17837 |
| 459 | Ga0213872_10005036 | 3300021361 | Bacteria | 6856 |
| 460 | Ga0213872_10019936 | 3300021361 | Bacteria | 3088 |
| 461 | Ga0213872_10044651 | 3300021361 | Bacteria | 2016 |
| 462 | Ga0213872_10055353 | 3300021361 | Bacteria | 1798 |
| 463 | Ga0213872_10064084 | 3300021361 | Bacteria | 1660 |
| 464 | Ga0213872_10086927 | 3300021361 | Bacteria | 1401 |
| 465 | Ga0213872_10200916 | 3300021361 | Bacteria | 854 |
| 466 | Ga0213874_10010862 | 3300021377 | Bacteria | 2291 |
| 467 | Ga0213876_10039233 | 3300021384 | Bacteria | 2502 |
| 468 | Ga0213876_10073494 | 3300021384 | Bacteria | 1805 |
| 469 | Ga0213876_10096606 | 3300021384 | Bacteria | 1565 |
| 470 | Ga0213876_10139567 | 3300021384 | Bacteria | 1289 |
| 471 | Ga0213876_10191663 | 3300021384 | Bacteria | 1087 |
| 472 | Ga0213871_10002106 | 3300021441 | Bacteria | 3582 |
| 473 | Ga0213871_10010533 | 3300021441 | Bacteria | 2100 |
| 474 | Ga0224712_10009341 | 3300022467 | Bacteria | 2951 |
| 475 | Ga0207425_1000030 | 3300025245 | Bacteria | 268200 |
| 476 | Ga0209026_1007176 | 3300025250 | Bacteria | 2567 |
| 477 | Ga0209148_1000465 | 3300025254 | Bacteria | 43292 |
| 478 | Ga0209129_1000063 | 3300025258 | Bacteria | 240205 |
| 479 | Ga0209565_1000048 | 3300025263 | Bacteria | 224961 |
| 480 | Ga0209455_1000412 | 3300025272 | Bacteria | 34309 |
| 481 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 482 | Ga0209673_1011110 | 3300025273 | Bacteria | 3737 |
| 483 | Ga0209130_1006749 | 3300025284 | Bacteria | 3669 |
| 484 | Ga0209675_1000045 | 3300025291 | Bacteria | 225750 |
| 485 | Ga0209676_1000024 | 3300025292 | Bacteria | 578839 |
| 486 | Ga0209676_1001796 | 3300025292 | Bacteria | 17987 |
| 487 | Ga0209676_1011794 | 3300025292 | Bacteria | 3492 |
| 488 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 489 | Ga0209025_1000013 | 3300025294 | Bacteria | 871757 |
| 490 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 491 | Ga0209564_1003044 | 3300025295 | Bacteria | 11921 |
| 492 | Ga0209758_1000014 | 3300025297 | Bacteria | 871757 |
| 493 | Ga0209758_1000059 | 3300025297 | Bacteria | 328458 |
| 494 | Ga0209758_1002649 | 3300025297 | Bacteria | 17731 |
| 495 | Ga0209758_1020793 | 3300025297 | Bacteria | 3087 |
| 496 | Ga0209758_1042195 | 3300025297 | Bacteria | 1694 |
| 497 | Ga0209758_1072879 | 3300025297 | Bacteria | 1072 |
| 498 | Ga0209050_1000101 | 3300025298 | Bacteria | 230076 |
| 499 | Ga0209050_1000603 | 3300025298 | Bacteria | 57120 |
| 500 | Ga0209050_1007717 | 3300025298 | Bacteria | 5943 |
| 501 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 502 | Ga0209256_1004724 | 3300025299 | Bacteria | 8337 |
| 503 | Ga0207426_1092821 | 3300025302 | Bacteria | 795 |
| 504 | Ga0209051_1005932 | 3300025303 | Bacteria | 7012 |
| 505 | Ga0209257_1000122 | 3300025304 | Bacteria | 219678 |
| 506 | Ga0209257_1000190 | 3300025304 | Bacteria | 153686 |
| 507 | Ga0209257_1000217 | 3300025304 | Bacteria | 136049 |
| 508 | Ga0209257_1000220 | 3300025304 | Bacteria | 135116 |
| 509 | Ga0209257_1002470 | 3300025304 | Bacteria | 18283 |
| 510 | Ga0209257_1002924 | 3300025304 | Bacteria | 15742 |
| 511 | Ga0209257_1014213 | 3300025304 | Bacteria | 3442 |
| 512 | Ga0207656_10027977 | 3300025321 | Bacteria | 2310 |
| 513 | Ga0207656_10223004 | 3300025321 | Bacteria | 917 |
| 514 | Ga0207655_1047992 | 3300025728 | Bacteria | 1757 |
| 515 | Ga0207713_1000327 | 3300025735 | Bacteria | 53351 |
| 516 | Ga0207642_10098589 | 3300025899 | Bacteria | 1461 |
| 517 | Ga0207710_10110327 | 3300025900 | Bacteria | 1306 |
| 518 | Ga0207680_10037045 | 3300025903 | Bacteria | 2813 |
| 519 | Ga0207680_10090610 | 3300025903 | Bacteria | 1944 |
| 520 | Ga0207680_10249450 | 3300025903 | Bacteria | 1226 |
| 521 | Ga0207680_10417757 | 3300025903 | Bacteria | 949 |
| 522 | Ga0207680_10453300 | 3300025903 | Bacteria | 911 |
| 523 | Ga0207647_10000111 | 3300025904 | Bacteria | 62900 |
| 524 | Ga0207647_10011815 | 3300025904 | Bacteria | 6103 |
| 525 | Ga0207647_10016203 | 3300025904 | Bacteria | 5089 |
| 526 | Ga0207643_10030175 | 3300025908 | Bacteria | 3017 |
| 527 | Ga0207705_10000083 | 3300025909 | Bacteria | 117366 |
| 528 | Ga0207705_10000798 | 3300025909 | Bacteria | 25879 |
| 529 | Ga0207705_10001414 | 3300025909 | Bacteria | 19120 |
| 530 | Ga0207705_10010215 | 3300025909 | Bacteria | 6829 |
| 531 | Ga0207705_10010553 | 3300025909 | Bacteria | 6715 |
| 532 | Ga0207705_10032237 | 3300025909 | Bacteria | 3743 |
| 533 | Ga0207705_10274583 | 3300025909 | Bacteria | 1289 |
| 534 | Ga0207705_10640786 | 3300025909 | Bacteria | 826 |
| 535 | Ga0207684_10180136 | 3300025910 | Bacteria | 1822 |
| 536 | Ga0207654_10116176 | 3300025911 | Bacteria | 1673 |
| 537 | Ga0207707_10000069 | 3300025912 | Bacteria | 103460 |
| 538 | Ga0207707_10000217 | 3300025912 | Bacteria | 61755 |
| 539 | Ga0207707_10000292 | 3300025912 | Bacteria | 53455 |
| 540 | Ga0207707_10001098 | 3300025912 | Bacteria | 25804 |
| 541 | Ga0207707_10002049 | 3300025912 | Bacteria | 18304 |
| 542 | Ga0207707_10052169 | 3300025912 | Bacteria | 3562 |
| 543 | Ga0207707_10058921 | 3300025912 | Bacteria | 3341 |
| 544 | Ga0207707_10070332 | 3300025912 | Bacteria | 3050 |
| 545 | Ga0207707_10090013 | 3300025912 | Bacteria | 2682 |
| 546 | Ga0207707_10353062 | 3300025912 | Bacteria | 1267 |
| 547 | Ga0207695_10000033 | 3300025913 | Bacteria | 507477 |
| 548 | Ga0207695_10000718 | 3300025913 | Bacteria | 64451 |
| 549 | Ga0207695_10000970 | 3300025913 | Bacteria | 51112 |
| 550 | Ga0207695_10001195 | 3300025913 | Bacteria | 44633 |
| 551 | Ga0207695_10003038 | 3300025913 | Bacteria | 24050 |
| 552 | Ga0207695_10003936 | 3300025913 | Bacteria | 20547 |
| 553 | Ga0207695_10004599 | 3300025913 | Bacteria | 18742 |
| 554 | Ga0207695_10005898 | 3300025913 | Bacteria | 16065 |
| 555 | Ga0207695_10010907 | 3300025913 | Bacteria | 11055 |
| 556 | Ga0207695_10017139 | 3300025913 | Bacteria | 8444 |
| 557 | Ga0207695_10028170 | 3300025913 | Bacteria | 6237 |
| 558 | Ga0207695_10088820 | 3300025913 | Bacteria | 3110 |
| 559 | Ga0207695_10210411 | 3300025913 | Bacteria | 1856 |
| 560 | Ga0207695_10326066 | 3300025913 | Bacteria | 1425 |
| 561 | Ga0207695_10338139 | 3300025913 | Bacteria | 1393 |
| 562 | Ga0207671_10016464 | 3300025914 | Bacteria | 5745 |
| 563 | Ga0207671_10018278 | 3300025914 | Bacteria | 5382 |
| 564 | Ga0207671_10042029 | 3300025914 | Bacteria | 3384 |
| 565 | Ga0207671_10121823 | 3300025914 | Bacteria | 1994 |
| 566 | Ga0207671_10126386 | 3300025914 | Bacteria | 1959 |
| 567 | Ga0207671_10330370 | 3300025914 | Bacteria | 1207 |
| 568 | Ga0207671_10533916 | 3300025914 | Bacteria | 935 |
| 569 | Ga0207693_10224028 | 3300025915 | Bacteria | 1477 |
| 570 | Ga0207693_10348915 | 3300025915 | Bacteria | 1158 |
| 571 | Ga0207663_10079527 | 3300025916 | Bacteria | 2141 |
| 572 | Ga0207663_10113620 | 3300025916 | Bacteria | 1842 |
| 573 | Ga0207660_10000080 | 3300025917 | Bacteria | 50991 |
| 574 | Ga0207660_10000424 | 3300025917 | Bacteria | 27861 |
| 575 | Ga0207660_10003626 | 3300025917 | Bacteria | 10067 |
| 576 | Ga0207660_10007036 | 3300025917 | Bacteria | 7286 |
| 577 | Ga0207660_10012164 | 3300025917 | Bacteria | 5624 |
| 578 | Ga0207660_10021898 | 3300025917 | Bacteria | 4302 |
| 579 | Ga0207660_10108895 | 3300025917 | Bacteria | 2081 |
| 580 | Ga0207657_10003790 | 3300025919 | Bacteria | 16076 |
| 581 | Ga0207657_10004044 | 3300025919 | Bacteria | 15581 |
| 582 | Ga0207657_10009693 | 3300025919 | Bacteria | 9660 |
| 583 | Ga0207657_10028669 | 3300025919 | Bacteria | 5074 |
| 584 | Ga0207657_10068037 | 3300025919 | Bacteria | 3026 |
| 585 | Ga0207657_10086378 | 3300025919 | Bacteria | 2626 |
| 586 | Ga0207657_10091470 | 3300025919 | Bacteria | 2537 |
| 587 | Ga0207657_10132187 | 3300025919 | Bacteria | 2045 |
| 588 | Ga0207649_10001073 | 3300025920 | Bacteria | 16700 |
| 589 | Ga0207649_10048120 | 3300025920 | Bacteria | 2629 |
| 590 | Ga0207649_10061362 | 3300025920 | Bacteria | 2366 |
| 591 | Ga0207652_10000426 | 3300025921 | Bacteria | 43785 |
| 592 | Ga0207652_10002658 | 3300025921 | Bacteria | 14994 |
| 593 | Ga0207652_10018427 | 3300025921 | Bacteria | 5726 |
| 594 | Ga0207652_10023654 | 3300025921 | Bacteria | 5090 |
| 595 | Ga0207652_10027696 | 3300025921 | Bacteria | 4724 |
| 596 | Ga0207652_10054583 | 3300025921 | Bacteria | 3435 |
| 597 | Ga0207652_10088077 | 3300025921 | Bacteria | 2723 |
| 598 | Ga0207652_10515537 | 3300025921 | Bacteria | 1076 |
| 599 | Ga0207681_10018428 | 3300025923 | Bacteria | 4398 |
| 600 | Ga0207681_10078688 | 3300025923 | Bacteria | 2321 |
| 601 | Ga0207681_10165896 | 3300025923 | Bacteria | 1670 |
| 602 | Ga0207681_10418980 | 3300025923 | Bacteria | 1085 |
| 603 | Ga0207681_10469328 | 3300025923 | Bacteria | 1026 |
| 604 | Ga0207694_10000613 | 3300025924 | Bacteria | 32386 |
| 605 | Ga0207694_10001014 | 3300025924 | Bacteria | 24489 |
| 606 | Ga0207694_10006504 | 3300025924 | Bacteria | 8891 |
| 607 | Ga0207694_10015471 | 3300025924 | Bacteria | 5753 |
| 608 | Ga0207694_10048535 | 3300025924 | Bacteria | 3285 |
| 609 | Ga0207694_10127442 | 3300025924 | Bacteria | 2038 |
| 610 | Ga0207694_10421469 | 3300025924 | Bacteria | 1112 |
| 611 | Ga0207694_10691820 | 3300025924 | Bacteria | 860 |
| 612 | Ga0207694_10939689 | 3300025924 | Bacteria | 731 |
| 613 | Ga0207650_10000062 | 3300025925 | Bacteria | 149776 |
| 614 | Ga0207650_10013073 | 3300025925 | Bacteria | 5742 |
| 615 | Ga0207650_10027556 | 3300025925 | Bacteria | 4068 |
| 616 | Ga0207650_10191868 | 3300025925 | Bacteria | 1633 |
| 617 | Ga0207650_10497271 | 3300025925 | Bacteria | 1019 |
| 618 | Ga0207650_10762735 | 3300025925 | Bacteria | 819 |
| 619 | Ga0207650_10806022 | 3300025925 | Bacteria | 796 |
| 620 | Ga0207659_10329774 | 3300025926 | Bacteria | 1261 |
| 621 | Ga0207700_11226758 | 3300025928 | Bacteria | 669 |
| 622 | Ga0207644_10002909 | 3300025931 | Bacteria | 11032 |
| 623 | Ga0207644_10047358 | 3300025931 | Bacteria | 3067 |
| 624 | Ga0207644_10061462 | 3300025931 | Bacteria | 2721 |
| 625 | Ga0207644_10268330 | 3300025931 | Bacteria | 1366 |
| 626 | Ga0207644_10358483 | 3300025931 | Bacteria | 1185 |
| 627 | Ga0207690_10000053 | 3300025932 | Bacteria | 105125 |
| 628 | Ga0207690_10002733 | 3300025932 | Bacteria | 10651 |
| 629 | Ga0207690_10003205 | 3300025932 | Bacteria | 9817 |
| 630 | Ga0207690_10007092 | 3300025932 | Bacteria | 6657 |
| 631 | Ga0207690_10027387 | 3300025932 | Bacteria | 3601 |
| 632 | Ga0207690_10485616 | 3300025932 | Bacteria | 997 |
| 633 | Ga0207706_10018542 | 3300025933 | Bacteria | 6261 |
| 634 | Ga0207706_10027221 | 3300025933 | Bacteria | 5114 |
| 635 | Ga0207706_10158101 | 3300025933 | Bacteria | 1993 |
| 636 | Ga0207706_10353204 | 3300025933 | Bacteria | 1278 |
| 637 | Ga0207686_10027308 | 3300025934 | Bacteria | 3341 |
| 638 | Ga0207686_10096284 | 3300025934 | Bacteria | 1966 |
| 639 | Ga0207709_10012485 | 3300025935 | Bacteria | 4677 |
| 640 | Ga0207709_10204820 | 3300025935 | Bacteria | 1412 |
| 641 | Ga0207670_10266685 | 3300025936 | Bacteria | 1329 |
| 642 | Ga0207669_10009736 | 3300025937 | Bacteria | 4593 |
| 643 | Ga0207669_10015571 | 3300025937 | Bacteria | 3838 |
| 644 | Ga0207669_10335405 | 3300025937 | Bacteria | 1162 |
| 645 | Ga0207704_10002126 | 3300025938 | Bacteria | 8882 |
| 646 | Ga0207704_10059788 | 3300025938 | Bacteria | 2354 |
| 647 | Ga0207704_10069509 | 3300025938 | Bacteria | 2225 |
| 648 | Ga0207704_10113911 | 3300025938 | Bacteria | 1835 |
| 649 | Ga0207691_10001351 | 3300025940 | Bacteria | 24456 |
| 650 | Ga0207691_10025374 | 3300025940 | Bacteria | 5566 |
| 651 | Ga0207691_10035026 | 3300025940 | Bacteria | 4665 |
| 652 | Ga0207711_10012717 | 3300025941 | Bacteria | 6990 |
| 653 | Ga0207711_10024660 | 3300025941 | Bacteria | 5043 |
| 654 | Ga0207711_10027271 | 3300025941 | Bacteria | 4797 |
| 655 | Ga0207711_10042670 | 3300025941 | Bacteria | 3865 |
| 656 | Ga0207711_10141256 | 3300025941 | Bacteria | 2167 |
| 657 | Ga0207711_10192184 | 3300025941 | Bacteria | 1861 |
| 658 | Ga0207711_10253028 | 3300025941 | Bacteria | 1618 |
| 659 | Ga0207711_10457639 | 3300025941 | Bacteria | 1188 |
| 660 | Ga0207689_10027678 | 3300025942 | Bacteria | 4745 |
| 661 | Ga0207689_10495832 | 3300025942 | Bacteria | 1023 |
| 662 | Ga0207661_10008563 | 3300025944 | Bacteria | 7312 |
| 663 | Ga0207661_10011284 | 3300025944 | Bacteria | 6465 |
| 664 | Ga0207661_10085429 | 3300025944 | Bacteria | 2615 |
| 665 | Ga0207661_10206773 | 3300025944 | Bacteria | 1728 |
| 666 | Ga0207661_10427520 | 3300025944 | Bacteria | 1204 |
| 667 | Ga0207679_10029143 | 3300025945 | Bacteria | 3841 |
| 668 | Ga0207679_10145402 | 3300025945 | Bacteria | 1922 |
| 669 | Ga0207679_10253811 | 3300025945 | Bacteria | 1496 |
| 670 | Ga0207679_10551447 | 3300025945 | Bacteria | 1034 |
| 671 | Ga0207667_10001111 | 3300025949 | Bacteria | 33935 |
| 672 | Ga0207667_10001609 | 3300025949 | Bacteria | 28404 |
| 673 | Ga0207667_10003472 | 3300025949 | Bacteria | 19452 |
| 674 | Ga0207667_10011832 | 3300025949 | Bacteria | 10106 |
| 675 | Ga0207667_10063144 | 3300025949 | Bacteria | 3870 |
| 676 | Ga0207667_10072340 | 3300025949 | Bacteria | 3584 |
| 677 | Ga0207667_10091489 | 3300025949 | Bacteria | 3143 |
| 678 | Ga0207667_10103518 | 3300025949 | Bacteria | 2936 |
| 679 | Ga0207667_10129933 | 3300025949 | Bacteria | 2594 |
| 680 | Ga0207667_10416059 | 3300025949 | Bacteria | 1368 |
| 681 | Ga0207651_10665055 | 3300025960 | Bacteria | 915 |
| 682 | Ga0207712_10000477 | 3300025961 | Bacteria | 33669 |
| 683 | Ga0207712_10004191 | 3300025961 | Bacteria | 9106 |
| 684 | Ga0207712_10152540 | 3300025961 | Bacteria | 1786 |
| 685 | Ga0207668_10002053 | 3300025972 | Bacteria | 11734 |
| 686 | Ga0207668_10005939 | 3300025972 | Bacteria | 7193 |
| 687 | Ga0207668_10007910 | 3300025972 | Bacteria | 6320 |
| 688 | Ga0207668_10016894 | 3300025972 | Bacteria | 4565 |
| 689 | Ga0207668_10036557 | 3300025972 | Bacteria | 3278 |
| 690 | Ga0207668_10302012 | 3300025972 | Bacteria | 1321 |
| 691 | Ga0207640_10001700 | 3300025981 | Bacteria | 11794 |
| 692 | Ga0207640_10002489 | 3300025981 | Bacteria | 9868 |
| 693 | Ga0207640_10008966 | 3300025981 | Bacteria | 5575 |
| 694 | Ga0207640_10008981 | 3300025981 | Bacteria | 5570 |
| 695 | Ga0207640_10370153 | 3300025981 | Bacteria | 1158 |
| 696 | Ga0207640_10412900 | 3300025981 | Bacteria | 1102 |
| 697 | Ga0207640_10592057 | 3300025981 | Bacteria | 938 |
| 698 | Ga0207658_10000218 | 3300025986 | Bacteria | 60270 |
| 699 | Ga0207658_10030679 | 3300025986 | Bacteria | 3809 |
| 700 | Ga0207658_10077471 | 3300025986 | Bacteria | 2537 |
| 701 | Ga0207658_10104463 | 3300025986 | Bacteria | 2226 |
| 702 | Ga0207658_10148354 | 3300025986 | Bacteria | 1907 |
| 703 | Ga0207658_10155210 | 3300025986 | Bacteria | 1870 |
| 704 | Ga0207658_10213565 | 3300025986 | Bacteria | 1618 |
| 705 | Ga0207658_10517957 | 3300025986 | Bacteria | 1064 |
| 706 | Ga0207658_10520288 | 3300025986 | Bacteria | 1062 |
| 707 | Ga0207658_10672999 | 3300025986 | Bacteria | 934 |
| 708 | Ga0207677_10021403 | 3300026023 | Bacteria | 3950 |
| 709 | Ga0207677_10125262 | 3300026023 | Bacteria | 1940 |
| 710 | Ga0207677_10864706 | 3300026023 | Bacteria | 813 |
| 711 | Ga0207703_10000038 | 3300026035 | Bacteria | 175917 |
| 712 | Ga0207703_10002250 | 3300026035 | Bacteria | 16865 |
| 713 | Ga0207703_10017790 | 3300026035 | Bacteria | 5550 |
| 714 | Ga0207703_10361156 | 3300026035 | Bacteria | 1339 |
| 715 | Ga0207639_10000197 | 3300026041 | Bacteria | 45460 |
| 716 | Ga0207639_10000985 | 3300026041 | Bacteria | 19385 |
| 717 | Ga0207639_10002481 | 3300026041 | Bacteria | 12369 |
| 718 | Ga0207639_10005918 | 3300026041 | Bacteria | 8289 |
| 719 | Ga0207639_10026929 | 3300026041 | Bacteria | 4182 |
| 720 | Ga0207639_10124773 | 3300026041 | Bacteria | 2121 |
| 721 | Ga0207639_10173855 | 3300026041 | Bacteria | 1826 |
| 722 | Ga0207639_10448771 | 3300026041 | Bacteria | 1170 |
| 723 | Ga0207639_10470318 | 3300026041 | Bacteria | 1144 |
| 724 | Ga0207639_10706516 | 3300026041 | Bacteria | 936 |
| 725 | Ga0207678_10001457 | 3300026067 | Bacteria | 21704 |
| 726 | Ga0207678_10007555 | 3300026067 | Bacteria | 9606 |
| 727 | Ga0207678_10025970 | 3300026067 | Bacteria | 5111 |
| 728 | Ga0207678_10106323 | 3300026067 | Bacteria | 2394 |
| 729 | Ga0207678_10124578 | 3300026067 | Bacteria | 2199 |
| 730 | Ga0207678_10221518 | 3300026067 | Bacteria | 1619 |
| 731 | Ga0207678_10460643 | 3300026067 | Bacteria | 1106 |
| 732 | Ga0207678_10501609 | 3300026067 | Bacteria | 1058 |
| 733 | Ga0207708_10230859 | 3300026075 | Bacteria | 1486 |
| 734 | Ga0207702_10010647 | 3300026078 | Bacteria | 7685 |
| 735 | Ga0207702_10019720 | 3300026078 | Bacteria | 5583 |
| 736 | Ga0207702_10030424 | 3300026078 | Bacteria | 4499 |
| 737 | Ga0207702_10055885 | 3300026078 | Bacteria | 3349 |
| 738 | Ga0207702_10150176 | 3300026078 | Bacteria | 2118 |
| 739 | Ga0207702_10223301 | 3300026078 | Bacteria | 1756 |
| 740 | Ga0207702_10371408 | 3300026078 | Bacteria | 1373 |
| 741 | Ga0207702_10390694 | 3300026078 | Bacteria | 1340 |
| 742 | Ga0207641_10000012 | 3300026088 | Bacteria | 375486 |
| 743 | Ga0207641_10050966 | 3300026088 | Bacteria | 3504 |
| 744 | Ga0207641_10077304 | 3300026088 | Bacteria | 2880 |
| 745 | Ga0207641_10200245 | 3300026088 | Bacteria | 1840 |
| 746 | Ga0207641_10332158 | 3300026088 | Bacteria | 1444 |
| 747 | Ga0207641_10375003 | 3300026088 | Bacteria | 1361 |
| 748 | Ga0207648_10025833 | 3300026089 | Bacteria | 5226 |
| 749 | Ga0207648_10047883 | 3300026089 | Bacteria | 3745 |
| 750 | Ga0207648_10052874 | 3300026089 | Bacteria | 3551 |
| 751 | Ga0207648_10240152 | 3300026089 | Bacteria | 1613 |
| 752 | Ga0207648_10287023 | 3300026089 | Bacteria | 1473 |
| 753 | Ga0207676_10000437 | 3300026095 | Bacteria | 35190 |
| 754 | Ga0207676_10002572 | 3300026095 | Bacteria | 12942 |
| 755 | Ga0207676_10362613 | 3300026095 | Bacteria | 1343 |
| 756 | Ga0207676_10366255 | 3300026095 | Bacteria | 1337 |
| 757 | Ga0207676_10741726 | 3300026095 | Bacteria | 954 |
| 758 | Ga0207674_10005969 | 3300026116 | Bacteria | 14413 |
| 759 | Ga0207674_10011504 | 3300026116 | Bacteria | 9939 |
| 760 | Ga0207674_10101934 | 3300026116 | Bacteria | 2851 |
| 761 | Ga0207675_100111099 | 3300026118 | Bacteria | 2586 |
| 762 | Ga0207675_101524300 | 3300026118 | Bacteria | 689 |
| 763 | Ga0207683_10003839 | 3300026121 | Bacteria | 13024 |
| 764 | Ga0207683_10045165 | 3300026121 | Bacteria | 3852 |
| 765 | Ga0207683_10053471 | 3300026121 | Bacteria | 3541 |
| 766 | Ga0207683_10060238 | 3300026121 | Bacteria | 3337 |
| 767 | Ga0207683_10127845 | 3300026121 | Bacteria | 2284 |
| 768 | Ga0207683_10305650 | 3300026121 | Bacteria | 1455 |
| 769 | Ga0207683_10333198 | 3300026121 | Bacteria | 1391 |
| 770 | Ga0207698_10000983 | 3300026142 | Bacteria | 16579 |
| 771 | Ga0207698_10004659 | 3300026142 | Bacteria | 8381 |
| 772 | Ga0207698_10019313 | 3300026142 | Bacteria | 4663 |
| 773 | Ga0207698_10021881 | 3300026142 | Bacteria | 4431 |
| 774 | Ga0207698_10078947 | 3300026142 | Bacteria | 2645 |
| 775 | Ga0207698_11024265 | 3300026142 | Bacteria | 837 |
| 776 | Ga0209281_1030707 | 3300027111 | Bacteria | 963 |
| 777 | Ga0209371_1000016 | 3300027312 | Bacteria | 646301 |
| 778 | Ga0209984_1000589 | 3300027424 | Bacteria | 3957 |
| 779 | Ga0210000_1020682 | 3300027462 | Bacteria | 1005 |
| 780 | Ga0209995_1000742 | 3300027471 | Bacteria | 4995 |
| 781 | Ga0209999_1000894 | 3300027543 | Bacteria | 4996 |
| 782 | Ga0209982_1006214 | 3300027552 | Bacteria | 1734 |
| 783 | Ga0209970_1008518 | 3300027614 | Bacteria | 1681 |
| 784 | Ga0209983_1018050 | 3300027665 | Bacteria | 1463 |
| 785 | Ga0209971_1001431 | 3300027682 | Bacteria | 5944 |
| 786 | Ga0209813_10002244 | 3300027866 | Bacteria | 4412 |
| 787 | Ga0209974_10046121 | 3300027876 | Bacteria | 1457 |
| 788 | Ga0207428_10000242 | 3300027907 | Bacteria | 74839 |
| 789 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 790 | Ga0268266_10000064 | 3300028379 | Bacteria | 249533 |
| 791 | Ga0268266_10006542 | 3300028379 | Bacteria | 10664 |
| 792 | Ga0268266_10013935 | 3300028379 | Bacteria | 6922 |
| 793 | Ga0268266_10093761 | 3300028379 | Bacteria | 2634 |
| 794 | Ga0268266_10138240 | 3300028379 | Bacteria | 2184 |
| 795 | Ga0268266_10216332 | 3300028379 | Bacteria | 1759 |
| 796 | Ga0268266_10232768 | 3300028379 | Bacteria | 1697 |
| 797 | Ga0268266_10752231 | 3300028379 | Bacteria | 941 |
| 798 | Ga0268265_10003538 | 3300028380 | Bacteria | 11176 |
| 799 | Ga0268265_10017919 | 3300028380 | Bacteria | 4898 |
| 800 | Ga0268265_10024029 | 3300028380 | Bacteria | 4305 |
| 801 | Ga0268265_10065739 | 3300028380 | Bacteria | 2800 |
| 802 | Ga0268265_10067098 | 3300028380 | Bacteria | 2776 |
| 803 | Ga0268265_10073511 | 3300028380 | Bacteria | 2670 |
| 804 | Ga0268265_10143311 | 3300028380 | Bacteria | 2003 |
| 805 | Ga0268265_10334732 | 3300028380 | Bacteria | 1376 |
| 806 | Ga0268265_10438920 | 3300028380 | Bacteria | 1216 |
| 807 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 808 | Ga0268264_10000059 | 3300028381 | Bacteria | 306927 |
| 809 | Ga0268264_10011951 | 3300028381 | Bacteria | 7149 |
| 810 | Ga0268264_10020551 | 3300028381 | Bacteria | 5395 |
| 811 | Ga0268264_10029670 | 3300028381 | Bacteria | 4482 |
| 812 | Ga0268264_10193780 | 3300028381 | Bacteria | 1854 |
| 813 | Ga0268264_10292272 | 3300028381 | Bacteria | 1531 |
| 814 | Ga0268264_10358715 | 3300028381 | Bacteria | 1390 |
| 815 | Ga0265337_1026919 | 3300028556 | Bacteria | 1737 |
| 816 | Ga0307517_10027160 | 3300028786 | Bacteria | 6886 |
| 817 | Ga0307517_10053780 | 3300028786 | Bacteria | 4001 |
| 818 | Ga0307517_10170521 | 3300028786 | Bacteria | 1432 |
| 819 | Ga0307515_10232570 | 3300028794 | Bacteria | 1632 |
| 820 | Ga0265338_10008247 | 3300028800 | Bacteria | 12686 |
| 821 | Ga0265338_10121631 | 3300028800 | Bacteria | 2080 |
| 822 | Ga0265338_10523677 | 3300028800 | Bacteria | 832 |
| 823 | Ga0268256_1000015 | 3300030500 | Bacteria | 646300 |
| 824 | Ga0307511_10012065 | 3300030521 | Bacteria | 8495 |
| 825 | Ga0307512_10153748 | 3300030522 | Bacteria | 1368 |
| 826 | Ga0307512_10178569 | 3300030522 | Bacteria | 1199 |
| 827 | Ga0314311_1188486 | 3300030733 | Bacteria | 7455 |
| 828 | Ga0316178_1153819 | 3300030735 | Bacteria | 1612 |
| 829 | Ga0316181_1070224 | 3300030744 | Bacteria | 1795 |
| 830 | Ga0265770_1027594 | 3300030878 | Bacteria | 935 |
| 831 | Ga0265760_10026772 | 3300031090 | Bacteria | 1688 |
| 832 | Ga0265328_10000024 | 3300031239 | Bacteria | 123047 |
| 833 | Ga0265329_10058428 | 3300031242 | Bacteria | 1221 |
| 834 | Ga0265340_10061657 | 3300031247 | Bacteria | 1793 |
| 835 | Ga0265331_10000695 | 3300031250 | Bacteria | 28793 |
| 836 | Ga0265331_10079576 | 3300031250 | Bacteria | 1524 |
| 837 | Ga0265327_10000602 | 3300031251 | Bacteria | 59632 |
| 838 | Ga0265327_10005667 | 3300031251 | Bacteria | 10335 |
| 839 | Ga0265327_10026828 | 3300031251 | Bacteria | 3327 |
| 840 | Ga0265327_10064376 | 3300031251 | Bacteria | 1858 |
| 841 | Ga0265316_10000169 | 3300031344 | Bacteria | 73902 |
| 842 | Ga0307513_10000261 | 3300031456 | Bacteria | 76045 |
| 843 | Ga0307513_10005614 | 3300031456 | Bacteria | 16535 |
| 844 | Ga0307513_10007398 | 3300031456 | Bacteria | 14249 |
| 845 | Ga0307513_10017161 | 3300031456 | Bacteria | 8689 |
| 846 | Ga0307513_10024641 | 3300031456 | Bacteria | 6995 |
| 847 | Ga0307513_10110818 | 3300031456 | Bacteria | 2739 |
| 848 | Ga0307513_10164307 | 3300031456 | Bacteria | 2107 |
| 849 | Ga0307513_10220515 | 3300031456 | Bacteria | 1718 |
| 850 | Ga0307408_100023432 | 3300031548 | Bacteria | 4205 |
| 851 | Ga0307408_100059383 | 3300031548 | Bacteria | 2783 |
| 852 | Ga0307408_100556187 | 3300031548 | Bacteria | 1013 |
| 853 | Ga0265313_10000607 | 3300031595 | Bacteria | 37291 |
| 854 | Ga0307508_10178564 | 3300031616 | Bacteria | 1726 |
| 855 | Ga0316575_10008349 | 3300031665 | Bacteria | 3769 |
| 856 | Ga0316579_10001331 | 3300031691 | Bacteria | 8924 |
| 857 | Ga0316579_10068192 | 3300031691 | Bacteria | 1682 |
| 858 | Ga0265314_10017596 | 3300031711 | Bacteria | 5604 |
| 859 | Ga0265314_10084856 | 3300031711 | Bacteria | 2078 |
| 860 | Ga0265342_10116897 | 3300031712 | Bacteria | 1505 |
| 861 | Ga0265342_10161256 | 3300031712 | Bacteria | 1239 |
| 862 | Ga0316576_10000900 | 3300031727 | Bacteria | 15127 |
| 863 | Ga0316576_10004461 | 3300031727 | Bacteria | 8398 |
| 864 | Ga0316576_10009679 | 3300031727 | Bacteria | 6234 |
| 865 | Ga0316576_10091862 | 3300031727 | Bacteria | 2262 |
| 866 | Ga0316576_10121259 | 3300031727 | Bacteria | 1963 |
| 867 | Ga0316576_10196710 | 3300031727 | Bacteria | 1519 |
| 868 | Ga0316576_10234188 | 3300031727 | Bacteria | 1380 |
| 869 | Ga0316576_10336766 | 3300031727 | Bacteria | 1124 |
| 870 | Ga0316578_10005182 | 3300031728 | Bacteria | 6283 |
| 871 | Ga0307516_10000352 | 3300031730 | Bacteria | 59644 |
| 872 | Ga0307516_10018741 | 3300031730 | Bacteria | 7187 |
| 873 | Ga0307405_10046357 | 3300031731 | Bacteria | 2670 |
| 874 | Ga0316577_10001973 | 3300031733 | Bacteria | 9973 |
| 875 | Ga0316577_10042778 | 3300031733 | Bacteria | 2534 |
| 876 | Ga0307413_10009990 | 3300031824 | Bacteria | 4575 |
| 877 | Ga0307413_10190025 | 3300031824 | Bacteria | 1473 |
| 878 | Ga0307413_10662777 | 3300031824 | Bacteria | 862 |
| 879 | Ga0307413_10669137 | 3300031824 | Bacteria | 858 |
| 880 | Ga0307410_10117306 | 3300031852 | Bacteria | 1935 |
| 881 | Ga0307410_11102228 | 3300031852 | Bacteria | 688 |
| 882 | Ga0307406_10109733 | 3300031901 | Bacteria | 1897 |
| 883 | Ga0307406_10141486 | 3300031901 | Bacteria | 1703 |
| 884 | Ga0307406_10219643 | 3300031901 | Bacteria | 1412 |
| 885 | Ga0307406_10436702 | 3300031901 | Bacteria | 1047 |
| 886 | Ga0307407_10264115 | 3300031903 | Bacteria | 1185 |
| 887 | Ga0307407_11090732 | 3300031903 | Bacteria | 620 |
| 888 | Ga0307412_10048584 | 3300031911 | Bacteria | 2791 |
| 889 | Ga0307412_10494193 | 3300031911 | Bacteria | 1017 |
| 890 | Ga0307412_10513885 | 3300031911 | Bacteria | 999 |
| 891 | Ga0307412_10585257 | 3300031911 | Bacteria | 943 |
| 892 | Ga0307412_11110326 | 3300031911 | Bacteria | 704 |
| 893 | Ga0307409_100053157 | 3300031995 | Bacteria | 3111 |
| 894 | Ga0307409_100061798 | 3300031995 | Bacteria | 2929 |
| 895 | Ga0307409_100525752 | 3300031995 | Bacteria | 1156 |
| 896 | Ga0307416_100323099 | 3300032002 | Bacteria | 1546 |
| 897 | Ga0307416_100426224 | 3300032002 | Bacteria | 1372 |
| 898 | Ga0307416_102011566 | 3300032002 | Bacteria | 680 |
| 899 | Ga0307414_10001661 | 3300032004 | Bacteria | 11568 |
| 900 | Ga0307414_10005182 | 3300032004 | Bacteria | 7154 |
| 901 | Ga0307414_10028486 | 3300032004 | Bacteria | 3624 |
| 902 | Ga0307414_10056888 | 3300032004 | Bacteria | 2746 |
| 903 | Ga0307414_10172549 | 3300032004 | Bacteria | 1730 |
| 904 | Ga0307414_10173982 | 3300032004 | Bacteria | 1724 |
| 905 | Ga0307414_10252600 | 3300032004 | Bacteria | 1467 |
| 906 | Ga0307414_10258936 | 3300032004 | Bacteria | 1450 |
| 907 | Ga0307414_10270265 | 3300032004 | Bacteria | 1423 |
| 908 | Ga0307414_10359988 | 3300032004 | Bacteria | 1251 |
| 909 | Ga0307414_10785632 | 3300032004 | Bacteria | 867 |
| 910 | Ga0307414_11343977 | 3300032004 | Bacteria | 663 |
| 911 | Ga0307414_11409177 | 3300032004 | Bacteria | 648 |
| 912 | Ga0307411_10042344 | 3300032005 | Bacteria | 2904 |
| 913 | Ga0307411_10256788 | 3300032005 | Bacteria | 1377 |
| 914 | Ga0307415_100301046 | 3300032126 | Bacteria | 1328 |
| 915 | Ga0307415_101077745 | 3300032126 | Bacteria | 751 |
| 916 | Ga0307415_101328188 | 3300032126 | Bacteria | 682 |
| 917 | Ga0316583_10001721 | 3300032133 | Bacteria | 7442 |
| 918 | Ga0316585_10003785 | 3300032137 | Bacteria | 4179 |
| 919 | Ga0316580_10003161 | 3300032139 | Bacteria | 4655 |
| 920 | Ga0316580_10042141 | 3300032139 | Bacteria | 1409 |
| 921 | Ga0316580_10100714 | 3300032139 | Bacteria | 884 |
| 922 | Ga0316580_10150071 | 3300032139 | Bacteria | 715 |
| 923 | Ga0307510_10074379 | 3300033180 | Bacteria | 3357 |
| 924 | Ga0316588_1002051 | 3300033528 | Bacteria | 3448 |
| 925 | Ga0373944_0035586 | 3300035089 | Bacteria | 1518 |
| 926 | Ga0373923_0353953 | 3300035111 | Bacteria | 702 |
| 927 | Ga0373936_0319138 | 3300035113 | Bacteria | 703 |
| 928 | Ga0373953_0115657 | 3300035117 | Bacteria | 1137 |
| 929 | Ga0373956_0115253 | 3300035119 | Bacteria | 1253 |
| 930 | Ga0373943_0118513 | 3300035170 | Bacteria | 1404 |
| 931 | Ga0373943_0313933 | 3300035170 | Bacteria | 892 |
| 932 | Ga0373955_0274242 | 3300035172 | Bacteria | 1014 |
| 933 | Ga0316574_0000378 | 3300035398 | Bacteria | 17299 |
| 934 | Ga0316574_0002268 | 3300035398 | Bacteria | 9580 |
| 935 | Ga0316574_0002483 | 3300035398 | Bacteria | 9265 |
| 936 | Ga0316574_0005380 | 3300035398 | Bacteria | 6824 |
| 937 | Ga0316574_0007935 | 3300035398 | Bacteria | 5860 |
| 938 | Ga0316574_0063294 | 3300035398 | Bacteria | 2326 |
| 939 | Ga0316574_0072190 | 3300035398 | Bacteria | 2181 |
| 940 | Ga0316574_0094711 | 3300035398 | Bacteria | 1907 |
| 941 | Ga0316574_0271189 | 3300035398 | Bacteria | 1082 |
| 942 | Ga0316574_0515916 | 3300035398 | Bacteria | 744 |
| 943 | Ga0316574_0653338 | 3300035398 | Bacteria | 647 |
| 944 | Ga0373924_0313530 | 3300035410 | Bacteria | 697 |
| 945 | Ga0373931_0446336 | 3300035691 | Bacteria | 827 |
| 946 | Ga0373931_0470987 | 3300035691 | Bacteria | 806 |
| 947 | Ga0373927_0000323 | 3300035695 | Bacteria | 37618 |
| 948 | Ga0373927_0009145 | 3300035695 | Bacteria | 6651 |
| 949 | Ga0373933_0015871 | 3300035724 | Bacteria | 4204 |
| 950 | Ga0373947_0002454 | 3300035725 | Bacteria | 11164 |
| 951 | Ga0373947_0082403 | 3300035725 | Bacteria | 1994 |
| 952 | Ga0373937_0006210 | 3300036401 | Bacteria | 10295 |
| 953 | Ga0373937_0067460 | 3300036401 | Bacteria | 3296 |
| 954 | Ga0373937_0145830 | 3300036401 | Bacteria | 2216 |
| 955 | Ga0316582_0004165 | 3300036647 | Bacteria | 7247 |
| 956 | Ga0316582_0223887 | 3300036647 | Bacteria | 1287 |
| 957 | Ga0316584_0009908 | 3300036712 | Bacteria | 6636 |
| 958 | Ga0316584_0214918 | 3300036712 | Bacteria | 1414 |
| 959 | Ga0316584_0509630 | 3300036712 | Bacteria | 844 |
| 960 | Ga0373925_0000061 | 3300037068 | Bacteria | 117783 |
| 961 | Ga0373925_0191857 | 3300037068 | Bacteria | 1621 |
| 962 | Ga0373925_0784018 | 3300037068 | Bacteria | 786 |
| 963 | Ga0395899_0000013 | 3300037312 | Bacteria | 510397 |
| 964 | Ga0395899_0000167 | 3300037312 | Bacteria | 100973 |
| 965 | Ga0395899_0020977 | 3300037312 | Bacteria | 4955 |
| 966 | Ga0395899_0066242 | 3300037312 | Bacteria | 2652 |
| 967 | Ga0395899_0068473 | 3300037312 | Bacteria | 2602 |
| 968 | Ga0395899_0154709 | 3300037312 | Bacteria | 1623 |
| 969 | Ga0395899_0264346 | 3300037312 | Bacteria | 1175 |
| 970 | Ga0395899_0321309 | 3300037312 | Bacteria | 1042 |
| 971 | Ga0395899_0369007 | 3300037312 | Bacteria | 956 |
| 972 | Ga0395899_0813685 | 3300037312 | Bacteria | 576 |
| 973 | Ga0395900_0000009 | 3300037418 | Bacteria | 476249 |
| 974 | Ga0395900_0017432 | 3300037418 | Bacteria | 7331 |
| 975 | Ga0395900_0018275 | 3300037418 | Bacteria | 7152 |
| 976 | Ga0395900_0084363 | 3300037418 | Bacteria | 3264 |
| 977 | Ga0395900_0204845 | 3300037418 | Bacteria | 1994 |
| 978 | Ga0395900_0251523 | 3300037418 | Bacteria | 1768 |
| 979 | Ga0395900_0569886 | 3300037418 | Bacteria | 1075 |
| 980 | Ga0395900_0798748 | 3300037418 | Bacteria | 872 |
| 981 | Ga0395900_1085647 | 3300037418 | Bacteria | 718 |
| 982 | Ga0395900_1169944 | 3300037418 | Bacteria | 685 |
| 983 | Ga0395900_1446452 | 3300037418 | Bacteria | 600 |
| 984 | Ga0395898_0080700 | 3300037466 | Bacteria | 3137 |
| 985 | Ga0395898_0143567 | 3300037466 | Bacteria | 2285 |
| 986 | Ga0395898_0210086 | 3300037466 | Bacteria | 1856 |
| 987 | Ga0395898_0417109 | 3300037466 | Bacteria | 1279 |
| 988 | Ga0395898_0816505 | 3300037466 | Bacteria | 872 |
| 989 | Ga0395898_0950863 | 3300037466 | Bacteria | 796 |
| 990 | Ga0395898_1007688 | 3300037466 | Bacteria | 768 |
| 991 | Ga0395905_0000306 | 3300037471 | Bacteria | 71299 |
| 992 | Ga0395905_0005950 | 3300037471 | Bacteria | 12354 |
| 993 | Ga0395905_0019189 | 3300037471 | Bacteria | 6484 |
| 994 | Ga0395905_0022098 | 3300037471 | Bacteria | 6018 |
| 995 | Ga0395905_0057588 | 3300037471 | Bacteria | 3635 |
| 996 | Ga0395905_0147022 | 3300037471 | Bacteria | 2217 |
| 997 | Ga0395905_0171027 | 3300037471 | Bacteria | 2041 |
| 998 | Ga0395905_0308418 | 3300037471 | Bacteria | 1471 |
| 999 | Ga0436364_0590512 | 3300037853 | Bacteria | 5151 |
| 1000 | Ga0436364_0728140 | 3300037853 | Bacteria | 868 |
| 1001 | Ga0436364_1209833 | 3300037853 | Bacteria | 1544 |
| 1002 | Ga0395901_0000014 | 3300038443 | Bacteria | 375100 |
| 1003 | Ga0395901_0003592 | 3300038443 | Bacteria | 15640 |
| 1004 | Ga0395901_0053639 | 3300038443 | Bacteria | 4189 |
| 1005 | Ga0395901_0077200 | 3300038443 | Bacteria | 3476 |
| 1006 | Ga0395901_0093160 | 3300038443 | Bacteria | 3154 |
| 1007 | Ga0395901_0145276 | 3300038443 | Bacteria | 2493 |
| 1008 | Ga0395901_0258191 | 3300038443 | Bacteria | 1814 |
| 1009 | Ga0395901_0774456 | 3300038443 | Bacteria | 950 |
| 1010 | Ga0237819_00617 | 3300038705 | Bacteria | 11655 |
| 1011 | Ga0237819_05128 | 3300038705 | Bacteria | 2082 |
| 1012 | Ga0436365_0900771 | 3300039437 | Bacteria | 1501 |
| 1013 | Ga0436365_1453965 | 3300039437 | Bacteria | 5835 |
| 1014 | Ga0436365_1537653 | 3300039437 | Bacteria | 7732 |
| 1015 | Ga0436360_0180515 | 3300039438 | Bacteria | 1212 |
| 1016 | Ga0436360_0465485 | 3300039438 | Bacteria | 10265 |
| 1017 | Ga0436360_0571493 | 3300039438 | Bacteria | 1166 |
| 1018 | Ga0436360_1035776 | 3300039438 | Bacteria | 4465 |
| 1019 | Ga0436360_1352436 | 3300039438 | Bacteria | 815 |
| 1020 | Ga0436361_0024076 | 3300039447 | Bacteria | 2029 |
| 1021 | Ga0436361_0082100 | 3300039447 | Bacteria | 1480 |
| 1022 | Ga0436361_0125156 | 3300039447 | Bacteria | 2105 |
| 1023 | Ga0436361_0134948 | 3300039447 | Bacteria | 2015 |
| 1024 | Ga0436361_0207410 | 3300039447 | Bacteria | 20395 |
| 1025 | Ga0436361_0407501 | 3300039447 | Bacteria | 2303 |
| 1026 | Ga0436361_0438208 | 3300039447 | Bacteria | 3610 |
| 1027 | Ga0436361_0554629 | 3300039447 | Bacteria | 1229 |
| 1028 | Ga0436361_0601407 | 3300039447 | Bacteria | 940 |
| 1029 | Ga0436361_0661214 | 3300039447 | Bacteria | 3169 |
| 1030 | Ga0436361_0700146 | 3300039447 | Bacteria | 7163 |
| 1031 | Ga0436361_0795199 | 3300039447 | Bacteria | 71391 |
| 1032 | Ga0436361_0987881 | 3300039447 | Bacteria | 6064 |
| 1033 | Ga0436361_1098427 | 3300039447 | Bacteria | 1495 |
| 1034 | Ga0436363_0370956 | 3300039450 | Bacteria | 5153 |
| 1035 | Ga0436363_0756882 | 3300039450 | Bacteria | 4461 |
| 1036 | Ga0436362_0664566 | 3300039453 | Bacteria | 716 |
| 1037 | Ga0436362_0805483 | 3300039453 | Bacteria | 989 |
| 1038 | Ga0436362_0854949 | 3300039453 | Bacteria | 808 |
| 1039 | Ga0439436_0007792 | 3300041404 | Bacteria | 3291 |
| 1040 | Ga0439465_0000818 | 3300041413 | Bacteria | 9793 |
| 1041 | Ga0451789_1151395 | 3300041443 | Bacteria | 1421 |
| 1042 | Ga0451793_1213491 | 3300041452 | Bacteria | 553 |
| 1043 | Ga0451797_0615277 | 3300041453 | Bacteria | 641 |
| 1044 | Ga0451797_0694177 | 3300041453 | Bacteria | 1438 |
| 1045 | Ga0451800_0785154 | 3300041459 | Bacteria | 5018 |
| 1046 | Ga0451804_0797094 | 3300041463 | Bacteria | 3326 |
| 1047 | Ga0451807_0646420 | 3300041486 | Bacteria | 2467 |
| 1048 | Ga0451807_1374972 | 3300041486 | Bacteria | 1677 |
| 1049 | Ga0451853_0503656 | 3300041512 | Bacteria | 1353 |
| 1050 | Ga0439433_0021188 | 3300041999 | Bacteria | 1453 |
| 1051 | Ga0439445_0004275 | 3300042004 | Bacteria | 3231 |
| 1052 | Ga0439432_068451 | 3300042006 | Bacteria | 1085 |
| 1053 | Ga0439432_128760 | 3300042006 | Bacteria | 747 |
| 1054 | Ga0439449_0000156 | 3300042007 | Bacteria | 23254 |
| 1055 | Ga0439449_0058775 | 3300042007 | Bacteria | 1419 |
| 1056 | Ga0450894_009732 | 3300042131 | Bacteria | 1246 |
| 1057 | Ga0439459_0020942 | 3300042438 | Bacteria | 1252 |
| 1058 | Ga0450893_0056067 | 3300042532 | Bacteria | 746 |
| 1059 | Ga0451577_0053079 | 3300042876 | Bacteria | 3619 |
| 1060 | Ga0453684_0001089 | 3300044712 | Bacteria | 85906 |
| 1061 | Ga0466968_0225373 | 3300044735 | Bacteria | 884 |
| 1062 | Ga0466957_0621402 | 3300044842 | Bacteria | 758 |
| 1063 | Ga0466960_0406280 | 3300044901 | Bacteria | 785 |
| 1064 | Ga0451576_0000030 | 3300045051 | Bacteria | 403352 |
| 1065 | Ga0451576_0000201 | 3300045051 | Bacteria | 150175 |
| 1066 | Ga0451576_0218381 | 3300045051 | Bacteria | 1991 |
| 1067 | Ga0451576_0220138 | 3300045051 | Bacteria | 1982 |
| 1068 | Ga0466958_0049465 | 3300045836 | Bacteria | 2543 |
| 1069 | Ga0495603_0000127 | 3300046455 | Bacteria | 37048 |
| 1070 | Ga0495629_0000474 | 3300046459 | Bacteria | 33674 |
| 1071 | Ga0495580_0000533 | 3300046472 | Bacteria | 32237 |
| 1072 | Ga0495580_0043708 | 3300046472 | Bacteria | 3188 |
| 1073 | Ga0495582_0000310 | 3300046473 | Bacteria | 26965 |
| 1074 | Ga0495582_0135842 | 3300046473 | Bacteria | 1391 |
| 1075 | Ga0495582_0484085 | 3300046473 | Bacteria | 715 |
| 1076 | Ga0495639_0000991 | 3300046475 | Bacteria | 12814 |
| 1077 | Ga0495639_0010135 | 3300046475 | Bacteria | 4053 |
| 1078 | Ga0495662_0311081 | 3300046476 | Bacteria | 775 |
| 1079 | Ga0495664_0173832 | 3300046477 | Bacteria | 1307 |
| 1080 | Ga0495584_0204284 | 3300046491 | Bacteria | 1004 |
| 1081 | Ga0495594_0000972 | 3300046499 | Bacteria | 14868 |
| 1082 | Ga0495583_0075766 | 3300046506 | Bacteria | 1471 |
| 1083 | Ga0495628_0096465 | 3300046516 | Bacteria | 2284 |
| 1084 | Ga0495663_0013629 | 3300046525 | Bacteria | 2274 |
| 1085 | Ga0495666_0020312 | 3300046526 | Bacteria | 3292 |
| 1086 | Ga0495665_0009023 | 3300046531 | Bacteria | 5410 |
| 1087 | Ga0495587_0211205 | 3300046536 | Bacteria | 1096 |
| 1088 | Ga0495598_0000742 | 3300046537 | Bacteria | 6218 |
| 1089 | Ga0495598_0023901 | 3300046537 | Bacteria | 1651 |
| 1090 | Ga0495621_0155747 | 3300046539 | Bacteria | 901 |
| 1091 | Ga0495597_0003006 | 3300046542 | Bacteria | 10169 |
| 1092 | Ga0495645_0021079 | 3300046543 | Bacteria | 4710 |
| 1093 | Ga0495622_0001379 | 3300046557 | Bacteria | 12379 |
| 1094 | Ga0495622_0311874 | 3300046557 | Bacteria | 685 |
| 1095 | Ga0495667_0203375 | 3300046559 | Bacteria | 1267 |
| 1096 | Ga0495656_0026463 | 3300046615 | Bacteria | 2309 |
| 1097 | Ga0495668_0073989 | 3300046616 | Bacteria | 1871 |
| 1098 | Ga0495668_0158899 | 3300046616 | Bacteria | 1238 |
| 1099 | Ga0495634_0006195 | 3300046642 | Bacteria | 9115 |
| 1100 | Ga0495625_0053363 | 3300046660 | Bacteria | 2891 |
| 1101 | Ga0495659_0364802 | 3300046664 | Bacteria | 619 |
| 1102 | Ga0495588_0006169 | 3300046674 | Bacteria | 5383 |
| 1103 | Ga0495657_0053318 | 3300046675 | Bacteria | 2707 |
| 1104 | Ga0495647_0071513 | 3300046681 | Bacteria | 1389 |
| 1105 | Ga0495647_0303021 | 3300046681 | Bacteria | 720 |
| 1106 | Ga0495658_0003124 | 3300046683 | Bacteria | 8268 |
| 1107 | Ga0495658_0004899 | 3300046683 | Bacteria | 6569 |
| 1108 | Ga0495669_0000003 | 3300046684 | Bacteria | 267741 |
| 1109 | Ga0495669_0001415 | 3300046684 | Bacteria | 9878 |
| 1110 | Ga0495669_0127525 | 3300046684 | Bacteria | 1196 |
| 1111 | Ga0495613_0000450 | 3300046689 | Bacteria | 35062 |
| 1112 | Ga0495613_0000829 | 3300046689 | Bacteria | 23885 |
| 1113 | Ga0495670_0207126 | 3300046691 | Bacteria | 1040 |
| 1114 | Ga0495600_0068446 | 3300046809 | Bacteria | 2320 |
| 1115 | Ga0495581_0019099 | 3300047315 | Bacteria | 3978 |
| 1116 | Ga0495636_0035974 | 3300047318 | Bacteria | 2040 |
| 1117 | Ga0495674_0231509 | 3300047319 | Bacteria | 1525 |
| 1118 | Ga0495672_0035895 | 3300047320 | Bacteria | 3049 |
| 1119 | Ga0495676_0017497 | 3300047321 | Bacteria | 6337 |
| 1120 | Ga0495676_0506239 | 3300047321 | Bacteria | 792 |
| 1121 | Ga0495677_0009586 | 3300047445 | Bacteria | 3576 |
| 1122 | Ga0495677_0021858 | 3300047445 | Bacteria | 2318 |
| 1123 | Ga0495685_156883 | 3300047447 | Bacteria | 738 |
| 1124 | Ga0495686_0005126 | 3300047472 | Bacteria | 10465 |
| 1125 | Ga0495593_0000730 | 3300047673 | Bacteria | 19058 |
| 1126 | Ga0495602_0175882 | 3300048088 | Bacteria | 1656 |
| 1127 | Ga0496100_0002973 | 3300048903 | Bacteria | 8724 |
| 1128 | Ga0496101_0012204 | 3300048904 | Bacteria | 5728 |
| 1129 | Ga0496101_0118566 | 3300048904 | Bacteria | 1999 |
| 1130 | Ga0496101_0300135 | 3300048904 | Bacteria | 1258 |
| 1131 | Ga0496102_0131440 | 3300048905 | Bacteria | 2344 |
| 1132 | Ga0496102_0169688 | 3300048905 | Bacteria | 2054 |
| 1133 | Ga0496102_0205799 | 3300048905 | Bacteria | 1855 |
| 1134 | Ga0496102_0246174 | 3300048905 | Bacteria | 1686 |
| 1135 | Ga0496102_0300931 | 3300048905 | Bacteria | 1512 |
| 1136 | Ga0496102_0305074 | 3300048905 | Bacteria | 1500 |
| 1137 | Ga0496103_0237308 | 3300048906 | Bacteria | 1173 |
| 1138 | Ga0496104_0000011 | 3300048907 | Bacteria | 459358 |
| 1139 | Ga0496104_0070429 | 3300048907 | Bacteria | 3324 |
| 1140 | Ga0496104_0159085 | 3300048907 | Bacteria | 2167 |
| 1141 | Ga0496104_0531658 | 3300048907 | Bacteria | 1087 |
| 1142 | Ga0496105_0000015 | 3300048908 | Bacteria | 218758 |
| 1143 | Ga0496105_0042671 | 3300048908 | Bacteria | 3740 |
| 1144 | Ga0496105_0195977 | 3300048908 | Bacteria | 1650 |
| 1145 | Ga0496105_0780206 | 3300048908 | Bacteria | 728 |
| 1146 | Ga0496106_0006479 | 3300048909 | Bacteria | 8671 |
| 1147 | Ga0496106_0124044 | 3300048909 | Bacteria | 2021 |
| 1148 | Ga0496107_0000945 | 3300048910 | Bacteria | 17196 |
| 1149 | Ga0496107_0163805 | 3300048910 | Bacteria | 1649 |
| 1150 | Ga0496107_0228553 | 3300048910 | Bacteria | 1384 |
| 1151 | Ga0496107_0262377 | 3300048910 | Bacteria | 1285 |
| 1152 | Ga0496107_0398666 | 3300048910 | Bacteria | 1023 |
| 1153 | Ga0496107_0703793 | 3300048910 | Bacteria | 743 |
| 1154 | Ga0496108_0032993 | 3300048911 | Bacteria | 4301 |
| 1155 | Ga0496108_0315564 | 3300048911 | Bacteria | 1362 |
| 1156 | Ga0496108_0415747 | 3300048911 | Bacteria | 1174 |
| 1157 | Ga0496109_0038130 | 3300048912 | Bacteria | 4343 |
| 1158 | Ga0496109_0064461 | 3300048912 | Bacteria | 3353 |
| 1159 | Ga0496109_0257522 | 3300048912 | Bacteria | 1643 |
| 1160 | Ga0496109_0819732 | 3300048912 | Bacteria | 868 |
| 1161 | Ga0496111_0167206 | 3300048914 | Bacteria | 1633 |
| 1162 | Ga0496112_0041018 | 3300048915 | Bacteria | 4528 |
| 1163 | Ga0496112_0048137 | 3300048915 | Bacteria | 4181 |
| 1164 | Ga0496112_0143940 | 3300048915 | Bacteria | 2352 |
| 1165 | Ga0496112_0890154 | 3300048915 | Bacteria | 812 |
| 1166 | Ga0496113_0623203 | 3300048916 | Bacteria | 863 |
| 1167 | Ga0496113_0818833 | 3300048916 | Bacteria | 739 |
| 1168 | Ga0496114_0001923 | 3300048917 | Bacteria | 15818 |
| 1169 | Ga0496114_0006407 | 3300048917 | Bacteria | 9269 |
| 1170 | Ga0496115_0053451 | 3300048918 | Bacteria | 3241 |
| 1171 | Ga0496115_0078363 | 3300048918 | Bacteria | 2688 |
| 1172 | Ga0496115_0090048 | 3300048918 | Bacteria | 2506 |
| 1173 | Ga0496115_0397658 | 3300048918 | Bacteria | 1118 |
| 1174 | Ga0496116_0101648 | 3300048919 | Bacteria | 1716 |
| 1175 | Ga0496117_0007761 | 3300048920 | Bacteria | 10363 |
| 1176 | Ga0496117_0087763 | 3300048920 | Bacteria | 2015 |
| 1177 | Ga0496117_0168415 | 3300048920 | Bacteria | 1274 |
| 1178 | Ga0496118_0009507 | 3300048921 | Bacteria | 9798 |
| 1179 | Ga0496118_0014388 | 3300048921 | Bacteria | 7412 |
| 1180 | Ga0496118_0091527 | 3300048921 | Bacteria | 2091 |
| 1181 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 1182 | Ga0496121_0001392 | 3300048924 | Bacteria | 40941 |
| 1183 | Ga0496121_0007647 | 3300048924 | Bacteria | 12982 |
| 1184 | Ga0496123_0000669 | 3300048926 | Bacteria | 56717 |
| 1185 | Ga0496124_0000009 | 3300048927 | Bacteria | 734820 |
| 1186 | Ga0496125_0186274 | 3300048928 | Bacteria | 1376 |
| 1187 | Ga0496126_0000185 | 3300048929 | Bacteria | 140051 |
| 1188 | Ga0496126_0838806 | 3300048929 | Bacteria | 702 |
| 1189 | Ga0496126_0858127 | 3300048929 | Bacteria | 692 |
| 1190 | Ga0501298_031880 | 3300049521 | Bacteria | 1038 |
| 1191 | Ga0501317_004161 | 3300049533 | Bacteria | 1489 |
| 1192 | Ga0501318_018159 | 3300049534 | Bacteria | 866 |
| 1193 | Ga0501031_0561300 | 3300049568 | Bacteria | 735 |
| 1194 | Ga0501032_0000951 | 3300049569 | Bacteria | 23376 |
| 1195 | Ga0501032_0018257 | 3300049569 | Bacteria | 4916 |
| 1196 | Ga0501032_0051897 | 3300049569 | Bacteria | 2764 |
| 1197 | Ga0501032_0313428 | 3300049569 | Bacteria | 1013 |
| 1198 | Ga0501033_0005232 | 3300049570 | Bacteria | 10300 |
| 1199 | Ga0501033_0007292 | 3300049570 | Bacteria | 8626 |
| 1200 | Ga0501033_0024179 | 3300049570 | Bacteria | 4583 |
| 1201 | Ga0501033_0073058 | 3300049570 | Bacteria | 2518 |
| 1202 | Ga0501033_0078840 | 3300049570 | Bacteria | 2417 |
| 1203 | Ga0501033_0079704 | 3300049570 | Bacteria | 2403 |
| 1204 | Ga0501033_0238196 | 3300049570 | Bacteria | 1291 |
| 1205 | Ga0501033_0346079 | 3300049570 | Bacteria | 1042 |
| 1206 | Ga0501034_0001021 | 3300049571 | Bacteria | 40111 |
| 1207 | Ga0501034_0002909 | 3300049571 | Bacteria | 19882 |
| 1208 | Ga0501034_0007250 | 3300049571 | Bacteria | 11832 |
| 1209 | Ga0501034_0007363 | 3300049571 | Bacteria | 11724 |
| 1210 | Ga0501034_0012492 | 3300049571 | Bacteria | 8770 |
| 1211 | Ga0501034_0015115 | 3300049571 | Bacteria | 7934 |
| 1212 | Ga0501034_0341010 | 3300049571 | Bacteria | 1428 |
| 1213 | Ga0501036_0002920 | 3300049572 | Bacteria | 13573 |
| 1214 | Ga0501036_0011840 | 3300049572 | Bacteria | 7231 |
| 1215 | Ga0501036_0037283 | 3300049572 | Bacteria | 4113 |
| 1216 | Ga0501036_0139494 | 3300049572 | Bacteria | 2046 |
| 1217 | Ga0501036_0212795 | 3300049572 | Bacteria | 1624 |
| 1218 | Ga0501036_0414845 | 3300049572 | Bacteria | 1123 |
| 1219 | Ga0501036_0428211 | 3300049572 | Bacteria | 1103 |
| 1220 | Ga0501037_0007142 | 3300049573 | Bacteria | 8164 |
| 1221 | Ga0501037_0012498 | 3300049573 | Bacteria | 6254 |
| 1222 | Ga0501037_0025735 | 3300049573 | Bacteria | 4346 |
| 1223 | Ga0501037_0236662 | 3300049573 | Bacteria | 1281 |
| 1224 | Ga0501037_0279375 | 3300049573 | Bacteria | 1164 |
| 1225 | Ga0501038_0000730 | 3300049574 | Bacteria | 29345 |
| 1226 | Ga0501038_0024435 | 3300049574 | Bacteria | 5391 |
| 1227 | Ga0501038_0058113 | 3300049574 | Bacteria | 3317 |
| 1228 | Ga0501038_0083304 | 3300049574 | Bacteria | 2692 |
| 1229 | Ga0501038_0114197 | 3300049574 | Bacteria | 2234 |
| 1230 | Ga0501038_0301852 | 3300049574 | Bacteria | 1257 |
| 1231 | Ga0501038_0416359 | 3300049574 | Bacteria | 1037 |
| 1232 | Ga0501039_0027260 | 3300049575 | Bacteria | 4392 |
| 1233 | Ga0501039_0050517 | 3300049575 | Bacteria | 3217 |
| 1234 | Ga0501039_1013903 | 3300049575 | Bacteria | 645 |
| 1235 | Ga0501040_0074452 | 3300049576 | Bacteria | 2347 |
| 1236 | Ga0501040_0163578 | 3300049576 | Bacteria | 1574 |
| 1237 | Ga0501042_0786373 | 3300049578 | Bacteria | 692 |
| 1238 | Ga0501043_0002840 | 3300049579 | Bacteria | 14469 |
| 1239 | Ga0501043_0006239 | 3300049579 | Bacteria | 9571 |
| 1240 | Ga0501043_0047395 | 3300049579 | Bacteria | 3379 |
| 1241 | Ga0501043_0054820 | 3300049579 | Bacteria | 3131 |
| 1242 | Ga0501043_0141231 | 3300049579 | Bacteria | 1886 |
| 1243 | Ga0501043_0275527 | 3300049579 | Bacteria | 1291 |
| 1244 | Ga0501043_0349259 | 3300049579 | Bacteria | 1124 |
| 1245 | Ga0501043_0717749 | 3300049579 | Bacteria | 729 |
| 1246 | Ga0501046_0008883 | 3300049580 | Bacteria | 8727 |
| 1247 | Ga0501046_0074192 | 3300049580 | Bacteria | 2640 |
| 1248 | Ga0501047_0001484 | 3300049581 | Bacteria | 22880 |
| 1249 | Ga0501047_0002573 | 3300049581 | Bacteria | 17317 |
| 1250 | Ga0501047_0004007 | 3300049581 | Bacteria | 13845 |
| 1251 | Ga0501047_0005066 | 3300049581 | Bacteria | 12366 |
| 1252 | Ga0501047_0005283 | 3300049581 | Bacteria | 12137 |
| 1253 | Ga0501047_0028115 | 3300049581 | Bacteria | 5420 |
| 1254 | Ga0501047_0036275 | 3300049581 | Bacteria | 4765 |
| 1255 | Ga0501047_0150351 | 3300049581 | Bacteria | 2205 |
| 1256 | Ga0501047_0228261 | 3300049581 | Bacteria | 1716 |
| 1257 | Ga0501047_0276064 | 3300049581 | Bacteria | 1526 |
| 1258 | Ga0501047_0437355 | 3300049581 | Bacteria | 1138 |
| 1259 | Ga0501047_0474392 | 3300049581 | Bacteria | 1079 |
| 1260 | Ga0501047_0924364 | 3300049581 | Bacteria | 686 |
| 1261 | Ga0501047_1009671 | 3300049581 | Bacteria | 645 |
| 1262 | Ga0501048_0010281 | 3300049582 | Bacteria | 6996 |
| 1263 | Ga0501048_0053832 | 3300049582 | Bacteria | 2860 |
| 1264 | Ga0501048_0084754 | 3300049582 | Bacteria | 2235 |
| 1265 | Ga0501048_0331573 | 3300049582 | Bacteria | 1084 |
| 1266 | Ga0501067_0003391 | 3300049583 | Bacteria | 8766 |
| 1267 | Ga0501067_0007181 | 3300049583 | Bacteria | 6191 |
| 1268 | Ga0501067_0152957 | 3300049583 | Bacteria | 1285 |
| 1269 | Ga0501068_0049923 | 3300049584 | Bacteria | 2528 |
| 1270 | Ga0501068_0141110 | 3300049584 | Bacteria | 1510 |
| 1271 | Ga0501068_0247826 | 3300049584 | Bacteria | 1135 |
| 1272 | Ga0501069_0000066 | 3300049585 | Bacteria | 55164 |
| 1273 | Ga0501069_0004692 | 3300049585 | Bacteria | 7064 |
| 1274 | Ga0501069_0036509 | 3300049585 | Bacteria | 2710 |
| 1275 | Ga0501069_0058290 | 3300049585 | Bacteria | 2153 |
| 1276 | Ga0501069_0192812 | 3300049585 | Bacteria | 1179 |
| 1277 | Ga0501070_0000857 | 3300049586 | Bacteria | 27644 |
| 1278 | Ga0501070_0003216 | 3300049586 | Bacteria | 14207 |
| 1279 | Ga0501070_0004879 | 3300049586 | Bacteria | 11462 |
| 1280 | Ga0501070_0006013 | 3300049586 | Bacteria | 10336 |
| 1281 | Ga0501070_0014099 | 3300049586 | Bacteria | 6729 |
| 1282 | Ga0501070_0015596 | 3300049586 | Bacteria | 6389 |
| 1283 | Ga0501070_0025388 | 3300049586 | Bacteria | 4970 |
| 1284 | Ga0501070_0042370 | 3300049586 | Bacteria | 3791 |
| 1285 | Ga0501070_0046661 | 3300049586 | Bacteria | 3602 |
| 1286 | Ga0501070_0069413 | 3300049586 | Bacteria | 2917 |
| 1287 | Ga0501070_0071977 | 3300049586 | Bacteria | 2862 |
| 1288 | Ga0501070_0083018 | 3300049586 | Bacteria | 2652 |
| 1289 | Ga0501070_0399531 | 3300049586 | Bacteria | 1112 |
| 1290 | Ga0501070_0443725 | 3300049586 | Bacteria | 1047 |
| 1291 | Ga0501071_0050648 | 3300049587 | Bacteria | 2991 |
| 1292 | Ga0501072_0003391 | 3300049588 | Bacteria | 11986 |
| 1293 | Ga0501072_0006358 | 3300049588 | Bacteria | 8994 |
| 1294 | Ga0501072_0258257 | 3300049588 | Bacteria | 1387 |
| 1295 | Ga0501073_0000746 | 3300049589 | Bacteria | 23011 |
| 1296 | Ga0501073_0005150 | 3300049589 | Bacteria | 9810 |
| 1297 | Ga0501073_0005526 | 3300049589 | Bacteria | 9465 |
| 1298 | Ga0501073_0009337 | 3300049589 | Bacteria | 7237 |
| 1299 | Ga0501073_0017231 | 3300049589 | Bacteria | 5233 |
| 1300 | Ga0501073_0049056 | 3300049589 | Bacteria | 2961 |
| 1301 | Ga0501073_0059450 | 3300049589 | Bacteria | 2669 |
| 1302 | Ga0501073_0072990 | 3300049589 | Bacteria | 2389 |
| 1303 | Ga0501074_0001418 | 3300049590 | Bacteria | 15959 |
| 1304 | Ga0501074_0022406 | 3300049590 | Bacteria | 4588 |
| 1305 | Ga0501074_0096182 | 3300049590 | Bacteria | 2120 |
| 1306 | Ga0501074_0167806 | 3300049590 | Bacteria | 1567 |
| 1307 | Ga0501075_0234744 | 3300049591 | Bacteria | 1398 |
| 1308 | Ga0501076_0271580 | 3300049592 | Bacteria | 1388 |
| 1309 | Ga0501077_0010950 | 3300049593 | Bacteria | 5654 |
| 1310 | Ga0501201_005502 | 3300049651 | Bacteria | 1186 |
| 1311 | Ga0501202_005951 | 3300049652 | Bacteria | 2170 |
| 1312 | Ga0501202_050105 | 3300049652 | Bacteria | 923 |
| 1313 | Ga0501235_014190 | 3300049669 | Bacteria | 1757 |
| 1314 | Ga0501257_000948 | 3300049686 | Bacteria | 5855 |
| 1315 | Ga0501261_011525 | 3300049690 | Bacteria | 1179 |
| 1316 | Ga0501225_0001183 | 3300049705 | Bacteria | 8140 |
| 1317 | Ga0501225_0029284 | 3300049705 | Bacteria | 1513 |
| 1318 | Ga0501079_0005450 | 3300049741 | Bacteria | 9482 |
| 1319 | Ga0501079_0074865 | 3300049741 | Bacteria | 2618 |
| 1320 | Ga0501079_0147358 | 3300049741 | Bacteria | 1835 |
| 1321 | Ga0501079_0588518 | 3300049741 | Bacteria | 875 |
| 1322 | Ga0501079_1111060 | 3300049741 | Bacteria | 623 |
| 1323 | Ga0501080_0000791 | 3300049742 | Bacteria | 25821 |
| 1324 | Ga0501080_0001309 | 3300049742 | Bacteria | 20742 |
| 1325 | Ga0501080_0015169 | 3300049742 | Bacteria | 7098 |
| 1326 | Ga0501080_0024885 | 3300049742 | Bacteria | 5552 |
| 1327 | Ga0501080_0026406 | 3300049742 | Bacteria | 5396 |
| 1328 | Ga0501080_0035197 | 3300049742 | Bacteria | 4674 |
| 1329 | Ga0501080_0036571 | 3300049742 | Bacteria | 4582 |
| 1330 | Ga0501080_0041119 | 3300049742 | Bacteria | 4309 |
| 1331 | Ga0501080_0041377 | 3300049742 | Bacteria | 4294 |
| 1332 | Ga0501080_0072402 | 3300049742 | Bacteria | 3206 |
| 1333 | Ga0501080_0154202 | 3300049742 | Bacteria | 2122 |
| 1334 | Ga0501080_0496525 | 3300049742 | Bacteria | 1091 |
| 1335 | Ga0501080_0936724 | 3300049742 | Bacteria | 754 |
| 1336 | Ga0501081_0039690 | 3300049743 | Bacteria | 3222 |
| 1337 | Ga0501081_0189469 | 3300049743 | Bacteria | 1489 |
| 1338 | Ga0501083_0001078 | 3300049744 | Bacteria | 18217 |
| 1339 | Ga0501083_0006526 | 3300049744 | Bacteria | 8272 |
| 1340 | Ga0501083_0017061 | 3300049744 | Bacteria | 5069 |
| 1341 | Ga0501083_0046170 | 3300049744 | Bacteria | 2946 |
| 1342 | Ga0501262_022218 | 3300049759 | Bacteria | 876 |
| 1343 | Ga0501264_020252 | 3300049761 | Bacteria | 702 |
| 1344 | Ga0501267_010317 | 3300049764 | Bacteria | 942 |
| 1345 | Ga0501270_020611 | 3300049767 | Bacteria | 1000 |
| 1346 | Ga0501271_012488 | 3300049768 | Bacteria | 921 |
| 1347 | Ga0501274_003030 | 3300049771 | Bacteria | 1339 |
| 1348 | Ga0501035_0008196 | 3300049822 | Bacteria | 9738 |
| 1349 | Ga0501035_0013440 | 3300049822 | Bacteria | 7557 |
| 1350 | Ga0501035_0014443 | 3300049822 | Bacteria | 7288 |
| 1351 | Ga0501035_0020365 | 3300049822 | Bacteria | 6090 |
| 1352 | Ga0501035_0112062 | 3300049822 | Bacteria | 2390 |
| 1353 | Ga0501035_0184233 | 3300049822 | Bacteria | 1797 |
| 1354 | Ga0501035_0202121 | 3300049822 | Bacteria | 1703 |
| 1355 | Ga0501035_0351149 | 3300049822 | Bacteria | 1234 |
| 1356 | Ga0501044_0005066 | 3300049823 | Bacteria | 14706 |
| 1357 | Ga0501044_0006024 | 3300049823 | Bacteria | 13394 |
| 1358 | Ga0501044_0011343 | 3300049823 | Bacteria | 9656 |
| 1359 | Ga0501044_0012740 | 3300049823 | Bacteria | 9106 |
| 1360 | Ga0501044_0021123 | 3300049823 | Bacteria | 6950 |
| 1361 | Ga0501044_0029461 | 3300049823 | Bacteria | 5788 |
| 1362 | Ga0501044_0037623 | 3300049823 | Bacteria | 5057 |
| 1363 | Ga0501044_0039911 | 3300049823 | Bacteria | 4894 |
| 1364 | Ga0501044_0045497 | 3300049823 | Bacteria | 4546 |
| 1365 | Ga0501044_0071868 | 3300049823 | Bacteria | 3518 |
| 1366 | Ga0501044_0278920 | 3300049823 | Bacteria | 1605 |
| 1367 | Ga0501044_0300616 | 3300049823 | Bacteria | 1534 |
| 1368 | Ga0501044_0338681 | 3300049823 | Bacteria | 1425 |
| 1369 | Ga0501044_0432044 | 3300049823 | Bacteria | 1226 |
| 1370 | Ga0501044_0494853 | 3300049823 | Bacteria | 1124 |
| 1371 | Ga0501044_1252047 | 3300049823 | Bacteria | 609 |
| 1372 | Ga0501045_0650210 | 3300049824 | Bacteria | 779 |
| 1373 | nmdc:mga00v17_171360_c1 | 3300050491 | Bacteria | 1400 |
| 1374 | nmdc:mga00v17_322_c1 | 3300050491 | Bacteria | 27155 |
| 1375 | nmdc:mga0k408_53973_c1 | 3300050493 | Bacteria | 2329 |
| 1376 | nmdc:mga0k408_87119_c1 | 3300050493 | Bacteria | 1834 |
| 1377 | nmdc:mga04h51_6941_c1 | 3300050495 | Bacteria | 2966 |
| 1378 | nmdc:mga07m45_1067_c1 | 3300050496 | Bacteria | 12206 |
| 1379 | nmdc:mga05p37_263414_c1 | 3300050507 | Bacteria | 2062 |
| 1380 | nmdc:mga05p37_96945_c1 | 3300050507 | Bacteria | 3633 |
| 1381 | nmdc:mga0qj67_184767_c1 | 3300050509 | Bacteria | 1693 |
| 1382 | nmdc:mga0qj67_470108_c1 | 3300050509 | Bacteria | 1012 |
| 1383 | nmdc:mga06r32_425194_c1 | 3300050510 | Bacteria | 1309 |
| 1384 | nmdc:mga08y16_232785_c1 | 3300050511 | Bacteria | 1905 |
| 1385 | nmdc:mga08y16_35_c1 | 3300050511 | Bacteria | 157578 |
| 1386 | nmdc:mga0n895_137439_c1 | 3300050512 | Bacteria | 2471 |
| 1387 | Ga0495601_0004088 | 3300053077 | Bacteria | 8413 |
| 1388 | Ga0495612_0240891 | 3300053078 | Bacteria | 803 |
| 1389 | Ga0500635_0000272 | 3300053080 | Bacteria | 19813 |
| 1390 | Ga0495595_0298458 | 3300053084 | Bacteria | 810 |
| 1391 | Ga0495619_0004827 | 3300053085 | Bacteria | 8559 |
| 1392 | Ga0495619_0034703 | 3300053085 | Bacteria | 3280 |
| 1393 | Ga0500578_0072674 | 3300053086 | Bacteria | 2191 |
| 1394 | Ga0500643_017342 | 3300053087 | Bacteria | 2413 |
| 1395 | Ga0500643_024190 | 3300053087 | Bacteria | 1931 |
| 1396 | Ga0500644_0052849 | 3300053088 | Bacteria | 1400 |
| 1397 | Ga0500644_0072901 | 3300053088 | Bacteria | 1242 |
| 1398 | Ga0500647_0006815 | 3300053091 | Bacteria | 4864 |
| 1399 | Ga0500583_0084612 | 3300053092 | Bacteria | 1537 |
| 1400 | Ga0500651_0077124 | 3300053093 | Bacteria | 2068 |
| 1401 | Ga0500566_0018781 | 3300053094 | Bacteria | 4059 |
| 1402 | Ga0500641_0003939 | 3300053096 | Bacteria | 5245 |
| 1403 | Ga0500555_012430 | 3300053103 | Bacteria | 2451 |
| 1404 | Ga0500556_0025140 | 3300053104 | Bacteria | 1965 |
| 1405 | Ga0500562_002067 | 3300053108 | Bacteria | 5015 |
| 1406 | Ga0500562_027940 | 3300053108 | Bacteria | 1482 |
| 1407 | Ga0500572_000816 | 3300053111 | Bacteria | 9872 |
| 1408 | Ga0500572_051368 | 3300053111 | Bacteria | 1230 |
| 1409 | Ga0500594_0036421 | 3300053118 | Bacteria | 1324 |
| 1410 | Ga0500595_005597 | 3300053119 | Bacteria | 5469 |
| 1411 | Ga0500595_010018 | 3300053119 | Bacteria | 3789 |
| 1412 | Ga0500608_000286 | 3300053122 | Bacteria | 19714 |
| 1413 | Ga0500614_004067 | 3300053123 | Bacteria | 3113 |
| 1414 | Ga0500618_034337 | 3300053125 | Bacteria | 1180 |
| 1415 | Ga0500642_0001748 | 3300053130 | Bacteria | 6260 |
| 1416 | Ga0500642_0036771 | 3300053130 | Bacteria | 2089 |
| 1417 | Ga0500642_0354961 | 3300053130 | Bacteria | 649 |
| 1418 | Ga0500559_0000077 | 3300053136 | Bacteria | 76287 |
| 1419 | Ga0500559_0093284 | 3300053136 | Bacteria | 1380 |
| 1420 | Ga0500559_0223563 | 3300053136 | Bacteria | 887 |
| 1421 | Ga0500573_0154421 | 3300053140 | Bacteria | 1254 |
| 1422 | Ga0500604_0020333 | 3300053151 | Bacteria | 1867 |
| 1423 | Ga0500616_0001203 | 3300053153 | Bacteria | 26255 |
| 1424 | Ga0500634_0000048 | 3300053161 | Bacteria | 55497 |
| 1425 | Ga0500638_077857 | 3300053162 | Bacteria | 1578 |
| 1426 | Ga0500637_0197909 | 3300053178 | Bacteria | 1145 |
| 1427 | Ga0500576_077327 | 3300053725 | Bacteria | 1415 |
| 1428 | Ga0500609_002739 | 3300053731 | Bacteria | 2512 |
| 1429 | Ga0500609_004454 | 3300053731 | Bacteria | 1937 |
| 1430 | Ga0500596_000361 | 3300053735 | Bacteria | 8233 |
| 1431 | Ga0501084_0023104 | 3300054114 | Bacteria | 5191 |
| 1432 | Ga0501084_0151195 | 3300054114 | Bacteria | 1957 |
| 1433 | Ga0501084_0386645 | 3300054114 | Bacteria | 1182 |
| 1434 | Ga0501084_0625770 | 3300054114 | Bacteria | 909 |
| 1435 | Ga0590071_028791 | 3300059421 | Bacteria | 1320 |
| 1436 | Ga0590075_007021 | 3300059424 | Bacteria | 2671 |
| 1437 | Ga0587084_072859 | 3300059477 | Bacteria | 652 |
| 1438 | Ga0587106_009543 | 3300059605 | Bacteria | 1236 |
| 1439 | Ga0587069_038136 | 3300059642 | Bacteria | 809 |
| 1440 | Ga0587111_0049718 | 3300060346 | Bacteria | 922 |
| 1441 | Ga0501082_0002595 | 3300060353 | Bacteria | 15802 |
| 1442 | Ga0501082_0006052 | 3300060353 | Bacteria | 10500 |
| 1443 | Ga0501082_0026737 | 3300060353 | Bacteria | 4973 |
| 1444 | Ga0501082_0049211 | 3300060353 | Bacteria | 3634 |
| 1445 | Ga0501082_0340936 | 3300060353 | Bacteria | 1306 |
| 1446 | Ga0466962_0196606 | 3300061719 | Bacteria | 985 |
| 1447 | Ga0530510_0198590 | 3300061734 | Bacteria | 1489 |
| 1448 | 2511125423 | 2510917020 | Bacteria | 5657507 |
| 1449 | 2524612184 | 2524023250 | Bacteria | 5457705 |
| 1450 | 2547503123 | 2547132130 | Bacteria | 4660562 |
| 1451 | 2572253570 | 2571042365 | Bacteria | 3289345 |
| 1452 | 2585148493 | 2582581279 | Bacteria | 4980720 |
| 1453 | 2585153083 | 2582581280 | Bacteria | 5994497 |
| 1454 | 2585196645 | 2582581293 | Bacteria | 5907401 |
| 1455 | 2587916737 | 2585428106 | Bacteria | 5179711 |
| 1456 | 2643751400 | 2643221545 | Bacteria | 5083237 |
| 1457 | 2643778190 | 2643221552 | Bacteria | 5708754 |
| 1458 | 2643815258 | 2643221559 | Bacteria | 4424915 |
| 1459 | 2643879297 | 2643221573 | Bacteria | 4784121 |
| 1460 | 2643908760 | 2643221579 | Bacteria | 4443405 |
| 1461 | 2643916188 | 2643221581 | Bacteria | 3893603 |
| 1462 | 2643923473 | 2643221583 | Bacteria | 5218014 |
| 1463 | 2643928431 | 2643221584 | Bacteria | 5511711 |
| 1464 | 2643939936 | 2643221586 | Bacteria | 4446529 |
| 1465 | 2643976204 | 2643221593 | Bacteria | 6296053 |
| 1466 | 2644076994 | 2643221612 | Bacteria | 4361984 |
| 1467 | 2644084946 | 2643221614 | Bacteria | 4260023 |
| 1468 | 2644225731 | 2643221640 | Bacteria | 5258820 |
| 1469 | 2644235220 | 2643221642 | Bacteria | 5357871 |
| 1470 | 2644342498 | 2643221661 | Bacteria | 4267604 |
| 1471 | 2644365798 | 2643221666 | Bacteria | 4265935 |
| 1472 | 2644510547 | 2643221691 | Bacteria | 5093099 |
| 1473 | 2644528905 | 2643221695 | Bacteria | 3441323 |
| 1474 | 2644660596 | 2643221720 | Bacteria | 4694283 |
| 1475 | 2644695308 | 2643221727 | Bacteria | 4415595 |
| 1476 | 2644697957 | 2643221728 | Bacteria | 4797149 |
| 1477 | 2748018276 | 2747842501 | Bacteria | 5293829 |
| 1478 | 2792460637 | 2791355048 | Bacteria | 5832535 |
| 1479 | 2816519079 | 2816332141 | Bacteria | 4436036 |
| 1480 | 2819536616 | 2818991435 | Bacteria | 5433759 |
| 1481 | 2819645777 | 2818991454 | Bacteria | 5563326 |
| 1482 | 2819660067 | 2818991457 | Bacteria | 5323295 |
| 1483 | 2842334888 | 2842333319 | Bacteria | 8899485 |
| 1484 | 2842760626 | 2842757796 | Bacteria | 3981385 |
| 1485 | 2842776898 | 2842775625 | Bacteria | 5587290 |
| 1486 | 2842781095 | 2842780639 | Bacteria | 4337790 |
| 1487 | 2843747760 | 2843744320 | Bacteria | 5659202 |
| 1488 | 2849565369 | 2849560528 | Bacteria | 5393480 |
| 1489 | 2849578402 | 2849573788 | Bacteria | 5421256 |
| 1490 | 2851153821 | 2851153111 | Bacteria | 5542585 |
| 1491 | 2852685118 | 2852684882 | Bacteria | 5463342 |
| 1492 | 2857506380 | 2857504554 | Bacteria | 5369913 |
| 1493 | 2883580552 | 2883577096 | Bacteria | 4709178 |
| 1494 | 2884965129 | 2884960567 | Bacteria | 5437054 |
| 1495 | 2894415887 | 2894414249 | Bacteria | 4405451 |
| 1496 | 2894772819 | 2894772417 | Bacteria | 5305674 |
| 1497 | 2895500810 | 2895498888 | Bacteria | 5283788 |
| 1498 | 2895516320 | 2895511927 | Bacteria | 6802080 |
| 1499 | 2895523761 | 2895522137 | Bacteria | 3284416 |
| 1500 | 2895526658 | 2895525241 | Bacteria | 3388457 |
| 1501 | 2898329506 | 2898329390 | Bacteria | 5168154 |
| 1502 | 2919130658 | 2919130084 | Bacteria | 5301837 |
| 1503 | 2919516113 | 2919513703 | Bacteria | 3844312 |
| 1504 | 2919677945 | 2919675420 | Bacteria | 3969095 |
| 1505 | 2923517970 | 2923516293 | Bacteria | 3716336 |
| 1506 | 2928535403 | 2928531327 | Bacteria | 5101314 |
| 1507 | 2929198339 | 2929195423 | Bacteria | 5325372 |
| 1508 | 2929203548 | 2929199973 | Bacteria | 7260745 |
| 1509 | 2937614867 | 2937610967 | Bacteria | 4618818 |
| 1510 | 2939628328 | 2939626828 | Bacteria | 4695272 |
| 1511 | 2941491130 | 2941489479 | Bacteria | 6313767 |
| 1512 | 2961049326 | 2961047084 | Bacteria | 4594415 |
| 1513 | 2961065982 | 2961064222 | Bacteria | 4749990 |
| 1514 | 2995952061 | 2995948881 | Bacteria | 6358104 |
| 1515 | 8002872527 | 8002869464 | Bacteria | 3588529 |
| 1516 | 8003014568 | 8003014200 | Bacteria | 4059994 |
| 1517 | 8021624523 | 8021622325 | Bacteria | 4844743 |
| 1518 | 8021627609 | 8021626552 | Bacteria | 4665214 |
| 1519 | 8021650728 | 8021648035 | Bacteria | 4772378 |
| 1520 | 8055911262 | 8055909800 | Bacteria | 7278581 |
| 1521 | Ga0105239_10192663 | |||
| 1522 | JGI24736J21556_1002298 | |||
| 1523 | JGI24741J21665_1000556 | |||
| 1524 | JGI24741J21665_1005287 | |||
| 1525 | JGI24741J21665_1008390 | |||
| 1526 | JGI24741J21665_1009734 | |||
| 1527 | JGI24740J21852_10000237 | |||
| 1528 | JGI24740J21852_10002033 | |||
| 1529 | JGI24744J21845_10003452 | |||
| 1530 | JGI25152J39213_1000106 | |||
| 1531 | JGI25150J39212_1000114 | |||
| 1532 | Ga0006778J45830_1040800 | |||
| 1533 | Ga0006759J45824_1036463 | |||
| 1534 | JGI25151J46595_10001018 | |||
| 1535 | JGI25151J46595_10036957 | |||
| 1536 | JGI25153J46596_10000012 | |||
| 1537 | JGI25153J46596_10000089 | |||
| 1538 | JGI25153J46596_10027450 | |||
| 1539 | JGI25153J46596_10088969 | |||
| 1540 | Ga0007417J51691_1031998 | |||
| 1541 | Ga0007410J51695_1037931 | |||
| 1542 | Ga0007409J51694_1038867 | |||
| 1543 | Ga0007416J51690_1041424 | |||
| 1544 | Ga0007429J51699_1034950 | |||
| 1545 | Ga0006780_1015555 | |||
| 1546 | Ga0055529_1005071 | |||
| 1547 | Ga0055526_1000021 | |||
| 1548 | Ga0055526_1005919 | |||
| 1549 | Ga0055537_1002606 | |||
| 1550 | Ga0055524_1000128 | |||
| 1551 | Ga0055524_1026098 | |||
| 1552 | Ga0055524_1047667 | |||
| 1553 | Ga0055536_1007116 | |||
| 1554 | Ga0055536_1015149 | |||
| 1555 | Ga0055534_1000054 | |||
| 1556 | Ga0055528_1000009 | |||
| 1557 | Ga0055528_1016808 | |||
| 1558 | Ga0055530_10002317 | |||
| 1559 | Ga0055530_10006557 | |||
| 1560 | Ga0055531_10002979 | |||
| 1561 | Ga0055531_10007070 | |||
| 1562 | Ga0055531_10017501 | |||
| 1563 | Ga0055531_10022544 | |||
| 1564 | Ga0058692_1000024 | |||
| 1565 | Ga0058863_11597900 | |||
| 1566 | Ga0058861_11717822 | |||
| 1567 | Ga0058862_12307887 | |||
| 1568 | Ga0065165_1001554 | |||
| 1569 | Ga0065165_1059051 | |||
| 1570 | Ga0065714_10072044 | |||
| 1571 | Ga0065704_10071703 | |||
| 1572 | Ga0065715_10697927 | |||
| 1573 | Ga0065707_10129451 | |||
| 1574 | Ga0070658_10210018 | |||
| 1575 | Ga0070658_10243198 | |||
| 1576 | Ga0070683_100038721 | |||
| 1577 | Ga0070683_100512303 | |||
| 1578 | Ga0070683_100758811 | |||
| 1579 | Ga0070690_100465756 | |||
| 1580 | Ga0070670_100004329 | |||
| 1581 | Ga0070670_100042556 | |||
| 1582 | Ga0070670_100081542 | |||
| 1583 | Ga0070670_100112308 | |||
| 1584 | Ga0070670_100114411 | |||
| 1585 | Ga0070670_100449637 | |||
| 1586 | Ga0068869_100442765 | |||
| 1587 | Ga0070666_10013056 | |||
| 1588 | Ga0070680_100010109 | |||
| 1589 | Ga0070680_100024779 | |||
| 1590 | Ga0070680_100036225 | |||
| 1591 | Ga0070680_100048158 | |||
| 1592 | Ga0070680_100054964 | |||
| 1593 | Ga0070680_100056628 | |||
| 1594 | Ga0070680_100416210 | |||
| 1595 | Ga0070682_100002762 | |||
| 1596 | Ga0070682_100197942 | |||
| 1597 | Ga0068868_100029245 | |||
| 1598 | Ga0068868_100153783 | |||
| 1599 | Ga0070660_100036785 | |||
| 1600 | Ga0070660_100045702 | |||
| 1601 | Ga0070660_100115723 | |||
| 1602 | Ga0070660_100178618 | |||
| 1603 | Ga0070660_100178816 | |||
| 1604 | Ga0070660_100308897 | |||
| 1605 | Ga0070660_100549373 | |||
| 1606 | Ga0070689_100100904 | |||
| 1607 | Ga0070691_10019829 | |||
| 1608 | Ga0070691_10022624 | |||
| 1609 | Ga0070691_10135627 | |||
| 1610 | Ga0070661_100013911 | |||
| 1611 | Ga0070661_100057307 | |||
| 1612 | Ga0070661_100110352 | |||
| 1613 | Ga0070661_100151454 | |||
| 1614 | Ga0070661_100781395 | |||
| 1615 | Ga0070692_10013129 | |||
| 1616 | Ga0070692_10017420 | |||
| 1617 | Ga0070692_10032873 | |||
| 1618 | Ga0070692_10090285 | |||
| 1619 | Ga0070668_100005311 | |||
| 1620 | Ga0070668_100006755 | |||
| 1621 | Ga0070668_100015688 | |||
| 1622 | Ga0070668_100027457 | |||
| 1623 | Ga0070668_100182783 | |||
| 1624 | Ga0070669_100060577 | |||
| 1625 | Ga0070669_100337906 | |||
| 1626 | Ga0070675_100028198 | |||
| 1627 | Ga0070675_100296528 | |||
| 1628 | Ga0070671_100009370 | |||
| 1629 | Ga0070671_100187836 | |||
| 1630 | Ga0070671_100338823 | |||
| 1631 | Ga0070674_100011872 | |||
| 1632 | Ga0070674_100311976 | |||
| 1633 | Ga0070674_100414335 | |||
| 1634 | Ga0070673_100234225 | |||
| 1635 | Ga0070673_100496917 | |||
| 1636 | Ga0070688_100013063 | |||
| 1637 | Ga0070688_100293372 | |||
| 1638 | Ga0070659_100000373 | |||
| 1639 | Ga0070659_100053199 | |||
| 1640 | Ga0070659_100182994 | |||
| 1641 | Ga0070659_100202028 | |||
| 1642 | Ga0070667_100004615 | |||
| 1643 | Ga0070667_100018296 | |||
| 1644 | Ga0070667_100023082 | |||
| 1645 | Ga0070667_100026123 | |||
| 1646 | Ga0070667_100074598 | |||
| 1647 | Ga0070667_100259841 | |||
| 1648 | Ga0070709_10052725 | |||
| 1649 | Ga0070711_100115857 | |||
| 1650 | Ga0070711_100630972 | |||
| 1651 | Ga0070694_100175963 | |||
| 1652 | Ga0070663_100005151 | |||
| 1653 | Ga0070663_100015377 | |||
| 1654 | Ga0070663_100044354 | |||
| 1655 | Ga0070663_100054066 | |||
| 1656 | Ga0070663_100220979 | |||
| 1657 | Ga0070663_100364850 | |||
| 1658 | Ga0070663_101007016 | |||
| 1659 | Ga0070678_100030828 | |||
| 1660 | Ga0070678_100052641 | |||
| 1661 | Ga0070678_100124704 | |||
| 1662 | Ga0070678_100134534 | |||
| 1663 | Ga0070678_100398044 | |||
| 1664 | Ga0070662_100016039 | |||
| 1665 | Ga0070662_100154392 | |||
| 1666 | Ga0070662_100248548 | |||
| 1667 | Ga0070681_10004072 | |||
| 1668 | Ga0070681_10005676 | |||
| 1669 | Ga0070681_10006381 | |||
| 1670 | Ga0070681_10025312 | |||
| 1671 | Ga0070681_10049802 | |||
| 1672 | Ga0070681_10105833 | |||
| 1673 | Ga0070681_10248428 | |||
| 1674 | Ga0070681_10329812 | |||
| 1675 | Ga0070681_10555017 | |||
| 1676 | Ga0070681_10980946 | |||
| 1677 | Ga0068867_100163109 | |||
| 1678 | Ga0068867_100422182 | |||
| 1679 | Ga0070685_10014339 | |||
| 1680 | Ga0070685_10048841 | |||
| 1681 | Ga0070685_10355403 | |||
| 1682 | Ga0070685_10553226 | |||
| 1683 | Ga0070679_100001932 | |||
| 1684 | Ga0070679_100003983 | |||
| 1685 | Ga0070679_100004827 | |||
| 1686 | Ga0070679_100067870 | |||
| 1687 | Ga0070679_100124618 | |||
| 1688 | Ga0070679_100281810 | |||
| 1689 | Ga0070679_100582425 | |||
| 1690 | Ga0070679_101013285 | |||
| 1691 | Ga0070684_100020471 | |||
| 1692 | Ga0070684_100028365 | |||
| 1693 | Ga0070684_100087520 | |||
| 1694 | Ga0070684_100097461 | |||
| 1695 | Ga0068853_100005378 | |||
| 1696 | Ga0068853_100051673 | |||
| 1697 | Ga0068853_100055523 | |||
| 1698 | Ga0068853_100117662 | |||
| 1699 | Ga0068853_100188555 | |||
| 1700 | Ga0068853_100217037 | |||
| 1701 | Ga0068853_100263775 | |||
| 1702 | Ga0068853_100685963 | |||
| 1703 | Ga0068853_100840129 | |||
| 1704 | Ga0070672_100015500 | |||
| 1705 | Ga0070672_100038838 | |||
| 1706 | Ga0070672_100215492 | |||
| 1707 | Ga0070696_100002369 | |||
| 1708 | Ga0070696_100588838 | |||
| 1709 | Ga0070693_100003121 | |||
| 1710 | Ga0070693_100018579 | |||
| 1711 | Ga0070665_100000116 | |||
| 1712 | Ga0070665_100000249 | |||
| 1713 | Ga0070665_100007181 | |||
| 1714 | Ga0070665_100007348 | |||
| 1715 | Ga0070665_100007471 | |||
| 1716 | Ga0070665_100021052 | |||
| 1717 | Ga0070665_100038139 | |||
| 1718 | Ga0070665_100194256 | |||
| 1719 | Ga0070665_100321505 | |||
| 1720 | Ga0070665_100591325 | |||
| 1721 | Ga0068855_100001777 | |||
| 1722 | Ga0068855_100017140 | |||
| 1723 | Ga0068855_100034551 | |||
| 1724 | Ga0068855_100061023 | |||
| 1725 | Ga0068855_100180792 | |||
| 1726 | Ga0068855_100354640 | |||
| 1727 | Ga0068855_100394886 | |||
| 1728 | Ga0068855_100480498 | |||
| 1729 | Ga0068855_100507767 | |||
| 1730 | Ga0068855_101065844 | |||
| 1731 | Ga0070664_100030391 | |||
| 1732 | Ga0070664_100142775 | |||
| 1733 | Ga0070664_100152235 | |||
| 1734 | Ga0070664_100231123 | |||
| 1735 | Ga0070664_100386317 | |||
| 1736 | Ga0070664_100632776 | |||
| 1737 | Ga0068857_100029718 | |||
| 1738 | Ga0068857_100162111 | |||
| 1739 | Ga0068857_100173201 | |||
| 1740 | Ga0068857_100221467 | |||
| 1741 | Ga0068854_100000634 | |||
| 1742 | Ga0068854_100023231 | |||
| 1743 | Ga0068854_100023771 | |||
| 1744 | Ga0068854_100030522 | |||
| 1745 | Ga0068854_100209340 | |||
| 1746 | Ga0068856_100004755 | |||
| 1747 | Ga0068856_100139272 | |||
| 1748 | Ga0068856_100183444 | |||
| 1749 | Ga0068856_100186813 | |||
| 1750 | Ga0068856_100243742 | |||
| 1751 | Ga0068856_100860991 | |||
| 1752 | Ga0068852_100037351 | |||
| 1753 | Ga0068852_100045678 | |||
| 1754 | Ga0068852_100065175 | |||
| 1755 | Ga0068852_100105921 | |||
| 1756 | Ga0068852_100136581 | |||
| 1757 | Ga0068852_100246934 | |||
| 1758 | Ga0068852_100456037 | |||
| 1759 | Ga0068859_100027752 | |||
| 1760 | Ga0068859_100355077 | |||
| 1761 | Ga0068859_100916530 | |||
| 1762 | Ga0068864_100000116 | |||
| 1763 | Ga0068864_100001947 | |||
| 1764 | Ga0068864_100283712 | |||
| 1765 | Ga0068864_100559058 | |||
| 1766 | Ga0068864_100658698 | |||
| 1767 | Ga0068864_100696063 | |||
| 1768 | Ga0068866_10097460 | |||
| 1769 | Ga0068866_10577226 | |||
| 1770 | Ga0068861_100040693 | |||
| 1771 | Ga0068861_100121297 | |||
| 1772 | Ga0068861_100316572 | |||
| 1773 | Ga0068861_100346400 | |||
| 1774 | Ga0068851_10366198 | |||
| 1775 | Ga0068863_100000007 | |||
| 1776 | Ga0068863_100005571 | |||
| 1777 | Ga0068863_100005779 | |||
| 1778 | Ga0068863_100019811 | |||
| 1779 | Ga0068863_100025344 | |||
| 1780 | Ga0068863_100047100 | |||
| 1781 | Ga0068863_100103052 | |||
| 1782 | Ga0068863_100204646 | |||
| 1783 | Ga0068863_100423293 | |||
| 1784 | Ga0068858_100000853 | |||
| 1785 | Ga0068858_100002098 | |||
| 1786 | Ga0068858_100120006 | |||
| 1787 | Ga0068858_100161534 | |||
| 1788 | Ga0068860_100000139 | |||
| 1789 | Ga0068860_100002623 | |||
| 1790 | Ga0068860_100006335 | |||
| 1791 | Ga0068860_100178147 | |||
| 1792 | Ga0068860_101212912 | |||
| 1793 | Ga0068862_100002233 | |||
| 1794 | Ga0068862_100008229 | |||
| 1795 | Ga0068862_100056398 | |||
| 1796 | Ga0068862_100057322 | |||
| 1797 | Ga0068862_100171336 | |||
| 1798 | Ga0068862_100208173 | |||
| 1799 | Ga0068862_100450311 | |||
| 1800 | Ga0081538_10022046 | |||
| 1801 | Ga0081539_10000076 | |||
| 1802 | Ga0081539_10041204 | |||
| 1803 | Ga0075365_10121153 | |||
| 1804 | Ga0075368_10002153 | |||
| 1805 | Ga0075363_100151003 | |||
| 1806 | Ga0075364_10001061 | |||
| 1807 | Ga0075364_10129025 | |||
| 1808 | Ga0070716_100105867 | |||
| 1809 | Ga0070712_100062640 | |||
| 1810 | Ga0075367_10003935 | |||
| 1811 | Ga0075366_10099835 | |||
| 1812 | Ga0097621_100038886 | |||
| 1813 | Ga0097621_100148569 | |||
| 1814 | Ga0097621_100160668 | |||
| 1815 | Ga0097621_100514489 | |||
| 1816 | Ga0075370_10062773 | |||
| 1817 | Ga0075370_10233064 | |||
| 1818 | Ga0068871_100009120 | |||
| 1819 | Ga0068871_100010471 | |||
| 1820 | Ga0068871_100068879 | |||
| 1821 | Ga0068871_100562746 | |||
| 1822 | Ga0075434_100180390 | |||
| 1823 | Ga0075429_100659611 | |||
| 1824 | Ga0068865_100013928 | |||
| 1825 | Ga0068865_100016336 | |||
| 1826 | Ga0097620_100027754 | |||
| 1827 | Ga0097620_100355077 | |||
| 1828 | Ga0097620_100916445 | |||
| 1829 | Ga0079104_1014548 | |||
| 1830 | Ga0105251_10003611 | |||
| 1831 | Ga0105240_10000535 | |||
| 1832 | Ga0105240_10000627 | |||
| 1833 | Ga0105240_10005884 | |||
| 1834 | Ga0105240_10061357 | |||
| 1835 | Ga0105240_10096562 | |||
| 1836 | Ga0105240_10169059 | |||
| 1837 | Ga0105240_10239207 | |||
| 1838 | Ga0105240_10276024 | |||
| 1839 | Ga0105240_10486834 | |||
| 1840 | Ga0105240_10524783 | |||
| 1841 | Ga0105240_10539709 | |||
| 1842 | Ga0105240_10867684 | |||
| 1843 | Ga0105240_11520493 | |||
| 1844 | Ga0111539_10000445 | |||
| 1845 | Ga0111539_10339064 | |||
| 1846 | Ga0105247_10050617 | |||
| 1847 | Ga0105247_10338635 | |||
| 1848 | Ga0105243_10004934 | |||
| 1849 | Ga0105243_10085115 | |||
| 1850 | Ga0105243_10380656 | |||
| 1851 | Ga0105241_10001710 | |||
| 1852 | Ga0105241_10028138 | |||
| 1853 | Ga0105241_10386589 | |||
| 1854 | Ga0105241_10986632 | |||
| 1855 | Ga0105242_10026078 | |||
| 1856 | Ga0105242_10185260 | |||
| 1857 | Ga0105248_10006146 | |||
| 1858 | Ga0105248_10043319 | |||
| 1859 | Ga0105248_10073578 | |||
| 1860 | Ga0105248_10261830 | |||
| 1861 | Ga0105248_10280172 | |||
| 1862 | Ga0105248_10578076 | |||
| 1863 | Ga0105248_11128470 | |||
| 1864 | Ga0105248_11282184 | |||
| 1865 | Ga0105237_10087512 | |||
| 1866 | Ga0105237_10172904 | |||
| 1867 | Ga0105237_10365081 | |||
| 1868 | Ga0105237_10444739 | |||
| 1869 | Ga0105237_10784996 | |||
| 1870 | Ga0105237_11107592 | |||
| 1871 | Ga0105238_10000920 | |||
| 1872 | Ga0105238_10001614 | |||
| 1873 | Ga0105238_10009795 | |||
| 1874 | Ga0105238_10012488 | |||
| 1875 | Ga0105238_10021470 | |||
| 1876 | Ga0105238_10055579 | |||
| 1877 | Ga0105238_10160666 | |||
| 1878 | Ga0105238_10209872 | |||
| 1879 | Ga0105238_10430041 | |||
| 1880 | Ga0105249_10008230 | |||
| 1881 | Ga0105249_10017312 | |||
| 1882 | Ga0105249_10100249 | |||
| 1883 | Ga0105249_10147697 | |||
| 1884 | Ga0105239_10035918 | |||
| 1885 | Ga0105239_10267801 | |||
| 1886 | Ga0105239_10498292 | |||
| 1887 | Ga0105239_10531914 | |||
| 1888 | Ga0105239_11122747 | |||
| 1889 | Ga0105246_10114347 | |||
| 1890 | Ga0157373_10029820 | |||
| 1891 | Ga0157373_10083347 | |||
| 1892 | Ga0157373_10112131 | |||
| 1893 | Ga0157373_10135969 | |||
| 1894 | Ga0157373_10145897 | |||
| 1895 | Ga0157373_10610902 | |||
| 1896 | Ga0157371_10009996 | |||
| 1897 | Ga0157371_10160552 | |||
| 1898 | Ga0157371_10174543 | |||
| 1899 | Ga0157371_10525277 | |||
| 1900 | Ga0157370_10002653 | |||
| 1901 | Ga0157370_10012599 | |||
| 1902 | Ga0157370_10203964 | |||
| 1903 | Ga0157370_10204346 | |||
| 1904 | Ga0157370_10327171 | |||
| 1905 | Ga0157370_10331173 | |||
| 1906 | Ga0157370_10376156 | |||
| 1907 | Ga0157370_11066015 | |||
| 1908 | Ga0157369_10000604 | |||
| 1909 | Ga0157369_10009635 | |||
| 1910 | Ga0157369_10100054 | |||
| 1911 | Ga0157369_10153859 | |||
| 1912 | Ga0157369_10183873 | |||
| 1913 | Ga0157369_10306546 | |||
| 1914 | Ga0157369_10393660 | |||
| 1915 | Ga0157369_10403367 | |||
| 1916 | Ga0157369_11744061 | |||
| 1917 | Ga0157374_10078441 | |||
| 1918 | Ga0157374_10151348 | |||
| 1919 | Ga0157374_10164751 | |||
| 1920 | Ga0157374_10636689 | |||
| 1921 | Ga0157378_10001163 | |||
| 1922 | Ga0157378_10531467 | |||
| 1923 | Ga0157378_11069854 | |||
| 1924 | Ga0163162_10001478 | |||
| 1925 | Ga0163162_10025041 | |||
| 1926 | Ga0163162_10027156 | |||
| 1927 | Ga0163162_10208324 | |||
| 1928 | Ga0163162_10216834 | |||
| 1929 | Ga0157372_10007838 | |||
| 1930 | Ga0157372_10009659 | |||
| 1931 | Ga0157372_10014305 | |||
| 1932 | Ga0157372_10019180 | |||
| 1933 | Ga0157372_10064416 | |||
| 1934 | Ga0157372_10113775 | |||
| 1935 | Ga0157372_10259383 | |||
| 1936 | Ga0157372_10343926 | |||
| 1937 | Ga0157372_10736844 | |||
| 1938 | Ga0157372_11212630 | |||
| 1939 | Ga0157372_11336942 | |||
| 1940 | Ga0157372_12579362 | |||
| 1941 | Ga0157375_10000156 | |||
| 1942 | Ga0157375_10024911 | |||
| 1943 | Ga0157375_10066299 | |||
| 1944 | Ga0157375_10076006 | |||
| 1945 | Ga0163163_10000143 | |||
| 1946 | Ga0163163_10003585 | |||
| 1947 | Ga0163163_10045235 | |||
| 1948 | Ga0163163_11069381 | |||
| 1949 | Ga0182008_10160547 | |||
| 1950 | Ga0157379_10010914 | |||
| 1951 | Ga0157379_10053694 | |||
| 1952 | Ga0157379_10053963 | |||
| 1953 | Ga0157379_10187538 | |||
| 1954 | Ga0157376_10002106 | |||
| 1955 | Ga0157376_10018145 | |||
| 1956 | Ga0157376_10031879 | |||
| 1957 | Ga0157376_10055048 | |||
| 1958 | Ga0182006_1045159 | |||
| 1959 | Ga0183360_10001 | |||
| 1960 | Ga0163161_10096300 | |||
| 1961 | Ga0163161_10254579 | |||
| 1962 | Ga0197907_11347143 | |||
| 1963 | Ga0206356_10554173 | |||
| 1964 | Ga0206355_1326977 | |||
| 1965 | Ga0206351_10077469 | |||
| 1966 | Ga0206352_10199513 | |||
| 1967 | Ga0206350_10412008 | |||
| 1968 | Ga0206354_10454696 | |||
| 1969 | Ga0206354_10876343 | |||
| 1970 | Ga0206354_10969686 | |||
| 1971 | Ga0206353_10489060 | |||
| 1972 | Ga0206353_11806100 | |||
| 1973 | Ga0154015_1038310 | |||
| 1974 | Ga0154015_1247783 | |||
| 1975 | Ga0213873_10025338 | |||
| 1976 | Ga0213873_10053926 | |||
| 1977 | Ga0213872_10000438 | |||
| 1978 | Ga0213872_10001168 | |||
| 1979 | Ga0213872_10005036 | |||
| 1980 | Ga0213872_10019936 | |||
| 1981 | Ga0213872_10044651 | |||
| 1982 | Ga0213872_10055353 | |||
| 1983 | Ga0213872_10064084 | |||
| 1984 | Ga0213872_10086927 | |||
| 1985 | Ga0213872_10200916 | |||
| 1986 | Ga0213874_10010862 | |||
| 1987 | Ga0213876_10039233 | |||
| 1988 | Ga0213876_10073494 | |||
| 1989 | Ga0213876_10096606 | |||
| 1990 | Ga0213876_10139567 | |||
| 1991 | Ga0213876_10191663 | |||
| 1992 | Ga0213871_10002106 | |||
| 1993 | Ga0213871_10010533 | |||
| 1994 | Ga0224712_10009341 | |||
| 1995 | Ga0207425_1000030 | |||
| 1996 | Ga0209026_1007176 | |||
| 1997 | Ga0209148_1000465 | |||
| 1998 | Ga0209129_1000063 | |||
| 1999 | Ga0209565_1000048 | |||
| 2000 | Ga0209455_1000412 | |||
| 2001 | Ga0209673_1000001 | |||
| 2002 | Ga0209673_1011110 | |||
| 2003 | Ga0209130_1006749 | |||
| 2004 | Ga0209675_1000045 | |||
| 2005 | Ga0209676_1000024 | |||
| 2006 | Ga0209676_1001796 | |||
| 2007 | Ga0209676_1011794 | |||
| 2008 | Ga0209025_1000005 | |||
| 2009 | Ga0209025_1000013 | |||
| 2010 | Ga0209564_1000001 | |||
| 2011 | Ga0209564_1003044 | |||
| 2012 | Ga0209758_1000014 | |||
| 2013 | Ga0209758_1000059 | |||
| 2014 | Ga0209758_1002649 | |||
| 2015 | Ga0209758_1020793 | |||
| 2016 | Ga0209758_1042195 | |||
| 2017 | Ga0209758_1072879 | |||
| 2018 | Ga0209050_1000101 | |||
| 2019 | Ga0209050_1000603 | |||
| 2020 | Ga0209050_1007717 | |||
| 2021 | Ga0209256_1000002 | |||
| 2022 | Ga0209256_1004724 | |||
| 2023 | Ga0207426_1092821 | |||
| 2024 | Ga0209051_1005932 | |||
| 2025 | Ga0209257_1000122 | |||
| 2026 | Ga0209257_1000190 | |||
| 2027 | Ga0209257_1000217 | |||
| 2028 | Ga0209257_1000220 | |||
| 2029 | Ga0209257_1002470 | |||
| 2030 | Ga0209257_1002924 | |||
| 2031 | Ga0209257_1014213 | |||
| 2032 | Ga0207656_10027977 | |||
| 2033 | Ga0207656_10223004 | |||
| 2034 | Ga0207655_1047992 | |||
| 2035 | Ga0207713_1000327 | |||
| 2036 | Ga0207642_10098589 | |||
| 2037 | Ga0207710_10110327 | |||
| 2038 | Ga0207680_10037045 | |||
| 2039 | Ga0207680_10090610 | |||
| 2040 | Ga0207680_10249450 | |||
| 2041 | Ga0207680_10417757 | |||
| 2042 | Ga0207680_10453300 | |||
| 2043 | Ga0207647_10000111 | |||
| 2044 | Ga0207647_10011815 | |||
| 2045 | Ga0207647_10016203 | |||
| 2046 | Ga0207643_10030175 | |||
| 2047 | Ga0207705_10000083 | |||
| 2048 | Ga0207705_10000798 | |||
| 2049 | Ga0207705_10001414 | |||
| 2050 | Ga0207705_10010215 | |||
| 2051 | Ga0207705_10010553 | |||
| 2052 | Ga0207705_10032237 | |||
| 2053 | Ga0207705_10274583 | |||
| 2054 | Ga0207705_10640786 | |||
| 2055 | Ga0207684_10180136 | |||
| 2056 | Ga0207654_10116176 | |||
| 2057 | Ga0207707_10000069 | |||
| 2058 | Ga0207707_10000217 | |||
| 2059 | Ga0207707_10000292 | |||
| 2060 | Ga0207707_10001098 | |||
| 2061 | Ga0207707_10002049 | |||
| 2062 | Ga0207707_10052169 | |||
| 2063 | Ga0207707_10058921 | |||
| 2064 | Ga0207707_10070332 | |||
| 2065 | Ga0207707_10090013 | |||
| 2066 | Ga0207707_10353062 | |||
| 2067 | Ga0207695_10000033 | |||
| 2068 | Ga0207695_10000718 | |||
| 2069 | Ga0207695_10000970 | |||
| 2070 | Ga0207695_10001195 | |||
| 2071 | Ga0207695_10003038 | |||
| 2072 | Ga0207695_10003936 | |||
| 2073 | Ga0207695_10004599 | |||
| 2074 | Ga0207695_10005898 | |||
| 2075 | Ga0207695_10010907 | |||
| 2076 | Ga0207695_10017139 | |||
| 2077 | Ga0207695_10028170 | |||
| 2078 | Ga0207695_10088820 | |||
| 2079 | Ga0207695_10210411 | |||
| 2080 | Ga0207695_10326066 | |||
| 2081 | Ga0207695_10338139 | |||
| 2082 | Ga0207671_10016464 | |||
| 2083 | Ga0207671_10018278 | |||
| 2084 | Ga0207671_10042029 | |||
| 2085 | Ga0207671_10121823 | |||
| 2086 | Ga0207671_10126386 | |||
| 2087 | Ga0207671_10330370 | |||
| 2088 | Ga0207671_10533916 | |||
| 2089 | Ga0207693_10224028 | |||
| 2090 | Ga0207693_10348915 | |||
| 2091 | Ga0207663_10079527 | |||
| 2092 | Ga0207663_10113620 | |||
| 2093 | Ga0207660_10000080 | |||
| 2094 | Ga0207660_10000424 | |||
| 2095 | Ga0207660_10003626 | |||
| 2096 | Ga0207660_10007036 | |||
| 2097 | Ga0207660_10012164 | |||
| 2098 | Ga0207660_10021898 | |||
| 2099 | Ga0207660_10108895 | |||
| 2100 | Ga0207657_10003790 | |||
| 2101 | Ga0207657_10004044 | |||
| 2102 | Ga0207657_10009693 | |||
| 2103 | Ga0207657_10028669 | |||
| 2104 | Ga0207657_10068037 | |||
| 2105 | Ga0207657_10086378 | |||
| 2106 | Ga0207657_10091470 | |||
| 2107 | Ga0207657_10132187 | |||
| 2108 | Ga0207649_10001073 | |||
| 2109 | Ga0207649_10048120 | |||
| 2110 | Ga0207649_10061362 | |||
| 2111 | Ga0207652_10000426 | |||
| 2112 | Ga0207652_10002658 | |||
| 2113 | Ga0207652_10018427 | |||
| 2114 | Ga0207652_10023654 | |||
| 2115 | Ga0207652_10027696 | |||
| 2116 | Ga0207652_10054583 | |||
| 2117 | Ga0207652_10088077 | |||
| 2118 | Ga0207652_10515537 | |||
| 2119 | Ga0207681_10018428 | |||
| 2120 | Ga0207681_10078688 | |||
| 2121 | Ga0207681_10165896 | |||
| 2122 | Ga0207681_10418980 | |||
| 2123 | Ga0207681_10469328 | |||
| 2124 | Ga0207694_10000613 | |||
| 2125 | Ga0207694_10001014 | |||
| 2126 | Ga0207694_10006504 | |||
| 2127 | Ga0207694_10015471 | |||
| 2128 | Ga0207694_10048535 | |||
| 2129 | Ga0207694_10127442 | |||
| 2130 | Ga0207694_10421469 | |||
| 2131 | Ga0207694_10691820 | |||
| 2132 | Ga0207694_10939689 | |||
| 2133 | Ga0207650_10000062 | |||
| 2134 | Ga0207650_10013073 | |||
| 2135 | Ga0207650_10027556 | |||
| 2136 | Ga0207650_10191868 | |||
| 2137 | Ga0207650_10497271 | |||
| 2138 | Ga0207650_10762735 | |||
| 2139 | Ga0207650_10806022 | |||
| 2140 | Ga0207659_10329774 | |||
| 2141 | Ga0207700_11226758 | |||
| 2142 | Ga0207644_10002909 | |||
| 2143 | Ga0207644_10047358 | |||
| 2144 | Ga0207644_10061462 | |||
| 2145 | Ga0207644_10268330 | |||
| 2146 | Ga0207644_10358483 | |||
| 2147 | Ga0207690_10000053 | |||
| 2148 | Ga0207690_10002733 | |||
| 2149 | Ga0207690_10003205 | |||
| 2150 | Ga0207690_10007092 | |||
| 2151 | Ga0207690_10027387 | |||
| 2152 | Ga0207690_10485616 | |||
| 2153 | Ga0207706_10018542 | |||
| 2154 | Ga0207706_10027221 | |||
| 2155 | Ga0207706_10158101 | |||
| 2156 | Ga0207706_10353204 | |||
| 2157 | Ga0207686_10027308 | |||
| 2158 | Ga0207686_10096284 | |||
| 2159 | Ga0207709_10012485 | |||
| 2160 | Ga0207709_10204820 | |||
| 2161 | Ga0207670_10266685 | |||
| 2162 | Ga0207669_10009736 | |||
| 2163 | Ga0207669_10015571 | |||
| 2164 | Ga0207669_10335405 | |||
| 2165 | Ga0207704_10002126 | |||
| 2166 | Ga0207704_10059788 | |||
| 2167 | Ga0207704_10069509 | |||
| 2168 | Ga0207704_10113911 | |||
| 2169 | Ga0207691_10001351 | |||
| 2170 | Ga0207691_10025374 | |||
| 2171 | Ga0207691_10035026 | |||
| 2172 | Ga0207711_10012717 | |||
| 2173 | Ga0207711_10024660 | |||
| 2174 | Ga0207711_10027271 | |||
| 2175 | Ga0207711_10042670 | |||
| 2176 | Ga0207711_10141256 | |||
| 2177 | Ga0207711_10192184 | |||
| 2178 | Ga0207711_10253028 | |||
| 2179 | Ga0207711_10457639 | |||
| 2180 | Ga0207689_10027678 | |||
| 2181 | Ga0207689_10495832 | |||
| 2182 | Ga0207661_10008563 | |||
| 2183 | Ga0207661_10011284 | |||
| 2184 | Ga0207661_10085429 | |||
| 2185 | Ga0207661_10206773 | |||
| 2186 | Ga0207661_10427520 | |||
| 2187 | Ga0207679_10029143 | |||
| 2188 | Ga0207679_10145402 | |||
| 2189 | Ga0207679_10253811 | |||
| 2190 | Ga0207679_10551447 | |||
| 2191 | Ga0207667_10001111 | |||
| 2192 | Ga0207667_10001609 | |||
| 2193 | Ga0207667_10003472 | |||
| 2194 | Ga0207667_10011832 | |||
| 2195 | Ga0207667_10063144 | |||
| 2196 | Ga0207667_10072340 | |||
| 2197 | Ga0207667_10091489 | |||
| 2198 | Ga0207667_10103518 | |||
| 2199 | Ga0207667_10129933 | |||
| 2200 | Ga0207667_10416059 | |||
| 2201 | Ga0207651_10665055 | |||
| 2202 | Ga0207712_10000477 | |||
| 2203 | Ga0207712_10004191 | |||
| 2204 | Ga0207712_10152540 | |||
| 2205 | Ga0207668_10002053 | |||
| 2206 | Ga0207668_10005939 | |||
| 2207 | Ga0207668_10007910 | |||
| 2208 | Ga0207668_10016894 | |||
| 2209 | Ga0207668_10036557 | |||
| 2210 | Ga0207668_10302012 | |||
| 2211 | Ga0207640_10001700 | |||
| 2212 | Ga0207640_10002489 | |||
| 2213 | Ga0207640_10008966 | |||
| 2214 | Ga0207640_10008981 | |||
| 2215 | Ga0207640_10370153 | |||
| 2216 | Ga0207640_10412900 | |||
| 2217 | Ga0207640_10592057 | |||
| 2218 | Ga0207658_10000218 | |||
| 2219 | Ga0207658_10030679 | |||
| 2220 | Ga0207658_10077471 | |||
| 2221 | Ga0207658_10104463 | |||
| 2222 | Ga0207658_10148354 | |||
| 2223 | Ga0207658_10155210 | |||
| 2224 | Ga0207658_10213565 | |||
| 2225 | Ga0207658_10517957 | |||
| 2226 | Ga0207658_10520288 | |||
| 2227 | Ga0207658_10672999 | |||
| 2228 | Ga0207677_10021403 | |||
| 2229 | Ga0207677_10125262 | |||
| 2230 | Ga0207677_10864706 | |||
| 2231 | Ga0207703_10000038 | |||
| 2232 | Ga0207703_10002250 | |||
| 2233 | Ga0207703_10017790 | |||
| 2234 | Ga0207703_10361156 | |||
| 2235 | Ga0207639_10000197 | |||
| 2236 | Ga0207639_10000985 | |||
| 2237 | Ga0207639_10002481 | |||
| 2238 | Ga0207639_10005918 | |||
| 2239 | Ga0207639_10026929 | |||
| 2240 | Ga0207639_10124773 | |||
| 2241 | Ga0207639_10173855 | |||
| 2242 | Ga0207639_10448771 | |||
| 2243 | Ga0207639_10470318 | |||
| 2244 | Ga0207639_10706516 | |||
| 2245 | Ga0207678_10001457 | |||
| 2246 | Ga0207678_10007555 | |||
| 2247 | Ga0207678_10025970 | |||
| 2248 | Ga0207678_10106323 | |||
| 2249 | Ga0207678_10124578 | |||
| 2250 | Ga0207678_10221518 | |||
| 2251 | Ga0207678_10460643 | |||
| 2252 | Ga0207678_10501609 | |||
| 2253 | Ga0207708_10230859 | |||
| 2254 | Ga0207702_10010647 | |||
| 2255 | Ga0207702_10019720 | |||
| 2256 | Ga0207702_10030424 | |||
| 2257 | Ga0207702_10055885 | |||
| 2258 | Ga0207702_10150176 | |||
| 2259 | Ga0207702_10223301 | |||
| 2260 | Ga0207702_10371408 | |||
| 2261 | Ga0207702_10390694 | |||
| 2262 | Ga0207641_10000012 | |||
| 2263 | Ga0207641_10050966 | |||
| 2264 | Ga0207641_10077304 | |||
| 2265 | Ga0207641_10200245 | |||
| 2266 | Ga0207641_10332158 | |||
| 2267 | Ga0207641_10375003 | |||
| 2268 | Ga0207648_10025833 | |||
| 2269 | Ga0207648_10047883 | |||
| 2270 | Ga0207648_10052874 | |||
| 2271 | Ga0207648_10240152 | |||
| 2272 | Ga0207648_10287023 | |||
| 2273 | Ga0207676_10000437 | |||
| 2274 | Ga0207676_10002572 | |||
| 2275 | Ga0207676_10362613 | |||
| 2276 | Ga0207676_10366255 | |||
| 2277 | Ga0207676_10741726 | |||
| 2278 | Ga0207674_10005969 | |||
| 2279 | Ga0207674_10011504 | |||
| 2280 | Ga0207674_10101934 | |||
| 2281 | Ga0207675_100111099 | |||
| 2282 | Ga0207675_101524300 | |||
| 2283 | Ga0207683_10003839 | |||
| 2284 | Ga0207683_10045165 | |||
| 2285 | Ga0207683_10053471 | |||
| 2286 | Ga0207683_10060238 | |||
| 2287 | Ga0207683_10127845 | |||
| 2288 | Ga0207683_10305650 | |||
| 2289 | Ga0207683_10333198 | |||
| 2290 | Ga0207698_10000983 | |||
| 2291 | Ga0207698_10004659 | |||
| 2292 | Ga0207698_10019313 | |||
| 2293 | Ga0207698_10021881 | |||
| 2294 | Ga0207698_10078947 | |||
| 2295 | Ga0207698_11024265 | |||
| 2296 | Ga0209281_1030707 | |||
| 2297 | Ga0209371_1000016 | |||
| 2298 | Ga0209984_1000589 | |||
| 2299 | Ga0210000_1020682 | |||
| 2300 | Ga0209995_1000742 | |||
| 2301 | Ga0209999_1000894 | |||
| 2302 | Ga0209982_1006214 | |||
| 2303 | Ga0209970_1008518 | |||
| 2304 | Ga0209983_1018050 | |||
| 2305 | Ga0209971_1001431 | |||
| 2306 | Ga0209813_10002244 | |||
| 2307 | Ga0209974_10046121 | |||
| 2308 | Ga0207428_10000242 | |||
| 2309 | Ga0268266_10000006 | |||
| 2310 | Ga0268266_10000064 | |||
| 2311 | Ga0268266_10006542 | |||
| 2312 | Ga0268266_10013935 | |||
| 2313 | Ga0268266_10093761 | |||
| 2314 | Ga0268266_10138240 | |||
| 2315 | Ga0268266_10216332 | |||
| 2316 | Ga0268266_10232768 | |||
| 2317 | Ga0268266_10752231 | |||
| 2318 | Ga0268265_10003538 | |||
| 2319 | Ga0268265_10017919 | |||
| 2320 | Ga0268265_10024029 | |||
| 2321 | Ga0268265_10065739 | |||
| 2322 | Ga0268265_10067098 | |||
| 2323 | Ga0268265_10073511 | |||
| 2324 | Ga0268265_10143311 | |||
| 2325 | Ga0268265_10334732 | |||
| 2326 | Ga0268265_10438920 | |||
| 2327 | Ga0268264_10000046 | |||
| 2328 | Ga0268264_10000059 | |||
| 2329 | Ga0268264_10011951 | |||
| 2330 | Ga0268264_10020551 | |||
| 2331 | Ga0268264_10029670 | |||
| 2332 | Ga0268264_10193780 | |||
| 2333 | Ga0268264_10292272 | |||
| 2334 | Ga0268264_10358715 | |||
| 2335 | Ga0265337_1026919 | |||
| 2336 | Ga0307517_10027160 | |||
| 2337 | Ga0307517_10053780 | |||
| 2338 | Ga0307517_10170521 | |||
| 2339 | Ga0307515_10232570 | |||
| 2340 | Ga0265338_10008247 | |||
| 2341 | Ga0265338_10121631 | |||
| 2342 | Ga0265338_10523677 | |||
| 2343 | Ga0268256_1000015 | |||
| 2344 | Ga0307511_10012065 | |||
| 2345 | Ga0307512_10153748 | |||
| 2346 | Ga0307512_10178569 | |||
| 2347 | Ga0314311_1188486 | |||
| 2348 | Ga0316178_1153819 | |||
| 2349 | Ga0316181_1070224 | |||
| 2350 | Ga0265770_1027594 | |||
| 2351 | Ga0265760_10026772 | |||
| 2352 | Ga0265328_10000024 | |||
| 2353 | Ga0265329_10058428 | |||
| 2354 | Ga0265340_10061657 | |||
| 2355 | Ga0265331_10000695 | |||
| 2356 | Ga0265331_10079576 | |||
| 2357 | Ga0265327_10000602 | |||
| 2358 | Ga0265327_10005667 | |||
| 2359 | Ga0265327_10026828 | |||
| 2360 | Ga0265327_10064376 | |||
| 2361 | Ga0265316_10000169 | |||
| 2362 | Ga0307513_10000261 | |||
| 2363 | Ga0307513_10005614 | |||
| 2364 | Ga0307513_10007398 | |||
| 2365 | Ga0307513_10017161 | |||
| 2366 | Ga0307513_10024641 | |||
| 2367 | Ga0307513_10110818 | |||
| 2368 | Ga0307513_10164307 | |||
| 2369 | Ga0307513_10220515 | |||
| 2370 | Ga0307408_100023432 | |||
| 2371 | Ga0307408_100059383 | |||
| 2372 | Ga0307408_100556187 | |||
| 2373 | Ga0265313_10000607 | |||
| 2374 | Ga0307508_10178564 | |||
| 2375 | Ga0316575_10008349 | |||
| 2376 | Ga0316579_10001331 | |||
| 2377 | Ga0316579_10068192 | |||
| 2378 | Ga0265314_10017596 | |||
| 2379 | Ga0265314_10084856 | |||
| 2380 | Ga0265342_10116897 | |||
| 2381 | Ga0265342_10161256 | |||
| 2382 | Ga0316576_10000900 | |||
| 2383 | Ga0316576_10004461 | |||
| 2384 | Ga0316576_10009679 | |||
| 2385 | Ga0316576_10091862 | |||
| 2386 | Ga0316576_10121259 | |||
| 2387 | Ga0316576_10196710 | |||
| 2388 | Ga0316576_10234188 | |||
| 2389 | Ga0316576_10336766 | |||
| 2390 | Ga0316578_10005182 | |||
| 2391 | Ga0307516_10000352 | |||
| 2392 | Ga0307516_10018741 | |||
| 2393 | Ga0307405_10046357 | |||
| 2394 | Ga0316577_10001973 | |||
| 2395 | Ga0316577_10042778 | |||
| 2396 | Ga0307413_10009990 | |||
| 2397 | Ga0307413_10190025 | |||
| 2398 | Ga0307413_10662777 | |||
| 2399 | Ga0307413_10669137 | |||
| 2400 | Ga0307410_10117306 | |||
| 2401 | Ga0307410_11102228 | |||
| 2402 | Ga0307406_10109733 | |||
| 2403 | Ga0307406_10141486 | |||
| 2404 | Ga0307406_10219643 | |||
| 2405 | Ga0307406_10436702 | |||
| 2406 | Ga0307407_10264115 | |||
| 2407 | Ga0307407_11090732 | |||
| 2408 | Ga0307412_10048584 | |||
| 2409 | Ga0307412_10494193 | |||
| 2410 | Ga0307412_10513885 | |||
| 2411 | Ga0307412_10585257 | |||
| 2412 | Ga0307412_11110326 | |||
| 2413 | Ga0307409_100053157 | |||
| 2414 | Ga0307409_100061798 | |||
| 2415 | Ga0307409_100525752 | |||
| 2416 | Ga0307416_100323099 | |||
| 2417 | Ga0307416_100426224 | |||
| 2418 | Ga0307416_102011566 | |||
| 2419 | Ga0307414_10001661 | |||
| 2420 | Ga0307414_10005182 | |||
| 2421 | Ga0307414_10028486 | |||
| 2422 | Ga0307414_10056888 | |||
| 2423 | Ga0307414_10172549 | |||
| 2424 | Ga0307414_10173982 | |||
| 2425 | Ga0307414_10252600 | |||
| 2426 | Ga0307414_10258936 | |||
| 2427 | Ga0307414_10270265 | |||
| 2428 | Ga0307414_10359988 | |||
| 2429 | Ga0307414_10785632 | |||
| 2430 | Ga0307414_11343977 | |||
| 2431 | Ga0307414_11409177 | |||
| 2432 | Ga0307411_10042344 | |||
| 2433 | Ga0307411_10256788 | |||
| 2434 | Ga0307415_100301046 | |||
| 2435 | Ga0307415_101077745 | |||
| 2436 | Ga0307415_101328188 | |||
| 2437 | Ga0316583_10001721 | |||
| 2438 | Ga0316585_10003785 | |||
| 2439 | Ga0316580_10003161 | |||
| 2440 | Ga0316580_10042141 | |||
| 2441 | Ga0316580_10100714 | |||
| 2442 | Ga0316580_10150071 | |||
| 2443 | Ga0307510_10074379 | |||
| 2444 | Ga0316588_1002051 | |||
| 2445 | Ga0373944_0035586 | |||
| 2446 | Ga0373923_0353953 | |||
| 2447 | Ga0373936_0319138 | |||
| 2448 | Ga0373953_0115657 | |||
| 2449 | Ga0373956_0115253 | |||
| 2450 | Ga0373943_0118513 | |||
| 2451 | Ga0373943_0313933 | |||
| 2452 | Ga0373955_0274242 | |||
| 2453 | Ga0316574_0000378 | |||
| 2454 | Ga0316574_0002268 | |||
| 2455 | Ga0316574_0002483 | |||
| 2456 | Ga0316574_0005380 | |||
| 2457 | Ga0316574_0007935 | |||
| 2458 | Ga0316574_0063294 | |||
| 2459 | Ga0316574_0072190 | |||
| 2460 | Ga0316574_0094711 | |||
| 2461 | Ga0316574_0271189 | |||
| 2462 | Ga0316574_0515916 | |||
| 2463 | Ga0316574_0653338 | |||
| 2464 | Ga0373924_0313530 | |||
| 2465 | Ga0373931_0446336 | |||
| 2466 | Ga0373931_0470987 | |||
| 2467 | Ga0373927_0000323 | |||
| 2468 | Ga0373927_0009145 | |||
| 2469 | Ga0373933_0015871 | |||
| 2470 | Ga0373947_0002454 | |||
| 2471 | Ga0373947_0082403 | |||
| 2472 | Ga0373937_0006210 | |||
| 2473 | Ga0373937_0067460 | |||
| 2474 | Ga0373937_0145830 | |||
| 2475 | Ga0316582_0004165 | |||
| 2476 | Ga0316582_0223887 | |||
| 2477 | Ga0316584_0009908 | |||
| 2478 | Ga0316584_0214918 | |||
| 2479 | Ga0316584_0509630 | |||
| 2480 | Ga0373925_0000061 | |||
| 2481 | Ga0373925_0191857 | |||
| 2482 | Ga0373925_0784018 | |||
| 2483 | Ga0395899_0000013 | |||
| 2484 | Ga0395899_0000167 | |||
| 2485 | Ga0395899_0020977 | |||
| 2486 | Ga0395899_0066242 | |||
| 2487 | Ga0395899_0068473 | |||
| 2488 | Ga0395899_0154709 | |||
| 2489 | Ga0395899_0264346 | |||
| 2490 | Ga0395899_0321309 | |||
| 2491 | Ga0395899_0369007 | |||
| 2492 | Ga0395899_0813685 | |||
| 2493 | Ga0395900_0000009 | |||
| 2494 | Ga0395900_0017432 | |||
| 2495 | Ga0395900_0018275 | |||
| 2496 | Ga0395900_0084363 | |||
| 2497 | Ga0395900_0204845 | |||
| 2498 | Ga0395900_0251523 | |||
| 2499 | Ga0395900_0569886 | |||
| 2500 | Ga0395900_0798748 | |||
| 2501 | Ga0395900_1085647 | |||
| 2502 | Ga0395900_1169944 | |||
| 2503 | Ga0395900_1446452 | |||
| 2504 | Ga0395898_0080700 | |||
| 2505 | Ga0395898_0143567 | |||
| 2506 | Ga0395898_0210086 | |||
| 2507 | Ga0395898_0417109 | |||
| 2508 | Ga0395898_0816505 | |||
| 2509 | Ga0395898_0950863 | |||
| 2510 | Ga0395898_1007688 | |||
| 2511 | Ga0395905_0000306 | |||
| 2512 | Ga0395905_0005950 | |||
| 2513 | Ga0395905_0019189 | |||
| 2514 | Ga0395905_0022098 | |||
| 2515 | Ga0395905_0057588 | |||
| 2516 | Ga0395905_0147022 | |||
| 2517 | Ga0395905_0171027 | |||
| 2518 | Ga0395905_0308418 | |||
| 2519 | Ga0436364_0590512 | |||
| 2520 | Ga0436364_0728140 | |||
| 2521 | Ga0436364_1209833 | |||
| 2522 | Ga0395901_0000014 | |||
| 2523 | Ga0395901_0003592 | |||
| 2524 | Ga0395901_0053639 | |||
| 2525 | Ga0395901_0077200 | |||
| 2526 | Ga0395901_0093160 | |||
| 2527 | Ga0395901_0145276 | |||
| 2528 | Ga0395901_0258191 | |||
| 2529 | Ga0395901_0774456 | |||
| 2530 | Ga0237819_00617 | |||
| 2531 | Ga0237819_05128 | |||
| 2532 | Ga0436365_0900771 | |||
| 2533 | Ga0436365_1453965 | |||
| 2534 | Ga0436365_1537653 | |||
| 2535 | Ga0436360_0180515 | |||
| 2536 | Ga0436360_0465485 | |||
| 2537 | Ga0436360_0571493 | |||
| 2538 | Ga0436360_1035776 | |||
| 2539 | Ga0436360_1352436 | |||
| 2540 | Ga0436361_0024076 | |||
| 2541 | Ga0436361_0082100 | |||
| 2542 | Ga0436361_0125156 | |||
| 2543 | Ga0436361_0134948 | |||
| 2544 | Ga0436361_0207410 | |||
| 2545 | Ga0436361_0407501 | |||
| 2546 | Ga0436361_0438208 | |||
| 2547 | Ga0436361_0554629 | |||
| 2548 | Ga0436361_0601407 | |||
| 2549 | Ga0436361_0661214 | |||
| 2550 | Ga0436361_0700146 | |||
| 2551 | Ga0436361_0795199 | |||
| 2552 | Ga0436361_0987881 | |||
| 2553 | Ga0436361_1098427 | |||
| 2554 | Ga0436363_0370956 | |||
| 2555 | Ga0436363_0756882 | |||
| 2556 | Ga0436362_0664566 | |||
| 2557 | Ga0436362_0805483 | |||
| 2558 | Ga0436362_0854949 | |||
| 2559 | Ga0439436_0007792 | |||
| 2560 | Ga0439465_0000818 | |||
| 2561 | Ga0451789_1151395 | |||
| 2562 | Ga0451793_1213491 | |||
| 2563 | Ga0451797_0615277 | |||
| 2564 | Ga0451797_0694177 | |||
| 2565 | Ga0451800_0785154 | |||
| 2566 | Ga0451804_0797094 | |||
| 2567 | Ga0451807_0646420 | |||
| 2568 | Ga0451807_1374972 | |||
| 2569 | Ga0451853_0503656 | |||
| 2570 | Ga0439433_0021188 | |||
| 2571 | Ga0439445_0004275 | |||
| 2572 | Ga0439432_068451 | |||
| 2573 | Ga0439432_128760 | |||
| 2574 | Ga0439449_0000156 | |||
| 2575 | Ga0439449_0058775 | |||
| 2576 | Ga0450894_009732 | |||
| 2577 | Ga0439459_0020942 | |||
| 2578 | Ga0450893_0056067 | |||
| 2579 | Ga0451577_0053079 | |||
| 2580 | Ga0453684_0001089 | |||
| 2581 | Ga0466968_0225373 | |||
| 2582 | Ga0466957_0621402 | |||
| 2583 | Ga0466960_0406280 | |||
| 2584 | Ga0451576_0000030 | |||
| 2585 | Ga0451576_0000201 | |||
| 2586 | Ga0451576_0218381 | |||
| 2587 | Ga0451576_0220138 | |||
| 2588 | Ga0466958_0049465 | |||
| 2589 | Ga0495603_0000127 | |||
| 2590 | Ga0495629_0000474 | |||
| 2591 | Ga0495580_0000533 | |||
| 2592 | Ga0495580_0043708 | |||
| 2593 | Ga0495582_0000310 | |||
| 2594 | Ga0495582_0135842 | |||
| 2595 | Ga0495582_0484085 | |||
| 2596 | Ga0495639_0000991 | |||
| 2597 | Ga0495639_0010135 | |||
| 2598 | Ga0495662_0311081 | |||
| 2599 | Ga0495664_0173832 | |||
| 2600 | Ga0495584_0204284 | |||
| 2601 | Ga0495594_0000972 | |||
| 2602 | Ga0495583_0075766 | |||
| 2603 | Ga0495628_0096465 | |||
| 2604 | Ga0495663_0013629 | |||
| 2605 | Ga0495666_0020312 | |||
| 2606 | Ga0495665_0009023 | |||
| 2607 | Ga0495587_0211205 | |||
| 2608 | Ga0495598_0000742 | |||
| 2609 | Ga0495598_0023901 | |||
| 2610 | Ga0495621_0155747 | |||
| 2611 | Ga0495597_0003006 | |||
| 2612 | Ga0495645_0021079 | |||
| 2613 | Ga0495622_0001379 | |||
| 2614 | Ga0495622_0311874 | |||
| 2615 | Ga0495667_0203375 | |||
| 2616 | Ga0495656_0026463 | |||
| 2617 | Ga0495668_0073989 | |||
| 2618 | Ga0495668_0158899 | |||
| 2619 | Ga0495634_0006195 | |||
| 2620 | Ga0495625_0053363 | |||
| 2621 | Ga0495659_0364802 | |||
| 2622 | Ga0495588_0006169 | |||
| 2623 | Ga0495657_0053318 | |||
| 2624 | Ga0495647_0071513 | |||
| 2625 | Ga0495647_0303021 | |||
| 2626 | Ga0495658_0003124 | |||
| 2627 | Ga0495658_0004899 | |||
| 2628 | Ga0495669_0000003 | |||
| 2629 | Ga0495669_0001415 | |||
| 2630 | Ga0495669_0127525 | |||
| 2631 | Ga0495613_0000450 | |||
| 2632 | Ga0495613_0000829 | |||
| 2633 | Ga0495670_0207126 | |||
| 2634 | Ga0495600_0068446 | |||
| 2635 | Ga0495581_0019099 | |||
| 2636 | Ga0495636_0035974 | |||
| 2637 | Ga0495674_0231509 | |||
| 2638 | Ga0495672_0035895 | |||
| 2639 | Ga0495676_0017497 | |||
| 2640 | Ga0495676_0506239 | |||
| 2641 | Ga0495677_0009586 | |||
| 2642 | Ga0495677_0021858 | |||
| 2643 | Ga0495685_156883 | |||
| 2644 | Ga0495686_0005126 | |||
| 2645 | Ga0495593_0000730 | |||
| 2646 | Ga0495602_0175882 | |||
| 2647 | Ga0496100_0002973 | |||
| 2648 | Ga0496101_0012204 | |||
| 2649 | Ga0496101_0118566 | |||
| 2650 | Ga0496101_0300135 | |||
| 2651 | Ga0496102_0131440 | |||
| 2652 | Ga0496102_0169688 | |||
| 2653 | Ga0496102_0205799 | |||
| 2654 | Ga0496102_0246174 | |||
| 2655 | Ga0496102_0300931 | |||
| 2656 | Ga0496102_0305074 | |||
| 2657 | Ga0496103_0237308 | |||
| 2658 | Ga0496104_0000011 | |||
| 2659 | Ga0496104_0070429 | |||
| 2660 | Ga0496104_0159085 | |||
| 2661 | Ga0496104_0531658 | |||
| 2662 | Ga0496105_0000015 | |||
| 2663 | Ga0496105_0042671 | |||
| 2664 | Ga0496105_0195977 | |||
| 2665 | Ga0496105_0780206 | |||
| 2666 | Ga0496106_0006479 | |||
| 2667 | Ga0496106_0124044 | |||
| 2668 | Ga0496107_0000945 | |||
| 2669 | Ga0496107_0163805 | |||
| 2670 | Ga0496107_0228553 | |||
| 2671 | Ga0496107_0262377 | |||
| 2672 | Ga0496107_0398666 | |||
| 2673 | Ga0496107_0703793 | |||
| 2674 | Ga0496108_0032993 | |||
| 2675 | Ga0496108_0315564 | |||
| 2676 | Ga0496108_0415747 | |||
| 2677 | Ga0496109_0038130 | |||
| 2678 | Ga0496109_0064461 | |||
| 2679 | Ga0496109_0257522 | |||
| 2680 | Ga0496109_0819732 | |||
| 2681 | Ga0496111_0167206 | |||
| 2682 | Ga0496112_0041018 | |||
| 2683 | Ga0496112_0048137 | |||
| 2684 | Ga0496112_0143940 | |||
| 2685 | Ga0496112_0890154 | |||
| 2686 | Ga0496113_0623203 | |||
| 2687 | Ga0496113_0818833 | |||
| 2688 | Ga0496114_0001923 | |||
| 2689 | Ga0496114_0006407 | |||
| 2690 | Ga0496115_0053451 | |||
| 2691 | Ga0496115_0078363 | |||
| 2692 | Ga0496115_0090048 | |||
| 2693 | Ga0496115_0397658 | |||
| 2694 | Ga0496116_0101648 | |||
| 2695 | Ga0496117_0007761 | |||
| 2696 | Ga0496117_0087763 | |||
| 2697 | Ga0496117_0168415 | |||
| 2698 | Ga0496118_0009507 | |||
| 2699 | Ga0496118_0014388 | |||
| 2700 | Ga0496118_0091527 | |||
| 2701 | Ga0496121_0000009 | |||
| 2702 | Ga0496121_0001392 | |||
| 2703 | Ga0496121_0007647 | |||
| 2704 | Ga0496123_0000669 | |||
| 2705 | Ga0496124_0000009 | |||
| 2706 | Ga0496125_0186274 | |||
| 2707 | Ga0496126_0000185 | |||
| 2708 | Ga0496126_0838806 | |||
| 2709 | Ga0496126_0858127 | |||
| 2710 | Ga0501298_031880 | |||
| 2711 | Ga0501317_004161 | |||
| 2712 | Ga0501318_018159 | |||
| 2713 | Ga0501031_0561300 | |||
| 2714 | Ga0501032_0000951 | |||
| 2715 | Ga0501032_0018257 | |||
| 2716 | Ga0501032_0051897 | |||
| 2717 | Ga0501032_0313428 | |||
| 2718 | Ga0501033_0005232 | |||
| 2719 | Ga0501033_0007292 | |||
| 2720 | Ga0501033_0024179 | |||
| 2721 | Ga0501033_0073058 | |||
| 2722 | Ga0501033_0078840 | |||
| 2723 | Ga0501033_0079704 | |||
| 2724 | Ga0501033_0238196 | |||
| 2725 | Ga0501033_0346079 | |||
| 2726 | Ga0501034_0001021 | |||
| 2727 | Ga0501034_0002909 | |||
| 2728 | Ga0501034_0007250 | |||
| 2729 | Ga0501034_0007363 | |||
| 2730 | Ga0501034_0012492 | |||
| 2731 | Ga0501034_0015115 | |||
| 2732 | Ga0501034_0341010 | |||
| 2733 | Ga0501036_0002920 | |||
| 2734 | Ga0501036_0011840 | |||
| 2735 | Ga0501036_0037283 | |||
| 2736 | Ga0501036_0139494 | |||
| 2737 | Ga0501036_0212795 | |||
| 2738 | Ga0501036_0414845 | |||
| 2739 | Ga0501036_0428211 | |||
| 2740 | Ga0501037_0007142 | |||
| 2741 | Ga0501037_0012498 | |||
| 2742 | Ga0501037_0025735 | |||
| 2743 | Ga0501037_0236662 | |||
| 2744 | Ga0501037_0279375 | |||
| 2745 | Ga0501038_0000730 | |||
| 2746 | Ga0501038_0024435 | |||
| 2747 | Ga0501038_0058113 | |||
| 2748 | Ga0501038_0083304 | |||
| 2749 | Ga0501038_0114197 | |||
| 2750 | Ga0501038_0301852 | |||
| 2751 | Ga0501038_0416359 | |||
| 2752 | Ga0501039_0027260 | |||
| 2753 | Ga0501039_0050517 | |||
| 2754 | Ga0501039_1013903 | |||
| 2755 | Ga0501040_0074452 | |||
| 2756 | Ga0501040_0163578 | |||
| 2757 | Ga0501042_0786373 | |||
| 2758 | Ga0501043_0002840 | |||
| 2759 | Ga0501043_0006239 | |||
| 2760 | Ga0501043_0047395 | |||
| 2761 | Ga0501043_0054820 | |||
| 2762 | Ga0501043_0141231 | |||
| 2763 | Ga0501043_0275527 | |||
| 2764 | Ga0501043_0349259 | |||
| 2765 | Ga0501043_0717749 | |||
| 2766 | Ga0501046_0008883 | |||
| 2767 | Ga0501046_0074192 | |||
| 2768 | Ga0501047_0001484 | |||
| 2769 | Ga0501047_0002573 | |||
| 2770 | Ga0501047_0004007 | |||
| 2771 | Ga0501047_0005066 | |||
| 2772 | Ga0501047_0005283 | |||
| 2773 | Ga0501047_0028115 | |||
| 2774 | Ga0501047_0036275 | |||
| 2775 | Ga0501047_0150351 | |||
| 2776 | Ga0501047_0228261 | |||
| 2777 | Ga0501047_0276064 | |||
| 2778 | Ga0501047_0437355 | |||
| 2779 | Ga0501047_0474392 | |||
| 2780 | Ga0501047_0924364 | |||
| 2781 | Ga0501047_1009671 | |||
| 2782 | Ga0501048_0010281 | |||
| 2783 | Ga0501048_0053832 | |||
| 2784 | Ga0501048_0084754 | |||
| 2785 | Ga0501048_0331573 | |||
| 2786 | Ga0501067_0003391 | |||
| 2787 | Ga0501067_0007181 | |||
| 2788 | Ga0501067_0152957 | |||
| 2789 | Ga0501068_0049923 | |||
| 2790 | Ga0501068_0141110 | |||
| 2791 | Ga0501068_0247826 | |||
| 2792 | Ga0501069_0000066 | |||
| 2793 | Ga0501069_0004692 | |||
| 2794 | Ga0501069_0036509 | |||
| 2795 | Ga0501069_0058290 | |||
| 2796 | Ga0501069_0192812 | |||
| 2797 | Ga0501070_0000857 | |||
| 2798 | Ga0501070_0003216 | |||
| 2799 | Ga0501070_0004879 | |||
| 2800 | Ga0501070_0006013 | |||
| 2801 | Ga0501070_0014099 | |||
| 2802 | Ga0501070_0015596 | |||
| 2803 | Ga0501070_0025388 | |||
| 2804 | Ga0501070_0042370 | |||
| 2805 | Ga0501070_0046661 | |||
| 2806 | Ga0501070_0069413 | |||
| 2807 | Ga0501070_0071977 | |||
| 2808 | Ga0501070_0083018 | |||
| 2809 | Ga0501070_0399531 | |||
| 2810 | Ga0501070_0443725 | |||
| 2811 | Ga0501071_0050648 | |||
| 2812 | Ga0501072_0003391 | |||
| 2813 | Ga0501072_0006358 | |||
| 2814 | Ga0501072_0258257 | |||
| 2815 | Ga0501073_0000746 | |||
| 2816 | Ga0501073_0005150 | |||
| 2817 | Ga0501073_0005526 | |||
| 2818 | Ga0501073_0009337 | |||
| 2819 | Ga0501073_0017231 | |||
| 2820 | Ga0501073_0049056 | |||
| 2821 | Ga0501073_0059450 | |||
| 2822 | Ga0501073_0072990 | |||
| 2823 | Ga0501074_0001418 | |||
| 2824 | Ga0501074_0022406 | |||
| 2825 | Ga0501074_0096182 | |||
| 2826 | Ga0501074_0167806 | |||
| 2827 | Ga0501075_0234744 | |||
| 2828 | Ga0501076_0271580 | |||
| 2829 | Ga0501077_0010950 | |||
| 2830 | Ga0501201_005502 | |||
| 2831 | Ga0501202_005951 | |||
| 2832 | Ga0501202_050105 | |||
| 2833 | Ga0501235_014190 | |||
| 2834 | Ga0501257_000948 | |||
| 2835 | Ga0501261_011525 | |||
| 2836 | Ga0501225_0001183 | |||
| 2837 | Ga0501225_0029284 | |||
| 2838 | Ga0501079_0005450 | |||
| 2839 | Ga0501079_0074865 | |||
| 2840 | Ga0501079_0147358 | |||
| 2841 | Ga0501079_0588518 | |||
| 2842 | Ga0501079_1111060 | |||
| 2843 | Ga0501080_0000791 | |||
| 2844 | Ga0501080_0001309 | |||
| 2845 | Ga0501080_0015169 | |||
| 2846 | Ga0501080_0024885 | |||
| 2847 | Ga0501080_0026406 | |||
| 2848 | Ga0501080_0035197 | |||
| 2849 | Ga0501080_0036571 | |||
| 2850 | Ga0501080_0041119 | |||
| 2851 | Ga0501080_0041377 | |||
| 2852 | Ga0501080_0072402 | |||
| 2853 | Ga0501080_0154202 | |||
| 2854 | Ga0501080_0496525 | |||
| 2855 | Ga0501080_0936724 | |||
| 2856 | Ga0501081_0039690 | |||
| 2857 | Ga0501081_0189469 | |||
| 2858 | Ga0501083_0001078 | |||
| 2859 | Ga0501083_0006526 | |||
| 2860 | Ga0501083_0017061 | |||
| 2861 | Ga0501083_0046170 | |||
| 2862 | Ga0501262_022218 | |||
| 2863 | Ga0501264_020252 | |||
| 2864 | Ga0501267_010317 | |||
| 2865 | Ga0501270_020611 | |||
| 2866 | Ga0501271_012488 | |||
| 2867 | Ga0501274_003030 | |||
| 2868 | Ga0501035_0008196 | |||
| 2869 | Ga0501035_0013440 | |||
| 2870 | Ga0501035_0014443 | |||
| 2871 | Ga0501035_0020365 | |||
| 2872 | Ga0501035_0112062 | |||
| 2873 | Ga0501035_0184233 | |||
| 2874 | Ga0501035_0202121 | |||
| 2875 | Ga0501035_0351149 | |||
| 2876 | Ga0501044_0005066 | |||
| 2877 | Ga0501044_0006024 | |||
| 2878 | Ga0501044_0011343 | |||
| 2879 | Ga0501044_0012740 | |||
| 2880 | Ga0501044_0021123 | |||
| 2881 | Ga0501044_0029461 | |||
| 2882 | Ga0501044_0037623 | |||
| 2883 | Ga0501044_0039911 | |||
| 2884 | Ga0501044_0045497 | |||
| 2885 | Ga0501044_0071868 | |||
| 2886 | Ga0501044_0278920 | |||
| 2887 | Ga0501044_0300616 | |||
| 2888 | Ga0501044_0338681 | |||
| 2889 | Ga0501044_0432044 | |||
| 2890 | Ga0501044_0494853 | |||
| 2891 | Ga0501044_1252047 | |||
| 2892 | Ga0501045_0650210 | |||
| 2893 | nmdc:mga00v17_171360_c1 | |||
| 2894 | nmdc:mga00v17_322_c1 | |||
| 2895 | nmdc:mga0k408_53973_c1 | |||
| 2896 | nmdc:mga0k408_87119_c1 | |||
| 2897 | nmdc:mga04h51_6941_c1 | |||
| 2898 | nmdc:mga07m45_1067_c1 | |||
| 2899 | nmdc:mga05p37_263414_c1 | |||
| 2900 | nmdc:mga05p37_96945_c1 | |||
| 2901 | nmdc:mga0qj67_184767_c1 | |||
| 2902 | nmdc:mga0qj67_470108_c1 | |||
| 2903 | nmdc:mga06r32_425194_c1 | |||
| 2904 | nmdc:mga08y16_232785_c1 | |||
| 2905 | nmdc:mga08y16_35_c1 | |||
| 2906 | nmdc:mga0n895_137439_c1 | |||
| 2907 | Ga0495601_0004088 | |||
| 2908 | Ga0495612_0240891 | |||
| 2909 | Ga0500635_0000272 | |||
| 2910 | Ga0495595_0298458 | |||
| 2911 | Ga0495619_0004827 | |||
| 2912 | Ga0495619_0034703 | |||
| 2913 | Ga0500578_0072674 | |||
| 2914 | Ga0500643_017342 | |||
| 2915 | Ga0500643_024190 | |||
| 2916 | Ga0500644_0052849 | |||
| 2917 | Ga0500644_0072901 | |||
| 2918 | Ga0500647_0006815 | |||
| 2919 | Ga0500583_0084612 | |||
| 2920 | Ga0500651_0077124 | |||
| 2921 | Ga0500566_0018781 | |||
| 2922 | Ga0500641_0003939 | |||
| 2923 | Ga0500555_012430 | |||
| 2924 | Ga0500556_0025140 | |||
| 2925 | Ga0500562_002067 | |||
| 2926 | Ga0500562_027940 | |||
| 2927 | Ga0500572_000816 | |||
| 2928 | Ga0500572_051368 | |||
| 2929 | Ga0500594_0036421 | |||
| 2930 | Ga0500595_005597 | |||
| 2931 | Ga0500595_010018 | |||
| 2932 | Ga0500608_000286 | |||
| 2933 | Ga0500614_004067 | |||
| 2934 | Ga0500618_034337 | |||
| 2935 | Ga0500642_0001748 | |||
| 2936 | Ga0500642_0036771 | |||
| 2937 | Ga0500642_0354961 | |||
| 2938 | Ga0500559_0000077 | |||
| 2939 | Ga0500559_0093284 | |||
| 2940 | Ga0500559_0223563 | |||
| 2941 | Ga0500573_0154421 | |||
| 2942 | Ga0500604_0020333 | |||
| 2943 | Ga0500616_0001203 | |||
| 2944 | Ga0500634_0000048 | |||
| 2945 | Ga0500638_077857 | |||
| 2946 | Ga0500637_0197909 | |||
| 2947 | Ga0500576_077327 | |||
| 2948 | Ga0500609_002739 | |||
| 2949 | Ga0500609_004454 | |||
| 2950 | Ga0500596_000361 | |||
| 2951 | Ga0501084_0023104 | |||
| 2952 | Ga0501084_0151195 | |||
| 2953 | Ga0501084_0386645 | |||
| 2954 | Ga0501084_0625770 | |||
| 2955 | Ga0590071_028791 | |||
| 2956 | Ga0590075_007021 | |||
| 2957 | Ga0587084_072859 | |||
| 2958 | Ga0587106_009543 | |||
| 2959 | Ga0587069_038136 | |||
| 2960 | Ga0587111_0049718 | |||
| 2961 | Ga0501082_0002595 | |||
| 2962 | Ga0501082_0006052 | |||
| 2963 | Ga0501082_0026737 | |||
| 2964 | Ga0501082_0049211 | |||
| 2965 | Ga0501082_0340936 | |||
| 2966 | Ga0466962_0196606 | |||
| 2967 | Ga0530510_0198590 | |||
| 2968 | 2511125423 | |||
| 2969 | 2524612184 | |||
| 2970 | 2547503123 | |||
| 2971 | 2572253570 | |||
| 2972 | 2585148493 | |||
| 2973 | 2585153083 | |||
| 2974 | 2585196645 | |||
| 2975 | 2587916737 | |||
| 2976 | 2643751400 | |||
| 2977 | 2643778190 | |||
| 2978 | 2643815258 | |||
| 2979 | 2643879297 | |||
| 2980 | 2643908760 | |||
| 2981 | 2643916188 | |||
| 2982 | 2643923473 | |||
| 2983 | 2643928431 | |||
| 2984 | 2643939936 | |||
| 2985 | 2643976204 | |||
| 2986 | 2644076994 | |||
| 2987 | 2644084946 | |||
| 2988 | 2644225731 | |||
| 2989 | 2644235220 | |||
| 2990 | 2644342498 | |||
| 2991 | 2644365798 | |||
| 2992 | 2644510547 | |||
| 2993 | 2644528905 | |||
| 2994 | 2644660596 | |||
| 2995 | 2644695308 | |||
| 2996 | 2644697957 | |||
| 2997 | 2748018276 | |||
| 2998 | 2792460637 | |||
| 2999 | 2816519079 | |||
| 3000 | 2819536616 | |||
| 3001 | 2819645777 | |||
| 3002 | 2819660067 | |||
| 3003 | 2842334888 | |||
| 3004 | 2842760626 | |||
| 3005 | 2842776898 | |||
| 3006 | 2842781095 | |||
| 3007 | 2843747760 | |||
| 3008 | 2849565369 | |||
| 3009 | 2849578402 | |||
| 3010 | 2851153821 | |||
| 3011 | 2852685118 | |||
| 3012 | 2857506380 | |||
| 3013 | 2883580552 | |||
| 3014 | 2884965129 | |||
| 3015 | 2894415887 | |||
| 3016 | 2894772819 | |||
| 3017 | 2895500810 | |||
| 3018 | 2895516320 | |||
| 3019 | 2895523761 | |||
| 3020 | 2895526658 | |||
| 3021 | 2898329506 | |||
| 3022 | 2919130658 | |||
| 3023 | 2919516113 | |||
| 3024 | 2919677945 | |||
| 3025 | 2923517970 | |||
| 3026 | 2928535403 | |||
| 3027 | 2929198339 | |||
| 3028 | 2929203548 | |||
| 3029 | 2937614867 | |||
| 3030 | 2939628328 | |||
| 3031 | 2941491130 | |||
| 3032 | 2961049326 | |||
| 3033 | 2961065982 | |||
| 3034 | 2995952061 | |||
| 3035 | 8002872527 | |||
| 3036 | 8003014568 | |||
| 3037 | 8021624523 | |||
| 3038 | 8021627609 | |||
| 3039 | 8021650728 | |||
| 3040 | 8055911262 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6cfw-assembly1.cif.gz_J | cryoem structure of a respiratory membrane-bound hydrogenase | 0.8036 | 50 | 179 |
| 7q5y-assembly4.cif.gz_X | structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus | 0.7829 | 48 | 179 |
| 7nz1-assembly1.cif.gz_B | respiratory complex i from escherichia coli - focused refinement of cytoplasmic arm | 0.7596 | 55 | 176 |
| 7q5y-assembly4.cif.gz_X | structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus | 0.7563 | 48 | 179 |
| 6zjn-assembly1.cif.gz_6 | respiratory complex i from thermus thermophilus, nadh dataset, minor state | 0.7469 | 43 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6cfwJ00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8036 | 50 | 179 | 3.40.50.12280 |
| af_I6XUD2_20_159_3.40.50.12280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7967 | 50 | 174 | 3.40.50.12280 |
| af_P20966_1_97_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.7447 | 53 | 99 | 3.40.50.2300 |
| af_Q57936_1_148_3.40.50.12280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7398 | 45 | 179 | 3.40.50.12280 |
| af_P9WJH1_2_170_3.40.50.12280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7328 | 36 | 176 | 3.40.50.12280 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U3CEH3-F1-model_v4 | NADH:ubiquinone oxidoreductase-like 20kDa subunit domain-containing protein | 0.8228 | 50 | 179 |
GO:0008137
GO:0046872 GO:0048038 GO:0051539 |
| AF-A0A7D5NVW1-F1-model_v4 | NADH-quinone oxidoreductase subunit NuoB (EC 1.6.5.11) | 0.8171 | 50 | 178 |
GO:0016491
GO:0051539 |
| AF-A0A7J3XTP5-F1-model_v4 | NADH-quinone oxidoreductase subunit B | 0.7947 | 46 | 178 |
GO:0008137
GO:0009060 GO:0015990 GO:0045271 GO:0046872 GO:0048038 GO:0051539 |
| AF-A0A7C5SKP0-F1-model_v4 | NADH-quinone oxidoreductase subunit B | 0.7944 | 43 | 175 |
GO:0008137
GO:0046872 GO:0048038 GO:0051539 |
| AF-A0A3C1IFK4-F1-model_v4 | NADH-quinone oxidoreductase subunit B | 0.7927 | 47 | 184 |
GO:0005886
GO:0008137 GO:0009060 GO:0015990 GO:0045271 GO:0046872 GO:0048038 GO:0051539 |