metagRoot

F494533

General Info

Members	Datasets	Scaffolds	Average Seq Length
1521	734	3042	341

Family's Representative Sequence

Representative Sequence	3300006038\|Ga0075365_10089188\|Ga0075365_100891883
Length	343
Sequence	MFETAIAGSLPKPAWLAETQKLWPQWKAQGEELRQAKADATLLWIKAQEDAGLDIVGDGEQSRQHFVHGFLEQVEGIDFEHKVKMGIRDNRYDAMVPQVVAPLRLRGRVHAFEAQLARAHTKRKLKFTLPGPMTIVDTVADRFYGGDAQGKVRMAMAFAELLNQEALALQADGVDIIQFDEPAFNVYMKDAADWGVQALERAAQGLTCTTAVHICYGYGIQANNDWKQKLGDEWRQYELVFPALARSSIGQVSLECYHSHVPPDLMKLLEGKDVMVGVIDVASDVVETPEQVADTIGKALQFVPKNRLFPCTNCGLAPMNREVALAKLQALGAGAALARERYR

Samples

	Sample ID	Description	Type	Environment
1	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
2	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
3	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
4	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
5	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
6	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
7	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
8	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
9	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
10	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
11	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
12	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
13	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
14	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
15	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
16	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
17	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
18	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
19	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
20	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
21	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
22	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
23	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
24	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
25	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
26	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
27	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
28	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
29	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
30	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
31	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
32	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
33	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
34	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
35	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
36	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
37	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
38	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
39	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
40	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
41	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
42	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
43	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
44	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
45	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
46	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
47	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
48	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
49	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
50	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
51	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
52	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
53	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
54	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
55	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
56	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
57	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
58	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
59	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
60	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
61	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
62	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
63	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
64	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
65	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
66	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
67	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
68	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
69	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
70	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
71	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
72	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
73	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
74	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
75	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
76	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
77	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
78	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
79	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
80	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
81	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
82	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
83	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
84	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
85	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
86	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
87	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
88	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
89	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
90	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
91	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
92	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
93	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
94	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
95	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
96	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
97	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
98	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
99	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
100	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
101	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
102	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
103	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
104	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
105	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
106	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
107	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
108	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
109	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
110	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
111	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
112	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
113	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
114	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
115	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
116	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
117	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
118	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
119	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
120	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
121	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
122	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
123	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
124	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
125	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
126	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
127	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
128	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
129	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
130	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
131	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
132	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
133	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
134	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
135	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
136	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
137	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
138	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
139	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
140	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
141	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
142	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
143	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
144	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
145	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
146	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
147	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
148	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
149	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
150	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
151	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
152	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
153	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
154	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
155	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
156	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
157	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
158	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
159	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
160	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
161	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
162	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
163	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
164	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
165	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
166	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
167	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
168	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
169	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
170	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
171	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
172	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
173	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
174	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
175	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
177	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
178	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
179	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
180	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
181	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
241	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
244	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
248	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
250	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
254	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
255	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
256	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
257	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
258	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
259	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
260	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
261	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
262	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
263	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
264	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
265	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
266	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
267	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
268	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
269	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
270	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
271	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
272	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
273	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
274	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
275	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
276	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
277	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
278	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
279	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
280	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
281	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
282	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
283	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
284	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
285	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
286	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
287	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
288	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
289	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
290	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
291	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
292	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
293	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
294	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
295	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
296	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
297	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
298	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
299	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
300	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
301	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
302	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
303	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
304	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
305	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
306	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
307	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
308	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
309	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
310	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
311	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
312	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
313	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
314	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
315	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
316	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
317	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
318	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
319	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
320	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
321	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
322	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
323	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
324	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
325	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
326	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
327	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
328	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
329	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
330	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
331	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
332	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
333	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
334	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
335	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
336	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
337	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
338	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
339	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
340	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
341	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
342	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
343	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
344	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
345	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
346	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
347	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
348	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
349	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
350	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
351	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
352	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
353	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
354	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
355	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
356	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
357	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
358	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
359	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
360	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
361	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
362	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
363	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
364	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
365	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
366	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
367	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
368	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
369	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
370	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
371	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
372	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
373	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
374	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
375	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
376	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
377	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
378	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
379	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
380	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
381	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
382	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
383	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
384	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
385	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
386	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
387	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
388	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
389	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
390	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
391	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
392	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
393	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
394	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
395	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
396	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
397	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
398	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
399	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
400	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
401	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
402	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
403	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
404	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
405	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
406	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
407	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
408	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
409	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
410	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
411	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
412	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
413	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
414	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
415	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
416	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
417	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
418	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
419	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
420	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
421	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
422	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
423	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
424	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
425	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
426	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
427	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
428	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
429	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
430	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
431	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
432	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
433	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
434	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
435	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
436	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
437	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
438	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
439	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
440	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
441	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
442	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
443	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
444	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
445	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
446	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
447	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
448	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
449	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
450	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
451	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
452	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
453	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
454	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
455	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
456	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
457	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
458	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
459	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
460	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
461	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
462	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
463	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
464	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
465	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
466	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
467	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
468	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
469	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
470	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
471	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
472	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
473	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
474	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
475	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
476	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
477	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
478	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
479	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
480	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
481	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
482	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
483	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
484	3300053733	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere	Metagenome	Endosphere
485	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
486	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
487	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
488	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
489	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
490	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
491	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
492	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
493	2511231002	Polaromonas sp. CF318	Isolate	Rhizosphere
494	2511231028	Bradyrhizobium sp. YR681	Isolate	Rhizosphere
495	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
496	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
497	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
498	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
499	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
500	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
501	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
502	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
503	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
504	2513237141	Bradyrhizobium sp. TV2a.2	Isolate	Nodule
505	2513237145	Bradyrhizobium elkanii USDA 3254	Isolate	Nodule
506	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
507	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
508	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
509	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
510	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
511	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
512	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
513	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
514	2547132374	Acidovorax radicis N35	Isolate	Unclassified
515	2585428057	Methylibium sp. YR605	Isolate	Rhizosphere
516	2602042107	Bradyrhizobium sp. NFR13	Isolate	Rhizoplane
517	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
518	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
519	2643221609	Acidovorax sp. Root217	Isolate	Unclassified
520	2643221611	Acidovorax sp. Root219	Isolate	Unclassified
521	2643221651	Afipia sp. Root123D2	Isolate	Unclassified
522	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
523	2721755523	Delftia sp. HK171	Isolate	Unclassified
524	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
525	2728368998	Bradyrhizobium macuxiense BR 10303	Isolate	Nodule
526	2738541277	Variovorax sp. GV051	Isolate	Unclassified
527	2738543012	Acidovorax sp. CF301	Isolate	Unclassified
528	2738543013	Variovorax sp. BT01	Isolate	Unclassified
529	2738543019	Variovorax sp. GV040	Isolate	Unclassified
530	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
531	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
532	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
533	2791355199
534	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
535	2816332133	Acidovorax radicis 2721A	Isolate	Unclassified
536	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
537	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
538	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
539	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
540	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
541	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
542	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
543	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
544	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
545	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
546	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
547	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
548	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
549	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
550	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
551	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
552	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
553	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
554	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
555	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
556	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
557	2831864461	Roseateles noduli HZ7	Isolate	Nodule
558	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
559	2839138175	Delftia acidovorans B15	Isolate	Rhizosphere
560	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
561	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
562	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
563	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
564	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
565	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
566	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
567	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
568	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
569	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
570	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
571	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
572	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
573	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
574	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
575	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
576	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
577	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
578	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
579	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
580	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
581	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
582	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
583	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
584	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
585	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
586	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
587	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
588	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
589	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
590	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
591	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
592	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
593	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
594	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
595	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
596	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
597	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
598	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
599	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
600	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
601	2893066018	Tardiphaga sp. P9-11	Isolate	Unclassified
602	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
603	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
604	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
605	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
606	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
607	2904699407
608	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
609	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
610	2906610324
611	2906626472	Bradyrhizobium hipponense aSej3	Isolate	Unclassified
612	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
613	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
614	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
615	2908739725	Bradyrhizobium sp. UFLA03-84	Isolate	Nodule
616	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
617	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
618	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
619	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
620	2922368715
621	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
622	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
623	2922425934
624	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
625	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
626	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
627	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
628	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
629	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
630	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
631	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
632	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
633	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
634	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
635	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
636	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
637	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
638	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
639	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
640	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
641	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
642	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
643	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
644	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
645	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
646	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
647	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
648	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
649	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
650	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
651	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
652	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
653	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
654	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
655	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
656	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
657	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
658	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
659	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
660	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
661	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
662	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
663	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
664	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
665	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
666	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
667	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
668	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
669	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
670	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
671	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
672	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
673	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
674	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
675	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
676	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
677	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
678	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
679	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
680	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
681	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
682	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
683	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
684	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
685	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
686	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
687	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
688	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
689	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
690	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
691	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
692	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
693	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
694	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
695	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
696	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
697	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
698	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
699	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
700	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
701	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
702	8016530956	Bradyrhizobium sp. LM6.11	Isolate	Nodule
703	8016548790	Bradyrhizobium sp. LM3.6	Isolate	Nodule
704	8016557553	Bradyrhizobium sp. LM3.4	Isolate	Nodule
705	8016566248	Bradyrhizobium sp. LM3.2	Isolate	Nodule
706	8016575299	Bradyrhizobium sp. LM2.9	Isolate	Nodule
707	8016583857	Bradyrhizobium sp. LM2.7	Isolate	Nodule
708	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
709	8016603502	Bradyrhizobium sp. LB7.2	Isolate	Nodule
710	8016613128	Bradyrhizobium sp. LB7.1	Isolate	Nodule
711	8016622563	Bradyrhizobium sp. LB13.1	Isolate	Nodule
712	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
713	8019530166	Bradyrhizobium sp. LM4.3	Isolate	Nodule
714	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
715	8019547302	Bradyrhizobium sp. LB1.3	Isolate	Nodule
716	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
717	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule
718	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
719	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
720	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
721	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
722	8019629233	Bradyrhizobium sp. GM6.1	Isolate	Nodule
723	8019638758	Bradyrhizobium sp. GM5.1	Isolate	Nodule
724	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
725	8019659431	Bradyrhizobium sp. GM22.5	Isolate	Nodule
726	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
727	8019678201	Bradyrhizobium sp. GM0.4	Isolate	Nodule
728	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
729	8055225921	Achromobacter panacis KCTC 42751	Isolate	Rhizosphere
730	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
731	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
732	8056681323	Bradyrhizobium cenepequi CNPSo 4026	Isolate	Nodule
733	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule
734	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	84.1
Metatranscriptomes	0
Isolates	15.9

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	12.95
Nodule	11.05
Rhizoplane	3.75
Rhizosphere	64.3
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0075365_10089188	3300006038	Bacteria	2099
2	JGI24740J21852_10017791	3300001979	Bacteria	2534
3	JGI24739J22299_10012305	3300001989	Bacteria	3142
4	JGI24737J22298_10027717	3300001990	Bacteria	1784
5	JGI24743J22301_10011688	3300001991	Bacteria	1586
6	JGI24744J21845_10009727	3300002077	Bacteria	1974
7	JGI24034J26672_10007151	3300002239	Bacteria	1618
8	JGI24751J29686_10009159	3300002459	Bacteria	2033
9	JGI25155J39150_1000055	3300002704	Bacteria	74180
10	JGI25156J39149_1000078	3300002705	Bacteria	74254
11	JGI25154J39366_1000105	3300002738	Bacteria	74254
12	JGI25157J39369_1000098	3300002741	Bacteria	74254
13	JGI25150J39212_1002968	3300002774	Bacteria	4091
14	JGI25159J45721_1000534	3300002987	Bacteria	17310
15	JGI25159J45721_1001755	3300002987	Bacteria	8727
16	JGI25159J45721_1004529	3300002987	Bacteria	4591
17	JGI25151J46595_10010016	3300003187	Bacteria	4442
18	JGI25151J46595_10017852	3300003187	Bacteria	3064
19	JGI25160J50197_1000270	3300003354	Bacteria	38571
20	JGI25161J50226_1000040	3300003374	Bacteria	124804
21	Ga0055526_1002482	3300003771	Bacteria	12463
22	Ga0055526_1004021	3300003771	Bacteria	9038
23	Ga0055526_1005102	3300003771	Bacteria	7661
24	Ga0055526_1013876	3300003771	Bacteria	3366
25	Ga0055537_1000157	3300003773	Bacteria	50500
26	Ga0055537_1006224	3300003773	Bacteria	3064
27	Ga0055524_1000070	3300003775	Bacteria	128656
28	Ga0055524_1000077	3300003775	Bacteria	121584
29	Ga0055534_1001317	3300003784	Bacteria	9994
30	Ga0055534_1006642	3300003784	Bacteria	2880
31	Ga0055528_1002647	3300003790	Bacteria	9460
32	Ga0055530_10000139	3300003791	Bacteria	64639
33	Ga0055530_10001005	3300003791	Bacteria	22543
34	Ga0055540_1000010	3300003792	Bacteria	290865
35	Ga0055540_1000013	3300003792	Bacteria	262274
36	Ga0055531_10000192	3300003794	Bacteria	67874
37	Ga0055531_10003627	3300003794	Bacteria	9742
38	Ga0055531_10006917	3300003794	Bacteria	6316
39	Ga0055531_10013187	3300003794	Bacteria	3831
40	Ga0055543_1001026	3300004625	Bacteria	12397
41	Ga0055543_1001266	3300004625	Bacteria	10416
42	Ga0065165_1000095	3300005262	Bacteria	145470
43	Ga0065165_1000281	3300005262	Bacteria	86863
44	Ga0065165_1002008	3300005262	Bacteria	19054
45	Ga0065165_1006168	3300005262	Bacteria	6398
46	Ga0065165_1007351	3300005262	Bacteria	5444
47	Ga0065165_1009432	3300005262	Bacteria	4377
48	Ga0065704_10010277	3300005289	Bacteria	2118
49	Ga0065707_10244126	3300005295	Bacteria	1146
50	Ga0070676_10106726	3300005328	Bacteria	1738
51	Ga0070683_100037201	3300005329	Bacteria	4455
52	Ga0070690_100005802	3300005330	Bacteria	6955
53	Ga0068869_100008642	3300005334	Bacteria	6579
54	Ga0068869_100023731	3300005334	Bacteria	4242
55	Ga0068869_100078498	3300005334	Bacteria	2459
56	Ga0068869_100309723	3300005334	Bacteria	1278
57	Ga0070680_100007395	3300005336	Bacteria	8384
58	Ga0070680_100043947	3300005336	Bacteria	3630
59	Ga0070680_100049099	3300005336	Bacteria	3440
60	Ga0070682_100008096	3300005337	Bacteria	5924
61	Ga0070682_100292108	3300005337	Bacteria	1193
62	Ga0068868_100302368	3300005338	Bacteria	1359
63	Ga0070660_100136362	3300005339	Bacteria	1966
64	Ga0070689_100014900	3300005340	Bacteria	5658
65	Ga0070691_10019004	3300005341	Bacteria	3167
66	Ga0070691_10074214	3300005341	Bacteria	1655
67	Ga0070687_100007952	3300005343	Bacteria	4464
68	Ga0070687_100106897	3300005343	Bacteria	1577
69	Ga0070661_100067892	3300005344	Bacteria	2621
70	Ga0070692_10035094	3300005345	Bacteria	2538
71	Ga0070669_100144790	3300005353	Bacteria	1835
72	Ga0070675_100104411	3300005354	Bacteria	2390
73	Ga0070671_100002780	3300005355	Bacteria	13594
74	Ga0070671_100003306	3300005355	Bacteria	12582
75	Ga0070671_100031182	3300005355	Bacteria	4403
76	Ga0070674_100096885	3300005356	Bacteria	2141
77	Ga0070673_100089573	3300005364	Bacteria	2512
78	Ga0070673_100130094	3300005364	Bacteria	2110
79	Ga0070688_100096440	3300005365	Bacteria	1942
80	Ga0070659_100087281	3300005366	Bacteria	2497
81	Ga0070667_100001103	3300005367	Bacteria	24743
82	Ga0070667_100012316	3300005367	Bacteria	7075
83	Ga0070667_100025891	3300005367	Bacteria	4880
84	Ga0070667_100285984	3300005367	Bacteria	1482
85	Ga0070703_10005526	3300005406	Bacteria	3537
86	Ga0070709_10034364	3300005434	Bacteria	3073
87	Ga0070709_10158666	3300005434	Bacteria	1571
88	Ga0070709_10225353	3300005434	Bacteria	1339
89	Ga0070714_100349201	3300005435	Bacteria	1389
90	Ga0070713_100013257	3300005436	Bacteria	6078
91	Ga0070713_100034407	3300005436	Bacteria	4070
92	Ga0070713_100154919	3300005436	Bacteria	2042
93	Ga0070713_100347368	3300005436	Bacteria	1376
94	Ga0070713_100373100	3300005436	Bacteria	1328
95	Ga0070713_100410888	3300005436	Bacteria	1265
96	Ga0070713_100500255	3300005436	Bacteria	1147
97	Ga0070710_10013162	3300005437	Bacteria	4134
98	Ga0070710_10049801	3300005437	Bacteria	2345
99	Ga0070701_10002701	3300005438	Bacteria	6875
100	Ga0070711_100015635	3300005439	Bacteria	4805
101	Ga0070711_100042392	3300005439	Bacteria	3076
102	Ga0070711_100057666	3300005439	Bacteria	2690
103	Ga0070711_100203072	3300005439	Bacteria	1531
104	Ga0070705_100000101	3300005440	Bacteria	48577
105	Ga0070705_100123007	3300005440	Bacteria	1679
106	Ga0070700_100013900	3300005441	Bacteria	4532
107	Ga0070700_100018001	3300005441	Bacteria	4053
108	Ga0070700_100019424	3300005441	Bacteria	3921
109	Ga0070700_100183220	3300005441	Bacteria	1459
110	Ga0070694_100000190	3300005444	Bacteria	32234
111	Ga0070694_100000321	3300005444	Bacteria	25869
112	Ga0070663_100038557	3300005455	Bacteria	3334
113	Ga0070663_100053943	3300005455	Bacteria	2872
114	Ga0070663_100133459	3300005455	Bacteria	1888
115	Ga0070663_100260408	3300005455	Bacteria	1376
116	Ga0070663_100313578	3300005455	Bacteria	1259
117	Ga0070678_100011466	3300005456	Bacteria	5470
118	Ga0070678_100059672	3300005456	Bacteria	2804
119	Ga0070662_100012011	3300005457	Bacteria	5731
120	Ga0070662_100078836	3300005457	Bacteria	2448
121	Ga0070681_10220075	3300005458	Bacteria	1814
122	Ga0068867_100005086	3300005459	Bacteria	9293
123	Ga0068867_100023159	3300005459	Bacteria	4446
124	Ga0068867_100023673	3300005459	Bacteria	4397
125	Ga0070685_10138591	3300005466	Bacteria	1529
126	Ga0070706_100070071	3300005467	Bacteria	3243
127	Ga0070706_100136151	3300005467	Bacteria	2293
128	Ga0070706_100151631	3300005467	Bacteria	2164
129	Ga0070707_100047846	3300005468	Bacteria	4095
130	Ga0070707_100115843	3300005468	Bacteria	2601
131	Ga0070707_100135087	3300005468	Bacteria	2399
132	Ga0070707_100142620	3300005468	Bacteria	2331
133	Ga0070698_100028063	3300005471	Bacteria	5849
134	Ga0070698_100057269	3300005471	Bacteria	3944
135	Ga0070698_100082697	3300005471	Bacteria	3203
136	Ga0070699_100000040	3300005518	Bacteria	130355
137	Ga0070699_100000281	3300005518	Bacteria	48573
138	Ga0070699_100004786	3300005518	Bacteria	11963
139	Ga0070699_100025324	3300005518	Bacteria	5116
140	Ga0070699_100090992	3300005518	Bacteria	2667
141	Ga0070679_100029845	3300005530	Bacteria	5380
142	Ga0070679_100052810	3300005530	Bacteria	4046
143	Ga0070679_100079040	3300005530	Bacteria	3278
144	Ga0070679_100093360	3300005530	Bacteria	2997
145	Ga0070679_100118628	3300005530	Bacteria	2631
146	Ga0070679_100215666	3300005530	Bacteria	1882
147	Ga0070679_100329079	3300005530	Bacteria	1476
148	Ga0070679_100361986	3300005530	Bacteria	1398
149	Ga0070684_100042913	3300005535	Bacteria	3906
150	Ga0070684_100080099	3300005535	Bacteria	2888
151	Ga0070697_100001131	3300005536	Bacteria	20169
152	Ga0070697_100017216	3300005536	Bacteria	5682
153	Ga0070697_100070185	3300005536	Bacteria	2871
154	Ga0070697_100196981	3300005536	Bacteria	1711
155	Ga0068853_100024057	3300005539	Bacteria	5105
156	Ga0068853_100032760	3300005539	Bacteria	4404
157	Ga0068853_100159152	3300005539	Bacteria	2037
158	Ga0070672_100002417	3300005543	Bacteria	11834
159	Ga0070672_100024419	3300005543	Bacteria	4468
160	Ga0070672_100163949	3300005543	Bacteria	1846
161	Ga0070686_100031871	3300005544	Bacteria	3227
162	Ga0070686_100080092	3300005544	Bacteria	2160
163	Ga0070686_100098612	3300005544	Bacteria	1970
164	Ga0070686_100148002	3300005544	Bacteria	1641
165	Ga0070695_100000120	3300005545	Bacteria	35206
166	Ga0070695_100001510	3300005545	Bacteria	12915
167	Ga0070695_100006158	3300005545	Bacteria	7091
168	Ga0070695_100023919	3300005545	Bacteria	3761
169	Ga0070696_100000478	3300005546	Bacteria	25109
170	Ga0070696_100034673	3300005546	Bacteria	3473
171	Ga0070696_100058686	3300005546	Bacteria	2688
172	Ga0070696_100060978	3300005546	Bacteria	2638
173	Ga0070693_100017099	3300005547	Bacteria	3764
174	Ga0070693_100024619	3300005547	Bacteria	3230
175	Ga0070665_100005197	3300005548	Bacteria	13464
176	Ga0070665_100008470	3300005548	Bacteria	10405
177	Ga0070665_100084260	3300005548	Bacteria	3184
178	Ga0070665_100136229	3300005548	Bacteria	2458
179	Ga0070704_100002732	3300005549	Bacteria	9977
180	Ga0070704_100015216	3300005549	Bacteria	4827
181	Ga0068855_100016193	3300005563	Bacteria	8965
182	Ga0068855_100083208	3300005563	Bacteria	3707
183	Ga0068855_100155269	3300005563	Bacteria	2601
184	Ga0068855_100168170	3300005563	Bacteria	2484
185	Ga0068855_100196773	3300005563	Bacteria	2271
186	Ga0068857_100006107	3300005577	Bacteria	10289
187	Ga0068857_100034794	3300005577	Bacteria	4456
188	Ga0068857_100034908	3300005577	Bacteria	4450
189	Ga0068857_100042074	3300005577	Bacteria	4052
190	Ga0068857_100054552	3300005577	Bacteria	3547
191	Ga0068854_100033432	3300005578	Bacteria	3585
192	Ga0068854_100048788	3300005578	Bacteria	3022
193	Ga0068856_100033788	3300005614	Bacteria	5008
194	Ga0068856_100059957	3300005614	Bacteria	3759
195	Ga0068856_100115510	3300005614	Bacteria	2684
196	Ga0070702_100005020	3300005615	Bacteria	6113
197	Ga0070702_100019273	3300005615	Bacteria	3555
198	Ga0068859_100006827	3300005617	Bacteria	11597
199	Ga0068859_100014929	3300005617	Bacteria	7797
200	Ga0068864_100091447	3300005618	Bacteria	2684
201	Ga0068864_100250064	3300005618	Bacteria	1646
202	Ga0068866_10004982	3300005718	Bacteria	5467
203	Ga0068866_10018679	3300005718	Bacteria	3141
204	Ga0068866_10068265	3300005718	Bacteria	1869
205	Ga0068861_100010399	3300005719	Bacteria	6456
206	Ga0068861_100086046	3300005719	Bacteria	2470
207	Ga0068861_100124811	3300005719	Bacteria	2082
208	Ga0068851_10014704	3300005834	Bacteria	3719
209	Ga0068870_10001565	3300005840	Bacteria	9301
210	Ga0068863_100021529	3300005841	Bacteria	6152
211	Ga0068863_100065045	3300005841	Bacteria	3450
212	Ga0068858_100005372	3300005842	Bacteria	12559
213	Ga0068858_100037333	3300005842	Bacteria	4505
214	Ga0068860_100000900	3300005843	Bacteria	32980
215	Ga0068860_100001801	3300005843	Bacteria	22801
216	Ga0068860_100004828	3300005843	Bacteria	13727
217	Ga0068862_100001691	3300005844	Bacteria	19990
218	Ga0068862_100007040	3300005844	Bacteria	9339
219	Ga0068862_100021658	3300005844	Bacteria	5374
220	Ga0068862_100188071	3300005844	Bacteria	1857
221	Ga0081455_10004276	3300005937	Bacteria	16079
222	Ga0081455_10016793	3300005937	Bacteria	7043
223	Ga0081538_10016517	3300005981	Bacteria	5654
224	Ga0081538_10038889	3300005981	Bacteria	3059
225	Ga0081540_1023658	3300005983	Bacteria	3587
226	Ga0081540_1034728	3300005983	Bacteria	2714
227	Ga0081540_1056077	3300005983	Bacteria	1915
228	Ga0081539_10001525	3300005985	Bacteria	38837
229	Ga0081539_10003706	3300005985	Bacteria	18204
230	Ga0081539_10006645	3300005985	Bacteria	10965
231	Ga0070717_10003274	3300006028	Bacteria	11582
232	Ga0070717_10009311	3300006028	Bacteria	7379
233	Ga0070717_10088717	3300006028	Bacteria	2607
234	Ga0075365_10014604	3300006038	Bacteria	4730
235	Ga0075365_10047953	3300006038	Bacteria	2810
236	Ga0075365_10118800	3300006038	Bacteria	1822
237	Ga0075365_10158482	3300006038	Bacteria	1576
238	Ga0075368_10023058	3300006042	Bacteria	2374
239	Ga0075363_100002514	3300006048	Bacteria	7519
240	Ga0075363_100038853	3300006048	Bacteria	2503
241	Ga0075363_100052576	3300006048	Bacteria	2175
242	Ga0075364_10029633	3300006051	Bacteria	3510
243	Ga0075364_10182469	3300006051	Bacteria	1420
244	Ga0070715_10053487	3300006163	Bacteria	1745
245	Ga0070716_100062984	3300006173	Bacteria	2152
246	Ga0070712_100003410	3300006175	Bacteria	9776
247	Ga0070712_100020484	3300006175	Bacteria	4328
248	Ga0075362_10000422	3300006177	Bacteria	12183
249	Ga0075362_10004427	3300006177	Bacteria	5046
250	Ga0075362_10005989	3300006177	Bacteria	4498
251	Ga0075362_10012101	3300006177	Bacteria	3417
252	Ga0075362_10053242	3300006177	Bacteria	1816
253	Ga0075362_10060327	3300006177	Bacteria	1714
254	Ga0075362_10061590	3300006177	Bacteria	1698
255	Ga0075367_10026289	3300006178	Bacteria	3300
256	Ga0075367_10070132	3300006178	Bacteria	2106
257	Ga0075367_10088621	3300006178	Bacteria	1880
258	Ga0075369_10001384	3300006186	Bacteria	8272
259	Ga0075369_10001670	3300006186	Bacteria	7650
260	Ga0075369_10007041	3300006186	Bacteria	4274
261	Ga0075369_10044928	3300006186	Bacteria	1898
262	Ga0075366_10000230	3300006195	Bacteria	24874
263	Ga0075366_10002756	3300006195	Bacteria	9089
264	Ga0075366_10010522	3300006195	Bacteria	5194
265	Ga0075366_10011433	3300006195	Bacteria	5014
266	Ga0075366_10014598	3300006195	Bacteria	4487
267	Ga0075366_10026071	3300006195	Bacteria	3421
268	Ga0075366_10031649	3300006195	Bacteria	3114
269	Ga0075366_10104748	3300006195	Bacteria	1700
270	Ga0097621_100007876	3300006237	Bacteria	7641
271	Ga0097621_100017698	3300006237	Bacteria	5420
272	Ga0075370_10002326	3300006353	Bacteria	8783
273	Ga0075370_10002633	3300006353	Bacteria	8380
274	Ga0075370_10072939	3300006353	Bacteria	1965
275	Ga0075370_10213849	3300006353	Bacteria	1139
276	Ga0068871_100009817	3300006358	Bacteria	6948
277	Ga0075428_100011445	3300006844	Bacteria	9868
278	Ga0075428_100021340	3300006844	Bacteria	7171
279	Ga0075428_100033626	3300006844	Bacteria	5659
280	Ga0075428_100035309	3300006844	Bacteria	5511
281	Ga0075428_100075812	3300006844	Bacteria	3672
282	Ga0075428_100196473	3300006844	Bacteria	2181
283	Ga0075428_100201188	3300006844	Bacteria	2153
284	Ga0075430_100022189	3300006846	Bacteria	5397
285	Ga0075430_100024922	3300006846	Bacteria	5088
286	Ga0075430_100050203	3300006846	Bacteria	3519
287	Ga0075431_100002077	3300006847	Bacteria	19121
288	Ga0075431_100032670	3300006847	Bacteria	5363
289	Ga0075431_100049001	3300006847	Bacteria	4357
290	Ga0075431_100049730	3300006847	Bacteria	4322
291	Ga0075431_100065764	3300006847	Bacteria	3743
292	Ga0075431_100250143	3300006847	Bacteria	1801
293	Ga0075433_10008717	3300006852	Bacteria	8093
294	Ga0075433_10044526	3300006852	Bacteria	3856
295	Ga0075434_100000653	3300006871	Bacteria	26879
296	Ga0075434_100001081	3300006871	Bacteria	22315
297	Ga0075434_100049402	3300006871	Bacteria	4177
298	Ga0075429_100006001	3300006880	Bacteria	10504
299	Ga0075429_100120358	3300006880	Bacteria	2294
300	Ga0068865_100002251	3300006881	Bacteria	11352
301	Ga0068865_100016940	3300006881	Bacteria	4676
302	Ga0068865_100092115	3300006881	Bacteria	2201
303	Ga0068865_100220206	3300006881	Bacteria	1483
304	Ga0075436_100007986	3300006914	Bacteria	7244
305	Ga0097620_100006827	3300006931	Bacteria	11597
306	Ga0097620_100014928	3300006931	Bacteria	7797
307	Ga0079104_1000001	3300006946	Bacteria	521847
308	Ga0079104_1000034	3300006946	Bacteria	199368
309	Ga0099826_10000013	3300006948	Bacteria	265459
310	Ga0075435_100003036	3300007076	Bacteria	11313
311	Ga0075435_100066469	3300007076	Bacteria	2933
312	Ga0075435_100084446	3300007076	Bacteria	2612
313	Ga0075435_100098784	3300007076	Bacteria	2417
314	Ga0075435_100118580	3300007076	Bacteria	2206
315	Ga0099794_10014472	3300007265	Bacteria	3458
316	Ga0105251_10013329	3300009011	Bacteria	4603
317	Ga0105240_10023938	3300009093	Bacteria	8066
318	Ga0105240_10040155	3300009093	Bacteria	5989
319	Ga0105240_10055715	3300009093	Bacteria	4949
320	Ga0105240_10063064	3300009093	Bacteria	4612
321	Ga0105240_10126908	3300009093	Bacteria	3064
322	Ga0111539_10010139	3300009094	Bacteria	11872
323	Ga0111539_10016859	3300009094	Bacteria	9047
324	Ga0111539_10110372	3300009094	Bacteria	3228
325	Ga0111539_10280509	3300009094	Bacteria	1939
326	Ga0105245_10010950	3300009098	Bacteria	7891
327	Ga0105245_10234824	3300009098	Bacteria	1775
328	Ga0114129_10005978	3300009147	Bacteria	17237
329	Ga0114129_10093857	3300009147	Bacteria	4156
330	Ga0114129_10315062	3300009147	Bacteria	2081
331	Ga0114129_10817751	3300009147	Bacteria	1187
332	Ga0105243_10003679	3300009148	Bacteria	12325
333	Ga0105243_10010685	3300009148	Bacteria	6958
334	Ga0105243_10094471	3300009148	Bacteria	2469
335	Ga0105243_10102609	3300009148	Bacteria	2377
336	Ga0105243_10123274	3300009148	Bacteria	2189
337	Ga0105243_10260477	3300009148	Bacteria	1552
338	Ga0105241_10030993	3300009174	Bacteria	4000
339	Ga0105241_10179295	3300009174	Bacteria	1756
340	Ga0105241_10202102	3300009174	Bacteria	1660
341	Ga0105242_10014148	3300009176	Bacteria	6178
342	Ga0105242_10036352	3300009176	Bacteria	3951
343	Ga0105242_10154645	3300009176	Bacteria	2002
344	Ga0105248_10001495	3300009177	Bacteria	26017
345	Ga0105248_10008114	3300009177	Bacteria	11527
346	Ga0105248_10042182	3300009177	Bacteria	5117
347	Ga0105237_10036152	3300009545	Bacteria	4997
348	Ga0105237_10052212	3300009545	Bacteria	4105
349	Ga0105238_10038672	3300009551	Bacteria	4844
350	Ga0105238_10050078	3300009551	Bacteria	4205
351	Ga0105238_10090036	3300009551	Bacteria	3056
352	Ga0105238_10194981	3300009551	Bacteria	2001
353	Ga0105238_10292733	3300009551	Bacteria	1611
354	Ga0105249_10008449	3300009553	Bacteria	8970
355	Ga0105249_10018354	3300009553	Bacteria	6220
356	Ga0105249_10022374	3300009553	Bacteria	5661
357	Ga0105249_10060936	3300009553	Bacteria	3462
358	Ga0105249_10499242	3300009553	Bacteria	1262
359	Ga0105239_10105388	3300010375	Bacteria	3123
360	Ga0105239_10155995	3300010375	Bacteria	2549
361	Ga0105239_10182845	3300010375	Bacteria	2345
362	Ga0157326_1008552	3300012513	Bacteria	1118
363	Ga0157373_10025937	3300013100	Bacteria	4235
364	Ga0157371_10347207	3300013102	Bacteria	1080
365	Ga0157370_10051172	3300013104	Bacteria	3946
366	Ga0157370_10244513	3300013104	Bacteria	1660
367	Ga0157369_10023068	3300013105	Bacteria	6935
368	Ga0157369_10217822	3300013105	Bacteria	1999
369	Ga0157369_10296890	3300013105	Bacteria	1681
370	Ga0157369_10407585	3300013105	Bacteria	1410
371	Ga0157378_10018884	3300013297	Bacteria	6060
372	Ga0157378_10070587	3300013297	Bacteria	3137
373	Ga0163162_10017892	3300013306	Bacteria	6933
374	Ga0163162_10044738	3300013306	Bacteria	4434
375	Ga0157372_10087636	3300013307	Bacteria	3532
376	Ga0157372_10318643	3300013307	Bacteria	1810
377	Ga0157375_10009694	3300013308	Bacteria	8467
378	Ga0157375_10055231	3300013308	Bacteria	3915
379	Ga0163163_10136049	3300014325	Bacteria	2498
380	Ga0163163_10404282	3300014325	Bacteria	1424
381	Ga0157380_10278580	3300014326	Bacteria	1529
382	Ga0157377_10004082	3300014745	Bacteria	6667
383	Ga0157379_10016565	3300014968	Bacteria	6482
384	Ga0157379_10027623	3300014968	Bacteria	5052
385	Ga0157379_10212843	3300014968	Bacteria	1750
386	Ga0157376_10048790	3300014969	Bacteria	3504
387	Ga0157376_10060088	3300014969	Bacteria	3190
388	Ga0157376_10064013	3300014969	Bacteria	3100
389	Ga0157376_10159089	3300014969	Bacteria	2045
390	Ga0182007_10053160	3300015262	Bacteria	1334
391	Ga0163161_10023935	3300017792	Bacteria	4310
392	Ga0163161_10043237	3300017792	Bacteria	3243
393	Ga0213871_10007141	3300021441	Bacteria	2400
394	Ga0224572_1014941	3300024225	Bacteria	1484
395	Ga0209435_100010	3300025206	Bacteria	475373
396	Ga0209436_107997	3300025208	Bacteria	2149
397	Ga0209563_105456	3300025230	Bacteria	2304
398	Ga0207425_1000529	3300025245	Bacteria	23293
399	Ga0207425_1013337	3300025245	Bacteria	1902
400	Ga0209646_1000001	3300025246	Bacteria	3092932
401	Ga0209026_1000001	3300025250	Bacteria	1228671
402	Ga0209759_1000001	3300025256	Bacteria	2799452
403	Ga0209129_1006750	3300025258	Bacteria	3613
404	Ga0209129_1015120	3300025258	Bacteria	1604
405	Ga0209233_1005635	3300025261	Bacteria	4137
406	Ga0209565_1000036	3300025263	Bacteria	293334
407	Ga0209565_1000226	3300025263	Bacteria	63161
408	Ga0209673_1000282	3300025273	Bacteria	95013
409	Ga0209673_1023252	3300025273	Bacteria	2116
410	Ga0209130_1000042	3300025284	Bacteria	257581
411	Ga0209130_1000117	3300025284	Bacteria	129338
412	Ga0209130_1000255	3300025284	Bacteria	67166
413	Ga0209130_1003302	3300025284	Bacteria	6987
414	Ga0209675_1000289	3300025291	Bacteria	47643
415	Ga0209675_1001115	3300025291	Bacteria	16357
416	Ga0209675_1003508	3300025291	Bacteria	7407
417	Ga0209675_1004251	3300025291	Bacteria	6454
418	Ga0209675_1004558	3300025291	Bacteria	6113
419	Ga0209676_1000007	3300025292	Bacteria	1029371
420	Ga0209676_1005428	3300025292	Bacteria	6666
421	Ga0209676_1014443	3300025292	Bacteria	2969
422	Ga0209025_1000490	3300025294	Bacteria	76105
423	Ga0209025_1002471	3300025294	Bacteria	19453
424	Ga0209025_1004169	3300025294	Bacteria	12796
425	Ga0209025_1005029	3300025294	Bacteria	11038
426	Ga0209025_1030997	3300025294	Bacteria	2542
427	Ga0209564_1000030	3300025295	Bacteria	503296
428	Ga0209564_1000297	3300025295	Bacteria	100091
429	Ga0209564_1001388	3300025295	Bacteria	25232
430	Ga0209564_1001472	3300025295	Bacteria	23825
431	Ga0209564_1027670	3300025295	Bacteria	1835
432	Ga0209758_1005037	3300025297	Bacteria	10504
433	Ga0209050_1000003	3300025298	Bacteria	1609245
434	Ga0209050_1000340	3300025298	Bacteria	92794
435	Ga0209050_1001643	3300025298	Bacteria	22832
436	Ga0209256_1000001	3300025299	Bacteria	2166974
437	Ga0209256_1000015	3300025299	Bacteria	622953
438	Ga0209256_1040060	3300025299	Bacteria	1199
439	Ga0207426_1000097	3300025302	Bacteria	265930
440	Ga0207426_1000554	3300025302	Bacteria	51521
441	Ga0207426_1003358	3300025302	Bacteria	8787
442	Ga0207426_1004842	3300025302	Bacteria	6383
443	Ga0209051_1000003	3300025303	Bacteria	1609245
444	Ga0209051_1000022	3300025303	Bacteria	474879
445	Ga0209051_1000317	3300025303	Bacteria	73057
446	Ga0209051_1003047	3300025303	Bacteria	11332
447	Ga0209051_1015326	3300025303	Bacteria	3531
448	Ga0209257_1000020	3300025304	Bacteria	773356
449	Ga0209257_1000030	3300025304	Bacteria	689812
450	Ga0209257_1000039	3300025304	Bacteria	591694
451	Ga0209257_1017850	3300025304	Bacteria	2769
452	Ga0207656_10016280	3300025321	Bacteria	2893
453	Ga0207653_10000352	3300025885	Bacteria	22767
454	Ga0207642_10004999	3300025899	Bacteria	4303
455	Ga0207642_10067284	3300025899	Bacteria	1690
456	Ga0207642_10070199	3300025899	Bacteria	1664
457	Ga0207647_10013302	3300025904	Bacteria	5710
458	Ga0207647_10017722	3300025904	Bacteria	4836
459	Ga0207647_10076776	3300025904	Bacteria	2009
460	Ga0207699_10020587	3300025906	Bacteria	3539
461	Ga0207699_10026409	3300025906	Bacteria	3201
462	Ga0207645_10010474	3300025907	Bacteria	6365
463	Ga0207643_10001548	3300025908	Bacteria	13108
464	Ga0207643_10047203	3300025908	Bacteria	2436
465	Ga0207684_10026966	3300025910	Bacteria	4898
466	Ga0207684_10055384	3300025910	Bacteria	3365
467	Ga0207684_10060098	3300025910	Bacteria	3228
468	Ga0207684_10109184	3300025910	Bacteria	2368
469	Ga0207684_10176761	3300025910	Bacteria	1840
470	Ga0207684_10189372	3300025910	Bacteria	1774
471	Ga0207654_10000803	3300025911	Bacteria	17284
472	Ga0207707_10079338	3300025912	Bacteria	2866
473	Ga0207695_10001543	3300025913	Bacteria	37956
474	Ga0207695_10055524	3300025913	Bacteria	4127
475	Ga0207695_10148018	3300025913	Bacteria	2290
476	Ga0207671_10132666	3300025914	Bacteria	1913
477	Ga0207693_10005060	3300025915	Bacteria	11066
478	Ga0207693_10007515	3300025915	Bacteria	8949
479	Ga0207693_10055577	3300025915	Bacteria	3106
480	Ga0207693_10155603	3300025915	Bacteria	1798
481	Ga0207693_10180504	3300025915	Bacteria	1661
482	Ga0207663_10051383	3300025916	Bacteria	2566
483	Ga0207663_10059580	3300025916	Bacteria	2416
484	Ga0207663_10229523	3300025916	Bacteria	1355
485	Ga0207663_10312890	3300025916	Bacteria	1177
486	Ga0207660_10001765	3300025917	Bacteria	14471
487	Ga0207660_10021315	3300025917	Bacteria	4357
488	Ga0207660_10024850	3300025917	Bacteria	4059
489	Ga0207660_10149881	3300025917	Bacteria	1791
490	Ga0207662_10003149	3300025918	Bacteria	8432
491	Ga0207657_10009798	3300025919	Bacteria	9604
492	Ga0207652_10002565	3300025921	Bacteria	15245
493	Ga0207652_10007935	3300025921	Bacteria	8524
494	Ga0207652_10035728	3300025921	Bacteria	4196
495	Ga0207652_10064508	3300025921	Bacteria	3169
496	Ga0207652_10072394	3300025921	Bacteria	2997
497	Ga0207646_10125012	3300025922	Bacteria	2312
498	Ga0207646_10159545	3300025922	Bacteria	2035
499	Ga0207646_10300495	3300025922	Bacteria	1450
500	Ga0207681_10022622	3300025923	Bacteria	4012
501	Ga0207694_10001371	3300025924	Bacteria	20975
502	Ga0207650_10019546	3300025925	Bacteria	4762
503	Ga0207659_10139685	3300025926	Bacteria	1879
504	Ga0207687_10008125	3300025927	Bacteria	6869
505	Ga0207687_10010116	3300025927	Bacteria	6167
506	Ga0207687_10063642	3300025927	Bacteria	2612
507	Ga0207687_10160747	3300025927	Bacteria	1723
508	Ga0207700_10004789	3300025928	Bacteria	8028
509	Ga0207700_10114966	3300025928	Bacteria	2172
510	Ga0207700_10349550	3300025928	Bacteria	1287
511	Ga0207664_10066548	3300025929	Bacteria	2889
512	Ga0207664_10119614	3300025929	Bacteria	2202
513	Ga0207644_10006905	3300025931	Bacteria	7393
514	Ga0207690_10087143	3300025932	Bacteria	2196
515	Ga0207706_10025531	3300025933	Bacteria	5293
516	Ga0207706_10043152	3300025933	Bacteria	3997
517	Ga0207706_10081156	3300025933	Bacteria	2850
518	Ga0207686_10004055	3300025934	Bacteria	7863
519	Ga0207709_10000200	3300025935	Bacteria	79228
520	Ga0207709_10065101	3300025935	Bacteria	2291
521	Ga0207670_10063194	3300025936	Bacteria	2532
522	Ga0207669_10009355	3300025937	Bacteria	4661
523	Ga0207669_10011212	3300025937	Bacteria	4354
524	Ga0207669_10064364	3300025937	Bacteria	2269
525	Ga0207704_10040033	3300025938	Bacteria	2735
526	Ga0207704_10080304	3300025938	Bacteria	2105
527	Ga0207704_10206969	3300025938	Bacteria	1441
528	Ga0207665_10002209	3300025939	Bacteria	13131
529	Ga0207665_10004891	3300025939	Bacteria	8926
530	Ga0207665_10185259	3300025939	Bacteria	1510
531	Ga0207691_10002396	3300025940	Bacteria	18341
532	Ga0207691_10037321	3300025940	Bacteria	4500
533	Ga0207691_10213429	3300025940	Bacteria	1676
534	Ga0207711_10031308	3300025941	Bacteria	4491
535	Ga0207711_10105923	3300025941	Bacteria	2494
536	Ga0207711_10154767	3300025941	Bacteria	2071
537	Ga0207689_10002971	3300025942	Bacteria	15641
538	Ga0207689_10003070	3300025942	Bacteria	15386
539	Ga0207689_10010105	3300025942	Bacteria	8137
540	Ga0207689_10015313	3300025942	Bacteria	6492
541	Ga0207689_10080837	3300025942	Bacteria	2672
542	Ga0207661_10094957	3300025944	Bacteria	2492
543	Ga0207679_10011446	3300025945	Bacteria	5748
544	Ga0207679_10094121	3300025945	Bacteria	2326
545	Ga0207679_10161904	3300025945	Bacteria	1833
546	Ga0207667_10007604	3300025949	Bacteria	12991
547	Ga0207667_10022915	3300025949	Bacteria	6884
548	Ga0207667_10036266	3300025949	Bacteria	5286
549	Ga0207667_10279278	3300025949	Bacteria	1707
550	Ga0207651_10064510	3300025960	Bacteria	2564
551	Ga0207712_10011341	3300025961	Bacteria	5677
552	Ga0207712_10037978	3300025961	Bacteria	3290
553	Ga0207668_10139953	3300025972	Bacteria	1859
554	Ga0207640_10046072	3300025981	Bacteria	2803
555	Ga0207640_10199903	3300025981	Bacteria	1514
556	Ga0207658_10001239	3300025986	Bacteria	20195
557	Ga0207658_10070413	3300025986	Bacteria	2646
558	Ga0207677_10003360	3300026023	Bacteria	8476
559	Ga0207677_10019722	3300026023	Bacteria	4078
560	Ga0207677_10126011	3300026023	Bacteria	1935
561	Ga0207677_10295681	3300026023	Bacteria	1336
562	Ga0207703_10150508	3300026035	Bacteria	2029
563	Ga0207703_10170249	3300026035	Bacteria	1915
564	Ga0207703_10175710	3300026035	Bacteria	1887
565	Ga0207639_10119073	3300026041	Bacteria	2166
566	Ga0207639_10193423	3300026041	Bacteria	1739
567	Ga0207678_10007224	3300026067	Bacteria	9846
568	Ga0207678_10008502	3300026067	Bacteria	9049
569	Ga0207678_10042840	3300026067	Bacteria	3919
570	Ga0207678_10097656	3300026067	Bacteria	2510
571	Ga0207678_10156982	3300026067	Bacteria	1943
572	Ga0207678_10207167	3300026067	Bacteria	1677
573	Ga0207678_10218383	3300026067	Bacteria	1631
574	Ga0207708_10001674	3300026075	Bacteria	16451
575	Ga0207708_10004441	3300026075	Bacteria	10339
576	Ga0207708_10023295	3300026075	Bacteria	4678
577	Ga0207708_10130065	3300026075	Bacteria	1968
578	Ga0207708_10138031	3300026075	Bacteria	1911
579	Ga0207702_10000005	3300026078	Bacteria	420296
580	Ga0207702_10024125	3300026078	Bacteria	5046
581	Ga0207702_10093110	3300026078	Bacteria	2642
582	Ga0207702_10149309	3300026078	Bacteria	2124
583	Ga0207641_10019819	3300026088	Bacteria	5521
584	Ga0207641_10103523	3300026088	Bacteria	2511
585	Ga0207648_10005710	3300026089	Bacteria	12470
586	Ga0207648_10010955	3300026089	Bacteria	8566
587	Ga0207648_10077210	3300026089	Bacteria	2903
588	Ga0207676_10002836	3300026095	Bacteria	12332
589	Ga0207676_10100639	3300026095	Bacteria	2395
590	Ga0207676_10388410	3300026095	Bacteria	1301
591	Ga0207674_10001070	3300026116	Bacteria	35647
592	Ga0207674_10043098	3300026116	Bacteria	4655
593	Ga0207674_10104326	3300026116	Bacteria	2813
594	Ga0207675_100004136	3300026118	Bacteria	14047
595	Ga0207675_100043849	3300026118	Bacteria	4178
596	Ga0207675_100055236	3300026118	Bacteria	3705
597	Ga0207675_100316991	3300026118	Bacteria	1522
598	Ga0207683_10025436	3300026121	Bacteria	5108
599	Ga0207683_10038962	3300026121	Bacteria	4145
600	Ga0207683_10052426	3300026121	Bacteria	3574
601	Ga0207698_10110922	3300026142	Bacteria	2299
602	Ga0207698_10124890	3300026142	Bacteria	2186
603	Ga0209281_1000005	3300027111	Bacteria	1242284
604	Ga0209281_1000057	3300027111	Bacteria	307145
605	Ga0209981_1004726	3300027378	Bacteria	1797
606	Ga0209999_1005143	3300027543	Bacteria	2353
607	Ga0209282_1000043	3300027666	Bacteria	119260
608	Ga0209588_1002380	3300027671	Bacteria	5095
609	Ga0209588_1008424	3300027671	Bacteria	3058
610	Ga0209966_1002897	3300027695	Bacteria	2875
611	Ga0209998_10032928	3300027717	Bacteria	1154
612	Ga0209813_10005559	3300027866	Bacteria	3066
613	Ga0209974_10031197	3300027876	Bacteria	1764
614	Ga0207428_10045223	3300027907	Bacteria	3547
615	Ga0268266_10036791	3300028379	Bacteria	4170
616	Ga0268266_10073583	3300028379	Bacteria	2965
617	Ga0268266_10425934	3300028379	Bacteria	1258
618	Ga0268265_10001922	3300028380	Bacteria	16509
619	Ga0268265_10066385	3300028380	Bacteria	2789
620	Ga0268265_10241771	3300028380	Bacteria	1593
621	Ga0268265_10357672	3300028380	Bacteria	1335
622	Ga0268264_10002112	3300028381	Bacteria	17710
623	Ga0268264_10409698	3300028381	Bacteria	1305
624	Ga0307515_10000026	3300028794	Bacteria	382411
625	Ga0307515_10070887	3300028794	Bacteria	4734
626	Ga0307515_10337843	3300028794	Bacteria	1160
627	Ga0265338_10037146	3300028800	Bacteria	4644
628	Ga0265338_10135613	3300028800	Bacteria	1935
629	Ga0265338_10268924	3300028800	Bacteria	1250
630	Ga0265332_10000035	3300031238	Bacteria	139554
631	Ga0265332_10013105	3300031238	Bacteria	3674
632	Ga0265332_10016450	3300031238	Bacteria	3264
633	Ga0265328_10036921	3300031239	Bacteria	1805
634	Ga0265325_10059636	3300031241	Bacteria	1939
635	Ga0265329_10040386	3300031242	Bacteria	1497
636	Ga0265340_10006842	3300031247	Bacteria	6239
637	Ga0265340_10008206	3300031247	Bacteria	5644
638	Ga0265339_10000075	3300031249	Bacteria	85133
639	Ga0265339_10059277	3300031249	Bacteria	2065
640	Ga0265316_10040657	3300031344	Bacteria	3726
641	Ga0265316_10313021	3300031344	Bacteria	1142
642	Ga0307513_10000011	3300031456	Bacteria	354929
643	Ga0307513_10000017	3300031456	Bacteria	282386
644	Ga0307513_10288748	3300031456	Bacteria	1413
645	Ga0307509_10005866	3300031507	Bacteria	16842
646	Ga0307408_100061080	3300031548	Bacteria	2750
647	Ga0307408_100106383	3300031548	Bacteria	2146
648	Ga0265313_10000540	3300031595	Bacteria	39475
649	Ga0265342_10000146	3300031712	Bacteria	80151
650	Ga0307516_10005910	3300031730	Bacteria	14486
651	Ga0307516_10028965	3300031730	Bacteria	5600
652	Ga0307405_10197874	3300031731	Bacteria	1457
653	Ga0307406_10062177	3300031901	Bacteria	2415
654	Ga0307412_10124737	3300031911	Bacteria	1860
655	Ga0307412_10199564	3300031911	Bacteria	1518
656	Ga0307414_10018572	3300032004	Bacteria	4287
657	Ga0307411_10134643	3300032005	Bacteria	1812
658	Ga0373934_0003348	3300035086	Bacteria	5871
659	Ga0373934_0039691	3300035086	Bacteria	1856
660	Ga0373934_0092045	3300035086	Bacteria	1223
661	Ga0373923_0000675	3300035111	Bacteria	8677
662	Ga0373923_0018872	3300035111	Bacteria	2662
663	Ga0373923_0054197	3300035111	Bacteria	1688
664	Ga0373936_0004148	3300035113	Bacteria	5461
665	Ga0373945_0027184	3300035116	Bacteria	1998
666	Ga0373953_0000670	3300035117	Bacteria	9477
667	Ga0373953_0009253	3300035117	Bacteria	3381
668	Ga0373953_0009567	3300035117	Bacteria	3341
669	Ga0373953_0034836	3300035117	Bacteria	1975
670	Ga0373953_0056014	3300035117	Bacteria	1602
671	Ga0373956_0004379	3300035119	Bacteria	5658
672	Ga0373956_0012639	3300035119	Bacteria	3503
673	Ga0373956_0049465	3300035119	Bacteria	1885
674	Ga0373957_0012415	3300035120	Bacteria	2868
675	Ga0373957_0012488	3300035120	Bacteria	2862
676	Ga0373957_0043328	3300035120	Bacteria	1700
677	Ga0373960_0008673	3300035121	Bacteria	2443
678	Ga0373943_0121989	3300035170	Bacteria	1386
679	Ga0373946_0000216	3300035171	Bacteria	17908
680	Ga0373955_0000447	3300035172	Bacteria	17475
681	Ga0373955_0002175	3300035172	Bacteria	8488
682	Ga0373955_0072881	3300035172	Bacteria	1924
683	Ga0373955_0096818	3300035172	Bacteria	1689
684	Ga0373962_0000832	3300035242	Bacteria	7041
685	Ga0373924_0000349	3300035410	Bacteria	14213
686	Ga0373924_0011185	3300035410	Bacteria	3326
687	Ga0373924_0015656	3300035410	Bacteria	2886
688	Ga0373931_0000672	3300035691	Bacteria	14181
689	Ga0373931_0037842	3300035691	Bacteria	2521
690	Ga0373935_0000980	3300035692	Bacteria	15499
691	Ga0373935_0013561	3300035692	Bacteria	4920
692	Ga0373935_0016416	3300035692	Bacteria	4480
693	Ga0373935_0243128	3300035692	Bacteria	1257
694	Ga0373927_0013277	3300035695	Bacteria	5475
695	Ga0373927_0017790	3300035695	Bacteria	4676
696	Ga0373927_0041783	3300035695	Bacteria	2973
697	Ga0373927_0184355	3300035695	Bacteria	1369
698	Ga0373927_0221312	3300035695	Bacteria	1243
699	Ga0373933_0000167	3300035724	Bacteria	42851
700	Ga0373933_0000518	3300035724	Bacteria	24100
701	Ga0373933_0002005	3300035724	Bacteria	11741
702	Ga0373933_0002927	3300035724	Bacteria	9536
703	Ga0373933_0005651	3300035724	Bacteria	6808
704	Ga0373933_0047839	3300035724	Bacteria	2545
705	Ga0373933_0115069	3300035724	Bacteria	1680
706	Ga0373933_0117616	3300035724	Bacteria	1662
707	Ga0373947_0000379	3300035725	Bacteria	25163
708	Ga0373947_0078635	3300035725	Bacteria	2036
709	Ga0373937_0000968	3300036401	Bacteria	24362
710	Ga0373937_0002750	3300036401	Bacteria	14678
711	Ga0373937_0003161	3300036401	Bacteria	13784
712	Ga0373937_0015114	3300036401	Bacteria	6820
713	Ga0373937_0074399	3300036401	Bacteria	3135
714	Ga0373937_0121748	3300036401	Bacteria	2431
715	Ga0373925_0000018	3300037068	Bacteria	174213
716	Ga0373925_0051480	3300037068	Bacteria	3074
717	Ga0373925_0189102	3300037068	Bacteria	1633
718	Ga0395899_0035586	3300037312	Bacteria	3737
719	Ga0395899_0088692	3300037312	Bacteria	2243
720	Ga0395900_0005885	3300037418	Bacteria	12806
721	Ga0395900_0015514	3300037418	Bacteria	7766
722	Ga0395900_0017765	3300037418	Bacteria	7260
723	Ga0395900_0044621	3300037418	Bacteria	4567
724	Ga0395900_0131969	3300037418	Bacteria	2559
725	Ga0395900_0215265	3300037418	Bacteria	1939
726	Ga0395898_0013144	3300037466	Bacteria	8533
727	Ga0395898_0014076	3300037466	Bacteria	8220
728	Ga0395898_0027894	3300037466	Bacteria	5662
729	Ga0395898_0051434	3300037466	Bacteria	4028
730	Ga0395898_0175740	3300037466	Bacteria	2047
731	Ga0395898_0250470	3300037466	Bacteria	1689
732	Ga0395905_0000065	3300037471	Bacteria	184928
733	Ga0395905_0001008	3300037471	Bacteria	35984
734	Ga0395905_0006143	3300037471	Bacteria	12122
735	Ga0395905_0022006	3300037471	Bacteria	6031
736	Ga0395905_0055610	3300037471	Bacteria	3704
737	Ga0395905_0186825	3300037471	Bacteria	1945
738	Ga0395905_0209114	3300037471	Bacteria	1828
739	Ga0395905_0259480	3300037471	Bacteria	1622
740	Ga0395905_0261224	3300037471	Bacteria	1617
741	Ga0395905_0301047	3300037471	Bacteria	1491
742	Ga0395905_0303832	3300037471	Bacteria	1483
743	Ga0436364_0329580	3300037853	Bacteria	1816
744	Ga0436364_0588488	3300037853	Bacteria	48316
745	Ga0436364_0899440	3300037853	Bacteria	1308
746	Ga0395901_0001202	3300038443	Bacteria	27514
747	Ga0395901_0004089	3300038443	Bacteria	14702
748	Ga0395901_0019599	3300038443	Bacteria	6914
749	Ga0395901_0021683	3300038443	Bacteria	6582
750	Ga0395901_0077683	3300038443	Bacteria	3465
751	Ga0395901_0088021	3300038443	Bacteria	3248
752	Ga0395901_0114873	3300038443	Bacteria	2827
753	Ga0395901_0214776	3300038443	Bacteria	2012
754	Ga0395901_0220354	3300038443	Bacteria	1983
755	Ga0436365_1625850	3300039437	Bacteria	1325
756	Ga0436360_0836846	3300039438	Bacteria	1577
757	Ga0436360_1175090	3300039438	Bacteria	9955
758	Ga0436361_0850390	3300039447	Bacteria	6001
759	Ga0436363_0658082	3300039450	Bacteria	1945
760	Ga0436363_0787574	3300039450	Bacteria	4623
761	Ga0436363_1070427	3300039450	Bacteria	1774
762	Ga0436362_0507584	3300039453	Bacteria	2099
763	Ga0436362_0746842	3300039453	Bacteria	1780
764	Ga0439465_0029543	3300041413	Bacteria	1742
765	Ga0451853_0600253	3300041512	Bacteria	1408
766	Ga0439433_0030749	3300041999	Bacteria	1228
767	Ga0439441_002904	3300042001	Bacteria	2464
768	Ga0439443_003378	3300042003	Bacteria	2008
769	Ga0439443_004018	3300042003	Bacteria	1892
770	Ga0439449_0000980	3300042007	Bacteria	11230
771	Ga0439455_0004730	3300042012	Bacteria	2717
772	Ga0439460_0013755	3300042461	Bacteria	2121
773	Ga0450893_0001145	3300042532	Bacteria	3988
774	Ga0451577_0009954	3300042876	Bacteria	9113
775	Ga0451577_0178325	3300042876	Bacteria	1915
776	Ga0466972_0000174	3300044658	Bacteria	49914
777	Ga0466965_0103275	3300044683	Bacteria	1459
778	Ga0466961_0085136	3300044693	Bacteria	1999
779	Ga0466963_0002626	3300044694	Bacteria	10095
780	Ga0466964_0029982	3300044706	Bacteria	2151
781	Ga0466957_0019551	3300044842	Bacteria	3984
782	Ga0466959_0039753	3300045049	Bacteria	3476
783	Ga0451576_0073270	3300045051	Bacteria	3564
784	Ga0451576_0095067	3300045051	Bacteria	3099
785	Ga0466967_0058165	3300045976	Bacteria	3416
786	Ga0495592_0000001	3300046454	Bacteria	305819
787	Ga0495592_0010346	3300046454	Bacteria	7034
788	Ga0495592_0028012	3300046454	Bacteria	4267
789	Ga0495592_0107156	3300046454	Bacteria	1983
790	Ga0495603_0057065	3300046455	Bacteria	2310
791	Ga0495629_0017080	3300046459	Bacteria	5205
792	Ga0495651_0002430	3300046462	Bacteria	14380
793	Ga0495651_0018895	3300046462	Bacteria	5339
794	Ga0495651_0033160	3300046462	Bacteria	4028
795	Ga0495651_0057181	3300046462	Bacteria	2995
796	Ga0495651_0104300	3300046462	Bacteria	2105
797	Ga0495651_0188424	3300046462	Bacteria	1453
798	Ga0495653_0000092	3300046463	Bacteria	74868
799	Ga0495653_0032787	3300046463	Bacteria	4121
800	Ga0495653_0055700	3300046463	Bacteria	3016
801	Ga0495653_0085636	3300046463	Bacteria	2318
802	Ga0495653_0171324	3300046463	Bacteria	1498
803	Ga0495580_0042377	3300046472	Bacteria	3243
804	Ga0495582_0027822	3300046473	Bacteria	3101
805	Ga0495662_0002406	3300046476	Bacteria	9406
806	Ga0495664_0000001	3300046477	Bacteria	757730
807	Ga0495664_0000814	3300046477	Bacteria	15977
808	Ga0495664_0002358	3300046477	Bacteria	10115
809	Ga0495584_0103174	3300046491	Bacteria	1442
810	Ga0495607_0091531	3300046501	Bacteria	1647
811	Ga0495583_0066870	3300046506	Bacteria	1589
812	Ga0495608_0000050	3300046511	Bacteria	96603
813	Ga0495608_0012355	3300046511	Bacteria	5929
814	Ga0495608_0033765	3300046511	Bacteria	3455
815	Ga0495608_0045769	3300046511	Bacteria	2914
816	Ga0495618_0000064	3300046514	Bacteria	77194
817	Ga0495618_0003906	3300046514	Bacteria	9207
818	Ga0495618_0026930	3300046514	Bacteria	3577
819	Ga0495628_0000003	3300046516	Bacteria	470339
820	Ga0495628_0046640	3300046516	Bacteria	3441
821	Ga0495628_0057389	3300046516	Bacteria	3062
822	Ga0495628_0091977	3300046516	Bacteria	2347
823	Ga0495628_0108476	3300046516	Bacteria	2137
824	Ga0495628_0196528	3300046516	Bacteria	1521
825	Ga0495628_0283918	3300046516	Bacteria	1228
826	Ga0495630_0018396	3300046517	Bacteria	5134
827	Ga0495630_0085470	3300046517	Bacteria	2382
828	Ga0495630_0150448	3300046517	Bacteria	1771
829	Ga0495632_0144080	3300046519	Bacteria	1104
830	Ga0495643_0071024	3300046522	Bacteria	1828
831	Ga0495644_0038471	3300046523	Bacteria	1804
832	Ga0495648_0037341	3300046524	Bacteria	3123
833	Ga0495666_0089559	3300046526	Bacteria	1452
834	Ga0495652_0000001	3300046529	Bacteria	1045081
835	Ga0495652_0017696	3300046529	Bacteria	6360
836	Ga0495652_0023154	3300046529	Bacteria	5506
837	Ga0495652_0028807	3300046529	Bacteria	4882
838	Ga0495652_0092412	3300046529	Bacteria	2472
839	Ga0495652_0186390	3300046529	Bacteria	1587
840	Ga0495652_0189553	3300046529	Bacteria	1570
841	Ga0495654_0034391	3300046530	Bacteria	2557
842	Ga0495640_0000006	3300046533	Bacteria	285419
843	Ga0495640_0016995	3300046533	Bacteria	5430
844	Ga0495640_0026836	3300046533	Bacteria	4158
845	Ga0495640_0028277	3300046533	Bacteria	4038
846	Ga0495640_0034698	3300046533	Bacteria	3574
847	Ga0495640_0050921	3300046533	Bacteria	2850
848	Ga0495640_0106162	3300046533	Bacteria	1839
849	Ga0495586_0052426	3300046535	Bacteria	2209
850	Ga0495587_0000028	3300046536	Bacteria	138663
851	Ga0495587_0004300	3300046536	Bacteria	9405
852	Ga0495587_0027737	3300046536	Bacteria	3447
853	Ga0495587_0029630	3300046536	Bacteria	3322
854	Ga0495587_0053040	3300046536	Bacteria	2391
855	Ga0495587_0058399	3300046536	Bacteria	2266
856	Ga0495645_0000004	3300046543	Bacteria	532661
857	Ga0495645_0002100	3300046543	Bacteria	13539
858	Ga0495645_0011359	3300046543	Bacteria	6264
859	Ga0495622_0024113	3300046557	Bacteria	2840
860	Ga0495667_0000001	3300046559	Bacteria	834831
861	Ga0495667_0001580	3300046559	Bacteria	15122
862	Ga0495667_0007304	3300046559	Bacteria	7497
863	Ga0495667_0015428	3300046559	Bacteria	5161
864	Ga0495667_0032079	3300046559	Bacteria	3522
865	Ga0495656_0000234	3300046615	Bacteria	19591
866	Ga0495634_0000075	3300046642	Bacteria	77824
867	Ga0495634_0004988	3300046642	Bacteria	10252
868	Ga0495634_0007454	3300046642	Bacteria	8217
869	Ga0495634_0035251	3300046642	Bacteria	3428
870	Ga0495634_0074661	3300046642	Bacteria	2228
871	Ga0495634_0129340	3300046642	Bacteria	1611
872	Ga0495625_0220081	3300046660	Bacteria	1244
873	Ga0495635_0000015	3300046663	Bacteria	215468
874	Ga0495635_0000892	3300046663	Bacteria	19578
875	Ga0495635_0002891	3300046663	Bacteria	11793
876	Ga0495635_0015572	3300046663	Bacteria	5315
877	Ga0495635_0023975	3300046663	Bacteria	4253
878	Ga0495635_0042968	3300046663	Bacteria	3120
879	Ga0495635_0045942	3300046663	Bacteria	3012
880	Ga0495635_0057618	3300046663	Bacteria	2673
881	Ga0495659_0082950	3300046664	Bacteria	1220
882	Ga0495657_0000155	3300046675	Bacteria	62116
883	Ga0495657_0001505	3300046675	Bacteria	20049
884	Ga0495657_0041288	3300046675	Bacteria	3158
885	Ga0495657_0063558	3300046675	Bacteria	2435
886	Ga0495657_0218446	3300046675	Bacteria	1156
887	Ga0495599_0000029	3300046678	Bacteria	113803
888	Ga0495599_0008138	3300046678	Bacteria	6368
889	Ga0495599_0011986	3300046678	Bacteria	5333
890	Ga0495599_0058409	3300046678	Bacteria	2413
891	Ga0495623_0002081	3300046679	Bacteria	13394
892	Ga0495623_0010716	3300046679	Bacteria	5936
893	Ga0495623_0016944	3300046679	Bacteria	4706
894	Ga0495646_0000006	3300046680	Bacteria	258496
895	Ga0495646_0003426	3300046680	Bacteria	9862
896	Ga0495646_0004824	3300046680	Bacteria	8517
897	Ga0495646_0021838	3300046680	Bacteria	4042
898	Ga0495646_0039647	3300046680	Bacteria	2903
899	Ga0495658_0027090	3300046683	Bacteria	3080
900	Ga0495613_0024732	3300046689	Bacteria	4474
901	Ga0495613_0077595	3300046689	Bacteria	2417
902	Ga0495613_0157219	3300046689	Bacteria	1619
903	Ga0495624_0075869	3300046690	Bacteria	2087
904	Ga0495670_0042164	3300046691	Bacteria	2277
905	Ga0495600_0000286	3300046809	Bacteria	27213
906	Ga0495600_0000845	3300046809	Bacteria	16327
907	Ga0495600_0018740	3300046809	Bacteria	4414
908	Ga0495600_0022874	3300046809	Bacteria	4017
909	Ga0495600_0152291	3300046809	Bacteria	1497
910	Ga0495581_0093945	3300047315	Bacteria	1741
911	Ga0495581_0102326	3300047315	Bacteria	1664
912	Ga0495604_0000091	3300047317	Bacteria	77216
913	Ga0495604_0021212	3300047317	Bacteria	5186
914	Ga0495604_0047456	3300047317	Bacteria	3344
915	Ga0495604_0052530	3300047317	Bacteria	3155
916	Ga0495674_0000001	3300047319	Bacteria	778665
917	Ga0495674_0026072	3300047319	Bacteria	5349
918	Ga0495674_0027509	3300047319	Bacteria	5197
919	Ga0495674_0070630	3300047319	Bacteria	3017
920	Ga0495674_0197302	3300047319	Bacteria	1671
921	Ga0495674_0291161	3300047319	Bacteria	1335
922	Ga0495676_0075708	3300047321	Bacteria	2573
923	Ga0495680_0000489	3300047322	Bacteria	44631
924	Ga0495680_0001893	3300047322	Bacteria	21968
925	Ga0495680_0025144	3300047322	Bacteria	4932
926	Ga0495680_0048642	3300047322	Bacteria	3328
927	Ga0495675_0000839	3300047444	Bacteria	18796
928	Ga0495675_0001788	3300047444	Bacteria	12805
929	Ga0495675_0004381	3300047444	Bacteria	8545
930	Ga0495675_0009939	3300047444	Bacteria	5932
931	Ga0495675_0109543	3300047444	Bacteria	1724
932	Ga0495675_0125856	3300047444	Bacteria	1594
933	Ga0495675_0152252	3300047444	Bacteria	1428
934	Ga0495681_0037945	3300047470	Bacteria	2367
935	Ga0495684_0000055	3300047471	Bacteria	79796
936	Ga0495684_0006728	3300047471	Bacteria	8925
937	Ga0495684_0021876	3300047471	Bacteria	4923
938	Ga0495684_0222587	3300047471	Bacteria	1383
939	Ga0495593_0002873	3300047673	Bacteria	10388
940	Ga0495593_0004038	3300047673	Bacteria	8743
941	Ga0495602_0000002	3300048088	Bacteria	422216
942	Ga0495602_0000131	3300048088	Bacteria	70438
943	Ga0495602_0017772	3300048088	Bacteria	7121
944	Ga0495602_0038377	3300048088	Bacteria	4429
945	Ga0495602_0047333	3300048088	Bacteria	3875
946	Ga0495602_0122954	3300048088	Bacteria	2084
947	Ga0495602_0208218	3300048088	Bacteria	1487
948	Ga0495614_0055646	3300048089	Bacteria	1697
949	Ga0496100_0082353	3300048903	Bacteria	2176
950	Ga0496100_0252211	3300048903	Bacteria	1306
951	Ga0496101_0001315	3300048904	Bacteria	14856
952	Ga0496102_0000742	3300048905	Bacteria	31941
953	Ga0496102_0000755	3300048905	Bacteria	31610
954	Ga0496103_0002582	3300048906	Bacteria	11343
955	Ga0496104_0000990	3300048907	Bacteria	24283
956	Ga0496104_0034233	3300048907	Bacteria	4735
957	Ga0496104_0055470	3300048907	Bacteria	3747
958	Ga0496104_0060580	3300048907	Bacteria	3585
959	Ga0496104_0123386	3300048907	Bacteria	2486
960	Ga0496104_0399727	3300048907	Bacteria	1286
961	Ga0496105_0009893	3300048908	Bacteria	7477
962	Ga0496105_0026830	3300048908	Bacteria	4701
963	Ga0496105_0054773	3300048908	Bacteria	3293
964	Ga0496105_0097734	3300048908	Bacteria	2425
965	Ga0496106_0001604	3300048909	Bacteria	17003
966	Ga0496106_0001887	3300048909	Bacteria	15709
967	Ga0496106_0006158	3300048909	Bacteria	8868
968	Ga0496106_0006881	3300048909	Bacteria	8413
969	Ga0496107_0000537	3300048910	Bacteria	21180
970	Ga0496107_0002510	3300048910	Bacteria	11932
971	Ga0496108_0002018	3300048911	Bacteria	16256
972	Ga0496108_0010705	3300048911	Bacteria	7442
973	Ga0496108_0074699	3300048911	Bacteria	2862
974	Ga0496108_0176182	3300048911	Bacteria	1851
975	Ga0496108_0277446	3300048911	Bacteria	1459
976	Ga0496109_0001503	3300048912	Bacteria	19386
977	Ga0496109_0001562	3300048912	Bacteria	19079
978	Ga0496109_0007320	3300048912	Bacteria	9332
979	Ga0496109_0036128	3300048912	Bacteria	4459
980	Ga0496109_0104551	3300048912	Bacteria	2629
981	Ga0496109_0308346	3300048912	Bacteria	1493
982	Ga0496110_0001525	3300048913	Bacteria	16816
983	Ga0496110_0002482	3300048913	Bacteria	13828
984	Ga0496110_0012544	3300048913	Bacteria	6969
985	Ga0496110_0040795	3300048913	Bacteria	4046
986	Ga0496110_0086383	3300048913	Bacteria	2801
987	Ga0496111_0000797	3300048914	Bacteria	16881
988	Ga0496111_0064699	3300048914	Bacteria	2653
989	Ga0496112_0018536	3300048915	Bacteria	6555
990	Ga0496112_0042695	3300048915	Bacteria	4437
991	Ga0496112_0058701	3300048915	Bacteria	3790
992	Ga0496112_0323603	3300048915	Bacteria	1486
993	Ga0496113_0000917	3300048916	Bacteria	15578
994	Ga0496113_0010734	3300048916	Bacteria	6071
995	Ga0496113_0018915	3300048916	Bacteria	4808
996	Ga0496113_0059093	3300048916	Bacteria	2887
997	Ga0496113_0193778	3300048916	Bacteria	1614
998	Ga0496114_0017778	3300048917	Bacteria	5746
999	Ga0496115_0004175	3300048918	Bacteria	10433
1000	Ga0496115_0032990	3300048918	Bacteria	4087
1001	Ga0496115_0064736	3300048918	Bacteria	2952
1002	Ga0496115_0085004	3300048918	Bacteria	2580
1003	Ga0496115_0338128	3300048918	Bacteria	1229
1004	Ga0496116_0003781	3300048919	Bacteria	14794
1005	Ga0496117_0110987	3300048920	Bacteria	1708
1006	Ga0496118_0025668	3300048921	Bacteria	5043
1007	Ga0496118_0175023	3300048921	Bacteria	1305
1008	Ga0496118_0208213	3300048921	Bacteria	1150
1009	Ga0496119_0042950	3300048922	Bacteria	2862
1010	Ga0496121_0001527	3300048924	Bacteria	38742
1011	Ga0496121_0002321	3300048924	Bacteria	29473
1012	Ga0496121_0006578	3300048924	Bacteria	14342
1013	Ga0496122_0026944	3300048925	Bacteria	4934
1014	Ga0496122_0093338	3300048925	Bacteria	2042
1015	Ga0496125_0000092	3300048928	Bacteria	211050
1016	Ga0496125_0001341	3300048928	Bacteria	36276
1017	Ga0496125_0009813	3300048928	Bacteria	9756
1018	Ga0496125_0073663	3300048928	Bacteria	2653
1019	Ga0496126_0015353	3300048929	Bacteria	7704
1020	Ga0496126_0022619	3300048929	Bacteria	6110
1021	Ga0496126_0044454	3300048929	Bacteria	4090
1022	Ga0496126_0044775	3300048929	Bacteria	4072
1023	Ga0496126_0174411	3300048929	Bacteria	1830
1024	Ga0501031_0000392	3300049568	Bacteria	25655
1025	Ga0501031_0007587	3300049568	Bacteria	7065
1026	Ga0501032_0000224	3300049569	Bacteria	46893
1027	Ga0501033_0000095	3300049570	Bacteria	84522
1028	Ga0501033_0007252	3300049570	Bacteria	8647
1029	Ga0501033_0029583	3300049570	Bacteria	4116
1030	Ga0501033_0039437	3300049570	Bacteria	3528
1031	Ga0501033_0077740	3300049570	Bacteria	2435
1032	Ga0501033_0098342	3300049570	Bacteria	2137
1033	Ga0501034_0000601	3300049571	Bacteria	56718
1034	Ga0501034_0001606	3300049571	Bacteria	29373
1035	Ga0501034_0022054	3300049571	Bacteria	6488
1036	Ga0501034_0026890	3300049571	Bacteria	5854
1037	Ga0501034_0126954	3300049571	Bacteria	2535
1038	Ga0501034_0135823	3300049571	Bacteria	2440
1039	Ga0501036_0000007	3300049572	Bacteria	240500
1040	Ga0501036_0016319	3300049572	Bacteria	6205
1041	Ga0501036_0070336	3300049572	Bacteria	2959
1042	Ga0501037_0000159	3300049573	Bacteria	63178
1043	Ga0501037_0017737	3300049573	Bacteria	5238
1044	Ga0501037_0119682	3300049573	Bacteria	1894
1045	Ga0501038_0000028	3300049574	Bacteria	144481
1046	Ga0501038_0043888	3300049574	Bacteria	3887
1047	Ga0501038_0175951	3300049574	Bacteria	1729
1048	Ga0501039_0000005	3300049575	Bacteria	295471
1049	Ga0501039_0010757	3300049575	Bacteria	6967
1050	Ga0501039_0106024	3300049575	Bacteria	2195
1051	Ga0501039_0204780	3300049575	Bacteria	1551
1052	Ga0501040_0021755	3300049576	Bacteria	4288
1053	Ga0501041_0101735	3300049577	Bacteria	1779
1054	Ga0501041_0131583	3300049577	Bacteria	1558
1055	Ga0501042_0009857	3300049578	Bacteria	6382
1056	Ga0501043_0000127	3300049579	Bacteria	70587
1057	Ga0501043_0040311	3300049579	Bacteria	3670
1058	Ga0501043_0075759	3300049579	Bacteria	2643
1059	Ga0501043_0198942	3300049579	Bacteria	1556
1060	Ga0501043_0333400	3300049579	Bacteria	1155
1061	Ga0501046_0000032	3300049580	Bacteria	180265
1062	Ga0501046_0003405	3300049580	Bacteria	14597
1063	Ga0501046_0042375	3300049580	Bacteria	3630
1064	Ga0501046_0055174	3300049580	Bacteria	3124
1065	Ga0501046_0072632	3300049580	Bacteria	2671
1066	Ga0501046_0085818	3300049580	Bacteria	2427
1067	Ga0501047_0000077	3300049581	Bacteria	123480
1068	Ga0501047_0111536	3300049581	Bacteria	2617
1069	Ga0501047_0286125	3300049581	Bacteria	1492
1070	Ga0501048_0000693	3300049582	Bacteria	24501
1071	Ga0501048_0001758	3300049582	Bacteria	16487
1072	Ga0501048_0017033	3300049582	Bacteria	5355
1073	Ga0501048_0324604	3300049582	Bacteria	1097
1074	Ga0501067_0001841	3300049583	Bacteria	11668
1075	Ga0501067_0002698	3300049583	Bacteria	9791
1076	Ga0501068_0000982	3300049584	Bacteria	14988
1077	Ga0501068_0001804	3300049584	Bacteria	11377
1078	Ga0501068_0007258	3300049584	Bacteria	6138
1079	Ga0501069_0003029	3300049585	Bacteria	8637
1080	Ga0501069_0008089	3300049585	Bacteria	5523
1081	Ga0501069_0209682	3300049585	Bacteria	1131
1082	Ga0501070_0000070	3300049586	Bacteria	86706
1083	Ga0501070_0002878	3300049586	Bacteria	14993
1084	Ga0501070_0042709	3300049586	Bacteria	3775
1085	Ga0501070_0093123	3300049586	Bacteria	2493
1086	Ga0501071_0065515	3300049587	Bacteria	2638
1087	Ga0501072_0019222	3300049588	Bacteria	5278
1088	Ga0501072_0104157	3300049588	Bacteria	2256
1089	Ga0501073_0002706	3300049589	Bacteria	13270
1090	Ga0501073_0018431	3300049589	Bacteria	5045
1091	Ga0501074_0000302	3300049590	Bacteria	28413
1092	Ga0501074_0009212	3300049590	Bacteria	7173
1093	Ga0501074_0175508	3300049590	Bacteria	1529
1094	Ga0501075_0003089	3300049591	Bacteria	11127
1095	Ga0501075_0147180	3300049591	Bacteria	1795
1096	Ga0501075_0182033	3300049591	Bacteria	1603
1097	Ga0501075_0203206	3300049591	Bacteria	1511
1098	Ga0501076_0000606	3300049592	Bacteria	22908
1099	Ga0501076_0015695	3300049592	Bacteria	5729
1100	Ga0501076_0039294	3300049592	Bacteria	3715
1101	Ga0501076_0047151	3300049592	Bacteria	3406
1102	Ga0501076_0204219	3300049592	Bacteria	1614
1103	Ga0501077_0029898	3300049593	Bacteria	3465
1104	Ga0501079_0039010	3300049741	Bacteria	3663
1105	Ga0501079_0050064	3300049741	Bacteria	3225
1106	Ga0501079_0053550	3300049741	Bacteria	3113
1107	Ga0501079_0060728	3300049741	Bacteria	2916
1108	Ga0501079_0108429	3300049741	Bacteria	2156
1109	Ga0501079_0111678	3300049741	Bacteria	2124
1110	Ga0501079_0115128	3300049741	Bacteria	2090
1111	Ga0501079_0191236	3300049741	Bacteria	1597
1112	Ga0501080_0000035	3300049742	Bacteria	83220
1113	Ga0501080_0041574	3300049742	Bacteria	4283
1114	Ga0501080_0091219	3300049742	Bacteria	2830
1115	Ga0501080_0098402	3300049742	Bacteria	2715
1116	Ga0501080_0343128	3300049742	Bacteria	1349
1117	Ga0501081_0011150	3300049743	Bacteria	5878
1118	Ga0501081_0034130	3300049743	Bacteria	3459
1119	Ga0501081_0221815	3300049743	Bacteria	1375
1120	Ga0501081_0307480	3300049743	Bacteria	1163
1121	Ga0501083_0156356	3300049744	Bacteria	1492
1122	Ga0501035_0000016	3300049822	Bacteria	243412
1123	Ga0501035_0114433	3300049822	Bacteria	2362
1124	Ga0501035_0168829	3300049822	Bacteria	1891
1125	Ga0501044_0000184	3300049823	Bacteria	77805
1126	Ga0501044_0002904	3300049823	Bacteria	19514
1127	Ga0501044_0003221	3300049823	Bacteria	18386
1128	Ga0501044_0010842	3300049823	Bacteria	9888
1129	Ga0501044_0013164	3300049823	Bacteria	8956
1130	Ga0501044_0073512	3300049823	Bacteria	3475
1131	Ga0501044_0232572	3300049823	Bacteria	1790
1132	Ga0501045_0002936	3300049824	Bacteria	11662
1133	Ga0501045_0003187	3300049824	Bacteria	11223
1134	Ga0501045_0047118	3300049824	Bacteria	3140
1135	Ga0501045_0056317	3300049824	Bacteria	2875
1136	Ga0501045_0229999	3300049824	Bacteria	1380
1137	nmdc:mga03683_13831_c1	3300050489	Bacteria	2976
1138	nmdc:mga03683_37293_c1	3300050489	Bacteria	1980
1139	nmdc:mga03683_7104_c1	3300050489	Bacteria	3870
1140	nmdc:mga03n38_2169_c1	3300050490	Bacteria	5978
1141	nmdc:mga00v17_221549_c1	3300050491	Bacteria	1225
1142	nmdc:mga00v17_22883_c1	3300050491	Bacteria	3611
1143	nmdc:mga00v17_56567_c1	3300050491	Bacteria	2399
1144	nmdc:mga0yw44_25967_c1	3300050492	Bacteria	3339
1145	nmdc:mga0yw44_40904_c1	3300050492	Bacteria	2757
1146	nmdc:mga0yw44_42090_c1	3300050492	Bacteria	2722
1147	nmdc:mga0k408_11849_c1	3300050493	Bacteria	4758
1148	nmdc:mga0k408_123879_c1	3300050493	Bacteria	1532
1149	nmdc:mga0k408_26183_c2	3300050493	Bacteria	3036
1150	nmdc:mga0k408_267_c1	3300050493	Bacteria	28555
1151	nmdc:mga0k408_32153_c1	3300050493	Bacteria	2998
1152	nmdc:mga0k408_3655_c1	3300050493	Bacteria	8140
1153	nmdc:mga0k408_3732_c1	3300050493	Bacteria	8075
1154	nmdc:mga06z11_148928_c1	3300050494	Bacteria	1329
1155	nmdc:mga06z11_24053_c1	3300050494	Bacteria	2869
1156	nmdc:mga06z11_78089_c1	3300050494	Bacteria	1769
1157	nmdc:mga04h51_45476_c1	3300050495	Bacteria	1452
1158	nmdc:mga04h51_941_c1	3300050495	Bacteria	6721
1159	nmdc:mga07m45_21445_c1	3300050496	Bacteria	3518
1160	nmdc:mga07m45_2935_c1	3300050496	Bacteria	8096
1161	nmdc:mga07m45_38328_c1	3300050496	Bacteria	2674
1162	nmdc:mga07m45_42136_c1	3300050496	Bacteria	2559
1163	nmdc:mga05p37_277907_c1	3300050507	Bacteria	1998
1164	nmdc:mga05p37_476309_c1	3300050507	Bacteria	1439
1165	nmdc:mga05p37_490959_c1	3300050507	Bacteria	1412
1166	nmdc:mga05p37_62385_c1	3300050507	Bacteria	4587
1167	nmdc:mga05p37_635_c1	3300050507	Bacteria	38849
1168	nmdc:mga09592_20297_c1	3300050508	Bacteria	5462
1169	nmdc:mga09592_4975_c1	3300050508	Bacteria	10770
1170	nmdc:mga0qj67_2628_c1	3300050509	Bacteria	12866
1171	nmdc:mga0qj67_45005_c1	3300050509	Bacteria	3482
1172	nmdc:mga0qj67_6299_c1	3300050509	Bacteria	8709
1173	nmdc:mga0qj67_70562_c1	3300050509	Bacteria	2787
1174	nmdc:mga0qj67_74275_c1	3300050509	Bacteria	2717
1175	nmdc:mga06r32_143484_c1	3300050510	Bacteria	2365
1176	nmdc:mga06r32_20171_c1	3300050510	Bacteria	6133
1177	nmdc:mga06r32_229502_c1	3300050510	Bacteria	1844
1178	nmdc:mga06r32_25814_c1	3300050510	Bacteria	5470
1179	nmdc:mga06r32_78989_c1	3300050510	Bacteria	3200
1180	nmdc:mga08y16_134_c1	3300050511	Bacteria	64270
1181	nmdc:mga08y16_15059_c1	3300050511	Bacteria	8132
1182	nmdc:mga08y16_239054_c1	3300050511	Bacteria	1878
1183	nmdc:mga08y16_273734_c1	3300050511	Bacteria	1742
1184	nmdc:mga0n895_101988_c1	3300050512	Bacteria	2880
1185	nmdc:mga0n895_23043_c1	3300050512	Bacteria	5848
1186	nmdc:mga0n895_7779_c1	3300050512	Bacteria	9233
1187	nmdc:mga0rr50_13376_c1	3300050513	Bacteria	5342
1188	nmdc:mga0rr50_197665_c1	3300050513	Bacteria	1651
1189	nmdc:mga0rr50_94610_c1	3300050513	Bacteria	2334
1190	nmdc:mga08x19_23_c1	3300050514	Bacteria	288286
1191	nmdc:mga0a205_27764_c1	3300050515	Bacteria	5407
1192	nmdc:mga0sz30_15764_c1	3300050516	Bacteria	2990
1193	nmdc:mga0sz30_1648_c1	3300050516	Bacteria	4540
1194	nmdc:mga0sz30_5725_c1	3300050516	Bacteria	4573
1195	nmdc:mga0sz30_63931_c1	3300050516	Bacteria	1575
1196	Ga0495601_0000006	3300053077	Bacteria	373770
1197	Ga0495601_0000702	3300053077	Bacteria	17977
1198	Ga0495601_0006936	3300053077	Bacteria	6635
1199	Ga0495601_0031751	3300053077	Bacteria	3283
1200	Ga0495601_0032587	3300053077	Bacteria	3244
1201	Ga0495601_0077264	3300053077	Bacteria	2132
1202	Ga0495612_0000004	3300053078	Bacteria	286946
1203	Ga0495612_0002858	3300053078	Bacteria	7144
1204	Ga0495612_0010096	3300053078	Bacteria	3819
1205	Ga0495595_0000051	3300053084	Bacteria	60041
1206	Ga0495595_0000687	3300053084	Bacteria	12922
1207	Ga0495595_0006154	3300053084	Bacteria	4878
1208	Ga0495595_0012385	3300053084	Bacteria	3585
1209	Ga0495595_0022736	3300053084	Bacteria	2755
1210	Ga0495595_0084162	3300053084	Bacteria	1519
1211	Ga0495619_0000027	3300053085	Bacteria	165001
1212	Ga0495619_0000394	3300053085	Bacteria	29767
1213	Ga0495619_0003214	3300053085	Bacteria	10575
1214	Ga0495619_0006487	3300053085	Bacteria	7410
1215	Ga0495619_0008856	3300053085	Bacteria	6362
1216	Ga0495619_0041011	3300053085	Bacteria	3027
1217	Ga0495619_0061050	3300053085	Bacteria	2507
1218	Ga0495619_0206233	3300053085	Bacteria	1361
1219	Ga0495619_0213482	3300053085	Bacteria	1336
1220	Ga0500643_019564	3300053087	Bacteria	2226
1221	Ga0500644_0005592	3300053088	Bacteria	3179
1222	Ga0500651_0067765	3300053093	Bacteria	2223
1223	Ga0500566_0000571	3300053094	Bacteria	20755
1224	Ga0500566_0000693	3300053094	Bacteria	18973
1225	Ga0500566_0031112	3300053094	Bacteria	3112
1226	Ga0500640_001688	3300053095	Bacteria	6868
1227	Ga0500641_0000327	3300053096	Bacteria	17563
1228	Ga0500556_0000024	3300053104	Bacteria	167556
1229	Ga0500562_005251	3300053108	Bacteria	3254
1230	Ga0500562_019563	3300053108	Bacteria	1752
1231	Ga0500569_007181	3300053109	Bacteria	2486
1232	Ga0500572_000457	3300053111	Bacteria	14217
1233	Ga0500592_000573	3300053116	Bacteria	6093
1234	Ga0500593_013759	3300053117	Bacteria	3460
1235	Ga0500608_043750	3300053122	Bacteria	2150
1236	Ga0500618_005018	3300053125	Bacteria	4089
1237	Ga0500642_0000035	3300053130	Bacteria	106656
1238	Ga0500652_000016	3300053131	Bacteria	126768
1239	Ga0500652_000404	3300053131	Bacteria	15463
1240	Ga0500559_0003716	3300053136	Bacteria	7440
1241	Ga0500559_0006017	3300053136	Bacteria	5508
1242	Ga0500568_0005040	3300053139	Bacteria	6916
1243	Ga0500568_0078166	3300053139	Bacteria	1258
1244	Ga0500577_0001147	3300053142	Bacteria	6786
1245	Ga0500603_000105	3300053150	Bacteria	19663
1246	Ga0500604_0001709	3300053151	Bacteria	6155
1247	Ga0500616_0000122	3300053153	Bacteria	140228
1248	Ga0500616_0000845	3300053153	Bacteria	34364
1249	Ga0500616_0005663	3300053153	Bacteria	8426
1250	Ga0500616_0102242	3300053153	Bacteria	1399
1251	Ga0500622_0000790	3300053156	Bacteria	27440
1252	Ga0500627_0056637	3300053158	Bacteria	1718
1253	Ga0500630_000990	3300053159	Bacteria	13298
1254	Ga0500639_000066	3300053163	Bacteria	47938
1255	Ga0500636_0000410	3300053177	Bacteria	23626
1256	Ga0500636_0006371	3300053177	Bacteria	6769
1257	Ga0500636_0063934	3300053177	Bacteria	2144
1258	Ga0500645_000408	3300053730	Bacteria	30041
1259	Ga0500645_002074	3300053730	Bacteria	9285
1260	Ga0500552_000210	3300053733	Bacteria	5233
1261	Ga0501084_0009891	3300054114	Bacteria	7882
1262	Ga0501084_0010974	3300054114	Bacteria	7504
1263	Ga0501084_0046623	3300054114	Bacteria	3631
1264	Ga0501084_0261866	3300054114	Bacteria	1460
1265	Ga0501084_0261908	3300054114	Bacteria	1460
1266	Ga0590075_034402	3300059424	Bacteria	1289
1267	Ga0501082_0000008	3300060353	Bacteria	125977
1268	Ga0501082_0002439	3300060353	Bacteria	16314
1269	Ga0501082_0043058	3300060353	Bacteria	3892
1270	Ga0501082_0045279	3300060353	Bacteria	3794
1271	Ga0501082_0167641	3300060353	Bacteria	1909
1272	Ga0530510_0001806	3300061734	Bacteria	14588
1273	Ga0530510_0003890	3300061734	Bacteria	10297
1274	Ga0530510_0014739	3300061734	Bacteria	5520
1275	Ga0530510_0120652	3300061734	Bacteria	1924
1276	2507509973	2507262055	Bacteria	8048963
1277	2508543979	2508501009	Bacteria	7784016
1278	2508698082	2508501042	Bacteria	8719808
1279	2509147608	2508501128	Bacteria	8613869
1280	2511244735	2511231002	Bacteria	5042903
1281	2511400363	2511231028	Bacteria	8046582
1282	2513627616	2513237092	Bacteria	8341956
1283	2513645018	2513237094	Bacteria	8789602
1284	2513652264	2513237095	Bacteria	8976980
1285	2513676382	2513237098	Bacteria	9902361
1286	2513696094	2513237101	Bacteria	7952346
1287	2513700260	2513237102	Bacteria	7703324
1288	2513721933	2513237104	Bacteria	10034502
1289	2513862035	2513237137	Bacteria	9558895
1290	2513876071	2513237139	Bacteria	8737671
1291	2513893361	2513237141	Bacteria	8496279
1292	2513921475	2513237145	Bacteria	8979722
1293	2514011270	2513237161	Bacteria	8871253
1294	2515629184	2515154112	Bacteria	8294334
1295	2517103273	2517093001	Bacteria	9002274
1296	2517893789	2517572143	Bacteria	9484767
1297	2524439007	2524023205	Bacteria	8918781
1298	2524469414	2524023210	Bacteria	9029266
1299	2524537738	2524023228	Bacteria	10118060
1300	2528852735	2528768022	Bacteria	10457665
1301	2548499528	2547132374	Bacteria	5530232
1302	2587728474	2585428057	Bacteria	6737412
1303	2603861104	2602042107	Bacteria	6226103
1304	2617353443	2617270735	Bacteria	9163226
1305	2617377994	2617270741	Bacteria	8201522
1306	2644060839	2643221609	Bacteria	6756331
1307	2644072118	2643221611	Bacteria	6820941
1308	2644287856	2643221651	Bacteria	4798932
1309	2671124122	2667528175	Bacteria	7532676
1310	2722884748	2721755523	Bacteria	6430384
1311	2723846329	2721755755	Bacteria	8322773
1312	2728752932	2728368998	Bacteria	8720350
1313	2738722620	2738541277	Bacteria	7458140
1314	2739245306	2738543012	Bacteria	7115078
1315	2739252395	2738543013	Bacteria	5618633
1316	2739283191	2738543019	Bacteria	7459457
1317	2745078880	2744054633	Bacteria	8678936
1318	2793060038	2791355196	Bacteria	7323613
1319	2793070710	2791355197	Bacteria	8420563
1320	2793083268
1321	2805917396	2802429603	Bacteria	8777136
1322	2816471635	2816332133	Bacteria	7249298
1323	2818242489	2816332527	Bacteria	8933356
1324	2824605654	2824600985	Bacteria	8488197
1325	2824609905	2824609381	Bacteria	8672835
1326	2824625286	2824617872	Bacteria	8814715
1327	2824634102	2824626560	Bacteria	8813858
1328	2824639832	2824635225	Bacteria	8785348
1329	2824648415	2824644064	Bacteria	8743947
1330	2824655696	2824653114	Bacteria	8493680
1331	2824666582	2824661429	Bacteria	9877870
1332	2824674153	2824671348	Bacteria	8369588
1333	2824686623	2824679649	Bacteria	8248951
1334	2824693207	2824687955	Bacteria	8360029
1335	2824698948	2824696289	Bacteria	8335049
1336	2824707783	2824704595	Bacteria	9667483
1337	2824718341	2824714736	Bacteria	8717648
1338	2824728405	2824723954	Bacteria	8758240
1339	2824736827	2824732956	Bacteria	7810675
1340	2824751079	2824746037	Bacteria	7911610
1341	2824758092	2824753945	Bacteria	9787441
1342	2824766230	2824763712	Bacteria	9792355
1343	2824774249	2824773399	Bacteria	8360218
1344	2831864991	2831864461	Bacteria	6502356
1345	2838127580	2838122688	Bacteria	8803140
1346	2839141021	2839138175	Bacteria	6549354
1347	2841941469	2841941048	Bacteria	8688029
1348	2841952520	2841949485	Bacteria	8680857
1349	2841959538	2841957949	Bacteria	8652217
1350	2841967610	2841966195	Bacteria	8673214
1351	2841978999	2841974524	Bacteria	8931498
1352	2841986541	2841983080	Bacteria	8395090
1353	2842038309	2842038055	Bacteria	8002051
1354	2842048746	2842045827	Bacteria	8006841
1355	2842749133	2842747753	Bacteria	5578255
1356	2844317781	2844315083	Bacteria	8138177
1357	2847934568	2847930680	Bacteria	9342022
1358	2847945180	2847939898	Bacteria	8606328
1359	2849080640	2849076700	Bacteria	7039503
1360	2857509998	2857509624	Bacteria	7472071
1361	2857528767	2857524615	Bacteria	6615449
1362	2874596721	2874590934	Bacteria	8299676
1363	2874610703	2874604998	Bacteria	7834745
1364	2874618269	2874612657	Bacteria	8252029
1365	2874623258	2874620515	Bacteria	8290088
1366	2874635964	2874628541	Bacteria	8630250
1367	2874653050	2874645413	Bacteria	8214782
1368	2876766644	2876761206	Bacteria	10111113
1369	2876776983	2876771140	Bacteria	8287509
1370	2876811736	2876808645	Bacteria	8824342
1371	2876825267	2876818435	Bacteria	8274608
1372	2879081120	2879074833	Bacteria	8279565
1373	2879089756	2879083081	Bacteria	8587928
1374	2879104033	2879099564	Bacteria	10442239
1375	2879118781	2879110137	Bacteria	8907982
1376	2879130858	2879127579	Bacteria	8294491
1377	2879147552	2879142872	Bacteria	8267021
1378	2881365631	2881364244	Bacteria	7710352
1379	2881671820	2881665667	Bacteria	8175609
1380	2885372479	2885366525	Bacteria	8326213
1381	2885376267	2885374607	Bacteria	8927485
1382	2885388000	2885383462	Bacteria	9473874
1383	2885411798	2885409591	Bacteria	9235467
1384	2888382516	2888378607	Bacteria	9652610
1385	2888388182	2888388044	Bacteria	7304136
1386	2888423093	2888419890	Bacteria	7857137
1387	2889039171	2889033259	Bacteria	9099371
1388	2893068962	2893066018	Bacteria	6158120
1389	2903735459	2903727486	Bacteria	8281579
1390	2903775944	2903768456	Bacteria	9749579
1391	2904546847	2904541872	Bacteria	8915136
1392	2904670078	2904666416	Bacteria	8226587
1393	2904691560	2904690495	Bacteria	9412302
1394	2904705059
1395	2904718418	2904711408	Bacteria	9771557
1396	2906607533	2906602504	Bacteria	8295279
1397	2906610674
1398	2906634933	2906626472	Bacteria	8826946
1399	2906641236	2906635258	Bacteria	8601019
1400	2906648969	2906643746	Bacteria	8722424
1401	2906665166	2906660503	Bacteria	8595048
1402	2908744197	2908739725	Bacteria	8628932
1403	2908761629	2908756301	Bacteria	8864324
1404	2908778757	2908775508	Bacteria	8092255
1405	2919079195	2919073203	Bacteria	6531949
1406	2922362135	2922361189	Bacteria	7436256
1407	2922375442
1408	2922388101	2922386360	Bacteria	7017218
1409	2922395033	2922393267	Bacteria	8285685
1410	2922428650
1411	2929164320	2929160207	Bacteria	9075316
1412	2929616179	2929615660	Bacteria	9193770
1413	2929624923	2929624759	Bacteria	9339455
1414	2932787156	2932784394	Bacteria	9704911
1415	2932797371	2932794094	Bacteria	7915132
1416	2932804744	2932801729	Bacteria	7987968
1417	2932811349	2932809354	Bacteria	9135765
1418	2932819778	2932818245	Bacteria	9955613
1419	2932835773	2932828146	Bacteria	9745859
1420	2933578537	2933577622	Bacteria	9116884
1421	2935611122	2935608549	Bacteria	8203142
1422	2935618964	2935616580	Bacteria	9032984
1423	2935634621	2935630451	Bacteria	8169952
1424	2935643219	2935638405	Bacteria	10015038
1425	2935648551	2935648319	Bacteria	8801166
1426	2935657461	2935656913	Bacteria	8965014
1427	2935669845	2935665750	Bacteria	9571747
1428	2935677014	2935675223	Bacteria	9928132
1429	2935693055	2935684952	Bacteria	9590419
1430	2935695453	2935694250	Bacteria	9291695
1431	2935709436	2935703347	Bacteria	10242284
1432	2935719663	2935713505	Bacteria	9608509
1433	2935729570	2935722832	Bacteria	9608746
1434	2935739546	2935732158	Bacteria	9706831
1435	2935748584	2935741537	Bacteria	9707219
1436	2935756829	2935750917	Bacteria	9590372
1437	2935761183	2935760218	Bacteria	9817913
1438	2935771523	2935769743	Bacteria	7878163
1439	2935779212	2935777560	Bacteria	8077691
1440	2935790818	2935785616	Bacteria	7962367
1441	2935799241	2935793552	Bacteria	8012592
1442	2935807362	2935801545	Bacteria	9301974
1443	2935812502	2935810662	Bacteria	9401221
1444	2935820607	2935819856	Bacteria	8261050
1445	2935832637	2935827899	Bacteria	10038562
1446	2935839284	2935837841	Bacteria	9454360
1447	2935849384	2935847175	Bacteria	8228321
1448	2935857329	2935855204	Bacteria	9035059
1449	2935864858	2935864058	Bacteria	9784707
1450	2935876636	2935873716	Bacteria	9632195
1451	2935885020	2935883170	Bacteria	7964738
1452	2935911841	2935908558	Bacteria	8568796
1453	2935920525	2935916978	Bacteria	9113783
1454	2935928870	2935926038	Bacteria	8601059
1455	2935938515	2935934488	Bacteria	8602579
1456	2935945593	2935942939	Bacteria	8599779
1457	2935954800	2935951376	Bacteria	8602333
1458	2935963398	2935959822	Bacteria	7869783
1459	2935970687	2935967501	Bacteria	8603075
1460	2935979076	2935975950	Bacteria	8347125
1461	2935987907	2935984226	Bacteria	8302647
1462	2935999011	2935992306	Bacteria	9802711
1463	2936008230	2936002035	Bacteria	9362176
1464	2936011461	2936011229	Bacteria	8801034
1465	2936020056	2936019824	Bacteria	8804134
1466	2936028652	2936028420	Bacteria	8965941
1467	2936039095	2936037263	Bacteria	9446081
1468	2936046779	2936046547	Bacteria	8903709
1469	2936058346	2936055302	Bacteria	8785755
1470	2940562743	2940556831	Bacteria	9590747
1471	2941509107	2941507105	Bacteria	8166816
1472	2941516936	2941515067	Bacteria	8166720
1473	2941524969	2941523033	Bacteria	8169134
1474	2941536418	2941531003	Bacteria	7653939
1475	2941539974	2941538514	Bacteria	9402094
1476	3005478781	3005474847	Bacteria	9259049
1477	3005487981	3005483717	Bacteria	7877331
1478	3005508688	3005506211	Bacteria	6943378
1479	3005590668	3005587118	Bacteria	7794411
1480	3005597534	3005594810	Bacteria	8716512
1481	3005713556	3005710791	Bacteria	7622528
1482	3005720958	3005718088	Bacteria	8283608
1483	8006928194	8006926726	Bacteria	6749210
1484	8006942564	8006933436	Bacteria	10410654
1485	8006964710	8006964411	Bacteria	8966052
1486	8006982288	8006973647	Bacteria	10679141
1487	8006991937	8006984368	Bacteria	9651211
1488	8006999870	8006994254	Bacteria	8309700
1489	8016536312	8016530956	Bacteria	8155261
1490	8016552650	8016548790	Bacteria	8155074
1491	8016561030	8016557553	Bacteria	8154380
1492	8016574675	8016566248	Bacteria	8158151
1493	8016578750	8016575299	Bacteria	8154085
1494	8016590899	8016583857	Bacteria	10421953
1495	8016598890	8016595262	Bacteria	8149947
1496	8016612184	8016603502	Bacteria	8731218
1497	8016621618	8016613128	Bacteria	8794220
1498	8016628342	8016622563	Bacteria	7999408
1499	8017061403	8017057580	Bacteria	10023680
1500	8019536036	8019530166	Bacteria	8155624
1501	8019543433	8019538911	Bacteria	7872763
1502	8019555421	8019547302	Bacteria	7996444
1503	8019558330	8019555841	Bacteria	9642137
1504	8019566964	8019565922	Bacteria	9639779
1505	8019580878	8019576017	Bacteria	10049540
1506	8019588611	8019586578	Bacteria	10212056
1507	8019615836	8019608314	Bacteria	10042931
1508	8019626570	8019619141	Bacteria	9218857
1509	8019635919	8019629233	Bacteria	8687553
1510	8019643742	8019638758	Bacteria	9062356
1511	8019656521	8019648815	Bacteria	10014479
1512	8019663688	8019659431	Bacteria	8577854
1513	8019673323	8019668869	Bacteria	8791617
1514	8019682806	8019678201	Bacteria	8863603
1515	8019688494	8019687851	Bacteria	8712826
1516	8055226956	8055225921	Bacteria	3341787
1517	8055747826	8055742211	Bacteria	9226248
1518	8056680288	8056673599	Bacteria	7871253
1519	8056688390	8056681323	Bacteria	8472857
1520	8056695935	8056689827	Bacteria	6712655
1521	8056970026	8056967851	Bacteria	9038162
1522	Ga0075365_10089188
1523	JGI24740J21852_10017791
1524	JGI24739J22299_10012305
1525	JGI24737J22298_10027717
1526	JGI24743J22301_10011688
1527	JGI24744J21845_10009727
1528	JGI24034J26672_10007151
1529	JGI24751J29686_10009159
1530	JGI25155J39150_1000055
1531	JGI25156J39149_1000078
1532	JGI25154J39366_1000105
1533	JGI25157J39369_1000098
1534	JGI25150J39212_1002968
1535	JGI25159J45721_1000534
1536	JGI25159J45721_1001755
1537	JGI25159J45721_1004529
1538	JGI25151J46595_10010016
1539	JGI25151J46595_10017852
1540	JGI25160J50197_1000270
1541	JGI25161J50226_1000040
1542	Ga0055526_1002482
1543	Ga0055526_1004021
1544	Ga0055526_1005102
1545	Ga0055526_1013876
1546	Ga0055537_1000157
1547	Ga0055537_1006224
1548	Ga0055524_1000070
1549	Ga0055524_1000077
1550	Ga0055534_1001317
1551	Ga0055534_1006642
1552	Ga0055528_1002647
1553	Ga0055530_10000139
1554	Ga0055530_10001005
1555	Ga0055540_1000010
1556	Ga0055540_1000013
1557	Ga0055531_10000192
1558	Ga0055531_10003627
1559	Ga0055531_10006917
1560	Ga0055531_10013187
1561	Ga0055543_1001026
1562	Ga0055543_1001266
1563	Ga0065165_1000095
1564	Ga0065165_1000281
1565	Ga0065165_1002008
1566	Ga0065165_1006168
1567	Ga0065165_1007351
1568	Ga0065165_1009432
1569	Ga0065704_10010277
1570	Ga0065707_10244126
1571	Ga0070676_10106726
1572	Ga0070683_100037201
1573	Ga0070690_100005802
1574	Ga0068869_100008642
1575	Ga0068869_100023731
1576	Ga0068869_100078498
1577	Ga0068869_100309723
1578	Ga0070680_100007395
1579	Ga0070680_100043947
1580	Ga0070680_100049099
1581	Ga0070682_100008096
1582	Ga0070682_100292108
1583	Ga0068868_100302368
1584	Ga0070660_100136362
1585	Ga0070689_100014900
1586	Ga0070691_10019004
1587	Ga0070691_10074214
1588	Ga0070687_100007952
1589	Ga0070687_100106897
1590	Ga0070661_100067892
1591	Ga0070692_10035094
1592	Ga0070669_100144790
1593	Ga0070675_100104411
1594	Ga0070671_100002780
1595	Ga0070671_100003306
1596	Ga0070671_100031182
1597	Ga0070674_100096885
1598	Ga0070673_100089573
1599	Ga0070673_100130094
1600	Ga0070688_100096440
1601	Ga0070659_100087281
1602	Ga0070667_100001103
1603	Ga0070667_100012316
1604	Ga0070667_100025891
1605	Ga0070667_100285984
1606	Ga0070703_10005526
1607	Ga0070709_10034364
1608	Ga0070709_10158666
1609	Ga0070709_10225353
1610	Ga0070714_100349201
1611	Ga0070713_100013257
1612	Ga0070713_100034407
1613	Ga0070713_100154919
1614	Ga0070713_100347368
1615	Ga0070713_100373100
1616	Ga0070713_100410888
1617	Ga0070713_100500255
1618	Ga0070710_10013162
1619	Ga0070710_10049801
1620	Ga0070701_10002701
1621	Ga0070711_100015635
1622	Ga0070711_100042392
1623	Ga0070711_100057666
1624	Ga0070711_100203072
1625	Ga0070705_100000101
1626	Ga0070705_100123007
1627	Ga0070700_100013900
1628	Ga0070700_100018001
1629	Ga0070700_100019424
1630	Ga0070700_100183220
1631	Ga0070694_100000190
1632	Ga0070694_100000321
1633	Ga0070663_100038557
1634	Ga0070663_100053943
1635	Ga0070663_100133459
1636	Ga0070663_100260408
1637	Ga0070663_100313578
1638	Ga0070678_100011466
1639	Ga0070678_100059672
1640	Ga0070662_100012011
1641	Ga0070662_100078836
1642	Ga0070681_10220075
1643	Ga0068867_100005086
1644	Ga0068867_100023159
1645	Ga0068867_100023673
1646	Ga0070685_10138591
1647	Ga0070706_100070071
1648	Ga0070706_100136151
1649	Ga0070706_100151631
1650	Ga0070707_100047846
1651	Ga0070707_100115843
1652	Ga0070707_100135087
1653	Ga0070707_100142620
1654	Ga0070698_100028063
1655	Ga0070698_100057269
1656	Ga0070698_100082697
1657	Ga0070699_100000040
1658	Ga0070699_100000281
1659	Ga0070699_100004786
1660	Ga0070699_100025324
1661	Ga0070699_100090992
1662	Ga0070679_100029845
1663	Ga0070679_100052810
1664	Ga0070679_100079040
1665	Ga0070679_100093360
1666	Ga0070679_100118628
1667	Ga0070679_100215666
1668	Ga0070679_100329079
1669	Ga0070679_100361986
1670	Ga0070684_100042913
1671	Ga0070684_100080099
1672	Ga0070697_100001131
1673	Ga0070697_100017216
1674	Ga0070697_100070185
1675	Ga0070697_100196981
1676	Ga0068853_100024057
1677	Ga0068853_100032760
1678	Ga0068853_100159152
1679	Ga0070672_100002417
1680	Ga0070672_100024419
1681	Ga0070672_100163949
1682	Ga0070686_100031871
1683	Ga0070686_100080092
1684	Ga0070686_100098612
1685	Ga0070686_100148002
1686	Ga0070695_100000120
1687	Ga0070695_100001510
1688	Ga0070695_100006158
1689	Ga0070695_100023919
1690	Ga0070696_100000478
1691	Ga0070696_100034673
1692	Ga0070696_100058686
1693	Ga0070696_100060978
1694	Ga0070693_100017099
1695	Ga0070693_100024619
1696	Ga0070665_100005197
1697	Ga0070665_100008470
1698	Ga0070665_100084260
1699	Ga0070665_100136229
1700	Ga0070704_100002732
1701	Ga0070704_100015216
1702	Ga0068855_100016193
1703	Ga0068855_100083208
1704	Ga0068855_100155269
1705	Ga0068855_100168170
1706	Ga0068855_100196773
1707	Ga0068857_100006107
1708	Ga0068857_100034794
1709	Ga0068857_100034908
1710	Ga0068857_100042074
1711	Ga0068857_100054552
1712	Ga0068854_100033432
1713	Ga0068854_100048788
1714	Ga0068856_100033788
1715	Ga0068856_100059957
1716	Ga0068856_100115510
1717	Ga0070702_100005020
1718	Ga0070702_100019273
1719	Ga0068859_100006827
1720	Ga0068859_100014929
1721	Ga0068864_100091447
1722	Ga0068864_100250064
1723	Ga0068866_10004982
1724	Ga0068866_10018679
1725	Ga0068866_10068265
1726	Ga0068861_100010399
1727	Ga0068861_100086046
1728	Ga0068861_100124811
1729	Ga0068851_10014704
1730	Ga0068870_10001565
1731	Ga0068863_100021529
1732	Ga0068863_100065045
1733	Ga0068858_100005372
1734	Ga0068858_100037333
1735	Ga0068860_100000900
1736	Ga0068860_100001801
1737	Ga0068860_100004828
1738	Ga0068862_100001691
1739	Ga0068862_100007040
1740	Ga0068862_100021658
1741	Ga0068862_100188071
1742	Ga0081455_10004276
1743	Ga0081455_10016793
1744	Ga0081538_10016517
1745	Ga0081538_10038889
1746	Ga0081540_1023658
1747	Ga0081540_1034728
1748	Ga0081540_1056077
1749	Ga0081539_10001525
1750	Ga0081539_10003706
1751	Ga0081539_10006645
1752	Ga0070717_10003274
1753	Ga0070717_10009311
1754	Ga0070717_10088717
1755	Ga0075365_10014604
1756	Ga0075365_10047953
1757	Ga0075365_10118800
1758	Ga0075365_10158482
1759	Ga0075368_10023058
1760	Ga0075363_100002514
1761	Ga0075363_100038853
1762	Ga0075363_100052576
1763	Ga0075364_10029633
1764	Ga0075364_10182469
1765	Ga0070715_10053487
1766	Ga0070716_100062984
1767	Ga0070712_100003410
1768	Ga0070712_100020484
1769	Ga0075362_10000422
1770	Ga0075362_10004427
1771	Ga0075362_10005989
1772	Ga0075362_10012101
1773	Ga0075362_10053242
1774	Ga0075362_10060327
1775	Ga0075362_10061590
1776	Ga0075367_10026289
1777	Ga0075367_10070132
1778	Ga0075367_10088621
1779	Ga0075369_10001384
1780	Ga0075369_10001670
1781	Ga0075369_10007041
1782	Ga0075369_10044928
1783	Ga0075366_10000230
1784	Ga0075366_10002756
1785	Ga0075366_10010522
1786	Ga0075366_10011433
1787	Ga0075366_10014598
1788	Ga0075366_10026071
1789	Ga0075366_10031649
1790	Ga0075366_10104748
1791	Ga0097621_100007876
1792	Ga0097621_100017698
1793	Ga0075370_10002326
1794	Ga0075370_10002633
1795	Ga0075370_10072939
1796	Ga0075370_10213849
1797	Ga0068871_100009817
1798	Ga0075428_100011445
1799	Ga0075428_100021340
1800	Ga0075428_100033626
1801	Ga0075428_100035309
1802	Ga0075428_100075812
1803	Ga0075428_100196473
1804	Ga0075428_100201188
1805	Ga0075430_100022189
1806	Ga0075430_100024922
1807	Ga0075430_100050203
1808	Ga0075431_100002077
1809	Ga0075431_100032670
1810	Ga0075431_100049001
1811	Ga0075431_100049730
1812	Ga0075431_100065764
1813	Ga0075431_100250143
1814	Ga0075433_10008717
1815	Ga0075433_10044526
1816	Ga0075434_100000653
1817	Ga0075434_100001081
1818	Ga0075434_100049402
1819	Ga0075429_100006001
1820	Ga0075429_100120358
1821	Ga0068865_100002251
1822	Ga0068865_100016940
1823	Ga0068865_100092115
1824	Ga0068865_100220206
1825	Ga0075436_100007986
1826	Ga0097620_100006827
1827	Ga0097620_100014928
1828	Ga0079104_1000001
1829	Ga0079104_1000034
1830	Ga0099826_10000013
1831	Ga0075435_100003036
1832	Ga0075435_100066469
1833	Ga0075435_100084446
1834	Ga0075435_100098784
1835	Ga0075435_100118580
1836	Ga0099794_10014472
1837	Ga0105251_10013329
1838	Ga0105240_10023938
1839	Ga0105240_10040155
1840	Ga0105240_10055715
1841	Ga0105240_10063064
1842	Ga0105240_10126908
1843	Ga0111539_10010139
1844	Ga0111539_10016859
1845	Ga0111539_10110372
1846	Ga0111539_10280509
1847	Ga0105245_10010950
1848	Ga0105245_10234824
1849	Ga0114129_10005978
1850	Ga0114129_10093857
1851	Ga0114129_10315062
1852	Ga0114129_10817751
1853	Ga0105243_10003679
1854	Ga0105243_10010685
1855	Ga0105243_10094471
1856	Ga0105243_10102609
1857	Ga0105243_10123274
1858	Ga0105243_10260477
1859	Ga0105241_10030993
1860	Ga0105241_10179295
1861	Ga0105241_10202102
1862	Ga0105242_10014148
1863	Ga0105242_10036352
1864	Ga0105242_10154645
1865	Ga0105248_10001495
1866	Ga0105248_10008114
1867	Ga0105248_10042182
1868	Ga0105237_10036152
1869	Ga0105237_10052212
1870	Ga0105238_10038672
1871	Ga0105238_10050078
1872	Ga0105238_10090036
1873	Ga0105238_10194981
1874	Ga0105238_10292733
1875	Ga0105249_10008449
1876	Ga0105249_10018354
1877	Ga0105249_10022374
1878	Ga0105249_10060936
1879	Ga0105249_10499242
1880	Ga0105239_10105388
1881	Ga0105239_10155995
1882	Ga0105239_10182845
1883	Ga0157326_1008552
1884	Ga0157373_10025937
1885	Ga0157371_10347207
1886	Ga0157370_10051172
1887	Ga0157370_10244513
1888	Ga0157369_10023068
1889	Ga0157369_10217822
1890	Ga0157369_10296890
1891	Ga0157369_10407585
1892	Ga0157378_10018884
1893	Ga0157378_10070587
1894	Ga0163162_10017892
1895	Ga0163162_10044738
1896	Ga0157372_10087636
1897	Ga0157372_10318643
1898	Ga0157375_10009694
1899	Ga0157375_10055231
1900	Ga0163163_10136049
1901	Ga0163163_10404282
1902	Ga0157380_10278580
1903	Ga0157377_10004082
1904	Ga0157379_10016565
1905	Ga0157379_10027623
1906	Ga0157379_10212843
1907	Ga0157376_10048790
1908	Ga0157376_10060088
1909	Ga0157376_10064013
1910	Ga0157376_10159089
1911	Ga0182007_10053160
1912	Ga0163161_10023935
1913	Ga0163161_10043237
1914	Ga0213871_10007141
1915	Ga0224572_1014941
1916	Ga0209435_100010
1917	Ga0209436_107997
1918	Ga0209563_105456
1919	Ga0207425_1000529
1920	Ga0207425_1013337
1921	Ga0209646_1000001
1922	Ga0209026_1000001
1923	Ga0209759_1000001
1924	Ga0209129_1006750
1925	Ga0209129_1015120
1926	Ga0209233_1005635
1927	Ga0209565_1000036
1928	Ga0209565_1000226
1929	Ga0209673_1000282
1930	Ga0209673_1023252
1931	Ga0209130_1000042
1932	Ga0209130_1000117
1933	Ga0209130_1000255
1934	Ga0209130_1003302
1935	Ga0209675_1000289
1936	Ga0209675_1001115
1937	Ga0209675_1003508
1938	Ga0209675_1004251
1939	Ga0209675_1004558
1940	Ga0209676_1000007
1941	Ga0209676_1005428
1942	Ga0209676_1014443
1943	Ga0209025_1000490
1944	Ga0209025_1002471
1945	Ga0209025_1004169
1946	Ga0209025_1005029
1947	Ga0209025_1030997
1948	Ga0209564_1000030
1949	Ga0209564_1000297
1950	Ga0209564_1001388
1951	Ga0209564_1001472
1952	Ga0209564_1027670
1953	Ga0209758_1005037
1954	Ga0209050_1000003
1955	Ga0209050_1000340
1956	Ga0209050_1001643
1957	Ga0209256_1000001
1958	Ga0209256_1000015
1959	Ga0209256_1040060
1960	Ga0207426_1000097
1961	Ga0207426_1000554
1962	Ga0207426_1003358
1963	Ga0207426_1004842
1964	Ga0209051_1000003
1965	Ga0209051_1000022
1966	Ga0209051_1000317
1967	Ga0209051_1003047
1968	Ga0209051_1015326
1969	Ga0209257_1000020
1970	Ga0209257_1000030
1971	Ga0209257_1000039
1972	Ga0209257_1017850
1973	Ga0207656_10016280
1974	Ga0207653_10000352
1975	Ga0207642_10004999
1976	Ga0207642_10067284
1977	Ga0207642_10070199
1978	Ga0207647_10013302
1979	Ga0207647_10017722
1980	Ga0207647_10076776
1981	Ga0207699_10020587
1982	Ga0207699_10026409
1983	Ga0207645_10010474
1984	Ga0207643_10001548
1985	Ga0207643_10047203
1986	Ga0207684_10026966
1987	Ga0207684_10055384
1988	Ga0207684_10060098
1989	Ga0207684_10109184
1990	Ga0207684_10176761
1991	Ga0207684_10189372
1992	Ga0207654_10000803
1993	Ga0207707_10079338
1994	Ga0207695_10001543
1995	Ga0207695_10055524
1996	Ga0207695_10148018
1997	Ga0207671_10132666
1998	Ga0207693_10005060
1999	Ga0207693_10007515
2000	Ga0207693_10055577
2001	Ga0207693_10155603
2002	Ga0207693_10180504
2003	Ga0207663_10051383
2004	Ga0207663_10059580
2005	Ga0207663_10229523
2006	Ga0207663_10312890
2007	Ga0207660_10001765
2008	Ga0207660_10021315
2009	Ga0207660_10024850
2010	Ga0207660_10149881
2011	Ga0207662_10003149
2012	Ga0207657_10009798
2013	Ga0207652_10002565
2014	Ga0207652_10007935
2015	Ga0207652_10035728
2016	Ga0207652_10064508
2017	Ga0207652_10072394
2018	Ga0207646_10125012
2019	Ga0207646_10159545
2020	Ga0207646_10300495
2021	Ga0207681_10022622
2022	Ga0207694_10001371
2023	Ga0207650_10019546
2024	Ga0207659_10139685
2025	Ga0207687_10008125
2026	Ga0207687_10010116
2027	Ga0207687_10063642
2028	Ga0207687_10160747
2029	Ga0207700_10004789
2030	Ga0207700_10114966
2031	Ga0207700_10349550
2032	Ga0207664_10066548
2033	Ga0207664_10119614
2034	Ga0207644_10006905
2035	Ga0207690_10087143
2036	Ga0207706_10025531
2037	Ga0207706_10043152
2038	Ga0207706_10081156
2039	Ga0207686_10004055
2040	Ga0207709_10000200
2041	Ga0207709_10065101
2042	Ga0207670_10063194
2043	Ga0207669_10009355
2044	Ga0207669_10011212
2045	Ga0207669_10064364
2046	Ga0207704_10040033
2047	Ga0207704_10080304
2048	Ga0207704_10206969
2049	Ga0207665_10002209
2050	Ga0207665_10004891
2051	Ga0207665_10185259
2052	Ga0207691_10002396
2053	Ga0207691_10037321
2054	Ga0207691_10213429
2055	Ga0207711_10031308
2056	Ga0207711_10105923
2057	Ga0207711_10154767
2058	Ga0207689_10002971
2059	Ga0207689_10003070
2060	Ga0207689_10010105
2061	Ga0207689_10015313
2062	Ga0207689_10080837
2063	Ga0207661_10094957
2064	Ga0207679_10011446
2065	Ga0207679_10094121
2066	Ga0207679_10161904
2067	Ga0207667_10007604
2068	Ga0207667_10022915
2069	Ga0207667_10036266
2070	Ga0207667_10279278
2071	Ga0207651_10064510
2072	Ga0207712_10011341
2073	Ga0207712_10037978
2074	Ga0207668_10139953
2075	Ga0207640_10046072
2076	Ga0207640_10199903
2077	Ga0207658_10001239
2078	Ga0207658_10070413
2079	Ga0207677_10003360
2080	Ga0207677_10019722
2081	Ga0207677_10126011
2082	Ga0207677_10295681
2083	Ga0207703_10150508
2084	Ga0207703_10170249
2085	Ga0207703_10175710
2086	Ga0207639_10119073
2087	Ga0207639_10193423
2088	Ga0207678_10007224
2089	Ga0207678_10008502
2090	Ga0207678_10042840
2091	Ga0207678_10097656
2092	Ga0207678_10156982
2093	Ga0207678_10207167
2094	Ga0207678_10218383
2095	Ga0207708_10001674
2096	Ga0207708_10004441
2097	Ga0207708_10023295
2098	Ga0207708_10130065
2099	Ga0207708_10138031
2100	Ga0207702_10000005
2101	Ga0207702_10024125
2102	Ga0207702_10093110
2103	Ga0207702_10149309
2104	Ga0207641_10019819
2105	Ga0207641_10103523
2106	Ga0207648_10005710
2107	Ga0207648_10010955
2108	Ga0207648_10077210
2109	Ga0207676_10002836
2110	Ga0207676_10100639
2111	Ga0207676_10388410
2112	Ga0207674_10001070
2113	Ga0207674_10043098
2114	Ga0207674_10104326
2115	Ga0207675_100004136
2116	Ga0207675_100043849
2117	Ga0207675_100055236
2118	Ga0207675_100316991
2119	Ga0207683_10025436
2120	Ga0207683_10038962
2121	Ga0207683_10052426
2122	Ga0207698_10110922
2123	Ga0207698_10124890
2124	Ga0209281_1000005
2125	Ga0209281_1000057
2126	Ga0209981_1004726
2127	Ga0209999_1005143
2128	Ga0209282_1000043
2129	Ga0209588_1002380
2130	Ga0209588_1008424
2131	Ga0209966_1002897
2132	Ga0209998_10032928
2133	Ga0209813_10005559
2134	Ga0209974_10031197
2135	Ga0207428_10045223
2136	Ga0268266_10036791
2137	Ga0268266_10073583
2138	Ga0268266_10425934
2139	Ga0268265_10001922
2140	Ga0268265_10066385
2141	Ga0268265_10241771
2142	Ga0268265_10357672
2143	Ga0268264_10002112
2144	Ga0268264_10409698
2145	Ga0307515_10000026
2146	Ga0307515_10070887
2147	Ga0307515_10337843
2148	Ga0265338_10037146
2149	Ga0265338_10135613
2150	Ga0265338_10268924
2151	Ga0265332_10000035
2152	Ga0265332_10013105
2153	Ga0265332_10016450
2154	Ga0265328_10036921
2155	Ga0265325_10059636
2156	Ga0265329_10040386
2157	Ga0265340_10006842
2158	Ga0265340_10008206
2159	Ga0265339_10000075
2160	Ga0265339_10059277
2161	Ga0265316_10040657
2162	Ga0265316_10313021
2163	Ga0307513_10000011
2164	Ga0307513_10000017
2165	Ga0307513_10288748
2166	Ga0307509_10005866
2167	Ga0307408_100061080
2168	Ga0307408_100106383
2169	Ga0265313_10000540
2170	Ga0265342_10000146
2171	Ga0307516_10005910
2172	Ga0307516_10028965
2173	Ga0307405_10197874
2174	Ga0307406_10062177
2175	Ga0307412_10124737
2176	Ga0307412_10199564
2177	Ga0307414_10018572
2178	Ga0307411_10134643
2179	Ga0373934_0003348
2180	Ga0373934_0039691
2181	Ga0373934_0092045
2182	Ga0373923_0000675
2183	Ga0373923_0018872
2184	Ga0373923_0054197
2185	Ga0373936_0004148
2186	Ga0373945_0027184
2187	Ga0373953_0000670
2188	Ga0373953_0009253
2189	Ga0373953_0009567
2190	Ga0373953_0034836
2191	Ga0373953_0056014
2192	Ga0373956_0004379
2193	Ga0373956_0012639
2194	Ga0373956_0049465
2195	Ga0373957_0012415
2196	Ga0373957_0012488
2197	Ga0373957_0043328
2198	Ga0373960_0008673
2199	Ga0373943_0121989
2200	Ga0373946_0000216
2201	Ga0373955_0000447
2202	Ga0373955_0002175
2203	Ga0373955_0072881
2204	Ga0373955_0096818
2205	Ga0373962_0000832
2206	Ga0373924_0000349
2207	Ga0373924_0011185
2208	Ga0373924_0015656
2209	Ga0373931_0000672
2210	Ga0373931_0037842
2211	Ga0373935_0000980
2212	Ga0373935_0013561
2213	Ga0373935_0016416
2214	Ga0373935_0243128
2215	Ga0373927_0013277
2216	Ga0373927_0017790
2217	Ga0373927_0041783
2218	Ga0373927_0184355
2219	Ga0373927_0221312
2220	Ga0373933_0000167
2221	Ga0373933_0000518
2222	Ga0373933_0002005
2223	Ga0373933_0002927
2224	Ga0373933_0005651
2225	Ga0373933_0047839
2226	Ga0373933_0115069
2227	Ga0373933_0117616
2228	Ga0373947_0000379
2229	Ga0373947_0078635
2230	Ga0373937_0000968
2231	Ga0373937_0002750
2232	Ga0373937_0003161
2233	Ga0373937_0015114
2234	Ga0373937_0074399
2235	Ga0373937_0121748
2236	Ga0373925_0000018
2237	Ga0373925_0051480
2238	Ga0373925_0189102
2239	Ga0395899_0035586
2240	Ga0395899_0088692
2241	Ga0395900_0005885
2242	Ga0395900_0015514
2243	Ga0395900_0017765
2244	Ga0395900_0044621
2245	Ga0395900_0131969
2246	Ga0395900_0215265
2247	Ga0395898_0013144
2248	Ga0395898_0014076
2249	Ga0395898_0027894
2250	Ga0395898_0051434
2251	Ga0395898_0175740
2252	Ga0395898_0250470
2253	Ga0395905_0000065
2254	Ga0395905_0001008
2255	Ga0395905_0006143
2256	Ga0395905_0022006
2257	Ga0395905_0055610
2258	Ga0395905_0186825
2259	Ga0395905_0209114
2260	Ga0395905_0259480
2261	Ga0395905_0261224
2262	Ga0395905_0301047
2263	Ga0395905_0303832
2264	Ga0436364_0329580
2265	Ga0436364_0588488
2266	Ga0436364_0899440
2267	Ga0395901_0001202
2268	Ga0395901_0004089
2269	Ga0395901_0019599
2270	Ga0395901_0021683
2271	Ga0395901_0077683
2272	Ga0395901_0088021
2273	Ga0395901_0114873
2274	Ga0395901_0214776
2275	Ga0395901_0220354
2276	Ga0436365_1625850
2277	Ga0436360_0836846
2278	Ga0436360_1175090
2279	Ga0436361_0850390
2280	Ga0436363_0658082
2281	Ga0436363_0787574
2282	Ga0436363_1070427
2283	Ga0436362_0507584
2284	Ga0436362_0746842
2285	Ga0439465_0029543
2286	Ga0451853_0600253
2287	Ga0439433_0030749
2288	Ga0439441_002904
2289	Ga0439443_003378
2290	Ga0439443_004018
2291	Ga0439449_0000980
2292	Ga0439455_0004730
2293	Ga0439460_0013755
2294	Ga0450893_0001145
2295	Ga0451577_0009954
2296	Ga0451577_0178325
2297	Ga0466972_0000174
2298	Ga0466965_0103275
2299	Ga0466961_0085136
2300	Ga0466963_0002626
2301	Ga0466964_0029982
2302	Ga0466957_0019551
2303	Ga0466959_0039753
2304	Ga0451576_0073270
2305	Ga0451576_0095067
2306	Ga0466967_0058165
2307	Ga0495592_0000001
2308	Ga0495592_0010346
2309	Ga0495592_0028012
2310	Ga0495592_0107156
2311	Ga0495603_0057065
2312	Ga0495629_0017080
2313	Ga0495651_0002430
2314	Ga0495651_0018895
2315	Ga0495651_0033160
2316	Ga0495651_0057181
2317	Ga0495651_0104300
2318	Ga0495651_0188424
2319	Ga0495653_0000092
2320	Ga0495653_0032787
2321	Ga0495653_0055700
2322	Ga0495653_0085636
2323	Ga0495653_0171324
2324	Ga0495580_0042377
2325	Ga0495582_0027822
2326	Ga0495662_0002406
2327	Ga0495664_0000001
2328	Ga0495664_0000814
2329	Ga0495664_0002358
2330	Ga0495584_0103174
2331	Ga0495607_0091531
2332	Ga0495583_0066870
2333	Ga0495608_0000050
2334	Ga0495608_0012355
2335	Ga0495608_0033765
2336	Ga0495608_0045769
2337	Ga0495618_0000064
2338	Ga0495618_0003906
2339	Ga0495618_0026930
2340	Ga0495628_0000003
2341	Ga0495628_0046640
2342	Ga0495628_0057389
2343	Ga0495628_0091977
2344	Ga0495628_0108476
2345	Ga0495628_0196528
2346	Ga0495628_0283918
2347	Ga0495630_0018396
2348	Ga0495630_0085470
2349	Ga0495630_0150448
2350	Ga0495632_0144080
2351	Ga0495643_0071024
2352	Ga0495644_0038471
2353	Ga0495648_0037341
2354	Ga0495666_0089559
2355	Ga0495652_0000001
2356	Ga0495652_0017696
2357	Ga0495652_0023154
2358	Ga0495652_0028807
2359	Ga0495652_0092412
2360	Ga0495652_0186390
2361	Ga0495652_0189553
2362	Ga0495654_0034391
2363	Ga0495640_0000006
2364	Ga0495640_0016995
2365	Ga0495640_0026836
2366	Ga0495640_0028277
2367	Ga0495640_0034698
2368	Ga0495640_0050921
2369	Ga0495640_0106162
2370	Ga0495586_0052426
2371	Ga0495587_0000028
2372	Ga0495587_0004300
2373	Ga0495587_0027737
2374	Ga0495587_0029630
2375	Ga0495587_0053040
2376	Ga0495587_0058399
2377	Ga0495645_0000004
2378	Ga0495645_0002100
2379	Ga0495645_0011359
2380	Ga0495622_0024113
2381	Ga0495667_0000001
2382	Ga0495667_0001580
2383	Ga0495667_0007304
2384	Ga0495667_0015428
2385	Ga0495667_0032079
2386	Ga0495656_0000234
2387	Ga0495634_0000075
2388	Ga0495634_0004988
2389	Ga0495634_0007454
2390	Ga0495634_0035251
2391	Ga0495634_0074661
2392	Ga0495634_0129340
2393	Ga0495625_0220081
2394	Ga0495635_0000015
2395	Ga0495635_0000892
2396	Ga0495635_0002891
2397	Ga0495635_0015572
2398	Ga0495635_0023975
2399	Ga0495635_0042968
2400	Ga0495635_0045942
2401	Ga0495635_0057618
2402	Ga0495659_0082950
2403	Ga0495657_0000155
2404	Ga0495657_0001505
2405	Ga0495657_0041288
2406	Ga0495657_0063558
2407	Ga0495657_0218446
2408	Ga0495599_0000029
2409	Ga0495599_0008138
2410	Ga0495599_0011986
2411	Ga0495599_0058409
2412	Ga0495623_0002081
2413	Ga0495623_0010716
2414	Ga0495623_0016944
2415	Ga0495646_0000006
2416	Ga0495646_0003426
2417	Ga0495646_0004824
2418	Ga0495646_0021838
2419	Ga0495646_0039647
2420	Ga0495658_0027090
2421	Ga0495613_0024732
2422	Ga0495613_0077595
2423	Ga0495613_0157219
2424	Ga0495624_0075869
2425	Ga0495670_0042164
2426	Ga0495600_0000286
2427	Ga0495600_0000845
2428	Ga0495600_0018740
2429	Ga0495600_0022874
2430	Ga0495600_0152291
2431	Ga0495581_0093945
2432	Ga0495581_0102326
2433	Ga0495604_0000091
2434	Ga0495604_0021212
2435	Ga0495604_0047456
2436	Ga0495604_0052530
2437	Ga0495674_0000001
2438	Ga0495674_0026072
2439	Ga0495674_0027509
2440	Ga0495674_0070630
2441	Ga0495674_0197302
2442	Ga0495674_0291161
2443	Ga0495676_0075708
2444	Ga0495680_0000489
2445	Ga0495680_0001893
2446	Ga0495680_0025144
2447	Ga0495680_0048642
2448	Ga0495675_0000839
2449	Ga0495675_0001788
2450	Ga0495675_0004381
2451	Ga0495675_0009939
2452	Ga0495675_0109543
2453	Ga0495675_0125856
2454	Ga0495675_0152252
2455	Ga0495681_0037945
2456	Ga0495684_0000055
2457	Ga0495684_0006728
2458	Ga0495684_0021876
2459	Ga0495684_0222587
2460	Ga0495593_0002873
2461	Ga0495593_0004038
2462	Ga0495602_0000002
2463	Ga0495602_0000131
2464	Ga0495602_0017772
2465	Ga0495602_0038377
2466	Ga0495602_0047333
2467	Ga0495602_0122954
2468	Ga0495602_0208218
2469	Ga0495614_0055646
2470	Ga0496100_0082353
2471	Ga0496100_0252211
2472	Ga0496101_0001315
2473	Ga0496102_0000742
2474	Ga0496102_0000755
2475	Ga0496103_0002582
2476	Ga0496104_0000990
2477	Ga0496104_0034233
2478	Ga0496104_0055470
2479	Ga0496104_0060580
2480	Ga0496104_0123386
2481	Ga0496104_0399727
2482	Ga0496105_0009893
2483	Ga0496105_0026830
2484	Ga0496105_0054773
2485	Ga0496105_0097734
2486	Ga0496106_0001604
2487	Ga0496106_0001887
2488	Ga0496106_0006158
2489	Ga0496106_0006881
2490	Ga0496107_0000537
2491	Ga0496107_0002510
2492	Ga0496108_0002018
2493	Ga0496108_0010705
2494	Ga0496108_0074699
2495	Ga0496108_0176182
2496	Ga0496108_0277446
2497	Ga0496109_0001503
2498	Ga0496109_0001562
2499	Ga0496109_0007320
2500	Ga0496109_0036128
2501	Ga0496109_0104551
2502	Ga0496109_0308346
2503	Ga0496110_0001525
2504	Ga0496110_0002482
2505	Ga0496110_0012544
2506	Ga0496110_0040795
2507	Ga0496110_0086383
2508	Ga0496111_0000797
2509	Ga0496111_0064699
2510	Ga0496112_0018536
2511	Ga0496112_0042695
2512	Ga0496112_0058701
2513	Ga0496112_0323603
2514	Ga0496113_0000917
2515	Ga0496113_0010734
2516	Ga0496113_0018915
2517	Ga0496113_0059093
2518	Ga0496113_0193778
2519	Ga0496114_0017778
2520	Ga0496115_0004175
2521	Ga0496115_0032990
2522	Ga0496115_0064736
2523	Ga0496115_0085004
2524	Ga0496115_0338128
2525	Ga0496116_0003781
2526	Ga0496117_0110987
2527	Ga0496118_0025668
2528	Ga0496118_0175023
2529	Ga0496118_0208213
2530	Ga0496119_0042950
2531	Ga0496121_0001527
2532	Ga0496121_0002321
2533	Ga0496121_0006578
2534	Ga0496122_0026944
2535	Ga0496122_0093338
2536	Ga0496125_0000092
2537	Ga0496125_0001341
2538	Ga0496125_0009813
2539	Ga0496125_0073663
2540	Ga0496126_0015353
2541	Ga0496126_0022619
2542	Ga0496126_0044454
2543	Ga0496126_0044775
2544	Ga0496126_0174411
2545	Ga0501031_0000392
2546	Ga0501031_0007587
2547	Ga0501032_0000224
2548	Ga0501033_0000095
2549	Ga0501033_0007252
2550	Ga0501033_0029583
2551	Ga0501033_0039437
2552	Ga0501033_0077740
2553	Ga0501033_0098342
2554	Ga0501034_0000601
2555	Ga0501034_0001606
2556	Ga0501034_0022054
2557	Ga0501034_0026890
2558	Ga0501034_0126954
2559	Ga0501034_0135823
2560	Ga0501036_0000007
2561	Ga0501036_0016319
2562	Ga0501036_0070336
2563	Ga0501037_0000159
2564	Ga0501037_0017737
2565	Ga0501037_0119682
2566	Ga0501038_0000028
2567	Ga0501038_0043888
2568	Ga0501038_0175951
2569	Ga0501039_0000005
2570	Ga0501039_0010757
2571	Ga0501039_0106024
2572	Ga0501039_0204780
2573	Ga0501040_0021755
2574	Ga0501041_0101735
2575	Ga0501041_0131583
2576	Ga0501042_0009857
2577	Ga0501043_0000127
2578	Ga0501043_0040311
2579	Ga0501043_0075759
2580	Ga0501043_0198942
2581	Ga0501043_0333400
2582	Ga0501046_0000032
2583	Ga0501046_0003405
2584	Ga0501046_0042375
2585	Ga0501046_0055174
2586	Ga0501046_0072632
2587	Ga0501046_0085818
2588	Ga0501047_0000077
2589	Ga0501047_0111536
2590	Ga0501047_0286125
2591	Ga0501048_0000693
2592	Ga0501048_0001758
2593	Ga0501048_0017033
2594	Ga0501048_0324604
2595	Ga0501067_0001841
2596	Ga0501067_0002698
2597	Ga0501068_0000982
2598	Ga0501068_0001804
2599	Ga0501068_0007258
2600	Ga0501069_0003029
2601	Ga0501069_0008089
2602	Ga0501069_0209682
2603	Ga0501070_0000070
2604	Ga0501070_0002878
2605	Ga0501070_0042709
2606	Ga0501070_0093123
2607	Ga0501071_0065515
2608	Ga0501072_0019222
2609	Ga0501072_0104157
2610	Ga0501073_0002706
2611	Ga0501073_0018431
2612	Ga0501074_0000302
2613	Ga0501074_0009212
2614	Ga0501074_0175508
2615	Ga0501075_0003089
2616	Ga0501075_0147180
2617	Ga0501075_0182033
2618	Ga0501075_0203206
2619	Ga0501076_0000606
2620	Ga0501076_0015695
2621	Ga0501076_0039294
2622	Ga0501076_0047151
2623	Ga0501076_0204219
2624	Ga0501077_0029898
2625	Ga0501079_0039010
2626	Ga0501079_0050064
2627	Ga0501079_0053550
2628	Ga0501079_0060728
2629	Ga0501079_0108429
2630	Ga0501079_0111678
2631	Ga0501079_0115128
2632	Ga0501079_0191236
2633	Ga0501080_0000035
2634	Ga0501080_0041574
2635	Ga0501080_0091219
2636	Ga0501080_0098402
2637	Ga0501080_0343128
2638	Ga0501081_0011150
2639	Ga0501081_0034130
2640	Ga0501081_0221815
2641	Ga0501081_0307480
2642	Ga0501083_0156356
2643	Ga0501035_0000016
2644	Ga0501035_0114433
2645	Ga0501035_0168829
2646	Ga0501044_0000184
2647	Ga0501044_0002904
2648	Ga0501044_0003221
2649	Ga0501044_0010842
2650	Ga0501044_0013164
2651	Ga0501044_0073512
2652	Ga0501044_0232572
2653	Ga0501045_0002936
2654	Ga0501045_0003187
2655	Ga0501045_0047118
2656	Ga0501045_0056317
2657	Ga0501045_0229999
2658	nmdc:mga03683_13831_c1
2659	nmdc:mga03683_37293_c1
2660	nmdc:mga03683_7104_c1
2661	nmdc:mga03n38_2169_c1
2662	nmdc:mga00v17_221549_c1
2663	nmdc:mga00v17_22883_c1
2664	nmdc:mga00v17_56567_c1
2665	nmdc:mga0yw44_25967_c1
2666	nmdc:mga0yw44_40904_c1
2667	nmdc:mga0yw44_42090_c1
2668	nmdc:mga0k408_11849_c1
2669	nmdc:mga0k408_123879_c1
2670	nmdc:mga0k408_26183_c2
2671	nmdc:mga0k408_267_c1
2672	nmdc:mga0k408_32153_c1
2673	nmdc:mga0k408_3655_c1
2674	nmdc:mga0k408_3732_c1
2675	nmdc:mga06z11_148928_c1
2676	nmdc:mga06z11_24053_c1
2677	nmdc:mga06z11_78089_c1
2678	nmdc:mga04h51_45476_c1
2679	nmdc:mga04h51_941_c1
2680	nmdc:mga07m45_21445_c1
2681	nmdc:mga07m45_2935_c1
2682	nmdc:mga07m45_38328_c1
2683	nmdc:mga07m45_42136_c1
2684	nmdc:mga05p37_277907_c1
2685	nmdc:mga05p37_476309_c1
2686	nmdc:mga05p37_490959_c1
2687	nmdc:mga05p37_62385_c1
2688	nmdc:mga05p37_635_c1
2689	nmdc:mga09592_20297_c1
2690	nmdc:mga09592_4975_c1
2691	nmdc:mga0qj67_2628_c1
2692	nmdc:mga0qj67_45005_c1
2693	nmdc:mga0qj67_6299_c1
2694	nmdc:mga0qj67_70562_c1
2695	nmdc:mga0qj67_74275_c1
2696	nmdc:mga06r32_143484_c1
2697	nmdc:mga06r32_20171_c1
2698	nmdc:mga06r32_229502_c1
2699	nmdc:mga06r32_25814_c1
2700	nmdc:mga06r32_78989_c1
2701	nmdc:mga08y16_134_c1
2702	nmdc:mga08y16_15059_c1
2703	nmdc:mga08y16_239054_c1
2704	nmdc:mga08y16_273734_c1
2705	nmdc:mga0n895_101988_c1
2706	nmdc:mga0n895_23043_c1
2707	nmdc:mga0n895_7779_c1
2708	nmdc:mga0rr50_13376_c1
2709	nmdc:mga0rr50_197665_c1
2710	nmdc:mga0rr50_94610_c1
2711	nmdc:mga08x19_23_c1
2712	nmdc:mga0a205_27764_c1
2713	nmdc:mga0sz30_15764_c1
2714	nmdc:mga0sz30_1648_c1
2715	nmdc:mga0sz30_5725_c1
2716	nmdc:mga0sz30_63931_c1
2717	Ga0495601_0000006
2718	Ga0495601_0000702
2719	Ga0495601_0006936
2720	Ga0495601_0031751
2721	Ga0495601_0032587
2722	Ga0495601_0077264
2723	Ga0495612_0000004
2724	Ga0495612_0002858
2725	Ga0495612_0010096
2726	Ga0495595_0000051
2727	Ga0495595_0000687
2728	Ga0495595_0006154
2729	Ga0495595_0012385
2730	Ga0495595_0022736
2731	Ga0495595_0084162
2732	Ga0495619_0000027
2733	Ga0495619_0000394
2734	Ga0495619_0003214
2735	Ga0495619_0006487
2736	Ga0495619_0008856
2737	Ga0495619_0041011
2738	Ga0495619_0061050
2739	Ga0495619_0206233
2740	Ga0495619_0213482
2741	Ga0500643_019564
2742	Ga0500644_0005592
2743	Ga0500651_0067765
2744	Ga0500566_0000571
2745	Ga0500566_0000693
2746	Ga0500566_0031112
2747	Ga0500640_001688
2748	Ga0500641_0000327
2749	Ga0500556_0000024
2750	Ga0500562_005251
2751	Ga0500562_019563
2752	Ga0500569_007181
2753	Ga0500572_000457
2754	Ga0500592_000573
2755	Ga0500593_013759
2756	Ga0500608_043750
2757	Ga0500618_005018
2758	Ga0500642_0000035
2759	Ga0500652_000016
2760	Ga0500652_000404
2761	Ga0500559_0003716
2762	Ga0500559_0006017
2763	Ga0500568_0005040
2764	Ga0500568_0078166
2765	Ga0500577_0001147
2766	Ga0500603_000105
2767	Ga0500604_0001709
2768	Ga0500616_0000122
2769	Ga0500616_0000845
2770	Ga0500616_0005663
2771	Ga0500616_0102242
2772	Ga0500622_0000790
2773	Ga0500627_0056637
2774	Ga0500630_000990
2775	Ga0500639_000066
2776	Ga0500636_0000410
2777	Ga0500636_0006371
2778	Ga0500636_0063934
2779	Ga0500645_000408
2780	Ga0500645_002074
2781	Ga0500552_000210
2782	Ga0501084_0009891
2783	Ga0501084_0010974
2784	Ga0501084_0046623
2785	Ga0501084_0261866
2786	Ga0501084_0261908
2787	Ga0590075_034402
2788	Ga0501082_0000008
2789	Ga0501082_0002439
2790	Ga0501082_0043058
2791	Ga0501082_0045279
2792	Ga0501082_0167641
2793	Ga0530510_0001806
2794	Ga0530510_0003890
2795	Ga0530510_0014739
2796	Ga0530510_0120652
2797	2507509973
2798	2508543979
2799	2508698082
2800	2509147608
2801	2511244735
2802	2511400363
2803	2513627616
2804	2513645018
2805	2513652264
2806	2513676382
2807	2513696094
2808	2513700260
2809	2513721933
2810	2513862035
2811	2513876071
2812	2513893361
2813	2513921475
2814	2514011270
2815	2515629184
2816	2517103273
2817	2517893789
2818	2524439007
2819	2524469414
2820	2524537738
2821	2528852735
2822	2548499528
2823	2587728474
2824	2603861104
2825	2617353443
2826	2617377994
2827	2644060839
2828	2644072118
2829	2644287856
2830	2671124122
2831	2722884748
2832	2723846329
2833	2728752932
2834	2738722620
2835	2739245306
2836	2739252395
2837	2739283191
2838	2745078880
2839	2793060038
2840	2793070710
2841	2793083268
2842	2805917396
2843	2816471635
2844	2818242489
2845	2824605654
2846	2824609905
2847	2824625286
2848	2824634102
2849	2824639832
2850	2824648415
2851	2824655696
2852	2824666582
2853	2824674153
2854	2824686623
2855	2824693207
2856	2824698948
2857	2824707783
2858	2824718341
2859	2824728405
2860	2824736827
2861	2824751079
2862	2824758092
2863	2824766230
2864	2824774249
2865	2831864991
2866	2838127580
2867	2839141021
2868	2841941469
2869	2841952520
2870	2841959538
2871	2841967610
2872	2841978999
2873	2841986541
2874	2842038309
2875	2842048746
2876	2842749133
2877	2844317781
2878	2847934568
2879	2847945180
2880	2849080640
2881	2857509998
2882	2857528767
2883	2874596721
2884	2874610703
2885	2874618269
2886	2874623258
2887	2874635964
2888	2874653050
2889	2876766644
2890	2876776983
2891	2876811736
2892	2876825267
2893	2879081120
2894	2879089756
2895	2879104033
2896	2879118781
2897	2879130858
2898	2879147552
2899	2881365631
2900	2881671820
2901	2885372479
2902	2885376267
2903	2885388000
2904	2885411798
2905	2888382516
2906	2888388182
2907	2888423093
2908	2889039171
2909	2893068962
2910	2903735459
2911	2903775944
2912	2904546847
2913	2904670078
2914	2904691560
2915	2904705059
2916	2904718418
2917	2906607533
2918	2906610674
2919	2906634933
2920	2906641236
2921	2906648969
2922	2906665166
2923	2908744197
2924	2908761629
2925	2908778757
2926	2919079195
2927	2922362135
2928	2922375442
2929	2922388101
2930	2922395033
2931	2922428650
2932	2929164320
2933	2929616179
2934	2929624923
2935	2932787156
2936	2932797371
2937	2932804744
2938	2932811349
2939	2932819778
2940	2932835773
2941	2933578537
2942	2935611122
2943	2935618964
2944	2935634621
2945	2935643219
2946	2935648551
2947	2935657461
2948	2935669845
2949	2935677014
2950	2935693055
2951	2935695453
2952	2935709436
2953	2935719663
2954	2935729570
2955	2935739546
2956	2935748584
2957	2935756829
2958	2935761183
2959	2935771523
2960	2935779212
2961	2935790818
2962	2935799241
2963	2935807362
2964	2935812502
2965	2935820607
2966	2935832637
2967	2935839284
2968	2935849384
2969	2935857329
2970	2935864858
2971	2935876636
2972	2935885020
2973	2935911841
2974	2935920525
2975	2935928870
2976	2935938515
2977	2935945593
2978	2935954800
2979	2935963398
2980	2935970687
2981	2935979076
2982	2935987907
2983	2935999011
2984	2936008230
2985	2936011461
2986	2936020056
2987	2936028652
2988	2936039095
2989	2936046779
2990	2936058346
2991	2940562743
2992	2941509107
2993	2941516936
2994	2941524969
2995	2941536418
2996	2941539974
2997	3005478781
2998	3005487981
2999	3005508688
3000	3005590668
3001	3005597534
3002	3005713556
3003	3005720958
3004	8006928194
3005	8006942564
3006	8006964710
3007	8006982288
3008	8006991937
3009	8006999870
3010	8016536312
3011	8016552650
3012	8016561030
3013	8016574675
3014	8016578750
3015	8016590899
3016	8016598890
3017	8016612184
3018	8016621618
3019	8016628342
3020	8017061403
3021	8019536036
3022	8019543433
3023	8019555421
3024	8019558330
3025	8019566964
3026	8019580878
3027	8019588611
3028	8019615836
3029	8019626570
3030	8019635919
3031	8019643742
3032	8019656521
3033	8019663688
3034	8019673323
3035	8019682806
3036	8019688494
3037	8055226956
3038	8055747826
3039	8056680288
3040	8056688390
3041	8056695935
3042	8056970026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01717

Meth_synt_2

Cobalamin-independent synthase, Catalytic domain

2

336

0.84 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3rpd-assembly2.cif.gz_B	the structure of a b12-independent methionine synthase from shewanella sp. w3-18-1 in complex with selenomethionine.	0.9771	1	339
3rpd-assembly2.cif.gz_B	the structure of a b12-independent methionine synthase from shewanella sp. w3-18-1 in complex with selenomethionine.	0.9687	1	339
2nq5-assembly1.cif.gz_A	crystal structure of methyltransferase from streptococcus mutans	0.8754	1	338
3bq6-assembly1.cif.gz_A	crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ (monoclinic)	0.8666	2	336
1xr2-assembly1.cif.gz_A	crystal structure of oxidized t. maritima cobalamin-independent methionine synthase complexed with methyltetrahydrofolate	0.8646	1	334

ID	Description	Score	Start	End	Superfamily
3rpdA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;	0.9753	2	339	3.20.20.210
2nq5A02	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;	0.8827	1	338	3.20.20.210
af_K7KK03_1_110_3.20.20.210	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;	0.8601	250	338	3.20.20.210
af_K7MME4_84_171_3.20.20.210	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;	0.8558	254	338	3.20.20.210
4l61A02	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;	0.8465	2	338	3.20.20.210

ID	Description	Score	Start	End	GO Terms
AF-A0A258Q165-F1-model_v4	deleted	0.9928	69	340
AF-A0A1H0A3X4-F1-model_v4	Methionine synthase (B12-independent)	0.9922	2	340	GO:0003871 GO:0008270 GO:0009086
AF-A0A1H7E688-F1-model_v4	5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase	0.9919	2	339	GO:0003871 GO:0008270 GO:0009086 GO:0032259
AF-A0A4Q5W7T4-F1-model_v4	deleted	0.9896	2	269
AF-A0A401U2M5-F1-model_v4	Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein	0.9891	86	255	GO:0003871 GO:0008270 GO:0009086

F494533

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01717

Meth_synt_2

Cobalamin-independent synthase, Catalytic domain

2

336

0.84

Structural Annotation

Top 5 Hits

Map