F494535

General Info

Members Datasets Scaffolds Average Seq Length
1521 1085 3042 515

Family's Representative Sequence

Representative Sequence 3300041501|Ga0451845_0113644|Ga0451845_0113644_227_1933
Length 568
Sequence MSDYTELDKKQDVHILHSMGYAQELERRMSSFSNFAVSFSIICILSGGINSLAQATSGAGGAAIGIGWPLGCFISLVFAIAMAQISSAYPTAGGLYHWGSILGNRFTGWLTAWFNLLGLVTVLGAINVGTYYFFMGSFGTTYLGLTDTTVVRIVFLVIITGAQALVNHMGIGLTAKLTDFSGYLIFATSIALALVCLAAAPSYEIGRLFTFANYSGEAGGNVWPSTSGAWVFLLGLLLPIYTITGYDASAHTSEETVKAAESVPRGMVASVLWSALFGYIMLCAFVLMLPNMDDAAKQGWNVFFWAMDSQVNPIVKDILYLAILVSQWLCGLATVTSVSRMIFAFSRDGGLPASKALSKVSPQYRTPVAAIWTGSILSVLFVWGSSLVSIGDTPVYTIVVSCTVIFLFFSFAIPITLGLFAWGTSKWDKMGPWNLGEGVFKLFAVLTVIAMILIFILGIQPPNEWALYITVGFLILTAIVWFGFESRRFKGPPIGAEVAKRQAEIAAAEAAVGETGENQASRLPSQMAGPHPAAPSRFNEKASGRKVRPSACDFVAPIFSIPIQADQS

Samples

Sample ID Description Type Environment
1 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
109 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
128 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
129 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
132 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
133 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
134 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
135 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
136 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
139 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
142 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
143 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
144 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
151 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
198 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
206 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
207 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
208 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
209 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
210 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
211 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
212 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
213 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
216 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
219 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
220 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
229 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
230 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
231 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
232 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
233 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
234 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
235 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
236 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
239 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
240 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
241 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
242 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
243 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
244 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
245 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
246 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
247 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
248 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
249 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
250 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
251 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
252 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
253 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
254 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
259 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
260 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
264 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
267 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
272 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
273 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
274 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
275 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
276 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
279 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
280 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
281 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
282 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
283 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
284 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
285 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
286 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
287 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
288 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
289 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
290 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
291 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
292 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
293 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
294 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
295 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
296 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
297 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
298 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
299 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
300 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
301 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
302 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
306 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
307 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
308 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
309 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
310 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
311 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
312 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
313 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
314 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
315 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
316 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
317 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
318 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
319 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
320 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
321 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
322 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
323 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
324 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
325 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
326 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
327 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
328 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
329 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
330 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
331 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
332 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
333 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
342 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
343 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
344 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
345 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
346 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
347 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
348 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
349 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
350 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
351 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
352 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
353 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
354 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
355 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
356 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
357 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
358 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
369 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
370 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
373 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
375 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
376 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
377 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
378 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
379 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
380 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
383 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
384 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
385 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
386 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
387 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
388 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
389 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
390 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
391 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
392 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
393 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
394 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
395 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
396 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
404 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
405 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
406 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
407 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
408 2509276019 Ensifer aridi TW10 Isolate Nodule
409 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
410 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
411 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
412 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
413 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
414 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
415 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
416 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
417 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
418 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
419 2511231004 Pseudomonas sp. GM102 Isolate Nodule
420 2511231007 Pseudomonas sp. GM18 Isolate Nodule
421 2511231008 Pseudomonas sp. GM21 Isolate Nodule
422 2511231012 Pseudomonas sp. GM33 Isolate Nodule
423 2511231015 Pseudomonas sp. GM49 Isolate Nodule
424 2511231016 Pseudomonas sp. GM50 Isolate Nodule
425 2511231017 Pseudomonas sp. GM55 Isolate Nodule
426 2511231018 Pseudomonas sp. GM60 Isolate Nodule
427 2511231019 Pseudomonas sp. GM67 Isolate Nodule
428 2511231020 Pseudomonas sp. GM74 Isolate Nodule
429 2511231021 Pseudomonas sp. GM78 Isolate Nodule
430 2511231022 Pseudomonas sp. GM79 Isolate Nodule
431 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
432 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
433 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
434 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
435 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
436 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
437 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
438 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
439 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
440 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
441 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
442 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
443 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
444 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
445 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
446 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
447 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
448 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
449 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
450 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
451 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
452 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
453 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
454 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
455 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
456 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
457 2516143018 Ensifer sp. BR816 Isolate Nodule
458 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
459 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
460 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
461 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
462 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
463 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
464 2519899620 Rhizobium sp. Pop5 Isolate Nodule
465 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
466 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
467 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
468 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
469 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
470 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
471 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
472 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
473 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
474 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
475 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
476 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
477 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
478 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
479 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
480 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
481 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
482 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
483 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
484 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
485 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
486 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
487 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
488 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
489 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
490 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
491 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
492 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
493 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
494 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
495 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
496 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
497 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
498 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
499 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
500 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
501 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
502 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
503 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
504 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
505 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
506 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
507 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
508 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
509 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
510 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
511 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
512 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
513 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
514 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
515 2643221557 Ensifer sp. Root558 Isolate Unclassified
516 2643221558 Rhizobium sp. Root149 Isolate Unclassified
517 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
518 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
519 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
520 2643221599 Rhizobium sp. Root708 Isolate Unclassified
521 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
522 2643221607 Rhizobium sp. Root73 Isolate Unclassified
523 2643221610 Ensifer sp. Root74 Isolate Unclassified
524 2643221618 Ensifer sp. Root231 Isolate Unclassified
525 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
526 2643221626 Ensifer sp. Root31 Isolate Unclassified
527 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
528 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
529 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
530 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
531 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
532 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
533 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
534 2643221655 Ensifer sp. Root1252 Isolate Unclassified
535 2643221659 Ensifer sp. Root127 Isolate Unclassified
536 2643221668 Ensifer sp. Root423 Isolate Unclassified
537 2643221675 Ensifer sp. Root1298 Isolate Unclassified
538 2643221680 Ensifer sp. Root1312 Isolate Unclassified
539 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
540 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
541 2643221698 Ensifer sp. Root142 Isolate Unclassified
542 2643221712 Ensifer sp. Root258 Isolate Unclassified
543 2643221718 Rhizobium sp. Root268 Isolate Unclassified
544 2643221719 Rhizobium sp. Root274 Isolate Unclassified
545 2643221723 Ensifer sp. Root278 Isolate Unclassified
546 2643221726 Ensifer sp. Root954 Isolate Unclassified
547 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
548 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
549 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
550 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
551 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
552 2718217882 Rhizobium sp. N741 Isolate Nodule
553 2718217927 Rhizobium sp. N324 Isolate Nodule
554 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
555 2718218009 Rhizobium sp. N561 Isolate Nodule
556 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
557 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
558 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
559 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
560 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
561 2718218363 Rhizobium sp. N113 Isolate Nodule
562 2718218365 Rhizobium sp. N731 Isolate Nodule
563 2718218366 Rhizobium sp. N621 Isolate Nodule
564 2718218423 Rhizobium sp. N941 Isolate Nodule
565 2721755514 Rhizobium sp. N6212 Isolate Nodule
566 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
567 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
568 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
569 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
570 2721755809 Rhizobium sp. N541 Isolate Nodule
571 2721755810 Rhizobium sp. N871 Isolate Nodule
572 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
573 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
574 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
575 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
576 2728369365 Rhizobium sp. N1341 Isolate Nodule
577 2728369397 Rhizobium sp. N1314 Isolate Nodule
578 2738541293 Rhizobium sp. GV031 Isolate Unclassified
579 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
580 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
581 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
582 2738543024 Aminobacter sp. AP02 Isolate Unclassified
583 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
584 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
585 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
586 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
587 2773857670 Pseudomonas sp. 478 Isolate Unclassified
588 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
589 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
590 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
591 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
592 2784132072 Pseudomonas sp. 460 Isolate Unclassified
593 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
594 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
595 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
596 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
597 2791355256 Rhizobium sp. M10 Isolate Nodule
598 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
599 2791355260 Rhizobium sp. L9 Isolate Nodule
600 2791355261 Rhizobium sp. J15 Isolate Nodule
601 2791355262 Rhizobium sp. M1 Isolate Nodule
602 2791355263 Rhizobium chutanense C5 Isolate Nodule
603 2791355264 Rhizobium sp. S9 Isolate Nodule
604 2791355265 Rhizobium sp. H4 Isolate Nodule
605 2791355266 Rhizobium sp. L43 Isolate Nodule
606 2791355267 Rhizobium sp. L18 Isolate Nodule
607 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
608 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
609 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
610 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
611 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
612 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
613 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
614 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
615 2802429633 Rhizobium anhuiense J3 Isolate Nodule
616 2802429634 Rhizobium anhuiense S10 Isolate Nodule
617 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
618 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
619 2802429637 Rhizobium anhuiense C15 Isolate Nodule
620 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
621 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
622 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
623 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
624 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
625 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
626 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
627 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
628 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
629 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
630 2838048938 Rhizobium pisi 27/80 Isolate Nodule
631 2838061910 Rhizobium phaseoli L15 Isolate Nodule
632 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
633 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
634 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
635 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
636 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
637 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
638 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
639 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
640 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
641 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
642 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
643 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
644 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
645 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
646 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
647 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
648 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
649 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
650 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
651 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
652 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
653 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
654 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
655 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
656 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
657 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
658 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
659 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
660 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
661 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
662 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
663 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
664 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
665 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
666 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
667 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
668 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
669 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
670 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
671 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
672 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
673 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
674 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
675 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
676 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
677 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
678 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
679 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
680 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
681 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
682 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
683 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
684 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
685 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
686 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
687 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
688 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
689 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
690 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
691 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
692 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
693 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
694 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
695 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
696 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
697 2844163670 Ensifer sp. 1H6 Isolate Unclassified
698 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
699 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
700 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
701 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
702 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
703 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
704 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
705 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
706 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
707 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
708 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
709 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
710 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
711 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
712 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
713 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
714 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
715 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
716 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
717 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
718 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
719 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
720 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
721 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
722 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
723 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
724 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
725 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
726 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
727 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
728 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
729 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
730 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
731 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
732 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
733 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
734 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
735 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
736 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
737 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
738 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
739 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
740 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
741 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
742 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
743 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
744 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
745 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
746 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
747 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
748 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
749 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
750 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
751 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
752 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
753 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
754 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
755 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
756 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
757 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
758 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
759 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
760 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
761 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
762 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
763 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
764 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
765 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
766 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
767 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
768 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
769 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
770 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
771 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
772 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
773 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
774 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
775 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
776 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
777 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
778 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
779 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
780 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
781 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
782 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
783 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
784 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
785 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
786 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
787 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
788 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
789 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
790 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
791 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
792 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
793 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
794 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
795 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
796 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
797 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
798 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
799 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
800 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
801 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
802 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
803 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
804 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
805 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
806 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
807 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
808 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
809 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
810 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
811 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
812 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
813 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
814 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
815 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
816 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
817 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
818 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
819 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
820 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
821 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
822 2933599457 Rhizobium phaseoli M3 Isolate Nodule
823 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
824 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
825 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
826 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
827 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
828 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
829 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
830 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
831 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
832 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
833 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
834 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
835 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
836 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
837 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
838 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
839 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
840 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
841 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
842 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
843 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
844 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
845 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
846 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
847 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
848 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
849 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
850 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
851 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
852 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
853 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
854 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
855 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
856 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
857 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
858 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
859 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
860 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
861 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
862 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
863 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
864 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
865 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
866 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
867 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
868 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
869 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
870 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
871 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
872 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
873 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
874 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
875 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
876 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
877 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
878 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
879 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
880 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
881 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
882 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
883 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
884 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
885 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
886 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
887 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
888 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
889 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
890 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
891 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
892 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
893 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
894 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
895 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
896 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
897 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
898 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
899 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
900 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
901 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
902 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
903 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
904 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
905 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
906 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
907 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
908 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
909 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
910 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
911 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
912 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
913 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
914 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
915 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
916 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
917 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
918 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
919 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
920 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
921 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
922 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
923 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
924 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
925 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
926 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
927 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
928 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
929 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
930 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
931 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
932 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
933 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
934 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
935 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
936 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
937 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
938 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
939 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
940 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
941 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
942 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
943 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
944 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
945 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
946 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
947 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
948 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
949 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
950 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
951 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
952 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
953 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
954 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
955 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
956 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
957 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
958 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
959 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
960 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
961 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
962 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
963 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
964 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
965 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
966 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
967 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
968 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
969 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
970 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
971 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
972 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
973 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
974 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
975 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
976 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
977 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
978 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
979 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
980 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
981 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
982 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
983 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
984 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
985 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
986 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
987 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
988 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
989 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
990 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
991 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
992 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
993 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
994 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
995 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
996 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
997 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
998 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
999 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
1000 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
1001 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
1002 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
1003 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
1004 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
1005 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
1006 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
1007 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
1008 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
1009 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
1010 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
1011 2996887358 Rhizobium sp. R711 Isolate Nodule
1012 2996893221 Rhizobium sp. R635 Isolate Nodule
1013 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
1014 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
1015 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
1016 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
1017 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
1018 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
1019 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
1020 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
1021 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
1022 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
1023 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
1024 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
1025 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1026 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1027 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1028 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1029 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1030 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
1031 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1032 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1033 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1034 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1035 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1036 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1037 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1038 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1039 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1040 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1041 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1042 8005258706 Rhizobium sp. R693 Isolate Nodule
1043 8005275841 Rhizobium sp. N4311 Isolate Nodule
1044 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1045 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1046 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1047 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1048 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1049 8005321885 Rhizobium sp. R72 Isolate Nodule
1050 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1051 8005382845 Rhizobium sp. R634 Isolate Nodule
1052 8005395548 Rhizobium sp. R339 Isolate Nodule
1053 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1054 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1055 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1056 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1057 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1058 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1059 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1060 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1061 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1062 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1063 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1064 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1065 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1066 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1067 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1068 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1069 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1070 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1071 8018176218 Rhizobium sp. N122 Isolate Nodule
1072 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1073 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1074 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1075 8024501048 Rhizobium sp. H4 Isolate Nodule
1076 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1077 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1078 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1079 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
1080 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
1081 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
1082 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1083 8056382006 Rhizobium croatiense 13T Isolate Nodule
1084 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1085 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.5
Metatranscriptomes 0.53
Isolates 44.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.05
Nodule 34.85
Rhizoplane 1.84
Rhizosphere 41.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451845_0113644 3300041501 Bacteria 1978
2 MRS2a_Contig_8 2124908027 Bacteria 21551
3 JGI24739J22299_10005537 3300001989 Bacteria 4786
4 JGI24737J22298_10017746 3300001990 Bacteria 2290
5 JGI25155J39150_1000001 3300002704 Bacteria 354543
6 JGI25156J39149_1000001 3300002705 Bacteria 354557
7 JGI25156J39149_1002982 3300002705 Bacteria 5748
8 JGI25162J39368_1000820 3300002737 Bacteria 20523
9 JGI25162J39368_1000825 3300002737 Bacteria 20436
10 JGI25154J39366_1000122 3300002738 Bacteria 61892
11 JGI25158J39367_1000618 3300002739 Bacteria 7057
12 JGI25157J39369_1000044 3300002741 Bacteria 122466
13 JGI25157J39369_1000502 3300002741 Bacteria 24104
14 JGI25152J39213_1000982 3300002773 Bacteria 13855
15 JGI25152J39213_1002493 3300002773 Bacteria 6961
16 JGI25152J39213_1008204 3300002773 Bacteria 2613
17 JGI25152J39213_1011790 3300002773 Bacteria 1913
18 JGI25152J39213_1011791 3300002773 Bacteria 1913
19 JGI25152J39213_1012871 3300002773 Bacteria 1770
20 JGI25150J39212_1000074 3300002774 Bacteria 60735
21 JGI25150J39212_1009995 3300002774 Bacteria 1784
22 JGI25159J45721_1000014 3300002987 Bacteria 147809
23 JGI25159J45721_1000411 3300002987 Bacteria 19832
24 JGI25159J45721_1001975 3300002987 Bacteria 8175
25 JGI25151J46595_10000414 3300003187 Bacteria 43361
26 JGI25151J46595_10000486 3300003187 Bacteria 37582
27 JGI25151J46595_10000492 3300003187 Bacteria 37383
28 JGI25151J46595_10001750 3300003187 Bacteria 14073
29 JGI25151J46595_10037412 3300003187 Bacteria 1820
30 JGI25165J46597_1000042 3300003214 Bacteria 271606
31 JGI25165J46597_1000910 3300003214 Bacteria 20508
32 JGI25165J46597_1000918 3300003214 Bacteria 20436
33 JGI25165J46597_1005484 3300003214 Bacteria 2433
34 JGI25153J46596_10000267 3300003215 Bacteria 41505
35 JGI25153J46596_10001781 3300003215 Bacteria 12771
36 JGI25153J46596_10004821 3300003215 Bacteria 7184
37 JGI25153J46596_10018960 3300003215 Bacteria 2651
38 JGI25153J46596_10019018 3300003215 Bacteria 2643
39 JGI25153J46596_10028908 3300003215 Bacteria 1913
40 JGI25153J46596_10028909 3300003215 Bacteria 1913
41 rootL2_10019237 3300003322 Bacteria 6551
42 JGI25160J50197_1000001 3300003354 Bacteria 782301
43 JGI25160J50197_1000020 3300003354 Bacteria 232739
44 JGI25160J50197_1000695 3300003354 Bacteria 18566
45 JGI25161J50226_1000001 3300003374 Bacteria 655036
46 JGI25161J50226_1002351 3300003374 Bacteria 4889
47 JGI25161J50226_1007818 3300003374 Bacteria 1724
48 Ga0006562J51391_1008995 3300003578 Bacteria 5162
49 Ga0055542_1002255 3300003762 Bacteria 6748
50 Ga0055526_1001939 3300003771 Bacteria 14317
51 Ga0055526_1002938 3300003771 Bacteria 11169
52 Ga0055526_1008798 3300003771 Bacteria 4966
53 Ga0055524_1001901 3300003775 Bacteria 11334
54 Ga0055524_1001996 3300003775 Bacteria 10898
55 Ga0055524_1002315 3300003775 Bacteria 9918
56 Ga0055524_1003206 3300003775 Bacteria 8023
57 Ga0055536_1006005 3300003781 Bacteria 5774
58 Ga0055536_1013507 3300003781 Bacteria 2939
59 Ga0055528_1000234 3300003790 Bacteria 46499
60 Ga0055528_1006404 3300003790 Bacteria 5343
61 Ga0055528_1015121 3300003790 Bacteria 2805
62 Ga0055530_10004406 3300003791 Bacteria 7257
63 Ga0055530_10018837 3300003791 Bacteria 2113
64 Ga0055540_1000350 3300003792 Bacteria 39199
65 Ga0055540_1004660 3300003792 Bacteria 6079
66 Ga0055531_10004879 3300003794 Bacteria 7993
67 Ga0055543_1000003 3300004625 Bacteria 358656
68 Ga0055543_1000047 3300004625 Bacteria 111073
69 Ga0055543_1000352 3300004625 Bacteria 31251
70 Ga0065165_1000013 3300005262 Bacteria 301887
71 Ga0065165_1000068 3300005262 Bacteria 170609
72 Ga0065714_10000178 3300005288 Bacteria 8386
73 Ga0065714_10070084 3300005288 Bacteria 3968
74 Ga0065714_10097657 3300005288 Bacteria 1718
75 Ga0065712_10007353 3300005290 Bacteria 7474
76 Ga0070690_100114774 3300005330 Bacteria 1801
77 Ga0070670_100000515 3300005331 Bacteria 30924
78 Ga0070670_100020194 3300005331 Bacteria 5724
79 Ga0070666_10008907 3300005335 Bacteria 6242
80 Ga0070666_10049139 3300005335 Bacteria 2834
81 Ga0070680_100030422 3300005336 Bacteria 4338
82 Ga0070682_100011946 3300005337 Bacteria 4969
83 Ga0070660_100045560 3300005339 Bacteria 3358
84 Ga0070689_100012472 3300005340 Bacteria 6125
85 Ga0070691_10005271 3300005341 Bacteria 5871
86 Ga0070687_100013580 3300005343 Bacteria 3633
87 Ga0070661_100012072 3300005344 Bacteria 6037
88 Ga0070692_10020451 3300005345 Bacteria 3210
89 Ga0070669_100009547 3300005353 Bacteria 6908
90 Ga0070675_100015113 3300005354 Bacteria 6097
91 Ga0070671_100005647 3300005355 Bacteria 9956
92 Ga0070674_100007355 3300005356 Bacteria 6494
93 Ga0070659_100007540 3300005366 Bacteria 7908
94 Ga0070714_100012208 3300005435 Bacteria 6850
95 Ga0070701_10049297 3300005438 Bacteria 2177
96 Ga0070711_100015670 3300005439 Bacteria 4799
97 Ga0070711_100094587 3300005439 Bacteria 2161
98 Ga0070705_100005274 3300005440 Bacteria 6284
99 Ga0070700_100007256 3300005441 Bacteria 5973
100 Ga0070694_100015290 3300005444 Bacteria 4816
101 Ga0070678_100003791 3300005456 Bacteria 8480
102 Ga0070662_100151590 3300005457 Bacteria 1805
103 Ga0070685_10033912 3300005466 Bacteria 2872
104 Ga0070707_100011550 3300005468 Bacteria 8236
105 Ga0070697_100002756 3300005536 Bacteria 13530
106 Ga0068853_100011416 3300005539 Bacteria 7216
107 Ga0068853_100021890 3300005539 Bacteria 5332
108 Ga0070672_100003056 3300005543 Bacteria 10787
109 Ga0070695_100028667 3300005545 Bacteria 3455
110 Ga0070696_100005268 3300005546 Bacteria 8632
111 Ga0070693_100019704 3300005547 Bacteria 3543
112 Ga0070665_100041852 3300005548 Bacteria 4605
113 Ga0070704_100005481 3300005549 Bacteria 7396
114 Ga0068855_100029116 3300005563 Bacteria 6605
115 Ga0068857_100041747 3300005577 Bacteria 4067
116 Ga0068854_100003619 3300005578 Bacteria 9668
117 Ga0068856_100019906 3300005614 Bacteria 6514
118 Ga0068856_100020987 3300005614 Bacteria 6347
119 Ga0068856_100096703 3300005614 Bacteria 2942
120 Ga0068852_100049145 3300005616 Bacteria 3607
121 Ga0068852_100077599 3300005616 Bacteria 2937
122 Ga0068864_100028963 3300005618 Bacteria 4685
123 Ga0068861_100009349 3300005719 Bacteria 6765
124 Ga0068851_10001321 3300005834 Bacteria 10808
125 Ga0068863_100004189 3300005841 Bacteria 14241
126 Ga0068858_100120426 3300005842 Bacteria 2454
127 Ga0068860_100003332 3300005843 Bacteria 16537
128 Ga0068860_100042022 3300005843 Bacteria 4368
129 Ga0068862_100013963 3300005844 Bacteria 6659
130 Ga0081455_10002838 3300005937 Bacteria 20395
131 Ga0081455_10026387 3300005937 Bacteria 5344
132 Ga0081540_1014907 3300005983 Bacteria 4945
133 Ga0075365_10002873 3300006038 Bacteria 8665
134 Ga0075365_10003006 3300006038 Bacteria 8545
135 Ga0075365_10059139 3300006038 Bacteria 2553
136 Ga0075368_10017077 3300006042 Bacteria 2712
137 Ga0075363_100036209 3300006048 Bacteria 2588
138 Ga0075364_10004080 3300006051 Bacteria 8380
139 Ga0075364_10040077 3300006051 Bacteria 3038
140 Ga0075432_10003110 3300006058 Bacteria 5604
141 Ga0075432_10020613 3300006058 Bacteria 2254
142 Ga0070715_10003288 3300006163 Bacteria 5108
143 Ga0070716_100019247 3300006173 Bacteria 3565
144 Ga0070712_100007563 3300006175 Bacteria 6791
145 Ga0075362_10016486 3300006177 Bacteria 3026
146 Ga0075367_10014435 3300006178 Bacteria 4276
147 Ga0075367_10084093 3300006178 Bacteria 1929
148 Ga0075369_10001599 3300006186 Bacteria 7789
149 Ga0075369_10011824 3300006186 Bacteria 3438
150 Ga0075366_10000495 3300006195 Bacteria 18223
151 Ga0075366_10073252 3300006195 Bacteria 2041
152 Ga0097621_100031786 3300006237 Bacteria 4190
153 Ga0075370_10012570 3300006353 Bacteria 4479
154 Ga0075370_10041257 3300006353 Bacteria 2605
155 Ga0068871_100049153 3300006358 Bacteria 3408
156 Ga0068865_100003306 3300006881 Bacteria 9651
157 Ga0079104_1000242 3300006946 Bacteria 72707
158 Ga0099795_10000010 3300007788 Bacteria 79907
159 Ga0105251_10002824 3300009011 Bacteria 13136
160 Ga0105251_10040345 3300009011 Bacteria 2276
161 Ga0105240_10016883 3300009093 Bacteria 9865
162 Ga0105247_10010453 3300009101 Bacteria 5611
163 Ga0105241_10007717 3300009174 Bacteria 7909
164 Ga0105242_10016114 3300009176 Bacteria 5807
165 Ga0105242_10022649 3300009176 Bacteria 4944
166 Ga0105248_10006272 3300009177 Bacteria 13041
167 Ga0105248_10025234 3300009177 Bacteria 6608
168 Ga0105237_10003921 3300009545 Bacteria 17431
169 Ga0105237_10017438 3300009545 Bacteria 7443
170 Ga0105237_10069760 3300009545 Bacteria 3510
171 Ga0105238_10012224 3300009551 Bacteria 8656
172 Ga0105238_10060540 3300009551 Bacteria 3791
173 Ga0105238_10220850 3300009551 Bacteria 1871
174 Ga0105249_10153389 3300009553 Bacteria 2220
175 Ga0123341_1000007 3300009765 Bacteria 147072
176 Ga0123342_1018027 3300009766 Bacteria 5731
177 Ga0099796_10000136 3300010159 Bacteria 11183
178 Ga0105239_10003384 3300010375 Bacteria 19568
179 Ga0105239_10004650 3300010375 Bacteria 16317
180 Ga0105239_10017593 3300010375 Bacteria 7905
181 Ga0105239_10019613 3300010375 Bacteria 7463
182 Ga0105239_10032414 3300010375 Bacteria 5742
183 Ga0105239_10073080 3300010375 Bacteria 3770
184 Ga0105246_10005675 3300011119 Bacteria 7616
185 Ga0157373_10011394 3300013100 Bacteria 6539
186 Ga0157371_10000739 3300013102 Bacteria 38165
187 Ga0157371_10008194 3300013102 Bacteria 8355
188 Ga0157370_10001902 3300013104 Bacteria 25703
189 Ga0157370_10004750 3300013104 Bacteria 15463
190 Ga0157370_10089244 3300013104 Bacteria 2896
191 Ga0157369_10005514 3300013105 Bacteria 14695
192 Ga0171463_1003 3300013249 Bacteria 695693
193 Ga0157378_10019275 3300013297 Bacteria 5996
194 Ga0163162_10008951 3300013306 Bacteria 9732
195 Ga0163162_10045296 3300013306 Bacteria 4407
196 Ga0163162_10052732 3300013306 Bacteria 4086
197 Ga0163162_10070983 3300013306 Bacteria 3535
198 Ga0157372_10028347 3300013307 Bacteria 6110
199 Ga0157375_10012686 3300013308 Bacteria 7480
200 Ga0157375_10042944 3300013308 Bacteria 4380
201 Ga0163163_10006326 3300014325 Bacteria 10339
202 Ga0157380_10013503 3300014326 Bacteria 5957
203 Ga0182008_10005086 3300014497 Bacteria 7554
204 Ga0182008_10018167 3300014497 Bacteria 3642
205 Ga0157379_10000614 3300014968 Bacteria 28820
206 Ga0157376_10010211 3300014969 Bacteria 6856
207 Ga0182006_1011956 3300015261 Bacteria 3802
208 Ga0182005_1002408 3300015265 Bacteria 6716
209 Ga0182005_1005141 3300015265 Bacteria 4122
210 Ga0183363_1085 3300015690 Bacteria 28396
211 Ga0163161_10002366 3300017792 Bacteria 13514
212 Ga0163161_10047218 3300017792 Bacteria 3110
213 Ga0214543_1000038 3300021327 Bacteria 182106
214 Ga0228711_1010496 3300022739 Bacteria 12155
215 Ga0228710_1010751 3300022740 Bacteria 12109
216 Ga0209435_100012 3300025206 Bacteria 401621
217 Ga0209436_100147 3300025208 Bacteria 34133
218 Ga0209436_101674 3300025208 Bacteria 7361
219 Ga0209437_100051 3300025233 Bacteria 392523
220 Ga0209437_100098 3300025233 Bacteria 229766
221 Ga0207425_1000075 3300025245 Bacteria 107452
222 Ga0207425_1000998 3300025245 Bacteria 13263
223 Ga0207425_1008796 3300025245 Bacteria 2555
224 Ga0207425_1013200 3300025245 Bacteria 1915
225 Ga0209646_1000026 3300025246 Bacteria 401621
226 Ga0209026_1000014 3300025250 Bacteria 401621
227 Ga0209026_1000029 3300025250 Bacteria 337109
228 Ga0209148_1000080 3300025254 Bacteria 277806
229 Ga0209759_1000012 3300025256 Bacteria 401621
230 Ga0209759_1000393 3300025256 Bacteria 54357
231 Ga0209129_1000156 3300025258 Bacteria 107484
232 Ga0209129_1000218 3300025258 Bacteria 66076
233 Ga0209129_1000537 3300025258 Bacteria 26442
234 Ga0209129_1000876 3300025258 Bacteria 18555
235 Ga0209129_1002124 3300025258 Bacteria 10080
236 Ga0209129_1003920 3300025258 Bacteria 6179
237 Ga0209129_1006767 3300025258 Bacteria 3606
238 Ga0209233_1000028 3300025261 Bacteria 642062
239 Ga0209233_1000095 3300025261 Bacteria 303783
240 Ga0209233_1000113 3300025261 Bacteria 253455
241 Ga0209233_1000148 3300025261 Bacteria 185135
242 Ga0209455_1000219 3300025272 Bacteria 79850
243 Ga0209673_1000010 3300025273 Bacteria 596656
244 Ga0209673_1000151 3300025273 Bacteria 148103
245 Ga0209673_1003822 3300025273 Bacteria 8533
246 Ga0209673_1005914 3300025273 Bacteria 6045
247 Ga0209673_1007521 3300025273 Bacteria 4997
248 Ga0209130_1000003 3300025284 Bacteria 677988
249 Ga0209130_1000020 3300025284 Bacteria 379297
250 Ga0209130_1000034 3300025284 Bacteria 302439
251 Ga0209676_1004814 3300025292 Bacteria 7328
252 Ga0209025_1000070 3300025294 Bacteria 287776
253 Ga0209025_1000311 3300025294 Bacteria 108141
254 Ga0209025_1000571 3300025294 Bacteria 66955
255 Ga0209025_1004070 3300025294 Bacteria 13061
256 Ga0209025_1007299 3300025294 Bacteria 8291
257 Ga0209025_1013298 3300025294 Bacteria 5187
258 Ga0209564_1000013 3300025295 Bacteria 775755
259 Ga0209564_1000424 3300025295 Bacteria 74299
260 Ga0209564_1000628 3300025295 Bacteria 53862
261 Ga0209564_1006268 3300025295 Bacteria 6482
262 Ga0209758_1000094 3300025297 Bacteria 241068
263 Ga0209758_1000405 3300025297 Bacteria 73971
264 Ga0209758_1000688 3300025297 Bacteria 50116
265 Ga0209758_1001271 3300025297 Bacteria 31244
266 Ga0209758_1005305 3300025297 Bacteria 10061
267 Ga0209758_1005493 3300025297 Bacteria 9718
268 Ga0209758_1007154 3300025297 Bacteria 7700
269 Ga0209758_1021893 3300025297 Bacteria 2957
270 Ga0209050_1000734 3300025298 Bacteria 47579
271 Ga0209050_1004869 3300025298 Bacteria 8801
272 Ga0209256_1000396 3300025299 Bacteria 69216
273 Ga0209256_1000610 3300025299 Bacteria 49586
274 Ga0209256_1000717 3300025299 Bacteria 43910
275 Ga0209256_1002535 3300025299 Bacteria 14621
276 Ga0209256_1006458 3300025299 Bacteria 6191
277 Ga0209256_1014656 3300025299 Bacteria 2800
278 Ga0207426_1000006 3300025302 Bacteria 1025969
279 Ga0207426_1000008 3300025302 Bacteria 848730
280 Ga0207426_1000011 3300025302 Bacteria 791203
281 Ga0207426_1000394 3300025302 Bacteria 74327
282 Ga0207426_1000449 3300025302 Bacteria 65802
283 Ga0209051_1000097 3300025303 Bacteria 167378
284 Ga0209051_1000314 3300025303 Bacteria 74316
285 Ga0209051_1003361 3300025303 Bacteria 10534
286 Ga0209051_1004687 3300025303 Bacteria 8321
287 Ga0209051_1013035 3300025303 Bacteria 3977
288 Ga0209257_1003955 3300025304 Bacteria 12028
289 Ga0209257_1005542 3300025304 Bacteria 8796
290 Ga0209257_1013695 3300025304 Bacteria 3573
291 Ga0207656_10022624 3300025321 Bacteria 2524
292 Ga0207713_1013193 3300025735 Bacteria 4371
293 Ga0207692_10074899 3300025898 Bacteria 1794
294 Ga0207688_10001376 3300025901 Bacteria 12614
295 Ga0207680_10102772 3300025903 Bacteria 1839
296 Ga0207647_10019753 3300025904 Bacteria 4526
297 Ga0207705_10138321 3300025909 Bacteria 1817
298 Ga0207707_10132729 3300025912 Bacteria 2178
299 Ga0207695_10000011 3300025913 Bacteria 910221
300 Ga0207671_10000093 3300025914 Bacteria 138939
301 Ga0207671_10000368 3300025914 Bacteria 64246
302 Ga0207671_10038443 3300025914 Bacteria 3547
303 Ga0207693_10002301 3300025915 Bacteria 16603
304 Ga0207663_10009025 3300025916 Bacteria 5250
305 Ga0207660_10160025 3300025917 Bacteria 1736
306 Ga0207662_10049198 3300025918 Bacteria 2500
307 Ga0207657_10007895 3300025919 Bacteria 10855
308 Ga0207657_10052655 3300025919 Bacteria 3531
309 Ga0207649_10015138 3300025920 Bacteria 4331
310 Ga0207646_10089301 3300025922 Bacteria 2758
311 Ga0207681_10087988 3300025923 Bacteria 2211
312 Ga0207694_10004759 3300025924 Bacteria 10554
313 Ga0207694_10067356 3300025924 Bacteria 2795
314 Ga0207694_10078324 3300025924 Bacteria 2591
315 Ga0207664_10095947 3300025929 Bacteria 2440
316 Ga0207644_10058013 3300025931 Bacteria 2796
317 Ga0207706_10012422 3300025933 Bacteria 7760
318 Ga0207686_10092424 3300025934 Bacteria 2000
319 Ga0207670_10045589 3300025936 Bacteria 2907
320 Ga0207669_10031201 3300025937 Bacteria 2974
321 Ga0207669_10118274 3300025937 Bacteria 1793
322 Ga0207665_10001960 3300025939 Bacteria 13847
323 Ga0207691_10024433 3300025940 Bacteria 5683
324 Ga0207711_10001501 3300025941 Bacteria 21749
325 Ga0207711_10036489 3300025941 Bacteria 4171
326 Ga0207711_10103334 3300025941 Bacteria 2523
327 Ga0207661_10087494 3300025944 Bacteria 2588
328 Ga0207667_10055846 3300025949 Bacteria 4149
329 Ga0207667_10115399 3300025949 Bacteria 2768
330 Ga0207651_10042193 3300025960 Bacteria 3034
331 Ga0207640_10012098 3300025981 Bacteria 4905
332 Ga0207640_10044313 3300025981 Bacteria 2849
333 Ga0207639_10035928 3300026041 Bacteria 3669
334 Ga0207678_10004056 3300026067 Bacteria 13177
335 Ga0207708_10001961 3300026075 Bacteria 15177
336 Ga0207702_10017612 3300026078 Bacteria 5911
337 Ga0207702_10049352 3300026078 Bacteria 3552
338 Ga0207676_10066610 3300026095 Bacteria 2873
339 Ga0207674_10032592 3300026116 Bacteria 5464
340 Ga0207675_100004575 3300026118 Bacteria 13343
341 Ga0207683_10002193 3300026121 Bacteria 17161
342 Ga0207698_10009822 3300026142 Bacteria 6116
343 Ga0207698_10037134 3300026142 Bacteria 3585
344 Ga0209281_1000245 3300027111 Bacteria 109870
345 Ga0209281_1000246 3300027111 Bacteria 107513
346 Ga0209281_1001017 3300027111 Bacteria 21872
347 Ga0209371_1001202 3300027312 Bacteria 18718
348 Ga0209179_1000084 3300027512 Bacteria 14130
349 Ga0209282_1001720 3300027666 Bacteria 12231
350 Ga0207428_10065001 3300027907 Bacteria 2879
351 Ga0207428_10087261 3300027907 Bacteria 2428
352 Ga0207428_10122631 3300027907 Bacteria 1992
353 Ga0268266_10000243 3300028379 Bacteria 92211
354 Ga0268266_10020347 3300028379 Bacteria 5657
355 Ga0268266_10040347 3300028379 Bacteria 3979
356 Ga0268265_10124897 3300028380 Bacteria 2127
357 Ga0268264_10106630 3300028381 Bacteria 2446
358 Ga0265318_10009183 3300028577 Bacteria 4361
359 Ga0307515_10009778 3300028794 Bacteria 18481
360 Ga0307515_10081852 3300028794 Bacteria 4186
361 Ga0268256_1001146 3300030500 Bacteria 17130
362 Ga0307511_10104344 3300030521 Bacteria 1841
363 Ga0265330_10005159 3300031235 Bacteria 6535
364 Ga0265330_10006952 3300031235 Bacteria 5557
365 Ga0265325_10054678 3300031241 Bacteria 2043
366 Ga0265340_10016071 3300031247 Bacteria 3880
367 Ga0265340_10017004 3300031247 Bacteria 3762
368 Ga0265340_10037343 3300031247 Bacteria 2407
369 Ga0265339_10004751 3300031249 Bacteria 9209
370 Ga0265339_10007741 3300031249 Bacteria 6907
371 Ga0265339_10019396 3300031249 Bacteria 3993
372 Ga0265316_10046564 3300031344 Bacteria 3435
373 Ga0307408_100037701 3300031548 Bacteria 3406
374 Ga0307408_100054666 3300031548 Bacteria 2887
375 Ga0265313_10000254 3300031595 Bacteria 58277
376 Ga0265342_10013481 3300031712 Bacteria 5479
377 Ga0307412_10002336 3300031911 Bacteria 10508
378 Ga0315914_1000015 3300031967 Bacteria 128727
379 Ga0315913_1008719 3300033430 Bacteria 11987
380 Ga0315915_1000020 3300033464 Bacteria 128727
381 Ga0373931_0040938 3300035691 Bacteria 2433
382 Ga0373947_0042715 3300035725 Bacteria 2706
383 Ga0373925_0060590 3300037068 Bacteria 2842
384 Ga0395900_0044165 3300037418 Bacteria 4593
385 Ga0395898_0048459 3300037466 Bacteria 4166
386 Ga0395905_0015713 3300037471 Bacteria 7191
387 Ga0395905_0100091 3300037471 Bacteria 2722
388 Ga0395901_0119547 3300038443 Bacteria 2769
389 Ga0439438_008088 3300041405 Bacteria 3530
390 Ga0439438_009424 3300041405 Bacteria 3160
391 Ga0439438_014592 3300041405 Bacteria 2335
392 Ga0439447_000016 3300041407 Bacteria 61120
393 Ga0439447_002713 3300041407 Bacteria 6398
394 Ga0439447_007552 3300041407 Bacteria 3438
395 Ga0439466_0000324 3300041411 Bacteria 18343
396 Ga0439466_0001368 3300041411 Bacteria 9477
397 Ga0439466_0002830 3300041411 Bacteria 6792
398 Ga0439466_0020071 3300041411 Bacteria 2386
399 Ga0439465_0002021 3300041413 Bacteria 6659
400 Ga0451835_1208747 3300041492 Bacteria 2163
401 Ga0451839_0382298 3300041496 Bacteria 6212
402 Ga0451841_0042953 3300041498 Bacteria 1679
403 Ga0451841_1320517 3300041498 Bacteria 1961
404 Ga0451845_0186460 3300041501 Bacteria 1751
405 Ga0451847_0054416 3300041503 Bacteria 2676
406 Ga0451847_0826475 3300041503 Bacteria 1751
407 Ga0451851_0094881 3300041507 Bacteria 3622
408 Ga0451853_1413502 3300041512 Bacteria 1990
409 Ga0439451_001654 3300042009 Bacteria 4427
410 Ga0439451_005187 3300042009 Bacteria 2649
411 Ga0439452_000046 3300042010 Bacteria 130842
412 Ga0439452_001433 3300042010 Bacteria 9767
413 Ga0439456_005154 3300042013 Bacteria 2652
414 Ga0439463_004915 3300042016 Bacteria 3334
415 Ga0450911_000927 3300042115 Bacteria 7735
416 Ga0450911_001620 3300042115 Bacteria 5024
417 Ga0450911_005324 3300042115 Bacteria 2013
418 Ga0450919_001004 3300042121 Bacteria 3649
419 Ga0450890_000666 3300042127 Bacteria 5008
420 Ga0450902_001530 3300042137 Bacteria 3165
421 Ga0450903_000582 3300042138 Bacteria 7507
422 Ga0450903_005885 3300042138 Bacteria 2047
423 Ga0450906_008209 3300042145 Bacteria 2029
424 Ga0450907_000003 3300042146 Bacteria 138102
425 Ga0450907_005269 3300042146 Bacteria 2187
426 Ga0450907_009138 3300042146 Bacteria 1643
427 Ga0439446_0005478 3300042156 Bacteria 3267
428 Ga0450909_000170 3300042185 Bacteria 7133
429 Ga0439434_0000019 3300042435 Bacteria 41172
430 Ga0439460_0001401 3300042461 Bacteria 5684
431 Ga0439460_0002987 3300042461 Bacteria 4083
432 Ga0439460_0004399 3300042461 Bacteria 3433
433 Ga0450918_012595 3300042531 Bacteria 1474
434 Ga0439440_0000508 3300042993 Bacteria 6530
435 Ga0439440_0001836 3300042993 Bacteria 3934
436 Ga0466963_0008573 3300044694 Bacteria 6137
437 Ga0466970_0005025 3300044765 Bacteria 6538
438 Ga0451576_0020802 3300045051 Bacteria 7142
439 Ga0451576_0054356 3300045051 Bacteria 4193
440 Ga0466958_0061189 3300045836 Bacteria 2293
441 Ga0495617_000282 3300046452 Bacteria 29411
442 Ga0495617_000613 3300046452 Bacteria 17917
443 Ga0495617_003117 3300046452 Bacteria 6315
444 Ga0495627_003377 3300046453 Bacteria 7078
445 Ga0495592_0027656 3300046454 Bacteria 4297
446 Ga0495603_0000535 3300046455 Bacteria 21117
447 Ga0495603_0000748 3300046455 Bacteria 18565
448 Ga0495603_0002140 3300046455 Bacteria 11624
449 Ga0495590_0000040 3300046457 Bacteria 122610
450 Ga0495590_0004520 3300046457 Bacteria 5606
451 Ga0495590_0022360 3300046457 Bacteria 2236
452 Ga0495591_000143 3300046458 Bacteria 76321
453 Ga0495591_004844 3300046458 Bacteria 6415
454 Ga0495591_024002 3300046458 Bacteria 1941
455 Ga0495629_0001118 3300046459 Bacteria 21234
456 Ga0495638_0000381 3300046460 Bacteria 55116
457 Ga0495638_0000906 3300046460 Bacteria 30294
458 Ga0495638_0001340 3300046460 Bacteria 22591
459 Ga0495638_0001770 3300046460 Bacteria 18918
460 Ga0495638_0002038 3300046460 Bacteria 17193
461 Ga0495638_0002734 3300046460 Bacteria 14175
462 Ga0495638_0009961 3300046460 Bacteria 6627
463 Ga0495638_0010217 3300046460 Bacteria 6533
464 Ga0495638_0017109 3300046460 Bacteria 4842
465 Ga0495638_0020752 3300046460 Bacteria 4337
466 Ga0495638_0045531 3300046460 Bacteria 2759
467 Ga0495641_0023519 3300046461 Bacteria 3058
468 Ga0495653_0004630 3300046463 Bacteria 11122
469 Ga0495650_0001536 3300046471 Bacteria 21887
470 Ga0495650_0001586 3300046471 Bacteria 21331
471 Ga0495650_0003945 3300046471 Bacteria 10454
472 Ga0495650_0005145 3300046471 Bacteria 8629
473 Ga0495650_0011776 3300046471 Bacteria 4755
474 Ga0495580_0000341 3300046472 Bacteria 38098
475 Ga0495582_0000352 3300046473 Bacteria 25196
476 Ga0495605_0000321 3300046474 Bacteria 49788
477 Ga0495605_0000751 3300046474 Bacteria 23782
478 Ga0495605_0001173 3300046474 Bacteria 17399
479 Ga0495605_0003344 3300046474 Bacteria 9590
480 Ga0495605_0006620 3300046474 Bacteria 6636
481 Ga0495605_0024592 3300046474 Bacteria 3150
482 Ga0495605_0036781 3300046474 Bacteria 2466
483 Ga0495639_0020283 3300046475 Bacteria 2904
484 Ga0495662_0006372 3300046476 Bacteria 5897
485 Ga0495584_0000019 3300046491 Bacteria 140608
486 Ga0495584_0000086 3300046491 Bacteria 64500
487 Ga0495584_0001430 3300046491 Bacteria 14368
488 Ga0495584_0007740 3300046491 Bacteria 5591
489 Ga0495584_0009593 3300046491 Bacteria 4985
490 Ga0495584_0017886 3300046491 Bacteria 3605
491 Ga0495584_0018691 3300046491 Bacteria 3523
492 Ga0495585_0000012 3300046492 Bacteria 203064
493 Ga0495585_0004015 3300046492 Bacteria 9688
494 Ga0495585_0005603 3300046492 Bacteria 7889
495 Ga0495585_0019679 3300046492 Bacteria 3889
496 Ga0495585_0021999 3300046492 Bacteria 3660
497 Ga0495585_0037158 3300046492 Bacteria 2743
498 Ga0495585_0060342 3300046492 Bacteria 2087
499 Ga0495594_0000049 3300046499 Bacteria 52677
500 Ga0495594_0017998 3300046499 Bacteria 3740
501 Ga0495596_0000050 3300046500 Bacteria 87493
502 Ga0495607_0000637 3300046501 Bacteria 34042
503 Ga0495607_0001207 3300046501 Bacteria 23350
504 Ga0495607_0001848 3300046501 Bacteria 18001
505 Ga0495607_0002549 3300046501 Bacteria 14730
506 Ga0495607_0005774 3300046501 Bacteria 8800
507 Ga0495607_0006918 3300046501 Bacteria 7908
508 Ga0495607_0011407 3300046501 Bacteria 5916
509 Ga0495607_0013112 3300046501 Bacteria 5442
510 Ga0495607_0041449 3300046501 Bacteria 2735
511 Ga0495607_0075597 3300046501 Bacteria 1866
512 Ga0495583_0000112 3300046506 Bacteria 138078
513 Ga0495583_0008546 3300046506 Bacteria 6243
514 Ga0495583_0014562 3300046506 Bacteria 4332
515 Ga0495606_0001735 3300046507 Bacteria 28008
516 Ga0495606_0002826 3300046507 Bacteria 19280
517 Ga0495606_0011380 3300046507 Bacteria 7261
518 Ga0495610_0002479 3300046512 Bacteria 15472
519 Ga0495610_0004038 3300046512 Bacteria 11046
520 Ga0495610_0005663 3300046512 Bacteria 8809
521 Ga0495610_0015078 3300046512 Bacteria 4508
522 Ga0495610_0018217 3300046512 Bacteria 3974
523 Ga0495610_0021223 3300046512 Bacteria 3577
524 Ga0495610_0024738 3300046512 Bacteria 3235
525 Ga0495610_0026778 3300046512 Bacteria 3074
526 Ga0495610_0033738 3300046512 Bacteria 2642
527 Ga0495610_0059039 3300046512 Bacteria 1832
528 Ga0495616_0000245 3300046513 Bacteria 44179
529 Ga0495616_0004681 3300046513 Bacteria 8582
530 Ga0495620_0001456 3300046515 Bacteria 14164
531 Ga0495620_0016359 3300046515 Bacteria 3723
532 Ga0495620_0022288 3300046515 Bacteria 3054
533 Ga0495620_0034597 3300046515 Bacteria 2280
534 Ga0495628_0102500 3300046516 Bacteria 2208
535 Ga0495630_0032806 3300046517 Bacteria 3871
536 Ga0495631_0000336 3300046518 Bacteria 32317
537 Ga0495631_0004032 3300046518 Bacteria 7903
538 Ga0495631_0006054 3300046518 Bacteria 6284
539 Ga0495631_0010474 3300046518 Bacteria 4584
540 Ga0495632_0000058 3300046519 Bacteria 122648
541 Ga0495632_0001123 3300046519 Bacteria 22908
542 Ga0495632_0001410 3300046519 Bacteria 20086
543 Ga0495632_0002362 3300046519 Bacteria 14436
544 Ga0495632_0006229 3300046519 Bacteria 7716
545 Ga0495632_0015651 3300046519 Bacteria 4241
546 Ga0495632_0024011 3300046519 Bacteria 3246
547 Ga0495632_0042224 3300046519 Bacteria 2287
548 Ga0495637_0000138 3300046520 Bacteria 55120
549 Ga0495637_0000493 3300046520 Bacteria 28658
550 Ga0495637_0002855 3300046520 Bacteria 9372
551 Ga0495637_0004378 3300046520 Bacteria 7325
552 Ga0495637_0005273 3300046520 Bacteria 6613
553 Ga0495637_0008173 3300046520 Bacteria 5150
554 Ga0495643_0004441 3300046522 Bacteria 9803
555 Ga0495643_0004788 3300046522 Bacteria 9337
556 Ga0495643_0023767 3300046522 Bacteria 3481
557 Ga0495643_0035887 3300046522 Bacteria 2727
558 Ga0495643_0050148 3300046522 Bacteria 2248
559 Ga0495644_0000031 3300046523 Bacteria 65825
560 Ga0495644_0000217 3300046523 Bacteria 27038
561 Ga0495644_0008000 3300046523 Bacteria 4067
562 Ga0495648_0000884 3300046524 Bacteria 31492
563 Ga0495648_0001115 3300046524 Bacteria 27217
564 Ga0495648_0010455 3300046524 Bacteria 7066
565 Ga0495648_0011307 3300046524 Bacteria 6735
566 Ga0495648_0017141 3300046524 Bacteria 5190
567 Ga0495648_0018407 3300046524 Bacteria 4944
568 Ga0495648_0021253 3300046524 Bacteria 4500
569 Ga0495648_0038438 3300046524 Bacteria 3060
570 Ga0495642_0000003 3300046528 Bacteria 185425
571 Ga0495642_0000165 3300046528 Bacteria 38677
572 Ga0495642_0001529 3300046528 Bacteria 10268
573 Ga0495642_0009734 3300046528 Bacteria 3680
574 Ga0495654_0000253 3300046530 Bacteria 48877
575 Ga0495654_0000914 3300046530 Bacteria 21930
576 Ga0495654_0001303 3300046530 Bacteria 17456
577 Ga0495654_0005849 3300046530 Bacteria 7080
578 Ga0495654_0007176 3300046530 Bacteria 6257
579 Ga0495654_0008468 3300046530 Bacteria 5678
580 Ga0495587_0001215 3300046536 Bacteria 17044
581 Ga0495587_0054141 3300046536 Bacteria 2365
582 Ga0495609_0001638 3300046538 Bacteria 14592
583 Ga0495597_0002798 3300046542 Bacteria 10721
584 Ga0495597_0008762 3300046542 Bacteria 5053
585 Ga0495597_0023593 3300046542 Bacteria 2845
586 Ga0495597_0029327 3300046542 Bacteria 2512
587 Ga0495597_0035028 3300046542 Bacteria 2266
588 Ga0495622_0000202 3300046557 Bacteria 47328
589 Ga0495622_0029491 3300046557 Bacteria 2563
590 Ga0495633_0002527 3300046558 Bacteria 12859
591 Ga0495633_0008736 3300046558 Bacteria 5677
592 Ga0495633_0019226 3300046558 Bacteria 3455
593 Ga0495633_0064863 3300046558 Bacteria 1707
594 Ga0495656_0004408 3300046615 Bacteria 4819
595 Ga0495656_0011380 3300046615 Bacteria 3264
596 Ga0495668_0000424 3300046616 Bacteria 55046
597 Ga0495668_0014377 3300046616 Bacteria 4641
598 Ga0495611_0002162 3300046648 Bacteria 9168
599 Ga0495611_0002456 3300046648 Bacteria 8461
600 Ga0495625_0002559 3300046660 Bacteria 19540
601 Ga0495625_0010569 3300046660 Bacteria 7622
602 Ga0495625_0017394 3300046660 Bacteria 5629
603 Ga0495625_0062508 3300046660 Bacteria 2631
604 Ga0495635_0000051 3300046663 Bacteria 74756
605 Ga0495635_0034264 3300046663 Bacteria 3522
606 Ga0495659_0000978 3300046664 Bacteria 10026
607 Ga0495661_0003829 3300046665 Bacteria 11004
608 Ga0495661_0004366 3300046665 Bacteria 10230
609 Ga0495661_0061313 3300046665 Bacteria 2233
610 Ga0495588_0001960 3300046674 Bacteria 8786
611 Ga0495588_0043879 3300046674 Bacteria 2288
612 Ga0495623_0002213 3300046679 Bacteria 12943
613 Ga0495646_0054737 3300046680 Bacteria 2398
614 Ga0495658_0010216 3300046683 Bacteria 4693
615 Ga0495658_0020699 3300046683 Bacteria 3457
616 Ga0495669_0000263 3300046684 Bacteria 30264
617 Ga0495613_0000244 3300046689 Bacteria 51563
618 Ga0495613_0002488 3300046689 Bacteria 13905
619 Ga0495670_0000103 3300046691 Bacteria 37384
620 Ga0495670_0000179 3300046691 Bacteria 28233
621 Ga0495670_0000800 3300046691 Bacteria 15118
622 Ga0495670_0002654 3300046691 Bacteria 8828
623 Ga0495670_0005587 3300046691 Bacteria 6169
624 Ga0495670_0039326 3300046691 Bacteria 2359
625 Ga0495670_0042063 3300046691 Bacteria 2280
626 Ga0495671_0000138 3300046692 Bacteria 64535
627 Ga0495671_0009774 3300046692 Bacteria 5343
628 Ga0495671_0042961 3300046692 Bacteria 2269
629 Ga0495671_0043244 3300046692 Bacteria 2261
630 Ga0495649_0000086 3300046694 Bacteria 80528
631 Ga0495649_0002906 3300046694 Bacteria 11857
632 Ga0495649_0005630 3300046694 Bacteria 7918
633 Ga0495649_0012799 3300046694 Bacteria 4864
634 Ga0495649_0018182 3300046694 Bacteria 3959
635 Ga0495649_0024184 3300046694 Bacteria 3388
636 Ga0495649_0033518 3300046694 Bacteria 2826
637 Ga0495649_0038179 3300046694 Bacteria 2636
638 Ga0495589_0000242 3300046794 Bacteria 45548
639 Ga0495589_0000583 3300046794 Bacteria 25061
640 Ga0495589_0000636 3300046794 Bacteria 23067
641 Ga0495589_0010820 3300046794 Bacteria 4742
642 Ga0495660_0003894 3300046810 Bacteria 9126
643 Ga0495660_0007879 3300046810 Bacteria 6255
644 Ga0495660_0025753 3300046810 Bacteria 3338
645 Ga0495660_0063720 3300046810 Bacteria 1972
646 Ga0495660_0069107 3300046810 Bacteria 1877
647 Ga0495581_0041653 3300047315 Bacteria 2658
648 Ga0495604_0005589 3300047317 Bacteria 9972
649 Ga0495604_0077209 3300047317 Bacteria 2503
650 Ga0495636_0001197 3300047318 Bacteria 9805
651 Ga0495672_0001126 3300047320 Bacteria 27097
652 Ga0495672_0002647 3300047320 Bacteria 16162
653 Ga0495672_0010412 3300047320 Bacteria 6627
654 Ga0495672_0010744 3300047320 Bacteria 6498
655 Ga0495672_0013220 3300047320 Bacteria 5704
656 Ga0495672_0013711 3300047320 Bacteria 5577
657 Ga0495672_0016563 3300047320 Bacteria 4961
658 Ga0495672_0018174 3300047320 Bacteria 4678
659 Ga0495672_0035830 3300047320 Bacteria 3053
660 Ga0495676_0048039 3300047321 Bacteria 3445
661 Ga0495680_0005209 3300047322 Bacteria 12270
662 Ga0495683_0000010 3300047323 Bacteria 223494
663 Ga0495683_0000116 3300047323 Bacteria 80411
664 Ga0495683_0001491 3300047323 Bacteria 15259
665 Ga0495683_0003259 3300047323 Bacteria 9484
666 Ga0495683_0009520 3300047323 Bacteria 5174
667 Ga0495687_000906 3300047443 Bacteria 30980
668 Ga0495687_001073 3300047443 Bacteria 26922
669 Ga0495687_004002 3300047443 Bacteria 10250
670 Ga0495677_0000047 3300047445 Bacteria 72197
671 Ga0495677_0045986 3300047445 Bacteria 1602
672 Ga0495679_001421 3300047446 Bacteria 13632
673 Ga0495679_002923 3300047446 Bacteria 8457
674 Ga0495673_0000242 3300047469 Bacteria 77375
675 Ga0495673_0000426 3300047469 Bacteria 47785
676 Ga0495673_0001672 3300047469 Bacteria 17072
677 Ga0495673_0002390 3300047469 Bacteria 13262
678 Ga0495673_0003183 3300047469 Bacteria 10969
679 Ga0495673_0003934 3300047469 Bacteria 9523
680 Ga0495673_0004107 3300047469 Bacteria 9243
681 Ga0495673_0004513 3300047469 Bacteria 8692
682 Ga0495673_0006926 3300047469 Bacteria 6599
683 Ga0495673_0043970 3300047469 Bacteria 1995
684 Ga0495681_0000232 3300047470 Bacteria 46130
685 Ga0495681_0001247 3300047470 Bacteria 19314
686 Ga0495681_0001288 3300047470 Bacteria 18982
687 Ga0495681_0002295 3300047470 Bacteria 13750
688 Ga0495681_0002859 3300047470 Bacteria 12196
689 Ga0495681_0002891 3300047470 Bacteria 12140
690 Ga0495681_0007890 3300047470 Bacteria 6731
691 Ga0495681_0008830 3300047470 Bacteria 6268
692 Ga0495681_0010168 3300047470 Bacteria 5718
693 Ga0495686_0000556 3300047472 Bacteria 53309
694 Ga0495686_0004878 3300047472 Bacteria 10819
695 Ga0495686_0034494 3300047472 Bacteria 3258
696 Ga0495593_0000689 3300047673 Bacteria 19483
697 Ga0495614_0012692 3300048089 Bacteria 3695
698 Ga0495626_0000169 3300048091 Bacteria 80674
699 Ga0495626_0000198 3300048091 Bacteria 72611
700 Ga0495626_0000280 3300048091 Bacteria 56131
701 Ga0495626_0000490 3300048091 Bacteria 39851
702 Ga0495626_0000531 3300048091 Bacteria 37903
703 Ga0495626_0004711 3300048091 Bacteria 8261
704 Ga0495626_0016966 3300048091 Bacteria 3687
705 Ga0496100_0013432 3300048903 Bacteria 4723
706 Ga0496100_0016235 3300048903 Bacteria 4367
707 Ga0496101_0010862 3300048904 Bacteria 6024
708 Ga0496101_0029268 3300048904 Bacteria 3852
709 Ga0496102_0000311 3300048905 Bacteria 61342
710 Ga0496102_0028920 3300048905 Bacteria 4954
711 Ga0496102_0081648 3300048905 Bacteria 2980
712 Ga0496103_0000272 3300048906 Bacteria 49098
713 Ga0496103_0006550 3300048906 Bacteria 6947
714 Ga0496103_0015984 3300048906 Bacteria 4476
715 Ga0496104_0041950 3300048907 Bacteria 4291
716 Ga0496104_0053531 3300048907 Bacteria 3813
717 Ga0496106_0008423 3300048909 Bacteria 7628
718 Ga0496107_0026927 3300048910 Bacteria 4080
719 Ga0496108_0008919 3300048911 Bacteria 8127
720 Ga0496110_0000849 3300048913 Bacteria 21520
721 Ga0496110_0071251 3300048913 Bacteria 3081
722 Ga0496114_0007712 3300048917 Bacteria 8513
723 Ga0496114_0032268 3300048917 Bacteria 4309
724 Ga0496115_0011303 3300048918 Bacteria 6689
725 Ga0496115_0072476 3300048918 Bacteria 2795
726 Ga0496116_0008936 3300048919 Bacteria 8615
727 Ga0496116_0010642 3300048919 Bacteria 7691
728 Ga0496116_0022739 3300048919 Bacteria 4689
729 Ga0496117_0001668 3300048920 Bacteria 31030
730 Ga0496117_0004903 3300048920 Bacteria 14402
731 Ga0496118_0003066 3300048921 Bacteria 21440
732 Ga0496118_0008151 3300048921 Bacteria 10908
733 Ga0496119_0000827 3300048922 Bacteria 41250
734 Ga0496119_0012196 3300048922 Bacteria 7011
735 Ga0496119_0022910 3300048922 Bacteria 4450
736 Ga0496120_0004176 3300048923 Bacteria 12372
737 Ga0496121_0003720 3300048924 Bacteria 21393
738 Ga0496121_0029231 3300048924 Bacteria 5104
739 Ga0496121_0033927 3300048924 Bacteria 4605
740 Ga0496121_0060083 3300048924 Bacteria 3129
741 Ga0496122_0014648 3300048925 Bacteria 7564
742 Ga0496122_0034472 3300048925 Bacteria 4141
743 Ga0496122_0034972 3300048925 Bacteria 4100
744 Ga0496122_0048178 3300048925 Bacteria 3280
745 Ga0496123_0000939 3300048926 Bacteria 45487
746 Ga0496123_0012163 3300048926 Bacteria 7368
747 Ga0496123_0026574 3300048926 Bacteria 4331
748 Ga0496124_0002136 3300048927 Bacteria 26565
749 Ga0496124_0010601 3300048927 Bacteria 9315
750 Ga0496124_0021253 3300048927 Bacteria 5983
751 Ga0496124_0048981 3300048927 Bacteria 3606
752 Ga0496125_0005054 3300048928 Bacteria 14879
753 Ga0496125_0010334 3300048928 Bacteria 9443
754 Ga0496125_0012178 3300048928 Bacteria 8558
755 Ga0496125_0026977 3300048928 Bacteria 5215
756 Ga0496125_0055987 3300048928 Bacteria 3207
757 Ga0496125_0083577 3300048928 Bacteria 2428
758 Ga0496125_0111623 3300048928 Bacteria 1978
759 Ga0496126_0071855 3300048929 Bacteria 3079
760 Ga0496126_0101407 3300048929 Bacteria 2518
761 Ga0496126_0106164 3300048929 Bacteria 2451
762 Ga0495678_000437 3300049459 Bacteria 41568
763 Ga0495678_002064 3300049459 Bacteria 14343
764 Ga0495678_004456 3300049459 Bacteria 8090
765 Ga0495678_008281 3300049459 Bacteria 5265
766 Ga0495678_015098 3300049459 Bacteria 3566
767 Ga0495678_039968 3300049459 Bacteria 1889
768 Ga0495678_048383 3300049459 Bacteria 1658
769 Ga0495682_0008128 3300049460 Bacteria 4143
770 Ga0495682_0030769 3300049460 Bacteria 1985
771 Ga0501032_0002101 3300049569 Bacteria 15708
772 Ga0501032_0020760 3300049569 Bacteria 4572
773 Ga0501033_0000327 3300049570 Bacteria 45361
774 Ga0501033_0009034 3300049570 Bacteria 7688
775 Ga0501034_0000208 3300049571 Bacteria 111739
776 Ga0501034_0076113 3300049571 Bacteria 3363
777 Ga0501036_0014937 3300049572 Bacteria 6478
778 Ga0501037_0023072 3300049573 Bacteria 4602
779 Ga0501038_0030852 3300049574 Bacteria 4739
780 Ga0501039_0000839 3300049575 Bacteria 22221
781 Ga0501043_0029573 3300049579 Bacteria 4305
782 Ga0501043_0032305 3300049579 Bacteria 4115
783 Ga0501046_0003824 3300049580 Bacteria 13779
784 Ga0501046_0009327 3300049580 Bacteria 8490
785 Ga0501047_0000923 3300049581 Bacteria 30084
786 Ga0501047_0066306 3300049581 Bacteria 3480
787 Ga0501047_0111476 3300049581 Bacteria 2618
788 Ga0501067_0004068 3300049583 Bacteria 8068
789 Ga0501070_0023774 3300049586 Bacteria 5136
790 Ga0501073_0035506 3300049589 Bacteria 3543
791 Ga0501080_0000024 3300049742 Bacteria 90341
792 Ga0501080_0157961 3300049742 Bacteria 2094
793 Ga0501083_0077637 3300049744 Bacteria 2203
794 Ga0501035_0000049 3300049822 Bacteria 145684
795 Ga0501035_0001644 3300049822 Bacteria 22585
796 Ga0501035_0031082 3300049822 Bacteria 4863
797 Ga0501044_0000030 3300049823 Bacteria 173442
798 Ga0501044_0093684 3300049823 Bacteria 3028
799 Ga0501044_0134163 3300049823 Bacteria 2468
800 nmdc:mga03683_28520_c1 3300050489 Bacteria 2220
801 nmdc:mga00v17_10952_c1 3300050491 Bacteria 4969
802 nmdc:mga0yw44_1373_c1 3300050492 Bacteria 9654
803 nmdc:mga0yw44_2786_c1 3300050492 Bacteria 7570
804 nmdc:mga0k408_1579_c1 3300050493 Bacteria 12312
805 nmdc:mga07m45_3549_c1 3300050496 Bacteria 7537
806 nmdc:mga05p37_167858_c1 3300050507 Bacteria 2678
807 nmdc:mga08y16_45860_c1 3300050511 Bacteria 4579
808 nmdc:mga0sz30_3249_c1 3300050516 Bacteria 5842
809 nmdc:mga0sz30_6030_c1 3300050516 Bacteria 4478
810 Ga0495601_0094337 3300053077 Bacteria 1928
811 Ga0495619_0014727 3300053085 Bacteria 4940
812 Ga0500556_0000124 3300053104 Bacteria 67080
813 Ga0500607_034281 3300053121 Bacteria 2780
814 Ga0500618_006947 3300053125 Bacteria 3272
815 Ga0500658_0004365 3300053134 Bacteria 5297
816 Ga0500559_0004411 3300053136 Bacteria 6688
817 Ga0500568_0000202 3300053139 Bacteria 52432
818 Ga0500568_0004466 3300053139 Bacteria 7471
819 Ga0500573_0005115 3300053140 Bacteria 6989
820 Ga0500590_032528 3300053148 Bacteria 2705
821 Ga0500616_0000102 3300053153 Bacteria 168834
822 Ga0500616_0001640 3300053153 Bacteria 20715
823 Ga0500616_0008317 3300053153 Bacteria 6459
824 Ga0500616_0031210 3300053153 Bacteria 2920
825 Ga0500636_0000003 3300053177 Bacteria 240189
826 Ga0500636_0106785 3300053177 Bacteria 1586
827 Ga0500645_015879 3300053730 Bacteria 2380
828 Ga0587070_003216 3300059491 Bacteria 1943
829 Ga0587080_005301 3300059503 Bacteria 1723
830 Ga0587083_0006042 3300059505 Bacteria 1783
831 Ga0587067_003438 3300059640 Bacteria 1978
832 Ga0587072_005216 3300059643 Bacteria 1933
833 Ga0587107_001798 3300059652 Bacteria 1816
834 Ga0587071_006920 3300060344 Bacteria 1790
835 Ga0501082_0034426 3300060353 Bacteria 4367
836 Ga0501082_0077661 3300060353 Bacteria 2863
837 Ga0501082_0109750 3300060353 Bacteria 2388
838 2503199906 2503198000 Bacteria 6884444
839 2509108363 2508501122 Bacteria 6292184
840 2509114620 2508501123 Bacteria 6283661
841 2509369620 2509276018 Bacteria 6910194
842 2509376504 2509276019 Bacteria 6802256
843 2509445613 2509276033 Bacteria 7180565
844 2509447086 2509276033 Bacteria 7180565
845 2510133989 2510065019 Bacteria 6903379
846 2510306487 2510065057 Bacteria 6649661
847 2510318577 2510065059 Bacteria 6847884
848 2510841243 2510461069 Bacteria 5505000
849 2510895408 2510461076 Bacteria 8618824
850 2511134001 2510917022 Bacteria 6504556
851 2511172761 2510917026 Bacteria 7046020
852 2511187087 2510917028 Bacteria 6185411
853 2511199062 2510917030 Bacteria 7460662
854 2511257460 2511231004 Bacteria 6669789
855 2511274083 2511231007 Bacteria 6306603
856 2511276592 2511231008 Bacteria 6624100
857 2511305005 2511231012 Bacteria 6738011
858 2511322539 2511231015 Bacteria 6598026
859 2511327816 2511231016 Bacteria 6704427
860 2511331165 2511231017 Bacteria 6503007
861 2511340612 2511231018 Bacteria 6436256
862 2511344624 2511231019 Bacteria 6520662
863 2511349949 2511231020 Bacteria 6115223
864 2511358754 2511231021 Bacteria 7302637
865 2511362455 2511231022 Bacteria 6719296
866 2511390297 2511231027 Bacteria 5013807
867 2511502277 2511231052 Bacteria 6974333
868 2512932619 2512875016 Bacteria 6529530
869 2512970649 2512875026 Bacteria 6861065
870 2513567937 2513237084 Bacteria 7231967
871 2513576978 2513237085 Bacteria 7695351
872 2513584351 2513237086 Bacteria 7265287
873 2513596508 2513237088 Bacteria 6927906
874 2513601711 2513237089 Bacteria 6553624
875 2513608738 2513237090 Bacteria 7096802
876 2513618837 2513237091 Bacteria 6900273
877 2513633352 2513237093 Bacteria 7545552
878 2513707631 2513237103 Bacteria 7647401
879 2513865632 2513237138 Bacteria 7368160
880 2513884371 2513237140 Bacteria 7076289
881 2513905044 2513237143 Bacteria 6664116
882 2513908962 2513237144 Bacteria 7530820
883 2513925352 2513237146 Bacteria 7166346
884 2513984136 2513237156 Bacteria 6402557
885 2514001468 2513237159 Bacteria 6810126
886 2514002846 2513237160 Bacteria 6650282
887 2514019973 2513237162 Bacteria 7468464
888 2514422826 2513237305 Bacteria 7293571
889 2515113036 2515075009 Bacteria 7288508
890 2515655321 2515154116 Bacteria 7552979
891 2515739518 2515154134 Bacteria 7220242
892 2516204178 2516143018 Bacteria 6951533
893 2516893656 2516653046 Bacteria 6989037
894 2517036738 2516653077 Bacteria 7555578
895 2517077099 2516653085 Bacteria 7346596
896 2517095865 2517093000 Bacteria 7412387
897 2517407436 2517287029 Bacteria 6905599
898 2517570380 2517487022 Bacteria 7227575
899 2520380496 2519899620 Bacteria 6499161
900 2524459623 2524023209 Bacteria 6679728
901 2530645918 2529292951 Bacteria 6916614
902 2535516899 2534681796 Bacteria 7146037
903 2551678488 2551306084 Bacteria 8942552
904 2551689784 2551306085 Bacteria 7347181
905 2551694378 2551306086 Bacteria 6843938
906 2551701995 2551306087 Bacteria 7351905
907 2551715265 2551306089 Bacteria 7162724
908 2551723286 2551306090 Bacteria 7953713
909 2551723701 2551306090 Bacteria 7953713
910 2551730482 2551306091 Bacteria 7086830
911 2551733006 2551306092 Bacteria 6992595
912 2551743396 2551306093 Bacteria 7064773
913 2558864428 2558860100 Bacteria 8458965
914 2561468341 2558860983 Bacteria 4133860
915 2585166387 2582581283 Bacteria 6030556
916 2585202236 2582581294 Bacteria 6626667
917 2585222865 2582581298 Bacteria 7315509
918 2585231776 2582581299 Bacteria 6518058
919 2585255122 2582581304 Bacteria 5831370
920 2585267388 2582581306 Bacteria 6450535
921 2585271170 2582581307 Bacteria 6597605
922 2585277515 2582581308 Bacteria 7413247
923 2585323301 2582581315 Bacteria 7318924
924 2585331442 2582581316 Bacteria 7774528
925 2585386456 2582581865 Bacteria 6644329
926 2585393289 2582581866 Bacteria 6859583
927 2585402365 2582581867 Bacteria 7184437
928 2585527480 2585427526 Bacteria 7258840
929 2585535142 2585427527 Bacteria 7273426
930 2585538218 2585427528 Bacteria 6842387
931 2585545448 2585427529 Bacteria 7395659
932 2585555992 2585427530 Bacteria 7383882
933 2585558894 2585427531 Bacteria 6992870
934 2585822948 2585427590 Bacteria 6824633
935 2585836167 2585427593 Bacteria 7141551
936 2585843263 2585427594 Bacteria 6180594
937 2585898275 2585427608 Bacteria 6544331
938 2585904136 2585427609 Bacteria 6667127
939 2587980747 2585428125 Bacteria 6662905
940 2588518698 2588253730 Bacteria 6881675
941 2599331782 2599185156 Bacteria 5403036
942 2599417268 2599185170 Bacteria 7295545
943 2599936485 2599185301 Bacteria 6161860
944 2600195482 2599185352 Bacteria 7228948
945 2616293328 2615840624 Bacteria 6557588
946 2616308990 2615840626 Bacteria 7921970
947 2616554261 2615840698 Bacteria 7319877
948 2617383601 2617270742 Bacteria 6808054
949 2643776641 2643221551 Bacteria 3750538
950 2643795089 2643221555 Bacteria 3749717
951 2643803049 2643221557 Bacteria 7184309
952 2643811500 2643221558 Bacteria 5460675
953 2643845852 2643221565 Bacteria 6216018
954 2643953779 2643221589 Bacteria 6250934
955 2643987409 2643221595 Bacteria 6565519
956 2644003136 2643221599 Bacteria 6292121
957 2644021713 2643221602 Bacteria 6249926
958 2644050480 2643221607 Bacteria 6314006
959 2644063411 2643221610 Bacteria 7480339
960 2644107243 2643221618 Bacteria 7717186
961 2644133313 2643221623 Bacteria 5239945
962 2644150809 2643221626 Bacteria 8069654
963 2644158071 2643221627 Bacteria 6761570
964 2644189436 2643221633 Bacteria 6733554
965 2644193546 2643221634 Bacteria 6705461
966 2644205708 2643221636 Bacteria 6583769
967 2644208995 2643221637 Bacteria 5345260
968 2644238644 2643221643 Bacteria 5749658
969 2644298706 2643221653 Bacteria 4569637
970 2644308638 2643221655 Bacteria 7722067
971 2644335456 2643221659 Bacteria 7890716
972 2644374694 2643221668 Bacteria 7306521
973 2644414174 2643221675 Bacteria 7473456
974 2644447702 2643221680 Bacteria 7473610
975 2644483398 2643221686 Bacteria 6310811
976 2644499609 2643221689 Bacteria 6042950
977 2644539861 2643221698 Bacteria 7756764
978 2644614579 2643221712 Bacteria 7729434
979 2644652525 2643221718 Bacteria 5345506
980 2644656935 2643221719 Bacteria 4568197
981 2644676042 2643221723 Bacteria 7095460
982 2644690175 2643221726 Bacteria 7455827
983 2671111398 2667528174 Bacteria 6435400
984 2688597161 2687453392 Bacteria 6880454
985 2692315508 2690316117 Bacteria 6800650
986 2694628773 2693429783 Bacteria 7019804
987 2694637313 2693429784 Bacteria 7241525
988 2719181839 2718217882 Bacteria 6556348
989 2719386445 2718217927 Bacteria 6972593
990 2719666191 2718217997 Bacteria 6740740
991 2719732503 2718218009 Bacteria 6478651
992 2720492611 2718218199 Bacteria 6740745
993 2720614045 2718218232 Bacteria 6720332
994 2720620852 2718218233 Bacteria 6662049
995 2720632177 2718218235 Bacteria 6630699
996 2720775905 2718218269 Bacteria 6906114
997 2721147930 2718218363 Bacteria 6524337
998 2721159381 2718218365 Bacteria 6274507
999 2721164766 2718218366 Bacteria 6425255
1000 2721400149 2718218423 Bacteria 6438183
1001 2722840936 2721755514 Bacteria 6424414
1002 2723027507 2721755556 Bacteria 6745503
1003 2723561128 2721755684 Bacteria 6859907
1004 2723567724 2721755685 Bacteria 6704835
1005 2723574356 2721755686 Bacteria 7343952
1006 2724038962 2721755809 Bacteria 6438790
1007 2724045259 2721755810 Bacteria 6479005
1008 2724090512 2721755819 Bacteria 6906405
1009 2724104989 2721755822 Bacteria 6726041
1010 2724110846 2721755823 Bacteria 6752556
1011 2730108443 2728369352 Bacteria 6745171
1012 2730165074 2728369365 Bacteria 6555560
1013 2730299013 2728369397 Bacteria 6274511
1014 2738800121 2738541293 Bacteria 7065685
1015 2739032874 2738541333 Bacteria 7106503
1016 2739199948 2738543004 Bacteria 6381073
1017 2739260176 2738543015 Bacteria 6750701
1018 2739307565 2738543024 Bacteria 5603683
1019 2753462060 2751185821 Bacteria 6189929
1020 2765466380 2765235802 Bacteria 5618596
1021 2766065905 2765235942 Bacteria 7445910
1022 2770199010 2767802442 Bacteria 5747986
1023 2774118719 2773857670 Bacteria 6407454
1024 2776270278 2775506902 Bacteria 6208009
1025 2776284992 2775506904 Bacteria 5954060
1026 2776913976 2775507049 Bacteria 6284736
1027 2778175448 2775507266 Bacteria 7392367
1028 2784312356 2784132072 Bacteria 6596533
1029 2792620738 2791355091 Bacteria 6135441
1030 2792626097 2791355092 Bacteria 6248105
1031 2792639034 2791355094 Bacteria 7011481
1032 2792748058 2791355123 Bacteria 8049106
1033 2793294404 2791355256 Bacteria 6798008
1034 2793314511 2791355259 Bacteria 7254731
1035 2793320338 2791355260 Bacteria 6598818
1036 2793331703 2791355261 Bacteria 6661293
1037 2793334523 2791355262 Bacteria 6774204
1038 2793339243 2791355263 Bacteria 6872478
1039 2793348913 2791355264 Bacteria 6429314
1040 2793351799 2791355265 Bacteria 6539969
1041 2793362547 2791355266 Bacteria 7116587
1042 2793368840 2791355267 Bacteria 7222458
1043 2802717003 2802428858 Bacteria 6636079
1044 2802725752 2802428859 Bacteria 6667919
1045 2802730159 2802428860 Bacteria 6525526
1046 2802737870 2802428861 Bacteria 6534206
1047 2802742676 2802428862 Bacteria 6633353
1048 2802750164 2802428863 Bacteria 6410669
1049 2805928768 2802429605 Bacteria 6875453
1050 2805935050 2802429606 Bacteria 6346811
1051 2806043854 2802429633 Bacteria 7341974
1052 2806050215 2802429634 Bacteria 7083200
1053 2806057031 2802429635 Bacteria 7650140
1054 2806064412 2802429636 Bacteria 7597525
1055 2806071679 2802429637 Bacteria 7067217
1056 2808933205 2808606377 Bacteria 6646337
1057 2808955288 2808606381 Bacteria 6646461
1058 2808961782 2808606382 Bacteria 6841132
1059 2819241369 2818991272 Bacteria 4622173
1060 2819609180 2818991448 Bacteria 6772224
1061 2819637591 2818991453 Bacteria 7181617
1062 2838017619 2838016132 Bacteria 6577831
1063 2838027581 2838022645 Bacteria 6494267
1064 2838029773 2838029111 Bacteria 6603031
1065 2838038533 2838035591 Bacteria 7166484
1066 2838054335 2838048938 Bacteria 6044578
1067 2838067702 2838061910 Bacteria 6794874
1068 2838070109 2838068647 Bacteria 6208656
1069 2838076825 2838074704 Bacteria 6785777
1070 2838661556 2838661181 Bacteria 7385261
1071 2838670394 2838668709 Bacteria 6671819
1072 2838683431 2838680041 Bacteria 6545511
1073 2838687018 2838686498 Bacteria 7807632
1074 2838697626 2838694306 Bacteria 6853137
1075 2838702765 2838701080 Bacteria 6669771
1076 2838710742 2838707686 Bacteria 6619912
1077 2838730009 2838729681 Bacteria 7400765
1078 2838742976 2838742623 Bacteria 7396178
1079 2839998272 2839993093 Bacteria 5512535
1080 2840769108 2840764183 Bacteria 6358399
1081 2841852462 2841851746 Bacteria 7532261
1082 2841870816 2841864319 Bacteria 6742987
1083 2842078915 2842077413 Bacteria 6508645
1084 2842113232 2842110456 Bacteria 7656360
1085 2842118575 2842118031 Bacteria 7033875
1086 2842147977 2842146304 Bacteria 5957337
1087 2842158079 2842156927 Bacteria 6894975
1088 2842168758 2842163707 Bacteria 6916235
1089 2842181698 2842180545 Bacteria 6888678
1090 2842197391 2842192696 Bacteria 6147454
1091 2842203591 2842198810 Bacteria 6608673
1092 2842205447 2842205361 Bacteria 6340321
1093 2842217970 2842217011 Bacteria 7497767
1094 2842230251 2842229732 Bacteria 7475766
1095 2842240487 2842237096 Bacteria 6620661
1096 2842244154 2842243621 Bacteria 7421798
1097 2842253043 2842250916 Bacteria 6579627
1098 2842257760 2842257432 Bacteria 7401195
1099 2842266300 2842264693 Bacteria 6472963
1100 2842271444 2842271015 Bacteria 7807131
1101 2842278904 2842278818 Bacteria 6340002
1102 2842285566 2842285085 Bacteria 6011953
1103 2842292577 2842291075 Bacteria 7076806
1104 2842301405 2842298080 Bacteria 6123127
1105 2842305073 2842304105 Bacteria 7023636
1106 2842316976 2842311132 Bacteria 6616990
1107 2842320743 2842317721 Bacteria 6793725
1108 2842346492 2842341865 Bacteria 7003929
1109 2842357942 2842357229 Bacteria 6485165
1110 2842368925 2842363717 Bacteria 6844742
1111 2842374062 2842370503 Bacteria 7038661
1112 2842378975 2842377471 Bacteria 7140707
1113 2842385086 2842384541 Bacteria 7057858
1114 2842402926 2842402390 Bacteria 6681310
1115 2842409702 2842409023 Bacteria 6687331
1116 2842416353 2842415677 Bacteria 6596907
1117 2842423723 2842422224 Bacteria 6239196
1118 2842430763 2842428310 Bacteria 6767288
1119 2842437250 2842434925 Bacteria 6502746
1120 2842443620 2842441272 Bacteria 6769273
1121 2842453874 2842447887 Bacteria 6754142
1122 2842464906 2842462802 Bacteria 6588055
1123 2842471868 2842469257 Bacteria 6752936
1124 2842476942 2842475841 Bacteria 6603183
1125 2842484528 2842482326 Bacteria 7212537
1126 2842492011 2842489311 Bacteria 6620893
1127 2842496793 2842495871 Bacteria 6820686
1128 2842503301 2842502639 Bacteria 6604161
1129 2842511096 2842509118 Bacteria 6850950
1130 2842521850 2842521101 Bacteria 6569494
1131 2842872266 2842871566 Bacteria 4827117
1132 2842924188 2842922631 Bacteria 5824079
1133 2844164612 2844163670 Bacteria 7266046
1134 2844458385 2844454524 Bacteria 7952546
1135 2847419430 2847417321 Bacteria 6913799
1136 2847674961 2847670302 Bacteria 6165597
1137 2847691048 2847686936 Bacteria 6278406
1138 2848994458 2848992105 Bacteria 6810864
1139 2850081501 2850079185 Bacteria 6848280
1140 2852390259 2852387548 Bacteria 8025568
1141 2855826378 2855825444 Bacteria 6785811
1142 2855841767 2855839649 Bacteria 7135830
1143 2855872488 2855872281 Bacteria 6964271
1144 2856320679 2856314179 Bacteria 6477897
1145 2856334781 2856328259 Bacteria 6528202
1146 2856336552 2856334872 Bacteria 7037011
1147 2856355585 2856349417 Bacteria 6230045
1148 2856362093 2856356410 Bacteria 6297484
1149 2857351897 2857349434 Bacteria 7926032
1150 2857368856 2857367948 Bacteria 6965560
1151 2857517396 2857516855 Bacteria 7787325
1152 2858802552 2858800743 Bacteria 6603254
1153 2869253179 2869249662 Bacteria 6868783
1154 2869267591 2869264136 Bacteria 6880765
1155 2869277603 2869271264 Bacteria 6908218
1156 2871450064 2871444079 Bacteria 6423508
1157 2871455731 2871451962 Bacteria 7336357
1158 2871493300 2871488783 Bacteria 6929816
1159 2871499112 2871495908 Bacteria 6935695
1160 2874108645 2874102143 Bacteria 6342645
1161 2874133698 2874131515 Bacteria 6820270
1162 2874168041 2874162495 Bacteria 6174670
1163 2876365128 2876363079 Bacteria 6544991
1164 2876375678 2876369609 Bacteria 6807521
1165 2876383147 2876377896 Bacteria 6565995
1166 2876402775 2876399893 Bacteria 6927900
1167 2876412030 2876406927 Bacteria 6191900
1168 2878036018 2878035449 Bacteria 6555736
1169 2878757345 2878753008 Bacteria 6922523
1170 2878763311 2878760144 Bacteria 6823465
1171 2878770299 2878767105 Bacteria 6898628
1172 2878787690 2878781027 Bacteria 6834456
1173 2881149842 2881147464 Bacteria 7779814
1174 2881160987 2881155292 Bacteria 6461656
1175 2881166721 2881161766 Bacteria 7127907
1176 2881849423 2881845957 Bacteria 6611900
1177 2881859179 2881853255 Bacteria 6698367
1178 2881868972 2881861095 Bacteria 7128710
1179 2882632478 2882632389 Bacteria 8154593
1180 2882919253 2882912400 Bacteria 6801539
1181 2885325832 2885318864 Bacteria 6729568
1182 2885350595 2885342637 Bacteria 7011821
1183 2888338240 2888337043 Bacteria 6629336
1184 2894655606 2894652903 Bacteria 4587256
1185 2894819238 2894817345 Bacteria 4892941
1186 2899807229 2899803654 Bacteria 5577784
1187 2903501072 2903492973 Bacteria 13473544
1188 2903522137 2903521522 Bacteria 6525694
1189 2903528515 2903528002 Bacteria 6586099
1190 2903543914 2903540706 Bacteria 7062119
1191 2904553690 2904550169 Bacteria 6221258
1192 2904582232 2904578770 Bacteria 5302906
1193 2906330759 2906328253 Bacteria 6585166
1194 2906364507 2906363423 Bacteria 6856682
1195 2906373553 2906370794 Bacteria 6881062
1196 2906395742 2906393657 Bacteria 6790866
1197 2906411162 2906408224 Bacteria 6162342
1198 2906419872 2906414383 Bacteria 6580790
1199 2915982979 2915980308 Bacteria 6624279
1200 2915990298 2915986958 Bacteria 6739310
1201 2916000825 2915993759 Bacteria 7016183
1202 2916003449 2916000859 Bacteria 6865702
1203 2916008082 2916007675 Bacteria 6898660
1204 2916019577 2916014648 Bacteria 6946486
1205 2916022165 2916021584 Bacteria 6854472
1206 2916034224 2916028427 Bacteria 6748433
1207 2916037903 2916035215 Bacteria 6755766
1208 2916045297 2916041962 Bacteria 6820487
1209 2916049079 2916048683 Bacteria 6543552
1210 2916055683 2916055098 Bacteria 6758838
1211 2916062281 2916061851 Bacteria 6737736
1212 2916075028 2916068649 Bacteria 6943657
1213 2916082291 2916076590 Bacteria 6596108
1214 2917557349 2917554339 Bacteria 4987857
1215 2919107623 2919100787 Bacteria 7710546
1216 2919122987 2919119836 Bacteria 5208557
1217 2919174676 2919171160 Bacteria 6499771
1218 2919410012 2919408235 Bacteria 6149349
1219 2919453043 2919450847 Bacteria 5631160
1220 2919461217 2919456309 Bacteria 6586567
1221 2920761484 2920760137 Bacteria 7427611
1222 2920825255 2920822456 Bacteria 6897201
1223 2921208500 2921201388 Bacteria 6926299
1224 2921240893 2921237296 Bacteria 6876710
1225 2921246737 2921244191 Bacteria 6568419
1226 2921253826 2921250672 Bacteria 6677771
1227 2921263076 2921257292 Bacteria 6808382
1228 2921266246 2921263974 Bacteria 6864552
1229 2921289159 2921282425 Bacteria 6826397
1230 2921296276 2921289301 Bacteria 7316391
1231 2922157193 2922151315 Bacteria 6902399
1232 2922160913 2922158528 Bacteria 6573167
1233 2922172820 2922172374 Bacteria 6167644
1234 2922180261 2922178524 Bacteria 6025201
1235 2923558606 2923556063 Bacteria 6793593
1236 2924146717 2924144063 Bacteria 6883928
1237 2924157955 2924150972 Bacteria 7169444
1238 2924159311 2924158325 Bacteria 7188855
1239 2924170521 2924165586 Bacteria 7260590
1240 2924174532 2924172951 Bacteria 6749356
1241 2924182963 2924179722 Bacteria 6843264
1242 2924187491 2924186466 Bacteria 6876637
1243 2924195421 2924193448 Bacteria 6955718
1244 2924203288 2924200457 Bacteria 6757188
1245 2924210707 2924207177 Bacteria 6917007
1246 2924215668 2924214083 Bacteria 7080103
1247 2924223257 2924221636 Bacteria 7113495
1248 2924230557 2924228884 Bacteria 6633132
1249 2924730925 2924726620 Bacteria 6271473
1250 2924737959 2924733363 Bacteria 7574837
1251 2924753438 2924748358 Bacteria 6154725
1252 2924786651 2924784321 Bacteria 7416538
1253 2928524192 2928521798 Bacteria 4960112
1254 2931402934 2931396565 Bacteria 7251677
1255 2933022195 2933016740 Bacteria 6355406
1256 2933570881 2933570622 Bacteria 7023390
1257 2933588712 2933586486 Bacteria 7667493
1258 2933600915 2933599457 Bacteria 5858799
1259 2935896988 2935894831 Bacteria 6620579
1260 2935901922 2935901341 Bacteria 7341747
1261 2936372001 2936367885 Bacteria 7324495
1262 2937004522 2937002841 Bacteria 6934057
1263 2937011235 2937009748 Bacteria 6746052
1264 2937019787 2937016420 Bacteria 6782579
1265 2937024622 2937023124 Bacteria 6815156
1266 2937031104 2937029754 Bacteria 6424026
1267 2937037026 2937036028 Bacteria 6846469
1268 2937047980 2937042894 Bacteria 6741576
1269 2937056467 2937049772 Bacteria 6757901
1270 2937063534 2937056579 Bacteria 7107896
1271 2937067811 2937063883 Bacteria 7199456
1272 2937074428 2937071275 Bacteria 6984483
1273 2937081576 2937078374 Bacteria 6610289
1274 2937087379 2937084907 Bacteria 6618516
1275 2937094860 2937091812 Bacteria 6979387
1276 2937105453 2937098957 Bacteria 7249374
1277 2937111294 2937106411 Bacteria 6947143
1278 2937116107 2937113482 Bacteria 6505872
1279 2937122022 2937119839 Bacteria 6597547
1280 2937128863 2937126314 Bacteria 6771275
1281 2937827746 2937822353 Bacteria 7290551
1282 2937870808 2937868953 Bacteria 6639878
1283 2937895667 2937891427 Bacteria 6357007
1284 2937997763 2937994558 Bacteria 7036190
1285 2938017985 2938014810 Bacteria 6700592
1286 2939640229 2939636861 Bacteria 6297853
1287 2939671894 2939669807 Bacteria 5028511
1288 2941502098 2941499720 Bacteria 7599444
1289 2954013138 2954011201 Bacteria 4762601
1290 2957378376 2957375807 Bacteria 6425588
1291 2957384241 2957382221 Bacteria 6737050
1292 2957390704 2957388812 Bacteria 6778072
1293 2957401689 2957395598 Bacteria 6822399
1294 2957404466 2957402308 Bacteria 6741770
1295 2957414102 2957408893 Bacteria 6558585
1296 2957423232 2957422303 Bacteria 7172205
1297 2957431753 2957430029 Bacteria 7022557
1298 2957438182 2957437181 Bacteria 6568994
1299 2957446872 2957443900 Bacteria 6869977
1300 2957453714 2957450854 Bacteria 6765715
1301 2957461910 2957457609 Bacteria 6967680
1302 2957467008 2957464669 Bacteria 6568877
1303 2957471608 2957471148 Bacteria 6797643
1304 2957479568 2957478035 Bacteria 6756658
1305 2957490426 2957484790 Bacteria 6703082
1306 2957497365 2957491536 Bacteria 6695180
1307 2957503347 2957498199 Bacteria 7126688
1308 2958121117 2958115193 Bacteria 6923548
1309 2958127325 2958122699 Bacteria 7280457
1310 2958137606 2958137437 Bacteria 6050276
1311 2958158269 2958158011 Bacteria 6058449
1312 2958168236 2958165035 Bacteria 6906348
1313 2960590878 2960584000 Bacteria 6864594
1314 2960594244 2960591022 Bacteria 6622873
1315 2960599957 2960597568 Bacteria 6550735
1316 2960610627 2960603979 Bacteria 6898737
1317 2960614562 2960610863 Bacteria 6691244
1318 2960620501 2960617483 Bacteria 6727748
1319 2960624445 2960624210 Bacteria 6875384
1320 2960633632 2960631154 Bacteria 6732508
1321 2960645006 2960637947 Bacteria 7296468
1322 2960652443 2960645483 Bacteria 7211087
1323 2960654681 2960652885 Bacteria 7083688
1324 2960666531 2960660292 Bacteria 7041660
1325 2960669694 2960667422 Bacteria 6763020
1326 2960675124 2960674078 Bacteria 6609048
1327 2960681034 2960680706 Bacteria 6624464
1328 2960692499 2960687367 Bacteria 6535474
1329 2960698036 2960693952 Bacteria 6749742
1330 2961131233 2961127735 Bacteria 7196641
1331 2961140365 2961136820 Bacteria 6775228
1332 2961166702 2961163497 Bacteria 6901077
1333 2961175326 2961170736 Bacteria 7072258
1334 2963646583 2963644680 Bacteria 6530403
1335 2964614162 2964607997 Bacteria 7101408
1336 2964617997 2964615318 Bacteria 6809089
1337 2964623597 2964621998 Bacteria 6834995
1338 2964632623 2964628898 Bacteria 7083044
1339 2964637130 2964636051 Bacteria 7091832
1340 2964645649 2964643177 Bacteria 6820887
1341 2964651592 2964649959 Bacteria 6675118
1342 2964661775 2964656573 Bacteria 7100150
1343 2964666887 2964663802 Bacteria 7019362
1344 2964677602 2964670856 Bacteria 6851364
1345 2964682911 2964678106 Bacteria 6792020
1346 2964688519 2964685014 Bacteria 6839111
1347 2964692516 2964691889 Bacteria 6802758
1348 2964705356 2964698721 Bacteria 6765331
1349 2964710485 2964705432 Bacteria 7114648
1350 2964718365 2964712639 Bacteria 6695970
1351 2964721471 2964719344 Bacteria 7286602
1352 2965021525 2965018300 Bacteria 6883036
1353 2965027536 2965025482 Bacteria 6532201
1354 2965035520 2965032056 Bacteria 6887443
1355 2965042213 2965040258 Bacteria 6855979
1356 2965051804 2965047637 Bacteria 6623551
1357 2965067604 2965062239 Bacteria 7412989
1358 2965095379 2965089291 Bacteria 6866420
1359 2965107173 2965102966 Bacteria 6800987
1360 2965115979 2965110997 Bacteria 6693150
1361 2967670742 2967664464 Bacteria 6948836
1362 2967678378 2967671571 Bacteria 7021409
1363 2967684390 2967678726 Bacteria 7264382
1364 2967689967 2967686174 Bacteria 6678622
1365 2967694680 2967693043 Bacteria 6804451
1366 2967701798 2967699805 Bacteria 6854538
1367 2967708658 2967706974 Bacteria 7186053
1368 2967714911 2967714385 Bacteria 7000047
1369 2967727954 2967721400 Bacteria 7073753
1370 2967730036 2967728569 Bacteria 6641507
1371 2967737183 2967735183 Bacteria 6827012
1372 2967742293 2967742019 Bacteria 6794534
1373 2967751567 2967748971 Bacteria 6733771
1374 2967757876 2967755722 Bacteria 6814706
1375 2967767705 2967762386 Bacteria 6923502
1376 2967772085 2967769361 Bacteria 6587838
1377 2967779017 2967775926 Bacteria 6738189
1378 2967999672 2967996073 Bacteria 6787468
1379 2968008030 2968003550 Bacteria 6929263
1380 2968094695 2968091066 Bacteria 6052692
1381 2968100912 2968097103 Bacteria 6107094
1382 2968119221 2968117919 Bacteria 6536078
1383 2968133734 2968128360 Bacteria 6270294
1384 2968175107 2968171901 Bacteria 6894245
1385 2970021026 2970019648 Bacteria 7072033
1386 2970031739 2970026789 Bacteria 6785236
1387 2970034126 2970033650 Bacteria 7118744
1388 2970041751 2970040964 Bacteria 6731123
1389 2970054581 2970047711 Bacteria 7088379
1390 2970056737 2970054988 Bacteria 6611507
1391 2970067179 2970061556 Bacteria 7099761
1392 2970071623 2970068827 Bacteria 7123112
1393 2970078299 2970076120 Bacteria 6697332
1394 2970085280 2970082768 Bacteria 6183754
1395 2970092583 2970088815 Bacteria 6933825
1396 2970096148 2970095765 Bacteria 6936963
1397 2970107962 2970102677 Bacteria 6812532
1398 2970110745 2970109326 Bacteria 6863976
1399 2970117390 2970116247 Bacteria 6501857
1400 2970124908 2970122695 Bacteria 6625855
1401 2970131130 2970129317 Bacteria 6806560
1402 2970136329 2970136068 Bacteria 7207982
1403 2970145132 2970143518 Bacteria 6446480
1404 2970151580 2970149975 Bacteria 6779706
1405 2970159604 2970156795 Bacteria 7168044
1406 2970166942 2970164137 Bacteria 6861252
1407 2970174279 2970170962 Bacteria 6876229
1408 2970180860 2970177841 Bacteria 6768001
1409 2970185962 2970184632 Bacteria 7054431
1410 2970198836 2970191845 Bacteria 7032787
1411 2970490625 2970489779 Bacteria 6517260
1412 2970507914 2970503327 Bacteria 7099517
1413 2970548599 2970547951 Bacteria 6931819
1414 2970558156 2970554993 Bacteria 6814252
1415 2977523722 2977516862 Bacteria 6940108
1416 2977528834 2977523885 Bacteria 6960446
1417 2977531454 2977530762 Bacteria 6951399
1418 2977539662 2977537788 Bacteria 6929320
1419 2977548345 2977544691 Bacteria 6875412
1420 2977558468 2977551784 Bacteria 7125765
1421 2977563209 2977558990 Bacteria 6863948
1422 2977567702 2977565890 Bacteria 6901543
1423 2977575711 2977572785 Bacteria 6763888
1424 2977581962 2977579622 Bacteria 6772100
1425 2977826504 2977821940 Bacteria 6906439
1426 2977834544 2977828996 Bacteria 7007971
1427 2977859412 2977858184 Bacteria 6215359
1428 2977865095 2977864932 Bacteria 7534097
1429 2977873545 2977872689 Bacteria 7270173
1430 2977922059 2977915119 Bacteria 6829656
1431 2977938106 2977935797 Bacteria 6252826
1432 2977944852 2977942078 Bacteria 7570577
1433 2977956128 2977950692 Bacteria 6893264
1434 2977958416 2977957713 Bacteria 6877875
1435 2977987858 2977986579 Bacteria 6581278
1436 2979783677 2979779861 Bacteria 6219781
1437 2979800946 2979793036 Bacteria 6808957
1438 2979813098 2979808191 Bacteria 7179355
1439 2987639081 2987636660 Bacteria 8088555
1440 2987647906 2987645492 Bacteria 6117018
1441 2987662714 2987659509 Bacteria 6966464
1442 2987676829 2987673487 Bacteria 6884027
1443 2989349710 2989349275 Bacteria 6349068
1444 2989779243 2989776772 Bacteria 4843317
1445 2996312151 2996310559 Bacteria 6357320
1446 2996344138 2996341866 Bacteria 6643098
1447 2996889004 2996887358 Bacteria 5795980
1448 2996894294 2996893221 Bacteria 5823108
1449 3002145099 3002141150 Bacteria 5254435
1450 3003934107 3003930520 Bacteria 5667563
1451 3004191764 3004188549 Bacteria 6952365
1452 3004201418 3004195979 Bacteria 6776956
1453 3004204676 3004203850 Bacteria 7307914
1454 3004335842 3004334049 Bacteria 8449246
1455 3005414560 3005409236 Bacteria 7188837
1456 3005417408 3005416602 Bacteria 7064308
1457 3005448480 3005445848 Bacteria 6906074
1458 3005454658 3005452660 Bacteria 5889319
1459 3007515130 3007511990 Bacteria 6481491
1460 3007620618 3007619802 Bacteria 6411688
1461 637075714 637000159 Bacteria 7596297
1462 639649220 639633055 Bacteria 7751309
1463 643826344 643692032 Bacteria 6891900
1464 648739245 648276728 Bacteria 6968865
1465 649871716 649633066 Bacteria 6690028
1466 8001850620 8001845381 Bacteria 5804942
1467 8002291573 8002285264 Bacteria 6717907
1468 8003994202 8003992118 Bacteria 7266902
1469 8004001844 8003999396 Bacteria 7063185
1470 8004306622 8004300914 Bacteria 6132239
1471 8004368573 8004361976 Bacteria 6858373
1472 8004378920 8004374579 Bacteria 6898112
1473 8004445891 8004445564 Bacteria 6322258
1474 8004645214 8004640170 Bacteria 6723001
1475 8004700752 8004695233 Bacteria 6731676
1476 8004712130 8004703790 Bacteria 8006957
1477 8005248802 8005246636 Bacteria 4933972
1478 8005260339 8005258706 Bacteria 6184835
1479 8005281243 8005275841 Bacteria 6929066
1480 8005286100 8005282627 Bacteria 6675747
1481 8005292241 8005289223 Bacteria 6634003
1482 8005303159 8005301065 Bacteria 6614431
1483 8005312867 8005307578 Bacteria 7395396
1484 8005315803 8005314921 Bacteria 7072929
1485 8005323531 8005321885 Bacteria 5795980
1486 8005380961 8005376324 Bacteria 6590079
1487 8005389088 8005382845 Bacteria 6732062
1488 8005396071 8005395548 Bacteria 6806915
1489 8005435187 8005430974 Bacteria 6689030
1490 8005463717 8005460587 Bacteria 7157962
1491 8005489155 8005484373 Bacteria 6297373
1492 8005500929 8005497431 Bacteria 6477605
1493 8005545653 8005542996 Bacteria 7077758
1494 8005556985 8005556819 Bacteria 6908598
1495 8005568023 8005563573 Bacteria 7153261
1496 8005573432 8005570704 Bacteria 6957481
1497 8005622302 8005619151 Bacteria 7030230
1498 8005629803 8005626139 Bacteria 6534237
1499 8005648172 8005645114 Bacteria 6950293
1500 8005658996 8005658619 Bacteria 4500593
1501 8005672347 8005668836 Bacteria 6953162
1502 8005682857 8005682033 Bacteria 6726518
1503 8005692073 8005688590 Bacteria 6610080
1504 8018134127 8018127388 Bacteria 7351159
1505 8018155217 8018150411 Bacteria 5549903
1506 8018164596 8018163183 Bacteria 7277977
1507 8018181291 8018176218 Bacteria 6896178
1508 8023683135 8023680758 Bacteria 7729763
1509 8024482833 8024479707 Bacteria 6954785
1510 8024488060 8024486573 Bacteria 6540512
1511 8024504453 8024501048 Bacteria 6427847
1512 8046771119 8046767195 Bacteria 7547379
1513 8055432721 8055431914 Bacteria 4551896
1514 8055619392 8055617313 Bacteria 7548464
1515 8056129666 8056125926 Bacteria 6228218
1516 8056156876 8056155041 Bacteria 6486948
1517 8056182597 8056177738 Bacteria 6748268
1518 8056375964 8056375014 Bacteria 7006639
1519 8056386756 8056382006 Bacteria 6408074
1520 8057575704 8057575449 Bacteria 7367519
1521 8057877643 8057874678 Bacteria 7494653
1522 Ga0451845_0113644
1523 MRS2a_Contig_8
1524 JGI24739J22299_10005537
1525 JGI24737J22298_10017746
1526 JGI25155J39150_1000001
1527 JGI25156J39149_1000001
1528 JGI25156J39149_1002982
1529 JGI25162J39368_1000820
1530 JGI25162J39368_1000825
1531 JGI25154J39366_1000122
1532 JGI25158J39367_1000618
1533 JGI25157J39369_1000044
1534 JGI25157J39369_1000502
1535 JGI25152J39213_1000982
1536 JGI25152J39213_1002493
1537 JGI25152J39213_1008204
1538 JGI25152J39213_1011790
1539 JGI25152J39213_1011791
1540 JGI25152J39213_1012871
1541 JGI25150J39212_1000074
1542 JGI25150J39212_1009995
1543 JGI25159J45721_1000014
1544 JGI25159J45721_1000411
1545 JGI25159J45721_1001975
1546 JGI25151J46595_10000414
1547 JGI25151J46595_10000486
1548 JGI25151J46595_10000492
1549 JGI25151J46595_10001750
1550 JGI25151J46595_10037412
1551 JGI25165J46597_1000042
1552 JGI25165J46597_1000910
1553 JGI25165J46597_1000918
1554 JGI25165J46597_1005484
1555 JGI25153J46596_10000267
1556 JGI25153J46596_10001781
1557 JGI25153J46596_10004821
1558 JGI25153J46596_10018960
1559 JGI25153J46596_10019018
1560 JGI25153J46596_10028908
1561 JGI25153J46596_10028909
1562 rootL2_10019237
1563 JGI25160J50197_1000001
1564 JGI25160J50197_1000020
1565 JGI25160J50197_1000695
1566 JGI25161J50226_1000001
1567 JGI25161J50226_1002351
1568 JGI25161J50226_1007818
1569 Ga0006562J51391_1008995
1570 Ga0055542_1002255
1571 Ga0055526_1001939
1572 Ga0055526_1002938
1573 Ga0055526_1008798
1574 Ga0055524_1001901
1575 Ga0055524_1001996
1576 Ga0055524_1002315
1577 Ga0055524_1003206
1578 Ga0055536_1006005
1579 Ga0055536_1013507
1580 Ga0055528_1000234
1581 Ga0055528_1006404
1582 Ga0055528_1015121
1583 Ga0055530_10004406
1584 Ga0055530_10018837
1585 Ga0055540_1000350
1586 Ga0055540_1004660
1587 Ga0055531_10004879
1588 Ga0055543_1000003
1589 Ga0055543_1000047
1590 Ga0055543_1000352
1591 Ga0065165_1000013
1592 Ga0065165_1000068
1593 Ga0065714_10000178
1594 Ga0065714_10070084
1595 Ga0065714_10097657
1596 Ga0065712_10007353
1597 Ga0070690_100114774
1598 Ga0070670_100000515
1599 Ga0070670_100020194
1600 Ga0070666_10008907
1601 Ga0070666_10049139
1602 Ga0070680_100030422
1603 Ga0070682_100011946
1604 Ga0070660_100045560
1605 Ga0070689_100012472
1606 Ga0070691_10005271
1607 Ga0070687_100013580
1608 Ga0070661_100012072
1609 Ga0070692_10020451
1610 Ga0070669_100009547
1611 Ga0070675_100015113
1612 Ga0070671_100005647
1613 Ga0070674_100007355
1614 Ga0070659_100007540
1615 Ga0070714_100012208
1616 Ga0070701_10049297
1617 Ga0070711_100015670
1618 Ga0070711_100094587
1619 Ga0070705_100005274
1620 Ga0070700_100007256
1621 Ga0070694_100015290
1622 Ga0070678_100003791
1623 Ga0070662_100151590
1624 Ga0070685_10033912
1625 Ga0070707_100011550
1626 Ga0070697_100002756
1627 Ga0068853_100011416
1628 Ga0068853_100021890
1629 Ga0070672_100003056
1630 Ga0070695_100028667
1631 Ga0070696_100005268
1632 Ga0070693_100019704
1633 Ga0070665_100041852
1634 Ga0070704_100005481
1635 Ga0068855_100029116
1636 Ga0068857_100041747
1637 Ga0068854_100003619
1638 Ga0068856_100019906
1639 Ga0068856_100020987
1640 Ga0068856_100096703
1641 Ga0068852_100049145
1642 Ga0068852_100077599
1643 Ga0068864_100028963
1644 Ga0068861_100009349
1645 Ga0068851_10001321
1646 Ga0068863_100004189
1647 Ga0068858_100120426
1648 Ga0068860_100003332
1649 Ga0068860_100042022
1650 Ga0068862_100013963
1651 Ga0081455_10002838
1652 Ga0081455_10026387
1653 Ga0081540_1014907
1654 Ga0075365_10002873
1655 Ga0075365_10003006
1656 Ga0075365_10059139
1657 Ga0075368_10017077
1658 Ga0075363_100036209
1659 Ga0075364_10004080
1660 Ga0075364_10040077
1661 Ga0075432_10003110
1662 Ga0075432_10020613
1663 Ga0070715_10003288
1664 Ga0070716_100019247
1665 Ga0070712_100007563
1666 Ga0075362_10016486
1667 Ga0075367_10014435
1668 Ga0075367_10084093
1669 Ga0075369_10001599
1670 Ga0075369_10011824
1671 Ga0075366_10000495
1672 Ga0075366_10073252
1673 Ga0097621_100031786
1674 Ga0075370_10012570
1675 Ga0075370_10041257
1676 Ga0068871_100049153
1677 Ga0068865_100003306
1678 Ga0079104_1000242
1679 Ga0099795_10000010
1680 Ga0105251_10002824
1681 Ga0105251_10040345
1682 Ga0105240_10016883
1683 Ga0105247_10010453
1684 Ga0105241_10007717
1685 Ga0105242_10016114
1686 Ga0105242_10022649
1687 Ga0105248_10006272
1688 Ga0105248_10025234
1689 Ga0105237_10003921
1690 Ga0105237_10017438
1691 Ga0105237_10069760
1692 Ga0105238_10012224
1693 Ga0105238_10060540
1694 Ga0105238_10220850
1695 Ga0105249_10153389
1696 Ga0123341_1000007
1697 Ga0123342_1018027
1698 Ga0099796_10000136
1699 Ga0105239_10003384
1700 Ga0105239_10004650
1701 Ga0105239_10017593
1702 Ga0105239_10019613
1703 Ga0105239_10032414
1704 Ga0105239_10073080
1705 Ga0105246_10005675
1706 Ga0157373_10011394
1707 Ga0157371_10000739
1708 Ga0157371_10008194
1709 Ga0157370_10001902
1710 Ga0157370_10004750
1711 Ga0157370_10089244
1712 Ga0157369_10005514
1713 Ga0171463_1003
1714 Ga0157378_10019275
1715 Ga0163162_10008951
1716 Ga0163162_10045296
1717 Ga0163162_10052732
1718 Ga0163162_10070983
1719 Ga0157372_10028347
1720 Ga0157375_10012686
1721 Ga0157375_10042944
1722 Ga0163163_10006326
1723 Ga0157380_10013503
1724 Ga0182008_10005086
1725 Ga0182008_10018167
1726 Ga0157379_10000614
1727 Ga0157376_10010211
1728 Ga0182006_1011956
1729 Ga0182005_1002408
1730 Ga0182005_1005141
1731 Ga0183363_1085
1732 Ga0163161_10002366
1733 Ga0163161_10047218
1734 Ga0214543_1000038
1735 Ga0228711_1010496
1736 Ga0228710_1010751
1737 Ga0209435_100012
1738 Ga0209436_100147
1739 Ga0209436_101674
1740 Ga0209437_100051
1741 Ga0209437_100098
1742 Ga0207425_1000075
1743 Ga0207425_1000998
1744 Ga0207425_1008796
1745 Ga0207425_1013200
1746 Ga0209646_1000026
1747 Ga0209026_1000014
1748 Ga0209026_1000029
1749 Ga0209148_1000080
1750 Ga0209759_1000012
1751 Ga0209759_1000393
1752 Ga0209129_1000156
1753 Ga0209129_1000218
1754 Ga0209129_1000537
1755 Ga0209129_1000876
1756 Ga0209129_1002124
1757 Ga0209129_1003920
1758 Ga0209129_1006767
1759 Ga0209233_1000028
1760 Ga0209233_1000095
1761 Ga0209233_1000113
1762 Ga0209233_1000148
1763 Ga0209455_1000219
1764 Ga0209673_1000010
1765 Ga0209673_1000151
1766 Ga0209673_1003822
1767 Ga0209673_1005914
1768 Ga0209673_1007521
1769 Ga0209130_1000003
1770 Ga0209130_1000020
1771 Ga0209130_1000034
1772 Ga0209676_1004814
1773 Ga0209025_1000070
1774 Ga0209025_1000311
1775 Ga0209025_1000571
1776 Ga0209025_1004070
1777 Ga0209025_1007299
1778 Ga0209025_1013298
1779 Ga0209564_1000013
1780 Ga0209564_1000424
1781 Ga0209564_1000628
1782 Ga0209564_1006268
1783 Ga0209758_1000094
1784 Ga0209758_1000405
1785 Ga0209758_1000688
1786 Ga0209758_1001271
1787 Ga0209758_1005305
1788 Ga0209758_1005493
1789 Ga0209758_1007154
1790 Ga0209758_1021893
1791 Ga0209050_1000734
1792 Ga0209050_1004869
1793 Ga0209256_1000396
1794 Ga0209256_1000610
1795 Ga0209256_1000717
1796 Ga0209256_1002535
1797 Ga0209256_1006458
1798 Ga0209256_1014656
1799 Ga0207426_1000006
1800 Ga0207426_1000008
1801 Ga0207426_1000011
1802 Ga0207426_1000394
1803 Ga0207426_1000449
1804 Ga0209051_1000097
1805 Ga0209051_1000314
1806 Ga0209051_1003361
1807 Ga0209051_1004687
1808 Ga0209051_1013035
1809 Ga0209257_1003955
1810 Ga0209257_1005542
1811 Ga0209257_1013695
1812 Ga0207656_10022624
1813 Ga0207713_1013193
1814 Ga0207692_10074899
1815 Ga0207688_10001376
1816 Ga0207680_10102772
1817 Ga0207647_10019753
1818 Ga0207705_10138321
1819 Ga0207707_10132729
1820 Ga0207695_10000011
1821 Ga0207671_10000093
1822 Ga0207671_10000368
1823 Ga0207671_10038443
1824 Ga0207693_10002301
1825 Ga0207663_10009025
1826 Ga0207660_10160025
1827 Ga0207662_10049198
1828 Ga0207657_10007895
1829 Ga0207657_10052655
1830 Ga0207649_10015138
1831 Ga0207646_10089301
1832 Ga0207681_10087988
1833 Ga0207694_10004759
1834 Ga0207694_10067356
1835 Ga0207694_10078324
1836 Ga0207664_10095947
1837 Ga0207644_10058013
1838 Ga0207706_10012422
1839 Ga0207686_10092424
1840 Ga0207670_10045589
1841 Ga0207669_10031201
1842 Ga0207669_10118274
1843 Ga0207665_10001960
1844 Ga0207691_10024433
1845 Ga0207711_10001501
1846 Ga0207711_10036489
1847 Ga0207711_10103334
1848 Ga0207661_10087494
1849 Ga0207667_10055846
1850 Ga0207667_10115399
1851 Ga0207651_10042193
1852 Ga0207640_10012098
1853 Ga0207640_10044313
1854 Ga0207639_10035928
1855 Ga0207678_10004056
1856 Ga0207708_10001961
1857 Ga0207702_10017612
1858 Ga0207702_10049352
1859 Ga0207676_10066610
1860 Ga0207674_10032592
1861 Ga0207675_100004575
1862 Ga0207683_10002193
1863 Ga0207698_10009822
1864 Ga0207698_10037134
1865 Ga0209281_1000245
1866 Ga0209281_1000246
1867 Ga0209281_1001017
1868 Ga0209371_1001202
1869 Ga0209179_1000084
1870 Ga0209282_1001720
1871 Ga0207428_10065001
1872 Ga0207428_10087261
1873 Ga0207428_10122631
1874 Ga0268266_10000243
1875 Ga0268266_10020347
1876 Ga0268266_10040347
1877 Ga0268265_10124897
1878 Ga0268264_10106630
1879 Ga0265318_10009183
1880 Ga0307515_10009778
1881 Ga0307515_10081852
1882 Ga0268256_1001146
1883 Ga0307511_10104344
1884 Ga0265330_10005159
1885 Ga0265330_10006952
1886 Ga0265325_10054678
1887 Ga0265340_10016071
1888 Ga0265340_10017004
1889 Ga0265340_10037343
1890 Ga0265339_10004751
1891 Ga0265339_10007741
1892 Ga0265339_10019396
1893 Ga0265316_10046564
1894 Ga0307408_100037701
1895 Ga0307408_100054666
1896 Ga0265313_10000254
1897 Ga0265342_10013481
1898 Ga0307412_10002336
1899 Ga0315914_1000015
1900 Ga0315913_1008719
1901 Ga0315915_1000020
1902 Ga0373931_0040938
1903 Ga0373947_0042715
1904 Ga0373925_0060590
1905 Ga0395900_0044165
1906 Ga0395898_0048459
1907 Ga0395905_0015713
1908 Ga0395905_0100091
1909 Ga0395901_0119547
1910 Ga0439438_008088
1911 Ga0439438_009424
1912 Ga0439438_014592
1913 Ga0439447_000016
1914 Ga0439447_002713
1915 Ga0439447_007552
1916 Ga0439466_0000324
1917 Ga0439466_0001368
1918 Ga0439466_0002830
1919 Ga0439466_0020071
1920 Ga0439465_0002021
1921 Ga0451835_1208747
1922 Ga0451839_0382298
1923 Ga0451841_0042953
1924 Ga0451841_1320517
1925 Ga0451845_0186460
1926 Ga0451847_0054416
1927 Ga0451847_0826475
1928 Ga0451851_0094881
1929 Ga0451853_1413502
1930 Ga0439451_001654
1931 Ga0439451_005187
1932 Ga0439452_000046
1933 Ga0439452_001433
1934 Ga0439456_005154
1935 Ga0439463_004915
1936 Ga0450911_000927
1937 Ga0450911_001620
1938 Ga0450911_005324
1939 Ga0450919_001004
1940 Ga0450890_000666
1941 Ga0450902_001530
1942 Ga0450903_000582
1943 Ga0450903_005885
1944 Ga0450906_008209
1945 Ga0450907_000003
1946 Ga0450907_005269
1947 Ga0450907_009138
1948 Ga0439446_0005478
1949 Ga0450909_000170
1950 Ga0439434_0000019
1951 Ga0439460_0001401
1952 Ga0439460_0002987
1953 Ga0439460_0004399
1954 Ga0450918_012595
1955 Ga0439440_0000508
1956 Ga0439440_0001836
1957 Ga0466963_0008573
1958 Ga0466970_0005025
1959 Ga0451576_0020802
1960 Ga0451576_0054356
1961 Ga0466958_0061189
1962 Ga0495617_000282
1963 Ga0495617_000613
1964 Ga0495617_003117
1965 Ga0495627_003377
1966 Ga0495592_0027656
1967 Ga0495603_0000535
1968 Ga0495603_0000748
1969 Ga0495603_0002140
1970 Ga0495590_0000040
1971 Ga0495590_0004520
1972 Ga0495590_0022360
1973 Ga0495591_000143
1974 Ga0495591_004844
1975 Ga0495591_024002
1976 Ga0495629_0001118
1977 Ga0495638_0000381
1978 Ga0495638_0000906
1979 Ga0495638_0001340
1980 Ga0495638_0001770
1981 Ga0495638_0002038
1982 Ga0495638_0002734
1983 Ga0495638_0009961
1984 Ga0495638_0010217
1985 Ga0495638_0017109
1986 Ga0495638_0020752
1987 Ga0495638_0045531
1988 Ga0495641_0023519
1989 Ga0495653_0004630
1990 Ga0495650_0001536
1991 Ga0495650_0001586
1992 Ga0495650_0003945
1993 Ga0495650_0005145
1994 Ga0495650_0011776
1995 Ga0495580_0000341
1996 Ga0495582_0000352
1997 Ga0495605_0000321
1998 Ga0495605_0000751
1999 Ga0495605_0001173
2000 Ga0495605_0003344
2001 Ga0495605_0006620
2002 Ga0495605_0024592
2003 Ga0495605_0036781
2004 Ga0495639_0020283
2005 Ga0495662_0006372
2006 Ga0495584_0000019
2007 Ga0495584_0000086
2008 Ga0495584_0001430
2009 Ga0495584_0007740
2010 Ga0495584_0009593
2011 Ga0495584_0017886
2012 Ga0495584_0018691
2013 Ga0495585_0000012
2014 Ga0495585_0004015
2015 Ga0495585_0005603
2016 Ga0495585_0019679
2017 Ga0495585_0021999
2018 Ga0495585_0037158
2019 Ga0495585_0060342
2020 Ga0495594_0000049
2021 Ga0495594_0017998
2022 Ga0495596_0000050
2023 Ga0495607_0000637
2024 Ga0495607_0001207
2025 Ga0495607_0001848
2026 Ga0495607_0002549
2027 Ga0495607_0005774
2028 Ga0495607_0006918
2029 Ga0495607_0011407
2030 Ga0495607_0013112
2031 Ga0495607_0041449
2032 Ga0495607_0075597
2033 Ga0495583_0000112
2034 Ga0495583_0008546
2035 Ga0495583_0014562
2036 Ga0495606_0001735
2037 Ga0495606_0002826
2038 Ga0495606_0011380
2039 Ga0495610_0002479
2040 Ga0495610_0004038
2041 Ga0495610_0005663
2042 Ga0495610_0015078
2043 Ga0495610_0018217
2044 Ga0495610_0021223
2045 Ga0495610_0024738
2046 Ga0495610_0026778
2047 Ga0495610_0033738
2048 Ga0495610_0059039
2049 Ga0495616_0000245
2050 Ga0495616_0004681
2051 Ga0495620_0001456
2052 Ga0495620_0016359
2053 Ga0495620_0022288
2054 Ga0495620_0034597
2055 Ga0495628_0102500
2056 Ga0495630_0032806
2057 Ga0495631_0000336
2058 Ga0495631_0004032
2059 Ga0495631_0006054
2060 Ga0495631_0010474
2061 Ga0495632_0000058
2062 Ga0495632_0001123
2063 Ga0495632_0001410
2064 Ga0495632_0002362
2065 Ga0495632_0006229
2066 Ga0495632_0015651
2067 Ga0495632_0024011
2068 Ga0495632_0042224
2069 Ga0495637_0000138
2070 Ga0495637_0000493
2071 Ga0495637_0002855
2072 Ga0495637_0004378
2073 Ga0495637_0005273
2074 Ga0495637_0008173
2075 Ga0495643_0004441
2076 Ga0495643_0004788
2077 Ga0495643_0023767
2078 Ga0495643_0035887
2079 Ga0495643_0050148
2080 Ga0495644_0000031
2081 Ga0495644_0000217
2082 Ga0495644_0008000
2083 Ga0495648_0000884
2084 Ga0495648_0001115
2085 Ga0495648_0010455
2086 Ga0495648_0011307
2087 Ga0495648_0017141
2088 Ga0495648_0018407
2089 Ga0495648_0021253
2090 Ga0495648_0038438
2091 Ga0495642_0000003
2092 Ga0495642_0000165
2093 Ga0495642_0001529
2094 Ga0495642_0009734
2095 Ga0495654_0000253
2096 Ga0495654_0000914
2097 Ga0495654_0001303
2098 Ga0495654_0005849
2099 Ga0495654_0007176
2100 Ga0495654_0008468
2101 Ga0495587_0001215
2102 Ga0495587_0054141
2103 Ga0495609_0001638
2104 Ga0495597_0002798
2105 Ga0495597_0008762
2106 Ga0495597_0023593
2107 Ga0495597_0029327
2108 Ga0495597_0035028
2109 Ga0495622_0000202
2110 Ga0495622_0029491
2111 Ga0495633_0002527
2112 Ga0495633_0008736
2113 Ga0495633_0019226
2114 Ga0495633_0064863
2115 Ga0495656_0004408
2116 Ga0495656_0011380
2117 Ga0495668_0000424
2118 Ga0495668_0014377
2119 Ga0495611_0002162
2120 Ga0495611_0002456
2121 Ga0495625_0002559
2122 Ga0495625_0010569
2123 Ga0495625_0017394
2124 Ga0495625_0062508
2125 Ga0495635_0000051
2126 Ga0495635_0034264
2127 Ga0495659_0000978
2128 Ga0495661_0003829
2129 Ga0495661_0004366
2130 Ga0495661_0061313
2131 Ga0495588_0001960
2132 Ga0495588_0043879
2133 Ga0495623_0002213
2134 Ga0495646_0054737
2135 Ga0495658_0010216
2136 Ga0495658_0020699
2137 Ga0495669_0000263
2138 Ga0495613_0000244
2139 Ga0495613_0002488
2140 Ga0495670_0000103
2141 Ga0495670_0000179
2142 Ga0495670_0000800
2143 Ga0495670_0002654
2144 Ga0495670_0005587
2145 Ga0495670_0039326
2146 Ga0495670_0042063
2147 Ga0495671_0000138
2148 Ga0495671_0009774
2149 Ga0495671_0042961
2150 Ga0495671_0043244
2151 Ga0495649_0000086
2152 Ga0495649_0002906
2153 Ga0495649_0005630
2154 Ga0495649_0012799
2155 Ga0495649_0018182
2156 Ga0495649_0024184
2157 Ga0495649_0033518
2158 Ga0495649_0038179
2159 Ga0495589_0000242
2160 Ga0495589_0000583
2161 Ga0495589_0000636
2162 Ga0495589_0010820
2163 Ga0495660_0003894
2164 Ga0495660_0007879
2165 Ga0495660_0025753
2166 Ga0495660_0063720
2167 Ga0495660_0069107
2168 Ga0495581_0041653
2169 Ga0495604_0005589
2170 Ga0495604_0077209
2171 Ga0495636_0001197
2172 Ga0495672_0001126
2173 Ga0495672_0002647
2174 Ga0495672_0010412
2175 Ga0495672_0010744
2176 Ga0495672_0013220
2177 Ga0495672_0013711
2178 Ga0495672_0016563
2179 Ga0495672_0018174
2180 Ga0495672_0035830
2181 Ga0495676_0048039
2182 Ga0495680_0005209
2183 Ga0495683_0000010
2184 Ga0495683_0000116
2185 Ga0495683_0001491
2186 Ga0495683_0003259
2187 Ga0495683_0009520
2188 Ga0495687_000906
2189 Ga0495687_001073
2190 Ga0495687_004002
2191 Ga0495677_0000047
2192 Ga0495677_0045986
2193 Ga0495679_001421
2194 Ga0495679_002923
2195 Ga0495673_0000242
2196 Ga0495673_0000426
2197 Ga0495673_0001672
2198 Ga0495673_0002390
2199 Ga0495673_0003183
2200 Ga0495673_0003934
2201 Ga0495673_0004107
2202 Ga0495673_0004513
2203 Ga0495673_0006926
2204 Ga0495673_0043970
2205 Ga0495681_0000232
2206 Ga0495681_0001247
2207 Ga0495681_0001288
2208 Ga0495681_0002295
2209 Ga0495681_0002859
2210 Ga0495681_0002891
2211 Ga0495681_0007890
2212 Ga0495681_0008830
2213 Ga0495681_0010168
2214 Ga0495686_0000556
2215 Ga0495686_0004878
2216 Ga0495686_0034494
2217 Ga0495593_0000689
2218 Ga0495614_0012692
2219 Ga0495626_0000169
2220 Ga0495626_0000198
2221 Ga0495626_0000280
2222 Ga0495626_0000490
2223 Ga0495626_0000531
2224 Ga0495626_0004711
2225 Ga0495626_0016966
2226 Ga0496100_0013432
2227 Ga0496100_0016235
2228 Ga0496101_0010862
2229 Ga0496101_0029268
2230 Ga0496102_0000311
2231 Ga0496102_0028920
2232 Ga0496102_0081648
2233 Ga0496103_0000272
2234 Ga0496103_0006550
2235 Ga0496103_0015984
2236 Ga0496104_0041950
2237 Ga0496104_0053531
2238 Ga0496106_0008423
2239 Ga0496107_0026927
2240 Ga0496108_0008919
2241 Ga0496110_0000849
2242 Ga0496110_0071251
2243 Ga0496114_0007712
2244 Ga0496114_0032268
2245 Ga0496115_0011303
2246 Ga0496115_0072476
2247 Ga0496116_0008936
2248 Ga0496116_0010642
2249 Ga0496116_0022739
2250 Ga0496117_0001668
2251 Ga0496117_0004903
2252 Ga0496118_0003066
2253 Ga0496118_0008151
2254 Ga0496119_0000827
2255 Ga0496119_0012196
2256 Ga0496119_0022910
2257 Ga0496120_0004176
2258 Ga0496121_0003720
2259 Ga0496121_0029231
2260 Ga0496121_0033927
2261 Ga0496121_0060083
2262 Ga0496122_0014648
2263 Ga0496122_0034472
2264 Ga0496122_0034972
2265 Ga0496122_0048178
2266 Ga0496123_0000939
2267 Ga0496123_0012163
2268 Ga0496123_0026574
2269 Ga0496124_0002136
2270 Ga0496124_0010601
2271 Ga0496124_0021253
2272 Ga0496124_0048981
2273 Ga0496125_0005054
2274 Ga0496125_0010334
2275 Ga0496125_0012178
2276 Ga0496125_0026977
2277 Ga0496125_0055987
2278 Ga0496125_0083577
2279 Ga0496125_0111623
2280 Ga0496126_0071855
2281 Ga0496126_0101407
2282 Ga0496126_0106164
2283 Ga0495678_000437
2284 Ga0495678_002064
2285 Ga0495678_004456
2286 Ga0495678_008281
2287 Ga0495678_015098
2288 Ga0495678_039968
2289 Ga0495678_048383
2290 Ga0495682_0008128
2291 Ga0495682_0030769
2292 Ga0501032_0002101
2293 Ga0501032_0020760
2294 Ga0501033_0000327
2295 Ga0501033_0009034
2296 Ga0501034_0000208
2297 Ga0501034_0076113
2298 Ga0501036_0014937
2299 Ga0501037_0023072
2300 Ga0501038_0030852
2301 Ga0501039_0000839
2302 Ga0501043_0029573
2303 Ga0501043_0032305
2304 Ga0501046_0003824
2305 Ga0501046_0009327
2306 Ga0501047_0000923
2307 Ga0501047_0066306
2308 Ga0501047_0111476
2309 Ga0501067_0004068
2310 Ga0501070_0023774
2311 Ga0501073_0035506
2312 Ga0501080_0000024
2313 Ga0501080_0157961
2314 Ga0501083_0077637
2315 Ga0501035_0000049
2316 Ga0501035_0001644
2317 Ga0501035_0031082
2318 Ga0501044_0000030
2319 Ga0501044_0093684
2320 Ga0501044_0134163
2321 nmdc:mga03683_28520_c1
2322 nmdc:mga00v17_10952_c1
2323 nmdc:mga0yw44_1373_c1
2324 nmdc:mga0yw44_2786_c1
2325 nmdc:mga0k408_1579_c1
2326 nmdc:mga07m45_3549_c1
2327 nmdc:mga05p37_167858_c1
2328 nmdc:mga08y16_45860_c1
2329 nmdc:mga0sz30_3249_c1
2330 nmdc:mga0sz30_6030_c1
2331 Ga0495601_0094337
2332 Ga0495619_0014727
2333 Ga0500556_0000124
2334 Ga0500607_034281
2335 Ga0500618_006947
2336 Ga0500658_0004365
2337 Ga0500559_0004411
2338 Ga0500568_0000202
2339 Ga0500568_0004466
2340 Ga0500573_0005115
2341 Ga0500590_032528
2342 Ga0500616_0000102
2343 Ga0500616_0001640
2344 Ga0500616_0008317
2345 Ga0500616_0031210
2346 Ga0500636_0000003
2347 Ga0500636_0106785
2348 Ga0500645_015879
2349 Ga0587070_003216
2350 Ga0587080_005301
2351 Ga0587083_0006042
2352 Ga0587067_003438
2353 Ga0587072_005216
2354 Ga0587107_001798
2355 Ga0587071_006920
2356 Ga0501082_0034426
2357 Ga0501082_0077661
2358 Ga0501082_0109750
2359 2503199906
2360 2509108363
2361 2509114620
2362 2509369620
2363 2509376504
2364 2509445613
2365 2509447086
2366 2510133989
2367 2510306487
2368 2510318577
2369 2510841243
2370 2510895408
2371 2511134001
2372 2511172761
2373 2511187087
2374 2511199062
2375 2511257460
2376 2511274083
2377 2511276592
2378 2511305005
2379 2511322539
2380 2511327816
2381 2511331165
2382 2511340612
2383 2511344624
2384 2511349949
2385 2511358754
2386 2511362455
2387 2511390297
2388 2511502277
2389 2512932619
2390 2512970649
2391 2513567937
2392 2513576978
2393 2513584351
2394 2513596508
2395 2513601711
2396 2513608738
2397 2513618837
2398 2513633352
2399 2513707631
2400 2513865632
2401 2513884371
2402 2513905044
2403 2513908962
2404 2513925352
2405 2513984136
2406 2514001468
2407 2514002846
2408 2514019973
2409 2514422826
2410 2515113036
2411 2515655321
2412 2515739518
2413 2516204178
2414 2516893656
2415 2517036738
2416 2517077099
2417 2517095865
2418 2517407436
2419 2517570380
2420 2520380496
2421 2524459623
2422 2530645918
2423 2535516899
2424 2551678488
2425 2551689784
2426 2551694378
2427 2551701995
2428 2551715265
2429 2551723286
2430 2551723701
2431 2551730482
2432 2551733006
2433 2551743396
2434 2558864428
2435 2561468341
2436 2585166387
2437 2585202236
2438 2585222865
2439 2585231776
2440 2585255122
2441 2585267388
2442 2585271170
2443 2585277515
2444 2585323301
2445 2585331442
2446 2585386456
2447 2585393289
2448 2585402365
2449 2585527480
2450 2585535142
2451 2585538218
2452 2585545448
2453 2585555992
2454 2585558894
2455 2585822948
2456 2585836167
2457 2585843263
2458 2585898275
2459 2585904136
2460 2587980747
2461 2588518698
2462 2599331782
2463 2599417268
2464 2599936485
2465 2600195482
2466 2616293328
2467 2616308990
2468 2616554261
2469 2617383601
2470 2643776641
2471 2643795089
2472 2643803049
2473 2643811500
2474 2643845852
2475 2643953779
2476 2643987409
2477 2644003136
2478 2644021713
2479 2644050480
2480 2644063411
2481 2644107243
2482 2644133313
2483 2644150809
2484 2644158071
2485 2644189436
2486 2644193546
2487 2644205708
2488 2644208995
2489 2644238644
2490 2644298706
2491 2644308638
2492 2644335456
2493 2644374694
2494 2644414174
2495 2644447702
2496 2644483398
2497 2644499609
2498 2644539861
2499 2644614579
2500 2644652525
2501 2644656935
2502 2644676042
2503 2644690175
2504 2671111398
2505 2688597161
2506 2692315508
2507 2694628773
2508 2694637313
2509 2719181839
2510 2719386445
2511 2719666191
2512 2719732503
2513 2720492611
2514 2720614045
2515 2720620852
2516 2720632177
2517 2720775905
2518 2721147930
2519 2721159381
2520 2721164766
2521 2721400149
2522 2722840936
2523 2723027507
2524 2723561128
2525 2723567724
2526 2723574356
2527 2724038962
2528 2724045259
2529 2724090512
2530 2724104989
2531 2724110846
2532 2730108443
2533 2730165074
2534 2730299013
2535 2738800121
2536 2739032874
2537 2739199948
2538 2739260176
2539 2739307565
2540 2753462060
2541 2765466380
2542 2766065905
2543 2770199010
2544 2774118719
2545 2776270278
2546 2776284992
2547 2776913976
2548 2778175448
2549 2784312356
2550 2792620738
2551 2792626097
2552 2792639034
2553 2792748058
2554 2793294404
2555 2793314511
2556 2793320338
2557 2793331703
2558 2793334523
2559 2793339243
2560 2793348913
2561 2793351799
2562 2793362547
2563 2793368840
2564 2802717003
2565 2802725752
2566 2802730159
2567 2802737870
2568 2802742676
2569 2802750164
2570 2805928768
2571 2805935050
2572 2806043854
2573 2806050215
2574 2806057031
2575 2806064412
2576 2806071679
2577 2808933205
2578 2808955288
2579 2808961782
2580 2819241369
2581 2819609180
2582 2819637591
2583 2838017619
2584 2838027581
2585 2838029773
2586 2838038533
2587 2838054335
2588 2838067702
2589 2838070109
2590 2838076825
2591 2838661556
2592 2838670394
2593 2838683431
2594 2838687018
2595 2838697626
2596 2838702765
2597 2838710742
2598 2838730009
2599 2838742976
2600 2839998272
2601 2840769108
2602 2841852462
2603 2841870816
2604 2842078915
2605 2842113232
2606 2842118575
2607 2842147977
2608 2842158079
2609 2842168758
2610 2842181698
2611 2842197391
2612 2842203591
2613 2842205447
2614 2842217970
2615 2842230251
2616 2842240487
2617 2842244154
2618 2842253043
2619 2842257760
2620 2842266300
2621 2842271444
2622 2842278904
2623 2842285566
2624 2842292577
2625 2842301405
2626 2842305073
2627 2842316976
2628 2842320743
2629 2842346492
2630 2842357942
2631 2842368925
2632 2842374062
2633 2842378975
2634 2842385086
2635 2842402926
2636 2842409702
2637 2842416353
2638 2842423723
2639 2842430763
2640 2842437250
2641 2842443620
2642 2842453874
2643 2842464906
2644 2842471868
2645 2842476942
2646 2842484528
2647 2842492011
2648 2842496793
2649 2842503301
2650 2842511096
2651 2842521850
2652 2842872266
2653 2842924188
2654 2844164612
2655 2844458385
2656 2847419430
2657 2847674961
2658 2847691048
2659 2848994458
2660 2850081501
2661 2852390259
2662 2855826378
2663 2855841767
2664 2855872488
2665 2856320679
2666 2856334781
2667 2856336552
2668 2856355585
2669 2856362093
2670 2857351897
2671 2857368856
2672 2857517396
2673 2858802552
2674 2869253179
2675 2869267591
2676 2869277603
2677 2871450064
2678 2871455731
2679 2871493300
2680 2871499112
2681 2874108645
2682 2874133698
2683 2874168041
2684 2876365128
2685 2876375678
2686 2876383147
2687 2876402775
2688 2876412030
2689 2878036018
2690 2878757345
2691 2878763311
2692 2878770299
2693 2878787690
2694 2881149842
2695 2881160987
2696 2881166721
2697 2881849423
2698 2881859179
2699 2881868972
2700 2882632478
2701 2882919253
2702 2885325832
2703 2885350595
2704 2888338240
2705 2894655606
2706 2894819238
2707 2899807229
2708 2903501072
2709 2903522137
2710 2903528515
2711 2903543914
2712 2904553690
2713 2904582232
2714 2906330759
2715 2906364507
2716 2906373553
2717 2906395742
2718 2906411162
2719 2906419872
2720 2915982979
2721 2915990298
2722 2916000825
2723 2916003449
2724 2916008082
2725 2916019577
2726 2916022165
2727 2916034224
2728 2916037903
2729 2916045297
2730 2916049079
2731 2916055683
2732 2916062281
2733 2916075028
2734 2916082291
2735 2917557349
2736 2919107623
2737 2919122987
2738 2919174676
2739 2919410012
2740 2919453043
2741 2919461217
2742 2920761484
2743 2920825255
2744 2921208500
2745 2921240893
2746 2921246737
2747 2921253826
2748 2921263076
2749 2921266246
2750 2921289159
2751 2921296276
2752 2922157193
2753 2922160913
2754 2922172820
2755 2922180261
2756 2923558606
2757 2924146717
2758 2924157955
2759 2924159311
2760 2924170521
2761 2924174532
2762 2924182963
2763 2924187491
2764 2924195421
2765 2924203288
2766 2924210707
2767 2924215668
2768 2924223257
2769 2924230557
2770 2924730925
2771 2924737959
2772 2924753438
2773 2924786651
2774 2928524192
2775 2931402934
2776 2933022195
2777 2933570881
2778 2933588712
2779 2933600915
2780 2935896988
2781 2935901922
2782 2936372001
2783 2937004522
2784 2937011235
2785 2937019787
2786 2937024622
2787 2937031104
2788 2937037026
2789 2937047980
2790 2937056467
2791 2937063534
2792 2937067811
2793 2937074428
2794 2937081576
2795 2937087379
2796 2937094860
2797 2937105453
2798 2937111294
2799 2937116107
2800 2937122022
2801 2937128863
2802 2937827746
2803 2937870808
2804 2937895667
2805 2937997763
2806 2938017985
2807 2939640229
2808 2939671894
2809 2941502098
2810 2954013138
2811 2957378376
2812 2957384241
2813 2957390704
2814 2957401689
2815 2957404466
2816 2957414102
2817 2957423232
2818 2957431753
2819 2957438182
2820 2957446872
2821 2957453714
2822 2957461910
2823 2957467008
2824 2957471608
2825 2957479568
2826 2957490426
2827 2957497365
2828 2957503347
2829 2958121117
2830 2958127325
2831 2958137606
2832 2958158269
2833 2958168236
2834 2960590878
2835 2960594244
2836 2960599957
2837 2960610627
2838 2960614562
2839 2960620501
2840 2960624445
2841 2960633632
2842 2960645006
2843 2960652443
2844 2960654681
2845 2960666531
2846 2960669694
2847 2960675124
2848 2960681034
2849 2960692499
2850 2960698036
2851 2961131233
2852 2961140365
2853 2961166702
2854 2961175326
2855 2963646583
2856 2964614162
2857 2964617997
2858 2964623597
2859 2964632623
2860 2964637130
2861 2964645649
2862 2964651592
2863 2964661775
2864 2964666887
2865 2964677602
2866 2964682911
2867 2964688519
2868 2964692516
2869 2964705356
2870 2964710485
2871 2964718365
2872 2964721471
2873 2965021525
2874 2965027536
2875 2965035520
2876 2965042213
2877 2965051804
2878 2965067604
2879 2965095379
2880 2965107173
2881 2965115979
2882 2967670742
2883 2967678378
2884 2967684390
2885 2967689967
2886 2967694680
2887 2967701798
2888 2967708658
2889 2967714911
2890 2967727954
2891 2967730036
2892 2967737183
2893 2967742293
2894 2967751567
2895 2967757876
2896 2967767705
2897 2967772085
2898 2967779017
2899 2967999672
2900 2968008030
2901 2968094695
2902 2968100912
2903 2968119221
2904 2968133734
2905 2968175107
2906 2970021026
2907 2970031739
2908 2970034126
2909 2970041751
2910 2970054581
2911 2970056737
2912 2970067179
2913 2970071623
2914 2970078299
2915 2970085280
2916 2970092583
2917 2970096148
2918 2970107962
2919 2970110745
2920 2970117390
2921 2970124908
2922 2970131130
2923 2970136329
2924 2970145132
2925 2970151580
2926 2970159604
2927 2970166942
2928 2970174279
2929 2970180860
2930 2970185962
2931 2970198836
2932 2970490625
2933 2970507914
2934 2970548599
2935 2970558156
2936 2977523722
2937 2977528834
2938 2977531454
2939 2977539662
2940 2977548345
2941 2977558468
2942 2977563209
2943 2977567702
2944 2977575711
2945 2977581962
2946 2977826504
2947 2977834544
2948 2977859412
2949 2977865095
2950 2977873545
2951 2977922059
2952 2977938106
2953 2977944852
2954 2977956128
2955 2977958416
2956 2977987858
2957 2979783677
2958 2979800946
2959 2979813098
2960 2987639081
2961 2987647906
2962 2987662714
2963 2987676829
2964 2989349710
2965 2989779243
2966 2996312151
2967 2996344138
2968 2996889004
2969 2996894294
2970 3002145099
2971 3003934107
2972 3004191764
2973 3004201418
2974 3004204676
2975 3004335842
2976 3005414560
2977 3005417408
2978 3005448480
2979 3005454658
2980 3007515130
2981 3007620618
2982 637075714
2983 639649220
2984 643826344
2985 648739245
2986 649871716
2987 8001850620
2988 8002291573
2989 8003994202
2990 8004001844
2991 8004306622
2992 8004368573
2993 8004378920
2994 8004445891
2995 8004645214
2996 8004700752
2997 8004712130
2998 8005248802
2999 8005260339
3000 8005281243
3001 8005286100
3002 8005292241
3003 8005303159
3004 8005312867
3005 8005315803
3006 8005323531
3007 8005380961
3008 8005389088
3009 8005396071
3010 8005435187
3011 8005463717
3012 8005489155
3013 8005500929
3014 8005545653
3015 8005556985
3016 8005568023
3017 8005573432
3018 8005622302
3019 8005629803
3020 8005648172
3021 8005658996
3022 8005672347
3023 8005682857
3024 8005692073
3025 8018134127
3026 8018155217
3027 8018164596
3028 8018181291
3029 8023683135
3030 8024482833
3031 8024488060
3032 8024504453
3033 8046771119
3034 8055432721
3035 8055619392
3036 8056129666
3037 8056156876
3038 8056182597
3039 8056375964
3040 8056386756
3041 8057575704
3042 8057877643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13520

AA_permease_2

Amino acid permease

29

484

0.79

PF00324

AA_permease

Amino acid permease

39

458

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j4i-assembly1.cif.gz_A crystal structure of the l-arginine/agmatine antiporter from e. coli at 2.2 angstroem resolution 0.8416 32 494
5j4i-assembly1.cif.gz_A crystal structure of the l-arginine/agmatine antiporter from e. coli at 2.2 angstroem resolution 0.8277 32 494
3ob6-assembly1.cif.gz_B structure of adic(n101a) in the open-to-out arg+ bound conformation 0.8265 28 494
3ob6-assembly1.cif.gz_B structure of adic(n101a) in the open-to-out arg+ bound conformation 0.8214 28 494
3ob6-assembly1.cif.gz_A structure of adic(n101a) in the open-to-out arg+ bound conformation 0.8164 28 494
ID Description Score Start End Superfamily
af_Q09887_36_510_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8892 27 490 1.20.1740.10
af_P32837_68_548_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8842 30 494 1.20.1740.10
af_Q7XUT0_22_503_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8829 27 486 1.20.1740.10
af_A0A1D8PH79_86_559_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8793 27 490 1.20.1740.10
af_A0A0P0VCX1_3_391_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8749 112 482 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A534PHQ4-F1-model_v4 Amino acid permease 0.9347 32 494 GO:0016020
GO:0022857
AF-A0A534PHQ4-F1-model_v4 Amino acid permease 0.9306 32 494 GO:0016020
GO:0022857
AF-A0A257H3W3-F1-model_v4 Amino acid permease 0.9204 221 512 GO:0016020
GO:0022857
AF-A0A257H3W3-F1-model_v4 Amino acid permease 0.8971 221 512 GO:0016020
GO:0022857
AF-A0A4U0UIC1-F1-model_v4 Amino acid permease/ SLC12A domain-containing protein 0.8831 43 462 GO:0016020
GO:0022857

Map