F494541
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1522 | 525 | 3044 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300015262|Ga0182007_10004797|Ga0182007_100047972 |
| Length | 290 |
| Sequence | MTEFLAVAVTTEFRTTRKNGTMWKAIKPNYKNLRIYQALVLVIFFIIWHLATRNPQTAFFFGEPIKVLQRVWQWFTVGSGSLEVGFGDHTWFTMTFPAEIYSHLLITLTETMLAFGIGTVFGLAVGLWLALSPLTSAILDPYIKASNAMPRVILAPIFAMWFGLGIWSKVALAGVKEVSPVVLANARMLGANQRQLLRTVYLPSATSWVFSSLHTSVGLAFVGVIVGEYLGSARGVGYLILQAEGAFDINTVFAGILVLTAFALVLDTVVGMIEKRLMKWQPKSGETERL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 17 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 39 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 47 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 50 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 74 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 82 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 100 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 107 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 108 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 109 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 110 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 111 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 112 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 117 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 120 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 121 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 122 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 125 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 126 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 127 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 152 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 157 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 158 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 160 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 161 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 177 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 255 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 258 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 262 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 263 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 264 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 265 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 266 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 267 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 268 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 269 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 270 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 271 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 272 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 273 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 274 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 275 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 276 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 277 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 278 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 279 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 280 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 281 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 282 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 283 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 284 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 285 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 286 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 287 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 288 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 289 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 290 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 291 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 292 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 293 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 294 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 295 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 296 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 297 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 298 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 299 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 300 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 301 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 302 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 303 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 304 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 305 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 306 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 307 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 308 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 309 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 310 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 311 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 312 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 313 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 314 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 315 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 316 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 317 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 318 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 319 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 320 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 322 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 323 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 324 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 325 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 326 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 327 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 328 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 329 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 330 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 331 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 332 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 333 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 334 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 335 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 336 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 337 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 338 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 339 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 340 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 341 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 342 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 343 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 344 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 345 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 346 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 347 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 348 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 349 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 350 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 351 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 352 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 353 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 428 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 429 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 430 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 431 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 432 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 433 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 434 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 436 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 437 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 438 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 439 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 440 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 441 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 442 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 443 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 444 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 445 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 446 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 447 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 448 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 449 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 450 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 451 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 452 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 453 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 474 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 475 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 478 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 479 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 483 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 484 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 485 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 486 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 487 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 488 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 489 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 490 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 492 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 494 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 495 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 498 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 499 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 500 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 501 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 502 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 503 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 504 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 505 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 506 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 507 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 508 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 509 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 510 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 511 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 512 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 513 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 514 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 515 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 516 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 517 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 518 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 519 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 520 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 521 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 522 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 523 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 524 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 525 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0 |
| Isolates | 0.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.21 |
| Nodule | 0.46 |
| Rhizoplane | 2.89 |
| Rhizosphere | 65.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182007_10004797 | 3300015262 | Bacteria | 6072 |
| 2 | JGI24740J21852_10016314 | 3300001979 | Bacteria | 2686 |
| 3 | JGI25155J39150_1000049 | 3300002704 | Bacteria | 78961 |
| 4 | JGI25155J39150_1000145 | 3300002704 | Bacteria | 32917 |
| 5 | JGI25155J39150_1000235 | 3300002704 | Bacteria | 21541 |
| 6 | JGI25156J39149_1000023 | 3300002705 | Bacteria | 146831 |
| 7 | JGI25156J39149_1000220 | 3300002705 | Bacteria | 39809 |
| 8 | JGI25156J39149_1000290 | 3300002705 | Bacteria | 33901 |
| 9 | JGI25156J39149_1001073 | 3300002705 | Bacteria | 12573 |
| 10 | JGI25156J39149_1004387 | 3300002705 | Bacteria | 4312 |
| 11 | JGI25162J39368_1000369 | 3300002737 | Bacteria | 38411 |
| 12 | JGI25154J39366_1000036 | 3300002738 | Bacteria | 161697 |
| 13 | JGI25154J39366_1000265 | 3300002738 | Bacteria | 33226 |
| 14 | JGI25154J39366_1000422 | 3300002738 | Bacteria | 22674 |
| 15 | JGI25154J39366_1000669 | 3300002738 | Bacteria | 15992 |
| 16 | JGI25157J39369_1000023 | 3300002741 | Bacteria | 161697 |
| 17 | JGI25157J39369_1000135 | 3300002741 | Bacteria | 61510 |
| 18 | JGI25157J39369_1000186 | 3300002741 | Bacteria | 52214 |
| 19 | JGI25163J39215_1004222 | 3300002771 | Bacteria | 1037 |
| 20 | JGI25164J39214_1001832 | 3300002772 | Bacteria | 4046 |
| 21 | JGI25152J39213_1004068 | 3300002773 | Bacteria | 4749 |
| 22 | JGI25152J39213_1013350 | 3300002773 | Bacteria | 1716 |
| 23 | JGI25150J39212_1005722 | 3300002774 | Bacteria | 2630 |
| 24 | JGI25150J39212_1014895 | 3300002774 | Bacteria | 1308 |
| 25 | JGI25159J45721_1001073 | 3300002987 | Bacteria | 11684 |
| 26 | JGI25159J45721_1001804 | 3300002987 | Bacteria | 8589 |
| 27 | JGI25159J45721_1010573 | 3300002987 | Bacteria | 2340 |
| 28 | JGI25151J46595_10000095 | 3300003187 | Bacteria | 118630 |
| 29 | JGI25151J46595_10000682 | 3300003187 | Bacteria | 28683 |
| 30 | JGI25151J46595_10001217 | 3300003187 | Bacteria | 18394 |
| 31 | JGI25151J46595_10004016 | 3300003187 | Bacteria | 7904 |
| 32 | JGI25151J46595_10011646 | 3300003187 | Bacteria | 4035 |
| 33 | JGI25151J46595_10015494 | 3300003187 | Bacteria | 3356 |
| 34 | JGI25151J46595_10025218 | 3300003187 | Bacteria | 2422 |
| 35 | JGI25165J46597_1000022 | 3300003214 | Bacteria | 357959 |
| 36 | JGI25160J50197_1000256 | 3300003354 | Bacteria | 40310 |
| 37 | JGI25160J50197_1000260 | 3300003354 | Bacteria | 39829 |
| 38 | JGI25161J50226_1000015 | 3300003374 | Bacteria | 183773 |
| 39 | JGI25161J50226_1003370 | 3300003374 | Bacteria | 3683 |
| 40 | Ga0055538_1000011 | 3300003751 | Bacteria | 357959 |
| 41 | Ga0055538_1000211 | 3300003751 | Bacteria | 34108 |
| 42 | Ga0055538_1004347 | 3300003751 | Bacteria | 1622 |
| 43 | Ga0055539_1000016 | 3300003752 | Bacteria | 358248 |
| 44 | Ga0055539_1000253 | 3300003752 | Bacteria | 34108 |
| 45 | Ga0055533_1000019 | 3300003756 | Bacteria | 357959 |
| 46 | Ga0055533_1000244 | 3300003756 | Bacteria | 34108 |
| 47 | Ga0055533_1006875 | 3300003756 | Bacteria | 1616 |
| 48 | Ga0055532_1000002 | 3300003758 | Bacteria | 576000 |
| 49 | Ga0055532_1000029 | 3300003758 | Bacteria | 232900 |
| 50 | Ga0055532_1000077 | 3300003758 | Bacteria | 122193 |
| 51 | Ga0055525_1000042 | 3300003759 | Bacteria | 279804 |
| 52 | Ga0055525_1000341 | 3300003759 | Bacteria | 34108 |
| 53 | Ga0055535_1001340 | 3300003761 | Bacteria | 13000 |
| 54 | Ga0055535_1013422 | 3300003761 | Bacteria | 1209 |
| 55 | Ga0055535_1016064 | 3300003761 | Bacteria | 1033 |
| 56 | Ga0055542_1000114 | 3300003762 | Bacteria | 107058 |
| 57 | Ga0055529_1000062 | 3300003763 | Bacteria | 183782 |
| 58 | Ga0055526_1001344 | 3300003771 | Bacteria | 17606 |
| 59 | Ga0055526_1003598 | 3300003771 | Bacteria | 9725 |
| 60 | Ga0055526_1006059 | 3300003771 | Bacteria | 6692 |
| 61 | Ga0055526_1006704 | 3300003771 | Bacteria | 6172 |
| 62 | Ga0055526_1027625 | 3300003771 | Bacteria | 1746 |
| 63 | Ga0055537_1000135 | 3300003773 | Bacteria | 55914 |
| 64 | Ga0055537_1000972 | 3300003773 | Bacteria | 13040 |
| 65 | Ga0055537_1004059 | 3300003773 | Bacteria | 4293 |
| 66 | Ga0055537_1007985 | 3300003773 | Bacteria | 2487 |
| 67 | Ga0055537_1011803 | 3300003773 | Bacteria | 1746 |
| 68 | Ga0055524_1000016 | 3300003775 | Bacteria | 244926 |
| 69 | Ga0055524_1001369 | 3300003775 | Bacteria | 14151 |
| 70 | Ga0055524_1027203 | 3300003775 | Bacteria | 1742 |
| 71 | Ga0055536_1001508 | 3300003781 | Bacteria | 13983 |
| 72 | Ga0055536_1002393 | 3300003781 | Bacteria | 10572 |
| 73 | Ga0055536_1002988 | 3300003781 | Bacteria | 9264 |
| 74 | Ga0055536_1003001 | 3300003781 | Bacteria | 9240 |
| 75 | Ga0055536_1005027 | 3300003781 | Bacteria | 6569 |
| 76 | Ga0055536_1012339 | 3300003781 | Bacteria | 3180 |
| 77 | Ga0055534_1000222 | 3300003784 | Bacteria | 41454 |
| 78 | Ga0055534_1003866 | 3300003784 | Bacteria | 4564 |
| 79 | Ga0055534_1004171 | 3300003784 | Bacteria | 4274 |
| 80 | Ga0055534_1004254 | 3300003784 | Bacteria | 4212 |
| 81 | Ga0055528_1000423 | 3300003790 | Bacteria | 33986 |
| 82 | Ga0055528_1021001 | 3300003790 | Bacteria | 2093 |
| 83 | Ga0055528_1041767 | 3300003790 | Bacteria | 1018 |
| 84 | Ga0055530_10000293 | 3300003791 | Bacteria | 45497 |
| 85 | Ga0055530_10000951 | 3300003791 | Bacteria | 23683 |
| 86 | Ga0055530_10010819 | 3300003791 | Bacteria | 3332 |
| 87 | Ga0055530_10027026 | 3300003791 | Bacteria | 1573 |
| 88 | Ga0055540_1000144 | 3300003792 | Bacteria | 71420 |
| 89 | Ga0055540_1001605 | 3300003792 | Bacteria | 13184 |
| 90 | Ga0055531_10003930 | 3300003794 | Bacteria | 9242 |
| 91 | Ga0055531_10006565 | 3300003794 | Bacteria | 6573 |
| 92 | Ga0055541_1000017 | 3300003841 | Bacteria | 286811 |
| 93 | Ga0055541_1000152 | 3300003841 | Bacteria | 34108 |
| 94 | Ga0055541_1008688 | 3300003841 | Bacteria | 1608 |
| 95 | Ga0065165_1002529 | 3300005262 | Bacteria | 15207 |
| 96 | Ga0065165_1003560 | 3300005262 | Bacteria | 10765 |
| 97 | Ga0065714_10027786 | 3300005288 | Bacteria | 1330 |
| 98 | Ga0065714_10110956 | 3300005288 | Bacteria | 1473 |
| 99 | Ga0065704_10196170 | 3300005289 | Bacteria | 1166 |
| 100 | Ga0065712_10033510 | 3300005290 | Bacteria | 1314 |
| 101 | Ga0065712_10215458 | 3300005290 | Bacteria | 1058 |
| 102 | Ga0065715_10018889 | 3300005293 | Bacteria | 1990 |
| 103 | Ga0065707_10097541 | 3300005295 | Bacteria | 3166 |
| 104 | Ga0070658_10003267 | 3300005327 | Bacteria | 13383 |
| 105 | Ga0070658_10006087 | 3300005327 | Bacteria | 9786 |
| 106 | Ga0070658_10078641 | 3300005327 | Bacteria | 2708 |
| 107 | Ga0070658_10125923 | 3300005327 | Bacteria | 2132 |
| 108 | Ga0070658_10189808 | 3300005327 | Bacteria | 1732 |
| 109 | Ga0070658_10266896 | 3300005327 | Bacteria | 1455 |
| 110 | Ga0070676_10000320 | 3300005328 | Bacteria | 21774 |
| 111 | Ga0070676_10031111 | 3300005328 | Bacteria | 3047 |
| 112 | Ga0070676_10095452 | 3300005328 | Bacteria | 1828 |
| 113 | Ga0070690_100006125 | 3300005330 | Bacteria | 6807 |
| 114 | Ga0070690_100199822 | 3300005330 | Bacteria | 1390 |
| 115 | Ga0070690_100283513 | 3300005330 | Bacteria | 1182 |
| 116 | Ga0070670_100010983 | 3300005331 | Bacteria | 7735 |
| 117 | Ga0070670_100435533 | 3300005331 | Bacteria | 1160 |
| 118 | Ga0070677_10004319 | 3300005333 | Bacteria | 4629 |
| 119 | Ga0070677_10055158 | 3300005333 | Bacteria | 1621 |
| 120 | Ga0070677_10064821 | 3300005333 | Bacteria | 1518 |
| 121 | Ga0068869_100002410 | 3300005334 | Bacteria | 11271 |
| 122 | Ga0068869_100033892 | 3300005334 | Bacteria | 3609 |
| 123 | Ga0068869_100070788 | 3300005334 | Bacteria | 2581 |
| 124 | Ga0068869_100085929 | 3300005334 | Bacteria | 2357 |
| 125 | Ga0070666_10083850 | 3300005335 | Bacteria | 2180 |
| 126 | Ga0070680_100016218 | 3300005336 | Bacteria | 5859 |
| 127 | Ga0070680_100040031 | 3300005336 | Bacteria | 3793 |
| 128 | Ga0070680_100162083 | 3300005336 | Bacteria | 1879 |
| 129 | Ga0068868_100019122 | 3300005338 | Bacteria | 5130 |
| 130 | Ga0068868_100114968 | 3300005338 | Bacteria | 2190 |
| 131 | Ga0068868_100210467 | 3300005338 | Bacteria | 1625 |
| 132 | Ga0070660_100021552 | 3300005339 | Bacteria | 4754 |
| 133 | Ga0070660_100056605 | 3300005339 | Bacteria | 3034 |
| 134 | Ga0070660_100433757 | 3300005339 | Bacteria | 1089 |
| 135 | Ga0070689_100069856 | 3300005340 | Bacteria | 2741 |
| 136 | Ga0070689_100105242 | 3300005340 | Bacteria | 2238 |
| 137 | Ga0070689_100262439 | 3300005340 | Bacteria | 1428 |
| 138 | Ga0070691_10040465 | 3300005341 | Bacteria | 2203 |
| 139 | Ga0070687_100372175 | 3300005343 | Bacteria | 928 |
| 140 | Ga0070661_100016420 | 3300005344 | Bacteria | 5233 |
| 141 | Ga0070661_100034875 | 3300005344 | Bacteria | 3651 |
| 142 | Ga0070692_10010718 | 3300005345 | Bacteria | 4184 |
| 143 | Ga0070668_100027748 | 3300005347 | Bacteria | 4297 |
| 144 | Ga0070668_100033774 | 3300005347 | Bacteria | 3897 |
| 145 | Ga0070668_100037347 | 3300005347 | Bacteria | 3709 |
| 146 | Ga0070669_100024401 | 3300005353 | Bacteria | 4335 |
| 147 | Ga0070669_100029937 | 3300005353 | Bacteria | 3926 |
| 148 | Ga0070675_100001927 | 3300005354 | Bacteria | 15350 |
| 149 | Ga0070675_100047101 | 3300005354 | Bacteria | 3532 |
| 150 | Ga0070675_100101858 | 3300005354 | Bacteria | 2419 |
| 151 | Ga0070675_100362323 | 3300005354 | Bacteria | 1287 |
| 152 | Ga0070671_100084995 | 3300005355 | Bacteria | 2646 |
| 153 | Ga0070671_100272223 | 3300005355 | Bacteria | 1439 |
| 154 | Ga0070671_100308037 | 3300005355 | Bacteria | 1349 |
| 155 | Ga0070671_100324383 | 3300005355 | Bacteria | 1312 |
| 156 | Ga0070671_100395609 | 3300005355 | Bacteria | 1182 |
| 157 | Ga0070674_100029239 | 3300005356 | Bacteria | 3627 |
| 158 | Ga0070674_100073669 | 3300005356 | Bacteria | 2421 |
| 159 | Ga0070673_100037884 | 3300005364 | Bacteria | 3678 |
| 160 | Ga0070673_100061084 | 3300005364 | Bacteria | 2988 |
| 161 | Ga0070673_100065980 | 3300005364 | Bacteria | 2890 |
| 162 | Ga0070688_100257944 | 3300005365 | Bacteria | 1244 |
| 163 | Ga0070659_100001576 | 3300005366 | Bacteria | 16422 |
| 164 | Ga0070659_100012726 | 3300005366 | Bacteria | 6244 |
| 165 | Ga0070659_100013884 | 3300005366 | Bacteria | 6009 |
| 166 | Ga0070659_100239492 | 3300005366 | Bacteria | 1501 |
| 167 | Ga0070659_100324925 | 3300005366 | Bacteria | 1287 |
| 168 | Ga0070667_100044049 | 3300005367 | Bacteria | 3746 |
| 169 | Ga0070667_100048082 | 3300005367 | Bacteria | 3590 |
| 170 | Ga0070667_100071496 | 3300005367 | Bacteria | 2955 |
| 171 | Ga0070667_100249764 | 3300005367 | Bacteria | 1586 |
| 172 | Ga0070714_100019818 | 3300005435 | Bacteria | 5485 |
| 173 | Ga0070701_10003477 | 3300005438 | Bacteria | 6240 |
| 174 | Ga0070705_100025900 | 3300005440 | Bacteria | 3186 |
| 175 | Ga0070705_100029002 | 3300005440 | Bacteria | 3037 |
| 176 | Ga0070705_100379738 | 3300005440 | Bacteria | 1040 |
| 177 | Ga0070700_100010396 | 3300005441 | Bacteria | 5137 |
| 178 | Ga0070663_100007977 | 3300005455 | Bacteria | 6488 |
| 179 | Ga0070663_100039272 | 3300005455 | Bacteria | 3307 |
| 180 | Ga0070678_100002841 | 3300005456 | Bacteria | 9579 |
| 181 | Ga0070678_100017631 | 3300005456 | Bacteria | 4605 |
| 182 | Ga0070678_100066761 | 3300005456 | Bacteria | 2675 |
| 183 | Ga0070678_100169788 | 3300005456 | Bacteria | 1775 |
| 184 | Ga0070678_100226554 | 3300005456 | Bacteria | 1556 |
| 185 | Ga0070662_100008031 | 3300005457 | Bacteria | 6866 |
| 186 | Ga0070662_100032246 | 3300005457 | Bacteria | 3681 |
| 187 | Ga0070662_100081197 | 3300005457 | Bacteria | 2415 |
| 188 | Ga0070662_100185248 | 3300005457 | Bacteria | 1643 |
| 189 | Ga0070662_100193596 | 3300005457 | Bacteria | 1610 |
| 190 | Ga0070681_10016317 | 3300005458 | Bacteria | 7413 |
| 191 | Ga0068867_100001486 | 3300005459 | Bacteria | 16233 |
| 192 | Ga0068867_100015713 | 3300005459 | Bacteria | 5371 |
| 193 | Ga0068867_100022223 | 3300005459 | Bacteria | 4534 |
| 194 | Ga0068867_100104915 | 3300005459 | Bacteria | 2164 |
| 195 | Ga0068867_100106500 | 3300005459 | Bacteria | 2148 |
| 196 | Ga0068867_100164030 | 3300005459 | Bacteria | 1754 |
| 197 | Ga0068867_100257839 | 3300005459 | Bacteria | 1420 |
| 198 | Ga0070685_10146818 | 3300005466 | Bacteria | 1491 |
| 199 | Ga0070706_100027210 | 3300005467 | Bacteria | 5262 |
| 200 | Ga0070706_100035650 | 3300005467 | Bacteria | 4592 |
| 201 | Ga0070706_100405324 | 3300005467 | Bacteria | 1269 |
| 202 | Ga0070707_100018087 | 3300005468 | Bacteria | 6630 |
| 203 | Ga0070707_100266192 | 3300005468 | Bacteria | 1667 |
| 204 | Ga0070698_100008886 | 3300005471 | Bacteria | 10799 |
| 205 | Ga0070698_100187757 | 3300005471 | Bacteria | 2004 |
| 206 | Ga0070699_100063404 | 3300005518 | Bacteria | 3205 |
| 207 | Ga0070699_100195495 | 3300005518 | Bacteria | 1798 |
| 208 | Ga0070679_100007311 | 3300005530 | Bacteria | 10317 |
| 209 | Ga0070679_100064860 | 3300005530 | Bacteria | 3641 |
| 210 | Ga0070679_100127769 | 3300005530 | Bacteria | 2523 |
| 211 | Ga0070679_100144109 | 3300005530 | Bacteria | 2361 |
| 212 | Ga0070679_100162507 | 3300005530 | Bacteria | 2207 |
| 213 | Ga0070679_100300381 | 3300005530 | Bacteria | 1556 |
| 214 | Ga0070684_100017377 | 3300005535 | Bacteria | 5902 |
| 215 | Ga0070684_100204439 | 3300005535 | Bacteria | 1799 |
| 216 | Ga0068853_100039942 | 3300005539 | Bacteria | 4002 |
| 217 | Ga0068853_100090444 | 3300005539 | Bacteria | 2690 |
| 218 | Ga0068853_100110475 | 3300005539 | Bacteria | 2442 |
| 219 | Ga0068853_100286302 | 3300005539 | Bacteria | 1520 |
| 220 | Ga0068853_100301975 | 3300005539 | Bacteria | 1480 |
| 221 | Ga0068853_100438804 | 3300005539 | Bacteria | 1227 |
| 222 | Ga0070672_100000455 | 3300005543 | Bacteria | 23832 |
| 223 | Ga0070672_100001146 | 3300005543 | Bacteria | 16215 |
| 224 | Ga0070672_100021909 | 3300005543 | Bacteria | 4683 |
| 225 | Ga0070672_100046548 | 3300005543 | Bacteria | 3361 |
| 226 | Ga0070686_100154140 | 3300005544 | Bacteria | 1612 |
| 227 | Ga0070686_100177581 | 3300005544 | Bacteria | 1511 |
| 228 | Ga0070686_100209010 | 3300005544 | Bacteria | 1404 |
| 229 | Ga0070686_100209064 | 3300005544 | Bacteria | 1403 |
| 230 | Ga0070686_100266902 | 3300005544 | Bacteria | 1257 |
| 231 | Ga0070686_100291640 | 3300005544 | Bacteria | 1207 |
| 232 | Ga0070695_100140069 | 3300005545 | Bacteria | 1676 |
| 233 | Ga0070695_100251517 | 3300005545 | Bacteria | 1286 |
| 234 | Ga0070693_100003698 | 3300005547 | Bacteria | 7151 |
| 235 | Ga0070693_100012198 | 3300005547 | Bacteria | 4346 |
| 236 | Ga0070693_100047433 | 3300005547 | Bacteria | 2444 |
| 237 | Ga0070693_100273485 | 3300005547 | Bacteria | 1128 |
| 238 | Ga0070693_100307521 | 3300005547 | Bacteria | 1071 |
| 239 | Ga0070665_100011648 | 3300005548 | Bacteria | 8888 |
| 240 | Ga0070665_100060646 | 3300005548 | Bacteria | 3792 |
| 241 | Ga0070665_100066266 | 3300005548 | Bacteria | 3623 |
| 242 | Ga0070704_100438152 | 3300005549 | Bacteria | 1122 |
| 243 | Ga0068855_100012616 | 3300005563 | Bacteria | 10198 |
| 244 | Ga0068855_100022837 | 3300005563 | Bacteria | 7497 |
| 245 | Ga0068855_100033825 | 3300005563 | Bacteria | 6097 |
| 246 | Ga0068855_100061531 | 3300005563 | Bacteria | 4386 |
| 247 | Ga0068855_100066997 | 3300005563 | Bacteria | 4185 |
| 248 | Ga0068855_100077991 | 3300005563 | Bacteria | 3843 |
| 249 | Ga0068855_100140452 | 3300005563 | Bacteria | 2754 |
| 250 | Ga0068855_100142557 | 3300005563 | Bacteria | 2730 |
| 251 | Ga0068855_100255587 | 3300005563 | Bacteria | 1953 |
| 252 | Ga0070664_100014870 | 3300005564 | Bacteria | 6351 |
| 253 | Ga0070664_100125613 | 3300005564 | Bacteria | 2250 |
| 254 | Ga0070664_100140084 | 3300005564 | Bacteria | 2129 |
| 255 | Ga0070664_100204104 | 3300005564 | Bacteria | 1765 |
| 256 | Ga0070664_100308755 | 3300005564 | Bacteria | 1431 |
| 257 | Ga0070664_100309817 | 3300005564 | Bacteria | 1428 |
| 258 | Ga0070664_100365647 | 3300005564 | Bacteria | 1314 |
| 259 | Ga0070664_100487770 | 3300005564 | Bacteria | 1135 |
| 260 | Ga0068857_100001496 | 3300005577 | Bacteria | 18618 |
| 261 | Ga0068857_100010173 | 3300005577 | Bacteria | 8178 |
| 262 | Ga0068857_100051914 | 3300005577 | Bacteria | 3639 |
| 263 | Ga0068857_100077855 | 3300005577 | Bacteria | 2959 |
| 264 | Ga0068854_100002285 | 3300005578 | Bacteria | 11791 |
| 265 | Ga0068854_100004431 | 3300005578 | Bacteria | 8857 |
| 266 | Ga0068854_100009632 | 3300005578 | Bacteria | 6238 |
| 267 | Ga0068854_100021798 | 3300005578 | Bacteria | 4354 |
| 268 | Ga0068854_100046047 | 3300005578 | Bacteria | 3104 |
| 269 | Ga0068854_100068368 | 3300005578 | Bacteria | 2590 |
| 270 | Ga0068856_100009070 | 3300005614 | Bacteria | 9678 |
| 271 | Ga0068856_100018538 | 3300005614 | Bacteria | 6745 |
| 272 | Ga0068856_100061885 | 3300005614 | Bacteria | 3697 |
| 273 | Ga0068856_100120537 | 3300005614 | Bacteria | 2624 |
| 274 | Ga0068856_100193901 | 3300005614 | Bacteria | 2045 |
| 275 | Ga0068856_100241011 | 3300005614 | Bacteria | 1823 |
| 276 | Ga0068856_100481611 | 3300005614 | Bacteria | 1262 |
| 277 | Ga0070702_100010386 | 3300005615 | Bacteria | 4584 |
| 278 | Ga0070702_100015341 | 3300005615 | Bacteria | 3911 |
| 279 | Ga0068852_100001380 | 3300005616 | Bacteria | 16305 |
| 280 | Ga0068852_100039666 | 3300005616 | Bacteria | 3966 |
| 281 | Ga0068852_100061872 | 3300005616 | Bacteria | 3254 |
| 282 | Ga0068852_100068072 | 3300005616 | Bacteria | 3114 |
| 283 | Ga0068852_100129822 | 3300005616 | Bacteria | 2319 |
| 284 | Ga0068852_100216993 | 3300005616 | Bacteria | 1818 |
| 285 | Ga0068852_100219269 | 3300005616 | Bacteria | 1808 |
| 286 | Ga0068852_100526901 | 3300005616 | Bacteria | 1179 |
| 287 | Ga0068859_100007275 | 3300005617 | Bacteria | 11228 |
| 288 | Ga0068859_100016209 | 3300005617 | Bacteria | 7485 |
| 289 | Ga0068859_100082328 | 3300005617 | Bacteria | 3261 |
| 290 | Ga0068859_100154983 | 3300005617 | Bacteria | 2368 |
| 291 | Ga0068859_100513955 | 3300005617 | Bacteria | 1293 |
| 292 | Ga0068864_100010520 | 3300005618 | Bacteria | 7646 |
| 293 | Ga0068864_100031907 | 3300005618 | Bacteria | 4472 |
| 294 | Ga0068864_100044791 | 3300005618 | Bacteria | 3794 |
| 295 | Ga0068864_100060611 | 3300005618 | Bacteria | 3276 |
| 296 | Ga0068866_10005198 | 3300005718 | Bacteria | 5360 |
| 297 | Ga0068866_10025134 | 3300005718 | Bacteria | 2796 |
| 298 | Ga0068866_10154427 | 3300005718 | Bacteria | 1332 |
| 299 | Ga0068861_100003094 | 3300005719 | Bacteria | 10994 |
| 300 | Ga0068861_100032543 | 3300005719 | Bacteria | 3839 |
| 301 | Ga0068861_100041906 | 3300005719 | Bacteria | 3431 |
| 302 | Ga0068861_100043682 | 3300005719 | Bacteria | 3366 |
| 303 | Ga0068861_100284323 | 3300005719 | Bacteria | 1426 |
| 304 | Ga0068851_10013725 | 3300005834 | Bacteria | 3835 |
| 305 | Ga0068851_10047436 | 3300005834 | Bacteria | 2175 |
| 306 | Ga0068851_10075684 | 3300005834 | Bacteria | 1750 |
| 307 | Ga0068851_10101961 | 3300005834 | Bacteria | 1524 |
| 308 | Ga0068851_10133598 | 3300005834 | Bacteria | 1344 |
| 309 | Ga0068870_10016636 | 3300005840 | Bacteria | 3519 |
| 310 | Ga0068870_10023363 | 3300005840 | Bacteria | 3048 |
| 311 | Ga0068863_100001744 | 3300005841 | Bacteria | 21556 |
| 312 | Ga0068863_100022783 | 3300005841 | Bacteria | 5983 |
| 313 | Ga0068858_100029306 | 3300005842 | Bacteria | 5110 |
| 314 | Ga0068858_100053295 | 3300005842 | Bacteria | 3742 |
| 315 | Ga0068858_100077271 | 3300005842 | Bacteria | 3092 |
| 316 | Ga0068858_100402312 | 3300005842 | Bacteria | 1316 |
| 317 | Ga0068860_100035652 | 3300005843 | Bacteria | 4770 |
| 318 | Ga0068860_100050343 | 3300005843 | Bacteria | 3966 |
| 319 | Ga0068860_100100749 | 3300005843 | Bacteria | 2756 |
| 320 | Ga0068860_100256243 | 3300005843 | Bacteria | 1705 |
| 321 | Ga0068862_100015247 | 3300005844 | Bacteria | 6382 |
| 322 | Ga0068862_100020890 | 3300005844 | Bacteria | 5470 |
| 323 | Ga0068862_100039407 | 3300005844 | Bacteria | 4012 |
| 324 | Ga0068862_100056495 | 3300005844 | Bacteria | 3363 |
| 325 | Ga0081455_10001395 | 3300005937 | Bacteria | 29860 |
| 326 | Ga0081455_10002648 | 3300005937 | Bacteria | 21189 |
| 327 | Ga0081455_10010547 | 3300005937 | Bacteria | 9363 |
| 328 | Ga0081539_10015865 | 3300005985 | Bacteria | 5433 |
| 329 | Ga0075365_10002444 | 3300006038 | Bacteria | 9116 |
| 330 | Ga0075365_10044317 | 3300006038 | Bacteria | 2914 |
| 331 | Ga0075365_10121602 | 3300006038 | Bacteria | 1801 |
| 332 | Ga0075365_10123674 | 3300006038 | Bacteria | 1786 |
| 333 | Ga0075365_10142884 | 3300006038 | Bacteria | 1662 |
| 334 | Ga0075368_10015636 | 3300006042 | Bacteria | 2818 |
| 335 | Ga0075368_10015867 | 3300006042 | Bacteria | 2799 |
| 336 | Ga0075363_100017418 | 3300006048 | Bacteria | 3563 |
| 337 | Ga0075363_100027807 | 3300006048 | Bacteria | 2903 |
| 338 | Ga0075363_100038847 | 3300006048 | Bacteria | 2504 |
| 339 | Ga0075363_100046661 | 3300006048 | Bacteria | 2299 |
| 340 | Ga0075364_10037915 | 3300006051 | Bacteria | 3122 |
| 341 | Ga0075364_10064427 | 3300006051 | Bacteria | 2406 |
| 342 | Ga0075364_10090544 | 3300006051 | Bacteria | 2029 |
| 343 | Ga0075364_10118418 | 3300006051 | Bacteria | 1771 |
| 344 | Ga0075432_10003417 | 3300006058 | Bacteria | 5378 |
| 345 | Ga0070715_10013631 | 3300006163 | Bacteria | 2990 |
| 346 | Ga0070712_100318561 | 3300006175 | Bacteria | 1264 |
| 347 | Ga0075362_10003711 | 3300006177 | Bacteria | 5395 |
| 348 | Ga0075362_10004022 | 3300006177 | Bacteria | 5234 |
| 349 | Ga0075362_10009604 | 3300006177 | Bacteria | 3748 |
| 350 | Ga0075362_10015470 | 3300006177 | Bacteria | 3103 |
| 351 | Ga0075362_10027448 | 3300006177 | Bacteria | 2438 |
| 352 | Ga0075362_10047479 | 3300006177 | Bacteria | 1913 |
| 353 | Ga0075362_10074111 | 3300006177 | Bacteria | 1559 |
| 354 | Ga0075362_10121470 | 3300006177 | Bacteria | 1237 |
| 355 | Ga0075367_10008214 | 3300006178 | Bacteria | 5396 |
| 356 | Ga0075367_10095447 | 3300006178 | Bacteria | 1814 |
| 357 | Ga0075367_10103121 | 3300006178 | Bacteria | 1746 |
| 358 | Ga0075367_10106172 | 3300006178 | Bacteria | 1720 |
| 359 | Ga0075367_10106780 | 3300006178 | Bacteria | 1716 |
| 360 | Ga0075367_10182577 | 3300006178 | Bacteria | 1308 |
| 361 | Ga0075369_10000736 | 3300006186 | Bacteria | 10608 |
| 362 | Ga0075369_10014986 | 3300006186 | Bacteria | 3104 |
| 363 | Ga0075366_10008204 | 3300006195 | Bacteria | 5794 |
| 364 | Ga0075366_10020307 | 3300006195 | Bacteria | 3853 |
| 365 | Ga0075366_10023577 | 3300006195 | Bacteria | 3586 |
| 366 | Ga0075366_10025110 | 3300006195 | Bacteria | 3478 |
| 367 | Ga0075366_10039213 | 3300006195 | Bacteria | 2800 |
| 368 | Ga0075366_10048713 | 3300006195 | Bacteria | 2513 |
| 369 | Ga0075366_10064808 | 3300006195 | Bacteria | 2173 |
| 370 | Ga0075366_10124617 | 3300006195 | Bacteria | 1553 |
| 371 | Ga0075366_10139857 | 3300006195 | Bacteria | 1463 |
| 372 | Ga0075366_10202852 | 3300006195 | Bacteria | 1206 |
| 373 | Ga0097621_100005368 | 3300006237 | Bacteria | 9031 |
| 374 | Ga0097621_100046253 | 3300006237 | Bacteria | 3520 |
| 375 | Ga0097621_100046943 | 3300006237 | Bacteria | 3497 |
| 376 | Ga0097621_100052233 | 3300006237 | Bacteria | 3329 |
| 377 | Ga0097621_100062452 | 3300006237 | Bacteria | 3058 |
| 378 | Ga0097621_100300081 | 3300006237 | Bacteria | 1418 |
| 379 | Ga0075370_10001756 | 3300006353 | Bacteria | 9663 |
| 380 | Ga0075370_10004393 | 3300006353 | Bacteria | 6839 |
| 381 | Ga0075370_10005564 | 3300006353 | Bacteria | 6278 |
| 382 | Ga0075370_10008738 | 3300006353 | Bacteria | 5226 |
| 383 | Ga0075370_10008946 | 3300006353 | Bacteria | 5177 |
| 384 | Ga0075370_10012183 | 3300006353 | Bacteria | 4538 |
| 385 | Ga0075370_10017291 | 3300006353 | Bacteria | 3895 |
| 386 | Ga0075370_10062019 | 3300006353 | Bacteria | 2130 |
| 387 | Ga0075370_10173554 | 3300006353 | Bacteria | 1268 |
| 388 | Ga0068871_100011498 | 3300006358 | Bacteria | 6492 |
| 389 | Ga0068871_100014985 | 3300006358 | Bacteria | 5796 |
| 390 | Ga0068871_100027274 | 3300006358 | Bacteria | 4465 |
| 391 | Ga0068871_100032191 | 3300006358 | Bacteria | 4140 |
| 392 | Ga0068871_100038841 | 3300006358 | Bacteria | 3805 |
| 393 | Ga0068871_100364516 | 3300006358 | Bacteria | 1281 |
| 394 | Ga0068871_100542427 | 3300006358 | Bacteria | 1052 |
| 395 | Ga0075434_100828613 | 3300006871 | Bacteria | 941 |
| 396 | Ga0068865_100024637 | 3300006881 | Bacteria | 3950 |
| 397 | Ga0068865_100029315 | 3300006881 | Bacteria | 3650 |
| 398 | Ga0068865_100082262 | 3300006881 | Bacteria | 2314 |
| 399 | Ga0097620_100007275 | 3300006931 | Bacteria | 11228 |
| 400 | Ga0097620_100016209 | 3300006931 | Bacteria | 7485 |
| 401 | Ga0097620_100082323 | 3300006931 | Bacteria | 3261 |
| 402 | Ga0097620_100154981 | 3300006931 | Bacteria | 2368 |
| 403 | Ga0097620_100513937 | 3300006931 | Bacteria | 1293 |
| 404 | Ga0099824_1046569 | 3300006942 | Bacteria | 888 |
| 405 | Ga0099826_10000020 | 3300006948 | Bacteria | 183920 |
| 406 | Ga0099826_10004782 | 3300006948 | Bacteria | 9564 |
| 407 | Ga0099826_10139654 | 3300006948 | Bacteria | 1401 |
| 408 | Ga0099794_10043265 | 3300007265 | Bacteria | 2149 |
| 409 | Ga0099794_10061160 | 3300007265 | Bacteria | 1829 |
| 410 | Ga0099794_10217919 | 3300007265 | Bacteria | 980 |
| 411 | Ga0105251_10001533 | 3300009011 | Bacteria | 19826 |
| 412 | Ga0105251_10072524 | 3300009011 | Bacteria | 1601 |
| 413 | Ga0105251_10164173 | 3300009011 | Bacteria | 1001 |
| 414 | Ga0105244_10005141 | 3300009036 | Bacteria | 8771 |
| 415 | Ga0105244_10114075 | 3300009036 | Bacteria | 1312 |
| 416 | Ga0105240_10002847 | 3300009093 | Bacteria | 27330 |
| 417 | Ga0105240_10004008 | 3300009093 | Bacteria | 22687 |
| 418 | Ga0105240_10004595 | 3300009093 | Bacteria | 20920 |
| 419 | Ga0105240_10006708 | 3300009093 | Bacteria | 16865 |
| 420 | Ga0105240_10010502 | 3300009093 | Bacteria | 13014 |
| 421 | Ga0105240_10021598 | 3300009093 | Bacteria | 8560 |
| 422 | Ga0105240_10050266 | 3300009093 | Bacteria | 5258 |
| 423 | Ga0105240_10052126 | 3300009093 | Bacteria | 5144 |
| 424 | Ga0105240_10180266 | 3300009093 | Bacteria | 2493 |
| 425 | Ga0105240_10409667 | 3300009093 | Bacteria | 1525 |
| 426 | Ga0105245_10038308 | 3300009098 | Bacteria | 4265 |
| 427 | Ga0105245_10057603 | 3300009098 | Bacteria | 3495 |
| 428 | Ga0105245_10077594 | 3300009098 | Bacteria | 3029 |
| 429 | Ga0105245_10120427 | 3300009098 | Bacteria | 2451 |
| 430 | Ga0105245_10471504 | 3300009098 | Bacteria | 1267 |
| 431 | Ga0105245_10826227 | 3300009098 | Bacteria | 966 |
| 432 | Ga0105245_10886509 | 3300009098 | Bacteria | 933 |
| 433 | Ga0114129_10477035 | 3300009147 | Bacteria | 1633 |
| 434 | Ga0105243_10000972 | 3300009148 | Bacteria | 26663 |
| 435 | Ga0105243_10001957 | 3300009148 | Bacteria | 17541 |
| 436 | Ga0105243_10006686 | 3300009148 | Bacteria | 8904 |
| 437 | Ga0105243_10029263 | 3300009148 | Bacteria | 4235 |
| 438 | Ga0105243_10032140 | 3300009148 | Bacteria | 4052 |
| 439 | Ga0105243_10141151 | 3300009148 | Bacteria | 2055 |
| 440 | Ga0105243_10179457 | 3300009148 | Bacteria | 1840 |
| 441 | Ga0105243_10257390 | 3300009148 | Bacteria | 1561 |
| 442 | Ga0105243_10283723 | 3300009148 | Bacteria | 1493 |
| 443 | Ga0105241_10167409 | 3300009174 | Bacteria | 1812 |
| 444 | Ga0105241_10247434 | 3300009174 | Bacteria | 1510 |
| 445 | Ga0105242_10011903 | 3300009176 | Bacteria | 6695 |
| 446 | Ga0105242_10023227 | 3300009176 | Bacteria | 4888 |
| 447 | Ga0105242_10117227 | 3300009176 | Bacteria | 2279 |
| 448 | Ga0105242_10267954 | 3300009176 | Bacteria | 1546 |
| 449 | Ga0105248_10006623 | 3300009177 | Bacteria | 12697 |
| 450 | Ga0105248_10323809 | 3300009177 | Bacteria | 1736 |
| 451 | Ga0105248_10372280 | 3300009177 | Bacteria | 1608 |
| 452 | Ga0105248_11268441 | 3300009177 | Bacteria | 833 |
| 453 | Ga0105237_10001856 | 3300009545 | Bacteria | 27034 |
| 454 | Ga0105237_10004431 | 3300009545 | Bacteria | 16270 |
| 455 | Ga0105237_10010879 | 3300009545 | Bacteria | 9654 |
| 456 | Ga0105237_10033848 | 3300009545 | Bacteria | 5177 |
| 457 | Ga0105237_10257728 | 3300009545 | Bacteria | 1746 |
| 458 | Ga0105237_10559222 | 3300009545 | Bacteria | 1151 |
| 459 | Ga0105238_10000006 | 3300009551 | Bacteria | 346249 |
| 460 | Ga0105238_10010668 | 3300009551 | Bacteria | 9228 |
| 461 | Ga0105238_10036320 | 3300009551 | Bacteria | 5008 |
| 462 | Ga0105238_10062761 | 3300009551 | Bacteria | 3716 |
| 463 | Ga0105238_10106908 | 3300009551 | Bacteria | 2779 |
| 464 | Ga0105238_10155806 | 3300009551 | Bacteria | 2259 |
| 465 | Ga0105238_10377118 | 3300009551 | Bacteria | 1409 |
| 466 | Ga0105249_10025103 | 3300009553 | Bacteria | 5364 |
| 467 | Ga0105249_10052442 | 3300009553 | Bacteria | 3725 |
| 468 | Ga0105249_10237353 | 3300009553 | Bacteria | 1801 |
| 469 | Ga0105249_10413878 | 3300009553 | Bacteria | 1381 |
| 470 | Ga0105239_10001826 | 3300010375 | Bacteria | 27875 |
| 471 | Ga0105239_10006997 | 3300010375 | Bacteria | 12984 |
| 472 | Ga0105239_10066463 | 3300010375 | Bacteria | 3961 |
| 473 | Ga0105239_10102505 | 3300010375 | Bacteria | 3167 |
| 474 | Ga0105239_10675601 | 3300010375 | Bacteria | 1180 |
| 475 | Ga0105239_10837932 | 3300010375 | Bacteria | 1054 |
| 476 | Ga0105246_10099723 | 3300011119 | Bacteria | 2112 |
| 477 | Ga0105246_10230233 | 3300011119 | Bacteria | 1459 |
| 478 | Ga0157371_10065548 | 3300013102 | Bacteria | 2572 |
| 479 | Ga0157371_10116637 | 3300013102 | Bacteria | 1897 |
| 480 | Ga0157370_10007222 | 3300013104 | Bacteria | 12124 |
| 481 | Ga0157370_10019942 | 3300013104 | Bacteria | 6707 |
| 482 | Ga0157370_10154548 | 3300013104 | Bacteria | 2135 |
| 483 | Ga0157370_10447941 | 3300013104 | Bacteria | 1187 |
| 484 | Ga0157369_10002332 | 3300013105 | Bacteria | 22844 |
| 485 | Ga0157369_10041430 | 3300013105 | Bacteria | 5027 |
| 486 | Ga0157369_10080187 | 3300013105 | Bacteria | 3495 |
| 487 | Ga0157369_10086670 | 3300013105 | Bacteria | 3344 |
| 488 | Ga0157369_10087324 | 3300013105 | Bacteria | 3330 |
| 489 | Ga0157369_10326096 | 3300013105 | Bacteria | 1596 |
| 490 | Ga0157369_10441847 | 3300013105 | Bacteria | 1347 |
| 491 | Ga0157374_10019483 | 3300013296 | Bacteria | 6005 |
| 492 | Ga0157374_10030208 | 3300013296 | Bacteria | 4916 |
| 493 | Ga0157374_10109104 | 3300013296 | Bacteria | 2661 |
| 494 | Ga0157378_10021050 | 3300013297 | Bacteria | 5737 |
| 495 | Ga0157378_10243075 | 3300013297 | Bacteria | 1720 |
| 496 | Ga0157378_10371985 | 3300013297 | Bacteria | 1401 |
| 497 | Ga0163162_10009232 | 3300013306 | Bacteria | 9594 |
| 498 | Ga0163162_10023582 | 3300013306 | Bacteria | 6075 |
| 499 | Ga0163162_10074809 | 3300013306 | Bacteria | 3446 |
| 500 | Ga0163162_10269541 | 3300013306 | Bacteria | 1834 |
| 501 | Ga0163162_10356051 | 3300013306 | Bacteria | 1596 |
| 502 | Ga0157372_10000824 | 3300013307 | Bacteria | 33574 |
| 503 | Ga0157372_10045482 | 3300013307 | Bacteria | 4870 |
| 504 | Ga0157372_10085341 | 3300013307 | Bacteria | 3580 |
| 505 | Ga0157372_10219693 | 3300013307 | Bacteria | 2203 |
| 506 | Ga0157372_10271276 | 3300013307 | Bacteria | 1971 |
| 507 | Ga0157372_10290053 | 3300013307 | Bacteria | 1903 |
| 508 | Ga0157372_11097025 | 3300013307 | Bacteria | 921 |
| 509 | Ga0157375_10108568 | 3300013308 | Bacteria | 2870 |
| 510 | Ga0157375_10146754 | 3300013308 | Bacteria | 2490 |
| 511 | Ga0157375_10160675 | 3300013308 | Bacteria | 2388 |
| 512 | Ga0157375_10164555 | 3300013308 | Bacteria | 2362 |
| 513 | Ga0157375_10294349 | 3300013308 | Bacteria | 1786 |
| 514 | Ga0157375_10340146 | 3300013308 | Bacteria | 1666 |
| 515 | Ga0157375_10915607 | 3300013308 | Bacteria | 1020 |
| 516 | Ga0163163_10617822 | 3300014325 | Bacteria | 1147 |
| 517 | Ga0157380_10038996 | 3300014326 | Bacteria | 3692 |
| 518 | Ga0157380_10090437 | 3300014326 | Bacteria | 2525 |
| 519 | Ga0157380_10455407 | 3300014326 | Bacteria | 1230 |
| 520 | Ga0182008_10000729 | 3300014497 | Bacteria | 23349 |
| 521 | Ga0182008_10003871 | 3300014497 | Bacteria | 8892 |
| 522 | Ga0182008_10016800 | 3300014497 | Bacteria | 3796 |
| 523 | Ga0182008_10019464 | 3300014497 | Bacteria | 3503 |
| 524 | Ga0182008_10036706 | 3300014497 | Bacteria | 2452 |
| 525 | Ga0182008_10069564 | 3300014497 | Bacteria | 1732 |
| 526 | Ga0182008_10075108 | 3300014497 | Bacteria | 1663 |
| 527 | Ga0157377_10009636 | 3300014745 | Bacteria | 4750 |
| 528 | Ga0157379_10005798 | 3300014968 | Bacteria | 10628 |
| 529 | Ga0157379_10015108 | 3300014968 | Bacteria | 6772 |
| 530 | Ga0157379_10157387 | 3300014968 | Bacteria | 2050 |
| 531 | Ga0157379_10253212 | 3300014968 | Bacteria | 1599 |
| 532 | Ga0157376_10008025 | 3300014969 | Bacteria | 7581 |
| 533 | Ga0157376_10032170 | 3300014969 | Bacteria | 4209 |
| 534 | Ga0157376_10435700 | 3300014969 | Bacteria | 1275 |
| 535 | Ga0157376_10740834 | 3300014969 | Bacteria | 991 |
| 536 | Ga0182006_1000680 | 3300015261 | Bacteria | 23835 |
| 537 | Ga0182006_1003026 | 3300015261 | Bacteria | 8847 |
| 538 | Ga0182006_1008332 | 3300015261 | Bacteria | 4699 |
| 539 | Ga0182006_1037486 | 3300015261 | Bacteria | 1921 |
| 540 | Ga0182006_1048476 | 3300015261 | Bacteria | 1643 |
| 541 | Ga0182007_10000164 | 3300015262 | Bacteria | 45789 |
| 542 | Ga0182007_10002069 | 3300015262 | Bacteria | 10313 |
| 543 | Ga0182007_10008922 | 3300015262 | Bacteria | 4083 |
| 544 | Ga0182007_10012543 | 3300015262 | Bacteria | 3255 |
| 545 | Ga0182005_1000986 | 3300015265 | Bacteria | 12316 |
| 546 | Ga0182005_1053904 | 3300015265 | Bacteria | 1095 |
| 547 | Ga0183361_10013 | 3300016635 | Bacteria | 179680 |
| 548 | Ga0163161_10007253 | 3300017792 | Bacteria | 7658 |
| 549 | Ga0163161_10009227 | 3300017792 | Bacteria | 6819 |
| 550 | Ga0163161_10010284 | 3300017792 | Bacteria | 6480 |
| 551 | Ga0163161_10030116 | 3300017792 | Bacteria | 3861 |
| 552 | Ga0163161_10032692 | 3300017792 | Bacteria | 3716 |
| 553 | Ga0163161_10058577 | 3300017792 | Bacteria | 2800 |
| 554 | Ga0163161_10108933 | 3300017792 | Bacteria | 2069 |
| 555 | Ga0213872_10001779 | 3300021361 | Bacteria | 13462 |
| 556 | Ga0213872_10035049 | 3300021361 | Bacteria | 2295 |
| 557 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 558 | Ga0209435_100048 | 3300025206 | Bacteria | 92746 |
| 559 | Ga0209435_100221 | 3300025206 | Bacteria | 16116 |
| 560 | Ga0209760_100904 | 3300025207 | Bacteria | 3720 |
| 561 | Ga0209784_100009 | 3300025224 | Bacteria | 688031 |
| 562 | Ga0209784_100019 | 3300025224 | Bacteria | 453558 |
| 563 | Ga0209784_102760 | 3300025224 | Bacteria | 1670 |
| 564 | Ga0209566_100007 | 3300025225 | Bacteria | 688031 |
| 565 | Ga0209566_100017 | 3300025225 | Bacteria | 453558 |
| 566 | Ga0209674_100018 | 3300025226 | Bacteria | 688031 |
| 567 | Ga0209674_100031 | 3300025226 | Bacteria | 453558 |
| 568 | Ga0209674_106377 | 3300025226 | Bacteria | 1614 |
| 569 | Ga0209672_100052 | 3300025228 | Bacteria | 231179 |
| 570 | Ga0209672_100190 | 3300025228 | Bacteria | 49762 |
| 571 | Ga0209672_101186 | 3300025228 | Bacteria | 10604 |
| 572 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 573 | Ga0209147_100122 | 3300025229 | Bacteria | 138553 |
| 574 | Ga0209563_100020 | 3300025230 | Bacteria | 688031 |
| 575 | Ga0209563_100035 | 3300025230 | Bacteria | 453558 |
| 576 | Ga0209563_111684 | 3300025230 | Bacteria | 1231 |
| 577 | Ga0207427_100296 | 3300025231 | Bacteria | 34920 |
| 578 | Ga0207427_101737 | 3300025231 | Bacteria | 7155 |
| 579 | Ga0209437_100038 | 3300025233 | Bacteria | 453558 |
| 580 | Ga0209437_100081 | 3300025233 | Bacteria | 271072 |
| 581 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 582 | Ga0209258_100225 | 3300025242 | Bacteria | 107138 |
| 583 | Ga0209258_100230 | 3300025242 | Bacteria | 104468 |
| 584 | Ga0209258_100869 | 3300025242 | Bacteria | 16009 |
| 585 | Ga0207425_1000149 | 3300025245 | Bacteria | 59740 |
| 586 | Ga0207425_1000530 | 3300025245 | Bacteria | 23292 |
| 587 | Ga0207425_1002683 | 3300025245 | Bacteria | 6093 |
| 588 | Ga0207425_1007888 | 3300025245 | Bacteria | 2771 |
| 589 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 590 | Ga0209646_1000130 | 3300025246 | Bacteria | 128556 |
| 591 | Ga0209646_1000152 | 3300025246 | Bacteria | 97484 |
| 592 | Ga0209646_1000214 | 3300025246 | Bacteria | 64093 |
| 593 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 594 | Ga0209026_1000059 | 3300025250 | Bacteria | 226652 |
| 595 | Ga0209026_1000126 | 3300025250 | Bacteria | 122422 |
| 596 | Ga0209677_100010 | 3300025253 | Bacteria | 688031 |
| 597 | Ga0209677_100020 | 3300025253 | Bacteria | 453558 |
| 598 | Ga0209677_100226 | 3300025253 | Bacteria | 40136 |
| 599 | Ga0209148_1000040 | 3300025254 | Bacteria | 473531 |
| 600 | Ga0209148_1003376 | 3300025254 | Bacteria | 4465 |
| 601 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 602 | Ga0209759_1000188 | 3300025256 | Bacteria | 99987 |
| 603 | Ga0209759_1000193 | 3300025256 | Bacteria | 97484 |
| 604 | Ga0209759_1000365 | 3300025256 | Bacteria | 56836 |
| 605 | Ga0209759_1000509 | 3300025256 | Bacteria | 42206 |
| 606 | Ga0209759_1015272 | 3300025256 | Bacteria | 1987 |
| 607 | Ga0209129_1000007 | 3300025258 | Bacteria | 771325 |
| 608 | Ga0209129_1000119 | 3300025258 | Bacteria | 138904 |
| 609 | Ga0209233_1000049 | 3300025261 | Bacteria | 453558 |
| 610 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 611 | Ga0209565_1000085 | 3300025263 | Bacteria | 153075 |
| 612 | Ga0209565_1000092 | 3300025263 | Bacteria | 141563 |
| 613 | Ga0209565_1000365 | 3300025263 | Bacteria | 38942 |
| 614 | Ga0209565_1000394 | 3300025263 | Bacteria | 36822 |
| 615 | Ga0209565_1004286 | 3300025263 | Bacteria | 4392 |
| 616 | Ga0209565_1014546 | 3300025263 | Bacteria | 1802 |
| 617 | Ga0209455_1000021 | 3300025272 | Bacteria | 699993 |
| 618 | Ga0209673_1000045 | 3300025273 | Bacteria | 290531 |
| 619 | Ga0209673_1000133 | 3300025273 | Bacteria | 161740 |
| 620 | Ga0209673_1000445 | 3300025273 | Bacteria | 70702 |
| 621 | Ga0209673_1003004 | 3300025273 | Bacteria | 10492 |
| 622 | Ga0209673_1005760 | 3300025273 | Bacteria | 6167 |
| 623 | Ga0209673_1027752 | 3300025273 | Bacteria | 1836 |
| 624 | Ga0209130_1000056 | 3300025284 | Bacteria | 210851 |
| 625 | Ga0209130_1000070 | 3300025284 | Bacteria | 179057 |
| 626 | Ga0209130_1000634 | 3300025284 | Bacteria | 33021 |
| 627 | Ga0209130_1001057 | 3300025284 | Bacteria | 20883 |
| 628 | Ga0209130_1004319 | 3300025284 | Bacteria | 5467 |
| 629 | Ga0209675_1000083 | 3300025291 | Bacteria | 153075 |
| 630 | Ga0209675_1000411 | 3300025291 | Bacteria | 35155 |
| 631 | Ga0209675_1000809 | 3300025291 | Bacteria | 20627 |
| 632 | Ga0209675_1000951 | 3300025291 | Bacteria | 18424 |
| 633 | Ga0209675_1002465 | 3300025291 | Bacteria | 9496 |
| 634 | Ga0209675_1007014 | 3300025291 | Bacteria | 4399 |
| 635 | Ga0209675_1007810 | 3300025291 | Bacteria | 4030 |
| 636 | Ga0209675_1013763 | 3300025291 | Bacteria | 2507 |
| 637 | Ga0209675_1041373 | 3300025291 | Bacteria | 1006 |
| 638 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 639 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 640 | Ga0209676_1000012 | 3300025292 | Bacteria | 841431 |
| 641 | Ga0209676_1000268 | 3300025292 | Bacteria | 108430 |
| 642 | Ga0209676_1000565 | 3300025292 | Bacteria | 55881 |
| 643 | Ga0209676_1006485 | 3300025292 | Bacteria | 5762 |
| 644 | Ga0209676_1013164 | 3300025292 | Bacteria | 3197 |
| 645 | Ga0209025_1000055 | 3300025294 | Bacteria | 316748 |
| 646 | Ga0209025_1000111 | 3300025294 | Bacteria | 218982 |
| 647 | Ga0209025_1000455 | 3300025294 | Bacteria | 79964 |
| 648 | Ga0209025_1000529 | 3300025294 | Bacteria | 72736 |
| 649 | Ga0209025_1000892 | 3300025294 | Bacteria | 46436 |
| 650 | Ga0209025_1001053 | 3300025294 | Bacteria | 40223 |
| 651 | Ga0209025_1001159 | 3300025294 | Bacteria | 37305 |
| 652 | Ga0209025_1001484 | 3300025294 | Bacteria | 30443 |
| 653 | Ga0209025_1003293 | 3300025294 | Bacteria | 15544 |
| 654 | Ga0209025_1004030 | 3300025294 | Bacteria | 13170 |
| 655 | Ga0209025_1007672 | 3300025294 | Bacteria | 7971 |
| 656 | Ga0209025_1034371 | 3300025294 | Bacteria | 2316 |
| 657 | Ga0209564_1000024 | 3300025295 | Bacteria | 535041 |
| 658 | Ga0209564_1000772 | 3300025295 | Bacteria | 44476 |
| 659 | Ga0209564_1001095 | 3300025295 | Bacteria | 32240 |
| 660 | Ga0209564_1001593 | 3300025295 | Bacteria | 22188 |
| 661 | Ga0209564_1002067 | 3300025295 | Bacteria | 17262 |
| 662 | Ga0209564_1002203 | 3300025295 | Bacteria | 16266 |
| 663 | Ga0209564_1004894 | 3300025295 | Bacteria | 7945 |
| 664 | Ga0209758_1000025 | 3300025297 | Bacteria | 586687 |
| 665 | Ga0209758_1000194 | 3300025297 | Bacteria | 134196 |
| 666 | Ga0209758_1010717 | 3300025297 | Bacteria | 5438 |
| 667 | Ga0209758_1032044 | 3300025297 | Bacteria | 2143 |
| 668 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 669 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 670 | Ga0209050_1000855 | 3300025298 | Bacteria | 41306 |
| 671 | Ga0209050_1000965 | 3300025298 | Bacteria | 37080 |
| 672 | Ga0209050_1002597 | 3300025298 | Bacteria | 14964 |
| 673 | Ga0209050_1011581 | 3300025298 | Bacteria | 4158 |
| 674 | Ga0209050_1024573 | 3300025298 | Bacteria | 2079 |
| 675 | Ga0209050_1029763 | 3300025298 | Bacteria | 1737 |
| 676 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 677 | Ga0209256_1000050 | 3300025299 | Bacteria | 308622 |
| 678 | Ga0209256_1000063 | 3300025299 | Bacteria | 252716 |
| 679 | Ga0209256_1000804 | 3300025299 | Bacteria | 40181 |
| 680 | Ga0209256_1001280 | 3300025299 | Bacteria | 27204 |
| 681 | Ga0209256_1035621 | 3300025299 | Bacteria | 1313 |
| 682 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 683 | Ga0207426_1000025 | 3300025302 | Bacteria | 532921 |
| 684 | Ga0207426_1000028 | 3300025302 | Bacteria | 483955 |
| 685 | Ga0207426_1000050 | 3300025302 | Bacteria | 393022 |
| 686 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 687 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 688 | Ga0209051_1000471 | 3300025303 | Bacteria | 52463 |
| 689 | Ga0209051_1000653 | 3300025303 | Bacteria | 39211 |
| 690 | Ga0209051_1000868 | 3300025303 | Bacteria | 30598 |
| 691 | Ga0209051_1005176 | 3300025303 | Bacteria | 7726 |
| 692 | Ga0209051_1033026 | 3300025303 | Bacteria | 1963 |
| 693 | Ga0209051_1038832 | 3300025303 | Bacteria | 1728 |
| 694 | Ga0209051_1051899 | 3300025303 | Bacteria | 1360 |
| 695 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 696 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 697 | Ga0209257_1000333 | 3300025304 | Bacteria | 98599 |
| 698 | Ga0209257_1001358 | 3300025304 | Bacteria | 29602 |
| 699 | Ga0209257_1011611 | 3300025304 | Bacteria | 4213 |
| 700 | Ga0209257_1024648 | 3300025304 | Bacteria | 2077 |
| 701 | Ga0207697_10002378 | 3300025315 | Bacteria | 9799 |
| 702 | Ga0207697_10020586 | 3300025315 | Bacteria | 2700 |
| 703 | Ga0207656_10000643 | 3300025321 | Bacteria | 11407 |
| 704 | Ga0207656_10020269 | 3300025321 | Bacteria | 2641 |
| 705 | Ga0207656_10098013 | 3300025321 | Bacteria | 1340 |
| 706 | Ga0207655_1001500 | 3300025728 | Bacteria | 21323 |
| 707 | Ga0207713_1001321 | 3300025735 | Bacteria | 20334 |
| 708 | Ga0207713_1044765 | 3300025735 | Bacteria | 1814 |
| 709 | Ga0207682_10003666 | 3300025893 | Bacteria | 6627 |
| 710 | Ga0207692_10182444 | 3300025898 | Bacteria | 1223 |
| 711 | Ga0207642_10003514 | 3300025899 | Bacteria | 4957 |
| 712 | Ga0207642_10038886 | 3300025899 | Bacteria | 2062 |
| 713 | Ga0207688_10012507 | 3300025901 | Bacteria | 4619 |
| 714 | Ga0207680_10010960 | 3300025903 | Bacteria | 4558 |
| 715 | Ga0207647_10014923 | 3300025904 | Bacteria | 5339 |
| 716 | Ga0207645_10001135 | 3300025907 | Bacteria | 22045 |
| 717 | Ga0207645_10007822 | 3300025907 | Bacteria | 7517 |
| 718 | Ga0207645_10017063 | 3300025907 | Bacteria | 4797 |
| 719 | Ga0207645_10053658 | 3300025907 | Bacteria | 2576 |
| 720 | Ga0207645_10113351 | 3300025907 | Bacteria | 1756 |
| 721 | Ga0207643_10019545 | 3300025908 | Bacteria | 3713 |
| 722 | Ga0207705_10018161 | 3300025909 | Bacteria | 5028 |
| 723 | Ga0207684_10131874 | 3300025910 | Bacteria | 2145 |
| 724 | Ga0207684_10277967 | 3300025910 | Bacteria | 1444 |
| 725 | Ga0207684_10479346 | 3300025910 | Bacteria | 1067 |
| 726 | Ga0207695_10001505 | 3300025913 | Bacteria | 38722 |
| 727 | Ga0207695_10006633 | 3300025913 | Bacteria | 14949 |
| 728 | Ga0207695_10008251 | 3300025913 | Bacteria | 13072 |
| 729 | Ga0207695_10029238 | 3300025913 | Bacteria | 6095 |
| 730 | Ga0207695_10030526 | 3300025913 | Bacteria | 5932 |
| 731 | Ga0207695_10039904 | 3300025913 | Bacteria | 5041 |
| 732 | Ga0207695_10084680 | 3300025913 | Bacteria | 3201 |
| 733 | Ga0207695_10163830 | 3300025913 | Bacteria | 2153 |
| 734 | Ga0207695_10311798 | 3300025913 | Bacteria | 1463 |
| 735 | Ga0207695_10405949 | 3300025913 | Bacteria | 1247 |
| 736 | Ga0207671_10004003 | 3300025914 | Bacteria | 14317 |
| 737 | Ga0207671_10009919 | 3300025914 | Bacteria | 7915 |
| 738 | Ga0207671_10026658 | 3300025914 | Bacteria | 4327 |
| 739 | Ga0207660_10036117 | 3300025917 | Bacteria | 3435 |
| 740 | Ga0207660_10037492 | 3300025917 | Bacteria | 3379 |
| 741 | Ga0207660_10126285 | 3300025917 | Bacteria | 1943 |
| 742 | Ga0207660_10164733 | 3300025917 | Bacteria | 1713 |
| 743 | Ga0207662_10064263 | 3300025918 | Bacteria | 2208 |
| 744 | Ga0207662_10190480 | 3300025918 | Bacteria | 1323 |
| 745 | Ga0207657_10020709 | 3300025919 | Bacteria | 6208 |
| 746 | Ga0207657_10073322 | 3300025919 | Bacteria | 2893 |
| 747 | Ga0207657_10378386 | 3300025919 | Bacteria | 1115 |
| 748 | Ga0207649_10013461 | 3300025920 | Bacteria | 4567 |
| 749 | Ga0207649_10029598 | 3300025920 | Bacteria | 3235 |
| 750 | Ga0207649_10056277 | 3300025920 | Bacteria | 2455 |
| 751 | Ga0207649_10068702 | 3300025920 | Bacteria | 2254 |
| 752 | Ga0207652_10015548 | 3300025921 | Bacteria | 6190 |
| 753 | Ga0207652_10068117 | 3300025921 | Bacteria | 3087 |
| 754 | Ga0207652_10075901 | 3300025921 | Bacteria | 2930 |
| 755 | Ga0207652_10137247 | 3300025921 | Bacteria | 2185 |
| 756 | Ga0207646_10121103 | 3300025922 | Bacteria | 2351 |
| 757 | Ga0207681_10000793 | 3300025923 | Bacteria | 20836 |
| 758 | Ga0207681_10002665 | 3300025923 | Bacteria | 11317 |
| 759 | Ga0207681_10224062 | 3300025923 | Bacteria | 1456 |
| 760 | Ga0207681_10395454 | 3300025923 | Bacteria | 1115 |
| 761 | Ga0207694_10000207 | 3300025924 | Bacteria | 58059 |
| 762 | Ga0207694_10022635 | 3300025924 | Bacteria | 4768 |
| 763 | Ga0207694_10069738 | 3300025924 | Bacteria | 2747 |
| 764 | Ga0207694_10120675 | 3300025924 | Bacteria | 2093 |
| 765 | Ga0207694_10334054 | 3300025924 | Bacteria | 1252 |
| 766 | Ga0207694_10400193 | 3300025924 | Bacteria | 1142 |
| 767 | Ga0207650_10001429 | 3300025925 | Bacteria | 17220 |
| 768 | Ga0207650_10185806 | 3300025925 | Bacteria | 1658 |
| 769 | Ga0207650_10380644 | 3300025925 | Bacteria | 1165 |
| 770 | Ga0207659_10021910 | 3300025926 | Bacteria | 4249 |
| 771 | Ga0207659_10027526 | 3300025926 | Bacteria | 3850 |
| 772 | Ga0207659_10078376 | 3300025926 | Bacteria | 2434 |
| 773 | Ga0207659_10123770 | 3300025926 | Bacteria | 1985 |
| 774 | Ga0207659_10178957 | 3300025926 | Bacteria | 1678 |
| 775 | Ga0207687_10029646 | 3300025927 | Bacteria | 3682 |
| 776 | Ga0207687_10035677 | 3300025927 | Bacteria | 3384 |
| 777 | Ga0207687_10053889 | 3300025927 | Bacteria | 2812 |
| 778 | Ga0207687_10067070 | 3300025927 | Bacteria | 2552 |
| 779 | Ga0207687_10112874 | 3300025927 | Bacteria | 2020 |
| 780 | Ga0207687_10124264 | 3300025927 | Bacteria | 1934 |
| 781 | Ga0207687_10195877 | 3300025927 | Bacteria | 1576 |
| 782 | Ga0207644_10003406 | 3300025931 | Bacteria | 10259 |
| 783 | Ga0207644_10015176 | 3300025931 | Bacteria | 5168 |
| 784 | Ga0207644_10162524 | 3300025931 | Bacteria | 1737 |
| 785 | Ga0207690_10023271 | 3300025932 | Bacteria | 3865 |
| 786 | Ga0207690_10057688 | 3300025932 | Bacteria | 2624 |
| 787 | Ga0207690_10059063 | 3300025932 | Bacteria | 2597 |
| 788 | Ga0207706_10009396 | 3300025933 | Bacteria | 8975 |
| 789 | Ga0207706_10022480 | 3300025933 | Bacteria | 5659 |
| 790 | Ga0207706_10075459 | 3300025933 | Bacteria | 2965 |
| 791 | Ga0207706_10090343 | 3300025933 | Bacteria | 2693 |
| 792 | Ga0207706_10110879 | 3300025933 | Bacteria | 2414 |
| 793 | Ga0207686_10011111 | 3300025934 | Bacteria | 4921 |
| 794 | Ga0207686_10024302 | 3300025934 | Bacteria | 3510 |
| 795 | Ga0207686_10041020 | 3300025934 | Bacteria | 2819 |
| 796 | Ga0207686_10133878 | 3300025934 | Bacteria | 1704 |
| 797 | Ga0207709_10000684 | 3300025935 | Bacteria | 27353 |
| 798 | Ga0207709_10001331 | 3300025935 | Bacteria | 17454 |
| 799 | Ga0207709_10010515 | 3300025935 | Bacteria | 5095 |
| 800 | Ga0207709_10012802 | 3300025935 | Bacteria | 4625 |
| 801 | Ga0207709_10026682 | 3300025935 | Bacteria | 3320 |
| 802 | Ga0207709_10040360 | 3300025935 | Bacteria | 2794 |
| 803 | Ga0207709_10334856 | 3300025935 | Bacteria | 1137 |
| 804 | Ga0207670_10049946 | 3300025936 | Bacteria | 2800 |
| 805 | Ga0207670_10307838 | 3300025936 | Bacteria | 1242 |
| 806 | Ga0207670_10540158 | 3300025936 | Bacteria | 951 |
| 807 | Ga0207669_10006488 | 3300025937 | Bacteria | 5353 |
| 808 | Ga0207704_10039248 | 3300025938 | Bacteria | 2755 |
| 809 | Ga0207704_10044782 | 3300025938 | Bacteria | 2624 |
| 810 | Ga0207704_10052843 | 3300025938 | Bacteria | 2465 |
| 811 | Ga0207704_10064635 | 3300025938 | Bacteria | 2287 |
| 812 | Ga0207704_10106398 | 3300025938 | Bacteria | 1884 |
| 813 | Ga0207665_10185562 | 3300025939 | Bacteria | 1508 |
| 814 | Ga0207691_10000973 | 3300025940 | Bacteria | 28494 |
| 815 | Ga0207691_10001288 | 3300025940 | Bacteria | 25003 |
| 816 | Ga0207691_10003133 | 3300025940 | Bacteria | 16161 |
| 817 | Ga0207691_10005935 | 3300025940 | Bacteria | 11791 |
| 818 | Ga0207691_10406246 | 3300025940 | Bacteria | 1161 |
| 819 | Ga0207711_10012438 | 3300025941 | Bacteria | 7074 |
| 820 | Ga0207711_10012450 | 3300025941 | Bacteria | 7070 |
| 821 | Ga0207711_10069679 | 3300025941 | Bacteria | 3049 |
| 822 | Ga0207711_10307326 | 3300025941 | Bacteria | 1463 |
| 823 | Ga0207689_10000591 | 3300025942 | Bacteria | 34621 |
| 824 | Ga0207689_10013054 | 3300025942 | Bacteria | 7094 |
| 825 | Ga0207689_10019585 | 3300025942 | Bacteria | 5702 |
| 826 | Ga0207689_10024609 | 3300025942 | Bacteria | 5049 |
| 827 | Ga0207689_10051124 | 3300025942 | Bacteria | 3407 |
| 828 | Ga0207689_10084343 | 3300025942 | Bacteria | 2612 |
| 829 | Ga0207661_10029479 | 3300025944 | Bacteria | 4215 |
| 830 | Ga0207679_10017656 | 3300025945 | Bacteria | 4764 |
| 831 | Ga0207679_10053658 | 3300025945 | Bacteria | 2964 |
| 832 | Ga0207679_10154175 | 3300025945 | Bacteria | 1874 |
| 833 | Ga0207679_10593778 | 3300025945 | Bacteria | 997 |
| 834 | Ga0207667_10002183 | 3300025949 | Bacteria | 24557 |
| 835 | Ga0207667_10013188 | 3300025949 | Bacteria | 9474 |
| 836 | Ga0207667_10017157 | 3300025949 | Bacteria | 8161 |
| 837 | Ga0207667_10063697 | 3300025949 | Bacteria | 3852 |
| 838 | Ga0207667_10063933 | 3300025949 | Bacteria | 3844 |
| 839 | Ga0207667_10108543 | 3300025949 | Bacteria | 2863 |
| 840 | Ga0207651_10004181 | 3300025960 | Bacteria | 7224 |
| 841 | Ga0207651_10015790 | 3300025960 | Bacteria | 4400 |
| 842 | Ga0207651_10088607 | 3300025960 | Bacteria | 2256 |
| 843 | Ga0207651_10532444 | 3300025960 | Bacteria | 1019 |
| 844 | Ga0207651_10541120 | 3300025960 | Bacteria | 1011 |
| 845 | Ga0207712_10023222 | 3300025961 | Bacteria | 4091 |
| 846 | Ga0207712_10133316 | 3300025961 | Bacteria | 1896 |
| 847 | Ga0207712_10296309 | 3300025961 | Bacteria | 1325 |
| 848 | Ga0207668_10027270 | 3300025972 | Bacteria | 3719 |
| 849 | Ga0207668_10043298 | 3300025972 | Bacteria | 3054 |
| 850 | Ga0207668_10065671 | 3300025972 | Bacteria | 2569 |
| 851 | Ga0207640_10005404 | 3300025981 | Bacteria | 6965 |
| 852 | Ga0207640_10027941 | 3300025981 | Bacteria | 3442 |
| 853 | Ga0207640_10128730 | 3300025981 | Bacteria | 1826 |
| 854 | Ga0207640_10133594 | 3300025981 | Bacteria | 1797 |
| 855 | Ga0207658_10022892 | 3300025986 | Bacteria | 4354 |
| 856 | Ga0207658_10037007 | 3300025986 | Bacteria | 3502 |
| 857 | Ga0207658_10055388 | 3300025986 | Bacteria | 2938 |
| 858 | Ga0207658_10170296 | 3300025986 | Bacteria | 1793 |
| 859 | Ga0207658_10384393 | 3300025986 | Bacteria | 1230 |
| 860 | Ga0207677_10019626 | 3300026023 | Bacteria | 4087 |
| 861 | Ga0207677_10026789 | 3300026023 | Bacteria | 3620 |
| 862 | Ga0207677_10185856 | 3300026023 | Bacteria | 1639 |
| 863 | Ga0207677_10228816 | 3300026023 | Bacteria | 1496 |
| 864 | Ga0207677_10266010 | 3300026023 | Bacteria | 1400 |
| 865 | Ga0207703_10002400 | 3300026035 | Bacteria | 16286 |
| 866 | Ga0207703_10046087 | 3300026035 | Bacteria | 3510 |
| 867 | Ga0207639_10005602 | 3300026041 | Bacteria | 8497 |
| 868 | Ga0207639_10132266 | 3300026041 | Bacteria | 2067 |
| 869 | Ga0207639_10302799 | 3300026041 | Bacteria | 1414 |
| 870 | Ga0207639_10469301 | 3300026041 | Bacteria | 1145 |
| 871 | Ga0207639_10628078 | 3300026041 | Bacteria | 992 |
| 872 | Ga0207678_10014575 | 3300026067 | Bacteria | 6917 |
| 873 | Ga0207678_10063186 | 3300026067 | Bacteria | 3182 |
| 874 | Ga0207678_10152644 | 3300026067 | Bacteria | 1972 |
| 875 | Ga0207678_10309787 | 3300026067 | Bacteria | 1357 |
| 876 | Ga0207708_10005823 | 3300026075 | Bacteria | 9117 |
| 877 | Ga0207708_10013196 | 3300026075 | Bacteria | 6169 |
| 878 | Ga0207702_10001439 | 3300026078 | Bacteria | 23650 |
| 879 | Ga0207702_10093495 | 3300026078 | Bacteria | 2637 |
| 880 | Ga0207702_10176941 | 3300026078 | Bacteria | 1961 |
| 881 | Ga0207641_10003472 | 3300026088 | Bacteria | 13960 |
| 882 | Ga0207641_10006729 | 3300026088 | Bacteria | 9631 |
| 883 | Ga0207641_10193440 | 3300026088 | Bacteria | 1871 |
| 884 | Ga0207648_10002124 | 3300026089 | Bacteria | 21566 |
| 885 | Ga0207648_10006556 | 3300026089 | Bacteria | 11561 |
| 886 | Ga0207648_10011202 | 3300026089 | Bacteria | 8454 |
| 887 | Ga0207648_10109510 | 3300026089 | Bacteria | 2425 |
| 888 | Ga0207648_10126629 | 3300026089 | Bacteria | 2247 |
| 889 | Ga0207648_10135160 | 3300026089 | Bacteria | 2172 |
| 890 | Ga0207648_10173204 | 3300026089 | Bacteria | 1908 |
| 891 | Ga0207676_10006970 | 3300026095 | Bacteria | 8010 |
| 892 | Ga0207676_10035437 | 3300026095 | Bacteria | 3787 |
| 893 | Ga0207676_10205549 | 3300026095 | Bacteria | 1743 |
| 894 | Ga0207674_10005404 | 3300026116 | Bacteria | 15190 |
| 895 | Ga0207674_10011591 | 3300026116 | Bacteria | 9901 |
| 896 | Ga0207674_10013504 | 3300026116 | Bacteria | 9056 |
| 897 | Ga0207674_10019948 | 3300026116 | Bacteria | 7254 |
| 898 | Ga0207674_10034569 | 3300026116 | Bacteria | 5281 |
| 899 | Ga0207674_10085480 | 3300026116 | Bacteria | 3150 |
| 900 | Ga0207674_10120677 | 3300026116 | Bacteria | 2589 |
| 901 | Ga0207675_100000138 | 3300026118 | Bacteria | 62372 |
| 902 | Ga0207675_100147211 | 3300026118 | Bacteria | 2240 |
| 903 | Ga0207683_10000520 | 3300026121 | Bacteria | 35614 |
| 904 | Ga0207683_10006544 | 3300026121 | Bacteria | 9978 |
| 905 | Ga0207683_10070843 | 3300026121 | Bacteria | 3081 |
| 906 | Ga0207683_10072389 | 3300026121 | Bacteria | 3048 |
| 907 | Ga0207683_10091702 | 3300026121 | Bacteria | 2707 |
| 908 | Ga0207683_10318365 | 3300026121 | Bacteria | 1425 |
| 909 | Ga0207683_10519571 | 3300026121 | Bacteria | 1100 |
| 910 | Ga0207698_10017736 | 3300026142 | Bacteria | 4838 |
| 911 | Ga0207698_10018165 | 3300026142 | Bacteria | 4786 |
| 912 | Ga0207698_10046884 | 3300026142 | Bacteria | 3268 |
| 913 | Ga0207698_10323058 | 3300026142 | Bacteria | 1446 |
| 914 | Ga0209970_1006899 | 3300027614 | Bacteria | 1864 |
| 915 | Ga0209282_1000045 | 3300027666 | Bacteria | 118401 |
| 916 | Ga0209282_1001910 | 3300027666 | Bacteria | 11760 |
| 917 | Ga0209282_1154304 | 3300027666 | Bacteria | 1105 |
| 918 | Ga0209588_1022047 | 3300027671 | Bacteria | 2004 |
| 919 | Ga0209588_1039580 | 3300027671 | Bacteria | 1520 |
| 920 | Ga0209813_10006509 | 3300027866 | Bacteria | 2889 |
| 921 | Ga0207428_10191856 | 3300027907 | Bacteria | 1540 |
| 922 | Ga0268266_10029677 | 3300028379 | Bacteria | 4647 |
| 923 | Ga0268266_10122024 | 3300028379 | Bacteria | 2320 |
| 924 | Ga0268266_10194168 | 3300028379 | Bacteria | 1855 |
| 925 | Ga0268266_10222027 | 3300028379 | Bacteria | 1737 |
| 926 | Ga0268266_10387456 | 3300028379 | Bacteria | 1319 |
| 927 | Ga0268265_10005157 | 3300028380 | Bacteria | 8946 |
| 928 | Ga0268265_10204842 | 3300028380 | Bacteria | 1714 |
| 929 | Ga0268264_10045892 | 3300028381 | Bacteria | 3629 |
| 930 | Ga0268264_10052991 | 3300028381 | Bacteria | 3384 |
| 931 | Ga0268264_10056049 | 3300028381 | Bacteria | 3294 |
| 932 | Ga0268264_10268348 | 3300028381 | Bacteria | 1593 |
| 933 | Ga0307517_10000228 | 3300028786 | Bacteria | 94852 |
| 934 | Ga0307517_10070147 | 3300028786 | Bacteria | 3162 |
| 935 | Ga0307517_10172646 | 3300028786 | Bacteria | 1417 |
| 936 | Ga0307515_10000013 | 3300028794 | Bacteria | 568456 |
| 937 | Ga0307515_10000037 | 3300028794 | Bacteria | 331970 |
| 938 | Ga0307515_10000428 | 3300028794 | Bacteria | 101247 |
| 939 | Ga0307515_10006133 | 3300028794 | Bacteria | 24177 |
| 940 | Ga0307515_10009239 | 3300028794 | Bacteria | 19087 |
| 941 | Ga0307515_10016260 | 3300028794 | Bacteria | 13636 |
| 942 | Ga0307515_10029046 | 3300028794 | Bacteria | 9368 |
| 943 | Ga0307515_10224608 | 3300028794 | Bacteria | 1686 |
| 944 | Ga0265338_10000022 | 3300028800 | Bacteria | 308414 |
| 945 | Ga0265338_10000281 | 3300028800 | Bacteria | 91847 |
| 946 | Ga0307511_10000671 | 3300030521 | Bacteria | 36432 |
| 947 | Ga0307512_10028786 | 3300030522 | Bacteria | 4863 |
| 948 | Ga0316177_1157730 | 3300030731 | Bacteria | 3153 |
| 949 | Ga0314311_1139236 | 3300030733 | Bacteria | 10237 |
| 950 | Ga0316180_1015378 | 3300030736 | Bacteria | 1607 |
| 951 | Ga0316183_1110270 | 3300030742 | Bacteria | 1296 |
| 952 | Ga0316181_1005389 | 3300030744 | Bacteria | 3102 |
| 953 | Ga0316182_1383921 | 3300030745 | Bacteria | 2426 |
| 954 | Ga0265327_10000689 | 3300031251 | Bacteria | 54050 |
| 955 | Ga0265327_10050387 | 3300031251 | Bacteria | 2179 |
| 956 | Ga0265327_10098071 | 3300031251 | Bacteria | 1419 |
| 957 | Ga0307513_10000010 | 3300031456 | Bacteria | 360812 |
| 958 | Ga0307513_10000121 | 3300031456 | Bacteria | 109551 |
| 959 | Ga0307513_10014924 | 3300031456 | Bacteria | 9439 |
| 960 | Ga0307513_10019112 | 3300031456 | Bacteria | 8166 |
| 961 | Ga0307509_10000426 | 3300031507 | Bacteria | 70899 |
| 962 | Ga0307509_10044488 | 3300031507 | Bacteria | 4797 |
| 963 | Ga0307509_10078868 | 3300031507 | Bacteria | 3410 |
| 964 | Ga0307509_10081835 | 3300031507 | Bacteria | 3333 |
| 965 | Ga0307509_10098023 | 3300031507 | Bacteria | 2978 |
| 966 | Ga0307509_10143290 | 3300031507 | Bacteria | 2320 |
| 967 | Ga0307509_10424653 | 3300031507 | Bacteria | 1029 |
| 968 | Ga0307408_100010028 | 3300031548 | Bacteria | 6243 |
| 969 | Ga0307408_100051176 | 3300031548 | Bacteria | 2974 |
| 970 | Ga0307408_100117334 | 3300031548 | Bacteria | 2055 |
| 971 | Ga0307408_100118412 | 3300031548 | Bacteria | 2047 |
| 972 | Ga0307408_100127321 | 3300031548 | Bacteria | 1982 |
| 973 | Ga0307408_100284214 | 3300031548 | Bacteria | 1379 |
| 974 | Ga0307408_100463756 | 3300031548 | Bacteria | 1101 |
| 975 | Ga0307408_100563380 | 3300031548 | Bacteria | 1007 |
| 976 | Ga0307508_10000096 | 3300031616 | Bacteria | 103730 |
| 977 | Ga0307508_10000273 | 3300031616 | Bacteria | 63550 |
| 978 | Ga0307508_10003742 | 3300031616 | Bacteria | 15206 |
| 979 | Ga0307508_10070041 | 3300031616 | Bacteria | 3079 |
| 980 | Ga0307514_10001887 | 3300031649 | Bacteria | 23094 |
| 981 | Ga0307514_10049636 | 3300031649 | Bacteria | 3262 |
| 982 | Ga0307514_10069075 | 3300031649 | Bacteria | 2660 |
| 983 | Ga0265314_10030091 | 3300031711 | Bacteria | 4024 |
| 984 | Ga0265342_10046019 | 3300031712 | Bacteria | 2624 |
| 985 | Ga0307516_10002590 | 3300031730 | Bacteria | 24022 |
| 986 | Ga0307516_10003708 | 3300031730 | Bacteria | 19431 |
| 987 | Ga0307516_10007835 | 3300031730 | Bacteria | 12183 |
| 988 | Ga0307516_10014241 | 3300031730 | Bacteria | 8424 |
| 989 | Ga0307516_10104851 | 3300031730 | Bacteria | 2639 |
| 990 | Ga0307516_10318387 | 3300031730 | Bacteria | 1227 |
| 991 | Ga0307405_10002872 | 3300031731 | Bacteria | 7745 |
| 992 | Ga0307405_10016578 | 3300031731 | Bacteria | 4020 |
| 993 | Ga0307405_10068124 | 3300031731 | Bacteria | 2276 |
| 994 | Ga0307405_10400363 | 3300031731 | Bacteria | 1074 |
| 995 | Ga0307518_10236745 | 3300031838 | Bacteria | 1176 |
| 996 | Ga0307410_10006084 | 3300031852 | Bacteria | 6471 |
| 997 | Ga0307410_10117073 | 3300031852 | Bacteria | 1937 |
| 998 | Ga0307406_10005443 | 3300031901 | Bacteria | 6966 |
| 999 | Ga0307406_10055913 | 3300031901 | Bacteria | 2524 |
| 1000 | Ga0307406_10181417 | 3300031901 | Bacteria | 1533 |
| 1001 | Ga0307407_10033949 | 3300031903 | Bacteria | 2788 |
| 1002 | Ga0307412_10001959 | 3300031911 | Bacteria | 11395 |
| 1003 | Ga0307412_10009352 | 3300031911 | Bacteria | 5621 |
| 1004 | Ga0307412_10017384 | 3300031911 | Bacteria | 4304 |
| 1005 | Ga0307412_10146700 | 3300031911 | Bacteria | 1735 |
| 1006 | Ga0307412_10473196 | 3300031911 | Bacteria | 1037 |
| 1007 | Ga0307409_100099675 | 3300031995 | Bacteria | 2406 |
| 1008 | Ga0307409_100506732 | 3300031995 | Bacteria | 1176 |
| 1009 | Ga0307416_100002887 | 3300032002 | Bacteria | 10015 |
| 1010 | Ga0307416_100007370 | 3300032002 | Bacteria | 6989 |
| 1011 | Ga0307416_100060673 | 3300032002 | Bacteria | 3082 |
| 1012 | Ga0307416_100089116 | 3300032002 | Bacteria | 2640 |
| 1013 | Ga0307416_100464400 | 3300032002 | Bacteria | 1322 |
| 1014 | Ga0307414_10008727 | 3300032004 | Bacteria | 5776 |
| 1015 | Ga0307411_10019230 | 3300032005 | Bacteria | 3941 |
| 1016 | Ga0307411_10239023 | 3300032005 | Bacteria | 1420 |
| 1017 | Ga0307415_100004219 | 3300032126 | Bacteria | 7426 |
| 1018 | Ga0307415_100191188 | 3300032126 | Bacteria | 1615 |
| 1019 | Ga0307507_10079515 | 3300033179 | Bacteria | 2897 |
| 1020 | Ga0307507_10094219 | 3300033179 | Bacteria | 2547 |
| 1021 | Ga0307510_10000088 | 3300033180 | Bacteria | 69071 |
| 1022 | Ga0307510_10000967 | 3300033180 | Bacteria | 30417 |
| 1023 | Ga0307510_10103592 | 3300033180 | Bacteria | 2622 |
| 1024 | Ga0373938_0007458 | 3300034957 | Bacteria | 1925 |
| 1025 | Ga0373934_0016737 | 3300035086 | Bacteria | 2789 |
| 1026 | Ga0373944_0040673 | 3300035089 | Bacteria | 1436 |
| 1027 | Ga0373952_0050698 | 3300035092 | Bacteria | 989 |
| 1028 | Ga0373939_0005037 | 3300035114 | Bacteria | 3140 |
| 1029 | Ga0373953_0130583 | 3300035117 | Bacteria | 1071 |
| 1030 | Ga0373955_0015132 | 3300035172 | Bacteria | 3770 |
| 1031 | Ga0373955_0029829 | 3300035172 | Bacteria | 2841 |
| 1032 | Ga0373924_0104364 | 3300035410 | Bacteria | 1221 |
| 1033 | Ga0373931_0000719 | 3300035691 | Bacteria | 13733 |
| 1034 | Ga0373931_0108854 | 3300035691 | Bacteria | 1569 |
| 1035 | Ga0373931_0214130 | 3300035691 | Bacteria | 1157 |
| 1036 | Ga0373935_0131175 | 3300035692 | Bacteria | 1684 |
| 1037 | Ga0373947_0043204 | 3300035725 | Bacteria | 2692 |
| 1038 | Ga0373937_0025212 | 3300036401 | Bacteria | 5369 |
| 1039 | Ga0373937_0097776 | 3300036401 | Bacteria | 2723 |
| 1040 | Ga0373925_0059226 | 3300037068 | Bacteria | 2873 |
| 1041 | Ga0373925_0077689 | 3300037068 | Bacteria | 2520 |
| 1042 | Ga0373925_0217678 | 3300037068 | Bacteria | 1523 |
| 1043 | Ga0373925_0539505 | 3300037068 | Bacteria | 959 |
| 1044 | Ga0395899_0003004 | 3300037312 | Bacteria | 13478 |
| 1045 | Ga0395899_0003834 | 3300037312 | Bacteria | 11864 |
| 1046 | Ga0395899_0023766 | 3300037312 | Bacteria | 4638 |
| 1047 | Ga0395899_0042037 | 3300037312 | Bacteria | 3413 |
| 1048 | Ga0395899_0188340 | 3300037312 | Bacteria | 1445 |
| 1049 | Ga0395900_0003666 | 3300037418 | Bacteria | 16510 |
| 1050 | Ga0395900_0012705 | 3300037418 | Bacteria | 8603 |
| 1051 | Ga0395900_0027220 | 3300037418 | Bacteria | 5855 |
| 1052 | Ga0395900_0032723 | 3300037418 | Bacteria | 5348 |
| 1053 | Ga0395900_0035522 | 3300037418 | Bacteria | 5133 |
| 1054 | Ga0395900_0066108 | 3300037418 | Bacteria | 3716 |
| 1055 | Ga0395900_0132453 | 3300037418 | Bacteria | 2554 |
| 1056 | Ga0395900_0135443 | 3300037418 | Bacteria | 2523 |
| 1057 | Ga0395900_0468270 | 3300037418 | Bacteria | 1214 |
| 1058 | Ga0395898_0002485 | 3300037466 | Bacteria | 21682 |
| 1059 | Ga0395898_0006527 | 3300037466 | Bacteria | 12459 |
| 1060 | Ga0395898_0036335 | 3300037466 | Bacteria | 4891 |
| 1061 | Ga0395898_0213390 | 3300037466 | Bacteria | 1841 |
| 1062 | Ga0395898_0261930 | 3300037466 | Bacteria | 1649 |
| 1063 | Ga0395905_0000041 | 3300037471 | Bacteria | 250958 |
| 1064 | Ga0395905_0000766 | 3300037471 | Bacteria | 42342 |
| 1065 | Ga0395905_0001291 | 3300037471 | Bacteria | 30780 |
| 1066 | Ga0395905_0001867 | 3300037471 | Bacteria | 24262 |
| 1067 | Ga0395905_0002404 | 3300037471 | Bacteria | 20821 |
| 1068 | Ga0395905_0006699 | 3300037471 | Bacteria | 11542 |
| 1069 | Ga0395905_0016311 | 3300037471 | Bacteria | 7059 |
| 1070 | Ga0395905_0022080 | 3300037471 | Bacteria | 6020 |
| 1071 | Ga0395905_0087687 | 3300037471 | Bacteria | 2917 |
| 1072 | Ga0395905_0240311 | 3300037471 | Bacteria | 1692 |
| 1073 | Ga0395905_0333913 | 3300037471 | Bacteria | 1406 |
| 1074 | Ga0395905_0429056 | 3300037471 | Bacteria | 1218 |
| 1075 | Ga0395905_0514960 | 3300037471 | Bacteria | 1097 |
| 1076 | Ga0436364_1452872 | 3300037853 | Bacteria | 1565 |
| 1077 | Ga0395901_0119273 | 3300038443 | Bacteria | 2772 |
| 1078 | Ga0395901_0164122 | 3300038443 | Bacteria | 2332 |
| 1079 | Ga0395901_0196832 | 3300038443 | Bacteria | 2113 |
| 1080 | Ga0436365_1069362 | 3300039437 | Bacteria | 2056 |
| 1081 | Ga0436361_0263782 | 3300039447 | Bacteria | 4960 |
| 1082 | Ga0436361_0706582 | 3300039447 | Bacteria | 17668 |
| 1083 | Ga0439436_0000271 | 3300041404 | Bacteria | 12488 |
| 1084 | Ga0439439_0008230 | 3300041406 | Bacteria | 2458 |
| 1085 | Ga0439439_0022327 | 3300041406 | Bacteria | 1580 |
| 1086 | Ga0439439_0024456 | 3300041406 | Bacteria | 1516 |
| 1087 | Ga0439447_018176 | 3300041407 | Bacteria | 1901 |
| 1088 | Ga0439465_0004740 | 3300041413 | Bacteria | 4381 |
| 1089 | Ga0451795_0371926 | 3300041456 | Bacteria | 1198 |
| 1090 | Ga0451807_2138912 | 3300041486 | Bacteria | 1632 |
| 1091 | Ga0451839_1172444 | 3300041496 | Bacteria | 1038 |
| 1092 | Ga0451841_0043643 | 3300041498 | Bacteria | 1297 |
| 1093 | Ga0451853_3303108 | 3300041512 | Bacteria | 1521 |
| 1094 | Ga0439431_0002491 | 3300041997 | Bacteria | 4075 |
| 1095 | Ga0439441_005125 | 3300042001 | Bacteria | 2020 |
| 1096 | Ga0439441_008564 | 3300042001 | Bacteria | 1674 |
| 1097 | Ga0439442_007787 | 3300042002 | Bacteria | 2161 |
| 1098 | Ga0439445_0000101 | 3300042004 | Bacteria | 14009 |
| 1099 | Ga0439432_003935 | 3300042006 | Bacteria | 5462 |
| 1100 | Ga0439449_0000836 | 3300042007 | Bacteria | 11922 |
| 1101 | Ga0439449_0003108 | 3300042007 | Bacteria | 6468 |
| 1102 | Ga0439449_0009194 | 3300042007 | Bacteria | 3745 |
| 1103 | Ga0439452_001575 | 3300042010 | Bacteria | 9083 |
| 1104 | Ga0439452_003824 | 3300042010 | Bacteria | 5171 |
| 1105 | Ga0439457_004271 | 3300042014 | Bacteria | 3760 |
| 1106 | Ga0439462_0005109 | 3300042015 | Bacteria | 3219 |
| 1107 | Ga0450894_005633 | 3300042131 | Bacteria | 1622 |
| 1108 | Ga0450889_007214 | 3300042144 | Bacteria | 1121 |
| 1109 | Ga0439446_0002170 | 3300042156 | Bacteria | 4670 |
| 1110 | Ga0450908_002671 | 3300042184 | Bacteria | 3487 |
| 1111 | Ga0450909_002890 | 3300042185 | Bacteria | 2440 |
| 1112 | Ga0439434_0001592 | 3300042435 | Bacteria | 6546 |
| 1113 | Ga0439434_0002659 | 3300042435 | Bacteria | 5206 |
| 1114 | Ga0439464_0017700 | 3300042439 | Bacteria | 1934 |
| 1115 | Ga0439460_0045072 | 3300042461 | Bacteria | 1307 |
| 1116 | Ga0450918_000258 | 3300042531 | Bacteria | 11913 |
| 1117 | Ga0451577_0045661 | 3300042876 | Bacteria | 3921 |
| 1118 | Ga0466969_0003266 | 3300044656 | Bacteria | 8619 |
| 1119 | Ga0466969_0159489 | 3300044656 | Bacteria | 1037 |
| 1120 | Ga0466972_0009395 | 3300044658 | Bacteria | 4913 |
| 1121 | Ga0466977_0000064 | 3300044666 | Bacteria | 19913 |
| 1122 | Ga0453683_0003262 | 3300044673 | Bacteria | 12057 |
| 1123 | Ga0466966_0003451 | 3300044684 | Bacteria | 10419 |
| 1124 | Ga0466961_0054667 | 3300044693 | Bacteria | 2546 |
| 1125 | Ga0453684_0003387 | 3300044712 | Bacteria | 36051 |
| 1126 | Ga0453684_0592183 | 3300044712 | Bacteria | 1216 |
| 1127 | Ga0466970_0017755 | 3300044765 | Bacteria | 3679 |
| 1128 | Ga0466970_0104668 | 3300044765 | Bacteria | 1543 |
| 1129 | Ga0466957_0007962 | 3300044842 | Bacteria | 6013 |
| 1130 | Ga0466957_0222836 | 3300044842 | Bacteria | 1246 |
| 1131 | Ga0451576_0007232 | 3300045051 | Bacteria | 13370 |
| 1132 | Ga0451576_0015307 | 3300045051 | Bacteria | 8501 |
| 1133 | Ga0451576_0048014 | 3300045051 | Bacteria | 4486 |
| 1134 | Ga0451576_0095976 | 3300045051 | Bacteria | 3084 |
| 1135 | Ga0451576_0186369 | 3300045051 | Bacteria | 2167 |
| 1136 | Ga0451576_0288095 | 3300045051 | Bacteria | 1717 |
| 1137 | Ga0451576_0300925 | 3300045051 | Bacteria | 1678 |
| 1138 | Ga0495592_0000307 | 3300046454 | Bacteria | 41229 |
| 1139 | Ga0495592_0005284 | 3300046454 | Bacteria | 9518 |
| 1140 | Ga0495590_0016152 | 3300046457 | Bacteria | 2698 |
| 1141 | Ga0495590_0019964 | 3300046457 | Bacteria | 2383 |
| 1142 | Ga0495629_0016193 | 3300046459 | Bacteria | 5352 |
| 1143 | Ga0495638_0009369 | 3300046460 | Bacteria | 6884 |
| 1144 | Ga0495638_0041320 | 3300046460 | Bacteria | 2918 |
| 1145 | Ga0495638_0094762 | 3300046460 | Bacteria | 1794 |
| 1146 | Ga0495651_0007788 | 3300046462 | Bacteria | 8195 |
| 1147 | Ga0495651_0058881 | 3300046462 | Bacteria | 2947 |
| 1148 | Ga0495651_0122775 | 3300046462 | Bacteria | 1905 |
| 1149 | Ga0495653_0031899 | 3300046463 | Bacteria | 4186 |
| 1150 | Ga0495653_0082601 | 3300046463 | Bacteria | 2371 |
| 1151 | Ga0495650_0002401 | 3300046471 | Bacteria | 15286 |
| 1152 | Ga0495650_0039741 | 3300046471 | Bacteria | 2027 |
| 1153 | Ga0495580_0012377 | 3300046472 | Bacteria | 6542 |
| 1154 | Ga0495580_0090482 | 3300046472 | Bacteria | 2130 |
| 1155 | Ga0495605_0003271 | 3300046474 | Bacteria | 9720 |
| 1156 | Ga0495605_0006415 | 3300046474 | Bacteria | 6768 |
| 1157 | Ga0495605_0010207 | 3300046474 | Bacteria | 5259 |
| 1158 | Ga0495639_0011603 | 3300046475 | Bacteria | 3801 |
| 1159 | Ga0495662_0023350 | 3300046476 | Bacteria | 2986 |
| 1160 | Ga0495584_0022556 | 3300046491 | Bacteria | 3193 |
| 1161 | Ga0495585_0000600 | 3300046492 | Bacteria | 33658 |
| 1162 | Ga0495585_0023825 | 3300046492 | Bacteria | 3512 |
| 1163 | Ga0495596_0000531 | 3300046500 | Bacteria | 23934 |
| 1164 | Ga0495596_0001392 | 3300046500 | Bacteria | 13894 |
| 1165 | Ga0495607_0000104 | 3300046501 | Bacteria | 89641 |
| 1166 | Ga0495607_0079164 | 3300046501 | Bacteria | 1811 |
| 1167 | Ga0495583_0000068 | 3300046506 | Bacteria | 188922 |
| 1168 | Ga0495583_0020770 | 3300046506 | Bacteria | 3391 |
| 1169 | Ga0495606_0031176 | 3300046507 | Bacteria | 3710 |
| 1170 | Ga0495606_0115978 | 3300046507 | Bacteria | 1609 |
| 1171 | Ga0495608_0009037 | 3300046511 | Bacteria | 6971 |
| 1172 | Ga0495608_0036970 | 3300046511 | Bacteria | 3284 |
| 1173 | Ga0495608_0043811 | 3300046511 | Bacteria | 2989 |
| 1174 | Ga0495608_0060615 | 3300046511 | Bacteria | 2489 |
| 1175 | Ga0495610_0000402 | 3300046512 | Bacteria | 44548 |
| 1176 | Ga0495610_0027502 | 3300046512 | Bacteria | 3021 |
| 1177 | Ga0495610_0034215 | 3300046512 | Bacteria | 2619 |
| 1178 | Ga0495616_0001588 | 3300046513 | Bacteria | 15594 |
| 1179 | Ga0495618_0009013 | 3300046514 | Bacteria | 6020 |
| 1180 | Ga0495618_0225602 | 3300046514 | Bacteria | 1181 |
| 1181 | Ga0495620_0023629 | 3300046515 | Bacteria | 2936 |
| 1182 | Ga0495620_0043753 | 3300046515 | Bacteria | 1949 |
| 1183 | Ga0495628_0000094 | 3300046516 | Bacteria | 71069 |
| 1184 | Ga0495628_0001686 | 3300046516 | Bacteria | 20158 |
| 1185 | Ga0495628_0010603 | 3300046516 | Bacteria | 7819 |
| 1186 | Ga0495630_0005175 | 3300046517 | Bacteria | 9190 |
| 1187 | Ga0495630_0023999 | 3300046517 | Bacteria | 4509 |
| 1188 | Ga0495630_0187311 | 3300046517 | Bacteria | 1579 |
| 1189 | Ga0495631_0007349 | 3300046518 | Bacteria | 5608 |
| 1190 | Ga0495632_0005817 | 3300046519 | Bacteria | 8077 |
| 1191 | Ga0495632_0016163 | 3300046519 | Bacteria | 4159 |
| 1192 | Ga0495644_0070785 | 3300046523 | Bacteria | 1310 |
| 1193 | Ga0495648_0077652 | 3300046524 | Bacteria | 1902 |
| 1194 | Ga0495642_0016179 | 3300046528 | Bacteria | 2906 |
| 1195 | Ga0495642_0017986 | 3300046528 | Bacteria | 2764 |
| 1196 | Ga0495642_0080640 | 3300046528 | Bacteria | 1370 |
| 1197 | Ga0495652_0053180 | 3300046529 | Bacteria | 3452 |
| 1198 | Ga0495652_0071724 | 3300046529 | Bacteria | 2889 |
| 1199 | Ga0495652_0151060 | 3300046529 | Bacteria | 1815 |
| 1200 | Ga0495652_0282927 | 3300046529 | Bacteria | 1213 |
| 1201 | Ga0495654_0001128 | 3300046530 | Bacteria | 19241 |
| 1202 | Ga0495654_0024039 | 3300046530 | Bacteria | 3151 |
| 1203 | Ga0495640_0003973 | 3300046533 | Bacteria | 11833 |
| 1204 | Ga0495586_0002666 | 3300046535 | Bacteria | 9649 |
| 1205 | Ga0495587_0032496 | 3300046536 | Bacteria | 3155 |
| 1206 | Ga0495609_0005608 | 3300046538 | Bacteria | 6544 |
| 1207 | Ga0495621_0042632 | 3300046539 | Bacteria | 1598 |
| 1208 | Ga0495621_0053686 | 3300046539 | Bacteria | 1447 |
| 1209 | Ga0495597_0004406 | 3300046542 | Bacteria | 7745 |
| 1210 | Ga0495597_0028022 | 3300046542 | Bacteria | 2580 |
| 1211 | Ga0495645_0004283 | 3300046543 | Bacteria | 9748 |
| 1212 | Ga0495645_0018404 | 3300046543 | Bacteria | 5015 |
| 1213 | Ga0495645_0097404 | 3300046543 | Bacteria | 2095 |
| 1214 | Ga0495645_0163979 | 3300046543 | Bacteria | 1534 |
| 1215 | Ga0495622_0123567 | 3300046557 | Bacteria | 1181 |
| 1216 | Ga0495667_0016481 | 3300046559 | Bacteria | 4992 |
| 1217 | Ga0495667_0220772 | 3300046559 | Bacteria | 1210 |
| 1218 | Ga0495656_0006029 | 3300046615 | Bacteria | 4222 |
| 1219 | Ga0495656_0075661 | 3300046615 | Bacteria | 1507 |
| 1220 | Ga0495668_0027061 | 3300046616 | Bacteria | 3250 |
| 1221 | Ga0495611_0008098 | 3300046648 | Bacteria | 4459 |
| 1222 | Ga0495611_0205991 | 3300046648 | Bacteria | 916 |
| 1223 | Ga0495625_0000811 | 3300046660 | Bacteria | 43302 |
| 1224 | Ga0495625_0002034 | 3300046660 | Bacteria | 22774 |
| 1225 | Ga0495625_0002147 | 3300046660 | Bacteria | 21938 |
| 1226 | Ga0495625_0013100 | 3300046660 | Bacteria | 6680 |
| 1227 | Ga0495625_0083948 | 3300046660 | Bacteria | 2213 |
| 1228 | Ga0495625_0147508 | 3300046660 | Bacteria | 1583 |
| 1229 | Ga0495661_0028289 | 3300046665 | Bacteria | 3589 |
| 1230 | Ga0495661_0037991 | 3300046665 | Bacteria | 3003 |
| 1231 | Ga0495661_0118774 | 3300046665 | Bacteria | 1463 |
| 1232 | Ga0495588_0025415 | 3300046674 | Bacteria | 2950 |
| 1233 | Ga0495588_0058570 | 3300046674 | Bacteria | 1991 |
| 1234 | Ga0495588_0134792 | 3300046674 | Bacteria | 1303 |
| 1235 | Ga0495657_0134798 | 3300046675 | Bacteria | 1544 |
| 1236 | Ga0495599_0002663 | 3300046678 | Bacteria | 10417 |
| 1237 | Ga0495599_0007337 | 3300046678 | Bacteria | 6683 |
| 1238 | Ga0495599_0007691 | 3300046678 | Bacteria | 6547 |
| 1239 | Ga0495623_0015463 | 3300046679 | Bacteria | 4934 |
| 1240 | Ga0495623_0021980 | 3300046679 | Bacteria | 4120 |
| 1241 | Ga0495623_0069969 | 3300046679 | Bacteria | 2186 |
| 1242 | Ga0495646_0101850 | 3300046680 | Bacteria | 1645 |
| 1243 | Ga0495658_0017838 | 3300046683 | Bacteria | 3677 |
| 1244 | Ga0495658_0124256 | 3300046683 | Bacteria | 1564 |
| 1245 | Ga0495613_0035150 | 3300046689 | Bacteria | 3720 |
| 1246 | Ga0495671_0000949 | 3300046692 | Bacteria | 20400 |
| 1247 | Ga0495671_0003079 | 3300046692 | Bacteria | 10361 |
| 1248 | Ga0495671_0051467 | 3300046692 | Bacteria | 2048 |
| 1249 | Ga0495671_0116445 | 3300046692 | Bacteria | 1305 |
| 1250 | Ga0495649_0000902 | 3300046694 | Bacteria | 23546 |
| 1251 | Ga0495649_0019136 | 3300046694 | Bacteria | 3848 |
| 1252 | Ga0495649_0054994 | 3300046694 | Bacteria | 2151 |
| 1253 | Ga0495600_0000395 | 3300046809 | Bacteria | 22545 |
| 1254 | Ga0495660_0151431 | 3300046810 | Bacteria | 1145 |
| 1255 | Ga0495604_0005126 | 3300047317 | Bacteria | 10368 |
| 1256 | Ga0495636_0028531 | 3300047318 | Bacteria | 2277 |
| 1257 | Ga0495674_0001417 | 3300047319 | Bacteria | 23473 |
| 1258 | Ga0495674_0021472 | 3300047319 | Bacteria | 5972 |
| 1259 | Ga0495674_0153891 | 3300047319 | Bacteria | 1927 |
| 1260 | Ga0495672_0024306 | 3300047320 | Bacteria | 3906 |
| 1261 | Ga0495676_0053294 | 3300047321 | Bacteria | 3224 |
| 1262 | Ga0495676_0114514 | 3300047321 | Bacteria | 1973 |
| 1263 | Ga0495680_0004617 | 3300047322 | Bacteria | 13122 |
| 1264 | Ga0495683_0036120 | 3300047323 | Bacteria | 2509 |
| 1265 | Ga0495687_000330 | 3300047443 | Bacteria | 60838 |
| 1266 | Ga0495687_003745 | 3300047443 | Bacteria | 10759 |
| 1267 | Ga0495687_007018 | 3300047443 | Bacteria | 6755 |
| 1268 | Ga0495687_008919 | 3300047443 | Bacteria | 5678 |
| 1269 | Ga0495679_000094 | 3300047446 | Bacteria | 81416 |
| 1270 | Ga0495673_0010894 | 3300047469 | Bacteria | 4919 |
| 1271 | Ga0495673_0011584 | 3300047469 | Bacteria | 4732 |
| 1272 | Ga0495684_0039710 | 3300047471 | Bacteria | 3608 |
| 1273 | Ga0495684_0291632 | 3300047471 | Bacteria | 1174 |
| 1274 | Ga0495686_0080473 | 3300047472 | Bacteria | 1991 |
| 1275 | Ga0495686_0114885 | 3300047472 | Bacteria | 1610 |
| 1276 | Ga0495593_0007103 | 3300047673 | Bacteria | 6565 |
| 1277 | Ga0495593_0036853 | 3300047673 | Bacteria | 2649 |
| 1278 | Ga0495602_0094606 | 3300048088 | Bacteria | 2468 |
| 1279 | Ga0495614_0115970 | 3300048089 | Bacteria | 1178 |
| 1280 | Ga0495615_0013150 | 3300048090 | Bacteria | 1724 |
| 1281 | Ga0495626_0004972 | 3300048091 | Bacteria | 7959 |
| 1282 | Ga0495626_0072964 | 3300048091 | Bacteria | 1538 |
| 1283 | Ga0496100_0003901 | 3300048903 | Bacteria | 7832 |
| 1284 | Ga0496100_0030272 | 3300048903 | Bacteria | 3356 |
| 1285 | Ga0496101_0001350 | 3300048904 | Bacteria | 14712 |
| 1286 | Ga0496101_0002565 | 3300048904 | Bacteria | 11148 |
| 1287 | Ga0496101_0076323 | 3300048904 | Bacteria | 2468 |
| 1288 | Ga0496102_0000863 | 3300048905 | Bacteria | 29024 |
| 1289 | Ga0496102_0002579 | 3300048905 | Bacteria | 15452 |
| 1290 | Ga0496102_0045016 | 3300048905 | Bacteria | 4005 |
| 1291 | Ga0496103_0001427 | 3300048906 | Bacteria | 16015 |
| 1292 | Ga0496103_0041940 | 3300048906 | Bacteria | 2814 |
| 1293 | Ga0496103_0057061 | 3300048906 | Bacteria | 2424 |
| 1294 | Ga0496103_0208958 | 3300048906 | Bacteria | 1255 |
| 1295 | Ga0496104_0022955 | 3300048907 | Bacteria | 5734 |
| 1296 | Ga0496104_0046945 | 3300048907 | Bacteria | 4069 |
| 1297 | Ga0496104_0169712 | 3300048907 | Bacteria | 2092 |
| 1298 | Ga0496104_0335815 | 3300048907 | Bacteria | 1424 |
| 1299 | Ga0496104_0480170 | 3300048907 | Bacteria | 1154 |
| 1300 | Ga0496105_0003513 | 3300048908 | Bacteria | 11613 |
| 1301 | Ga0496105_0008623 | 3300048908 | Bacteria | 7926 |
| 1302 | Ga0496105_0059239 | 3300048908 | Bacteria | 3160 |
| 1303 | Ga0496106_0004306 | 3300048909 | Bacteria | 10570 |
| 1304 | Ga0496106_0006498 | 3300048909 | Bacteria | 8658 |
| 1305 | Ga0496106_0052015 | 3300048909 | Bacteria | 3089 |
| 1306 | Ga0496106_0094112 | 3300048909 | Bacteria | 2316 |
| 1307 | Ga0496107_0010565 | 3300048910 | Bacteria | 6418 |
| 1308 | Ga0496107_0386226 | 3300048910 | Bacteria | 1041 |
| 1309 | Ga0496108_0236644 | 3300048911 | Bacteria | 1588 |
| 1310 | Ga0496109_0004487 | 3300048912 | Bacteria | 11665 |
| 1311 | Ga0496109_0677770 | 3300048912 | Bacteria | 968 |
| 1312 | Ga0496110_0024210 | 3300048913 | Bacteria | 5171 |
| 1313 | Ga0496110_0048777 | 3300048913 | Bacteria | 3712 |
| 1314 | Ga0496110_0209482 | 3300048913 | Bacteria | 1772 |
| 1315 | Ga0496111_0040125 | 3300048914 | Bacteria | 3357 |
| 1316 | Ga0496112_0001203 | 3300048915 | Bacteria | 19412 |
| 1317 | Ga0496113_0041941 | 3300048916 | Bacteria | 3379 |
| 1318 | Ga0496113_0044410 | 3300048916 | Bacteria | 3292 |
| 1319 | Ga0496113_0046906 | 3300048916 | Bacteria | 3209 |
| 1320 | Ga0496113_0459545 | 3300048916 | Bacteria | 1023 |
| 1321 | Ga0496114_0089693 | 3300048917 | Bacteria | 2609 |
| 1322 | Ga0496114_0134655 | 3300048917 | Bacteria | 2136 |
| 1323 | Ga0496114_0236300 | 3300048917 | Bacteria | 1606 |
| 1324 | Ga0496115_0003898 | 3300048918 | Bacteria | 10750 |
| 1325 | Ga0496116_0003609 | 3300048919 | Bacteria | 15226 |
| 1326 | Ga0496116_0011291 | 3300048919 | Bacteria | 7411 |
| 1327 | Ga0496116_0013523 | 3300048919 | Bacteria | 6571 |
| 1328 | Ga0496116_0015998 | 3300048919 | Bacteria | 5897 |
| 1329 | Ga0496116_0020876 | 3300048919 | Bacteria | 4958 |
| 1330 | Ga0496116_0066795 | 3300048919 | Bacteria | 2300 |
| 1331 | Ga0496117_0002329 | 3300048920 | Bacteria | 24307 |
| 1332 | Ga0496117_0012972 | 3300048920 | Bacteria | 7298 |
| 1333 | Ga0496117_0023493 | 3300048920 | Bacteria | 4909 |
| 1334 | Ga0496117_0122537 | 3300048920 | Bacteria | 1594 |
| 1335 | Ga0496118_0005797 | 3300048921 | Bacteria | 13855 |
| 1336 | Ga0496118_0006085 | 3300048921 | Bacteria | 13425 |
| 1337 | Ga0496118_0022991 | 3300048921 | Bacteria | 5428 |
| 1338 | Ga0496118_0025287 | 3300048921 | Bacteria | 5097 |
| 1339 | Ga0496118_0040421 | 3300048921 | Bacteria | 3708 |
| 1340 | Ga0496119_0008405 | 3300048922 | Bacteria | 9069 |
| 1341 | Ga0496119_0077189 | 3300048922 | Bacteria | 1930 |
| 1342 | Ga0496119_0087501 | 3300048922 | Bacteria | 1778 |
| 1343 | Ga0496120_0003056 | 3300048923 | Bacteria | 15793 |
| 1344 | Ga0496120_0140458 | 3300048923 | Bacteria | 1227 |
| 1345 | Ga0496121_0000140 | 3300048924 | Bacteria | 162689 |
| 1346 | Ga0496121_0000694 | 3300048924 | Bacteria | 62818 |
| 1347 | Ga0496121_0005950 | 3300048924 | Bacteria | 15421 |
| 1348 | Ga0496121_0023470 | 3300048924 | Bacteria | 5939 |
| 1349 | Ga0496121_0026586 | 3300048924 | Bacteria | 5446 |
| 1350 | Ga0496121_0031014 | 3300048924 | Bacteria | 4897 |
| 1351 | Ga0496121_0036546 | 3300048924 | Bacteria | 4376 |
| 1352 | Ga0496121_0182840 | 3300048924 | Bacteria | 1511 |
| 1353 | Ga0496122_0000227 | 3300048925 | Bacteria | 125743 |
| 1354 | Ga0496122_0001089 | 3300048925 | Bacteria | 47126 |
| 1355 | Ga0496122_0001677 | 3300048925 | Bacteria | 34347 |
| 1356 | Ga0496122_0002020 | 3300048925 | Bacteria | 30158 |
| 1357 | Ga0496122_0146954 | 3300048925 | Bacteria | 1463 |
| 1358 | Ga0496123_0000141 | 3300048926 | Bacteria | 147111 |
| 1359 | Ga0496123_0000265 | 3300048926 | Bacteria | 104723 |
| 1360 | Ga0496123_0000826 | 3300048926 | Bacteria | 49740 |
| 1361 | Ga0496123_0028714 | 3300048926 | Bacteria | 4111 |
| 1362 | Ga0496124_0017865 | 3300048927 | Bacteria | 6667 |
| 1363 | Ga0496124_0042725 | 3300048927 | Bacteria | 3901 |
| 1364 | Ga0496124_0070406 | 3300048927 | Bacteria | 2901 |
| 1365 | Ga0496124_0070752 | 3300048927 | Bacteria | 2893 |
| 1366 | Ga0496124_0080196 | 3300048927 | Bacteria | 2686 |
| 1367 | Ga0496124_0169278 | 3300048927 | Bacteria | 1694 |
| 1368 | Ga0496125_0000190 | 3300048928 | Bacteria | 132540 |
| 1369 | Ga0496125_0004085 | 3300048928 | Bacteria | 17079 |
| 1370 | Ga0496125_0036252 | 3300048928 | Bacteria | 4310 |
| 1371 | Ga0496125_0113381 | 3300048928 | Bacteria | 1956 |
| 1372 | Ga0496126_0015524 | 3300048929 | Bacteria | 7656 |
| 1373 | Ga0496126_0083485 | 3300048929 | Bacteria | 2820 |
| 1374 | Ga0495678_011176 | 3300049459 | Bacteria | 4315 |
| 1375 | Ga0495678_023409 | 3300049459 | Bacteria | 2684 |
| 1376 | Ga0501031_0002275 | 3300049568 | Bacteria | 12168 |
| 1377 | Ga0501031_0013733 | 3300049568 | Bacteria | 5279 |
| 1378 | Ga0501031_0245625 | 3300049568 | Bacteria | 1163 |
| 1379 | Ga0501032_0008003 | 3300049569 | Bacteria | 7705 |
| 1380 | Ga0501032_0206696 | 3300049569 | Bacteria | 1281 |
| 1381 | Ga0501033_0000561 | 3300049570 | Bacteria | 34537 |
| 1382 | Ga0501033_0033574 | 3300049570 | Bacteria | 3853 |
| 1383 | Ga0501034_0000530 | 3300049571 | Bacteria | 60898 |
| 1384 | Ga0501034_0021788 | 3300049571 | Bacteria | 6529 |
| 1385 | Ga0501034_0070473 | 3300049571 | Bacteria | 3507 |
| 1386 | Ga0501034_0078178 | 3300049571 | Bacteria | 3313 |
| 1387 | Ga0501034_0116453 | 3300049571 | Bacteria | 2660 |
| 1388 | Ga0501034_0117453 | 3300049571 | Bacteria | 2647 |
| 1389 | Ga0501034_0139003 | 3300049571 | Bacteria | 2409 |
| 1390 | Ga0501034_0642255 | 3300049571 | Bacteria | 964 |
| 1391 | Ga0501036_0002030 | 3300049572 | Bacteria | 15759 |
| 1392 | Ga0501036_0150387 | 3300049572 | Bacteria | 1964 |
| 1393 | Ga0501037_0001491 | 3300049573 | Bacteria | 17103 |
| 1394 | Ga0501037_0060230 | 3300049573 | Bacteria | 2769 |
| 1395 | Ga0501038_0002799 | 3300049574 | Bacteria | 16238 |
| 1396 | Ga0501038_0045659 | 3300049574 | Bacteria | 3802 |
| 1397 | Ga0501038_0111840 | 3300049574 | Bacteria | 2262 |
| 1398 | Ga0501039_0015640 | 3300049575 | Bacteria | 5807 |
| 1399 | Ga0501041_0099466 | 3300049577 | Bacteria | 1799 |
| 1400 | Ga0501043_0015551 | 3300049579 | Bacteria | 5963 |
| 1401 | Ga0501046_0008826 | 3300049580 | Bacteria | 8756 |
| 1402 | Ga0501046_0031581 | 3300049580 | Bacteria | 4291 |
| 1403 | Ga0501046_0043246 | 3300049580 | Bacteria | 3587 |
| 1404 | Ga0501047_0016207 | 3300049581 | Bacteria | 7111 |
| 1405 | Ga0501047_0048942 | 3300049581 | Bacteria | 4081 |
| 1406 | Ga0501047_0199893 | 3300049581 | Bacteria | 1860 |
| 1407 | Ga0501067_0087511 | 3300049583 | Bacteria | 1729 |
| 1408 | Ga0501070_0116211 | 3300049586 | Bacteria | 2209 |
| 1409 | Ga0501071_0001109 | 3300049587 | Bacteria | 15021 |
| 1410 | Ga0501072_0004585 | 3300049588 | Bacteria | 10519 |
| 1411 | Ga0501073_0013789 | 3300049589 | Bacteria | 5876 |
| 1412 | Ga0501075_0036646 | 3300049591 | Bacteria | 3661 |
| 1413 | Ga0501076_0000902 | 3300049592 | Bacteria | 19332 |
| 1414 | Ga0501246_002775 | 3300049676 | Bacteria | 1390 |
| 1415 | Ga0501225_0015135 | 3300049705 | Bacteria | 2151 |
| 1416 | Ga0501079_0029789 | 3300049741 | Bacteria | 4192 |
| 1417 | Ga0501083_0020137 | 3300049744 | Bacteria | 4642 |
| 1418 | Ga0501083_0144163 | 3300049744 | Bacteria | 1559 |
| 1419 | Ga0501241_009979 | 3300049758 | Bacteria | 1727 |
| 1420 | Ga0501262_000181 | 3300049759 | Bacteria | 7854 |
| 1421 | Ga0501262_002123 | 3300049759 | Bacteria | 2243 |
| 1422 | Ga0501035_0002736 | 3300049822 | Bacteria | 17098 |
| 1423 | Ga0501035_0015212 | 3300049822 | Bacteria | 7102 |
| 1424 | Ga0501035_0022017 | 3300049822 | Bacteria | 5855 |
| 1425 | Ga0501044_0001803 | 3300049823 | Bacteria | 24994 |
| 1426 | Ga0501044_0002507 | 3300049823 | Bacteria | 20937 |
| 1427 | Ga0501044_0003761 | 3300049823 | Bacteria | 17052 |
| 1428 | Ga0501044_0061861 | 3300049823 | Bacteria | 3829 |
| 1429 | Ga0501044_0178955 | 3300049823 | Bacteria | 2088 |
| 1430 | Ga0501045_0056270 | 3300049824 | Bacteria | 2876 |
| 1431 | nmdc:mga03683_12216_c1 | 3300050489 | Bacteria | 3131 |
| 1432 | nmdc:mga03683_35302_c1 | 3300050489 | Bacteria | 2027 |
| 1433 | nmdc:mga03683_4492_c1 | 3300050489 | Bacteria | 4638 |
| 1434 | nmdc:mga03683_4655_c1 | 3300050489 | Bacteria | 4570 |
| 1435 | nmdc:mga03683_5619_c1 | 3300050489 | Bacteria | 4243 |
| 1436 | nmdc:mga03683_6955_c1 | 3300050489 | Bacteria | 3901 |
| 1437 | nmdc:mga03n38_17488_c1 | 3300050490 | Bacteria | 2809 |
| 1438 | nmdc:mga03n38_26844_c1 | 3300050490 | Bacteria | 2382 |
| 1439 | nmdc:mga03n38_30837_c1 | 3300050490 | Bacteria | 2258 |
| 1440 | nmdc:mga03n38_85573_c1 | 3300050490 | Bacteria | 1491 |
| 1441 | nmdc:mga03n38_98519_c1 | 3300050490 | Bacteria | 1406 |
| 1442 | nmdc:mga00v17_104432_c1 | 3300050491 | Bacteria | 1791 |
| 1443 | nmdc:mga00v17_33119_c1 | 3300050491 | Bacteria | 3060 |
| 1444 | nmdc:mga00v17_58800_c1 | 3300050491 | Bacteria | 2356 |
| 1445 | nmdc:mga0yw44_148517_c1 | 3300050492 | Bacteria | 1528 |
| 1446 | nmdc:mga0yw44_84836_c1 | 3300050492 | Bacteria | 1992 |
| 1447 | nmdc:mga0k408_1081_c1 | 3300050493 | Bacteria | 14950 |
| 1448 | nmdc:mga0k408_108584_c1 | 3300050493 | Bacteria | 1639 |
| 1449 | nmdc:mga0k408_137202_c1 | 3300050493 | Bacteria | 1454 |
| 1450 | nmdc:mga0k408_13834_c1 | 3300050493 | Bacteria | 4433 |
| 1451 | nmdc:mga0k408_19496_c1 | 3300050493 | Bacteria | 3792 |
| 1452 | nmdc:mga0k408_25391_c1 | 3300050493 | Bacteria | 3356 |
| 1453 | nmdc:mga0k408_4664_c1 | 3300050493 | Bacteria | 7262 |
| 1454 | nmdc:mga0k408_52279_c1 | 3300050493 | Bacteria | 2368 |
| 1455 | nmdc:mga0k408_5276_c1 | 3300050493 | Bacteria | 6862 |
| 1456 | nmdc:mga0k408_6711_c1 | 3300050493 | Bacteria | 4018 |
| 1457 | nmdc:mga0k408_75326_c1 | 3300050493 | Bacteria | 1972 |
| 1458 | nmdc:mga06z11_153292_c1 | 3300050494 | Bacteria | 1312 |
| 1459 | nmdc:mga06z11_3666_c1 | 3300050494 | Bacteria | 5963 |
| 1460 | nmdc:mga06z11_57755_c1 | 3300050494 | Bacteria | 2011 |
| 1461 | nmdc:mga04h51_7806_c1 | 3300050495 | Bacteria | 2840 |
| 1462 | nmdc:mga04h51_81838_c1 | 3300050495 | Bacteria | 1147 |
| 1463 | nmdc:mga07m45_1155_c1 | 3300050496 | Bacteria | 11859 |
| 1464 | nmdc:mga07m45_152014_c1 | 3300050496 | Bacteria | 1342 |
| 1465 | nmdc:mga07m45_179669_c1 | 3300050496 | Bacteria | 1230 |
| 1466 | nmdc:mga07m45_2192_c1 | 3300050496 | Bacteria | 9114 |
| 1467 | nmdc:mga07m45_22422_c1 | 3300050496 | Bacteria | 3447 |
| 1468 | nmdc:mga07m45_225999_c1 | 3300050496 | Bacteria | 1089 |
| 1469 | nmdc:mga07m45_40714_c1 | 3300050496 | Bacteria | 2600 |
| 1470 | nmdc:mga07m45_42714_c2 | 3300050496 | Bacteria | 1607 |
| 1471 | nmdc:mga07m45_7463_c1 | 3300050496 | Bacteria | 5590 |
| 1472 | nmdc:mga07m45_7550_c1 | 3300050496 | Bacteria | 4275 |
| 1473 | nmdc:mga07m45_9064_c1 | 3300050496 | Bacteria | 5142 |
| 1474 | nmdc:mga0n895_790177_c1 | 3300050512 | Bacteria | 940 |
| 1475 | nmdc:mga0sz30_1372_c1 | 3300050516 | Bacteria | 8712 |
| 1476 | nmdc:mga0sz30_424_c1 | 3300050516 | Bacteria | 15989 |
| 1477 | Ga0495601_0005754 | 3300053077 | Bacteria | 7228 |
| 1478 | Ga0495601_0111250 | 3300053077 | Bacteria | 1774 |
| 1479 | Ga0495601_0412530 | 3300053077 | Bacteria | 875 |
| 1480 | Ga0500610_0009289 | 3300053079 | Bacteria | 4346 |
| 1481 | Ga0500635_0000055 | 3300053080 | Bacteria | 74107 |
| 1482 | Ga0495595_0004360 | 3300053084 | Bacteria | 5696 |
| 1483 | Ga0495619_0010788 | 3300053085 | Bacteria | 5749 |
| 1484 | Ga0495619_0413361 | 3300053085 | Bacteria | 931 |
| 1485 | Ga0500578_0001033 | 3300053086 | Bacteria | 30501 |
| 1486 | Ga0500643_004846 | 3300053087 | Bacteria | 5942 |
| 1487 | Ga0500644_0044020 | 3300053088 | Bacteria | 1497 |
| 1488 | Ga0500646_0015828 | 3300053090 | Bacteria | 1966 |
| 1489 | Ga0500651_0000324 | 3300053093 | Bacteria | 27187 |
| 1490 | Ga0500651_0009686 | 3300053093 | Bacteria | 5741 |
| 1491 | Ga0500651_0155072 | 3300053093 | Bacteria | 1373 |
| 1492 | Ga0500641_0007988 | 3300053096 | Bacteria | 3770 |
| 1493 | Ga0500641_0020272 | 3300053096 | Bacteria | 2523 |
| 1494 | Ga0500571_000080 | 3300053110 | Bacteria | 30359 |
| 1495 | Ga0500595_001317 | 3300053119 | Bacteria | 13455 |
| 1496 | Ga0500608_034717 | 3300053122 | Bacteria | 2403 |
| 1497 | Ga0500618_009424 | 3300053125 | Bacteria | 2665 |
| 1498 | Ga0500642_0008169 | 3300053130 | Bacteria | 3565 |
| 1499 | Ga0500652_000391 | 3300053131 | Bacteria | 15723 |
| 1500 | Ga0500658_0000210 | 3300053134 | Bacteria | 27749 |
| 1501 | Ga0500658_0000493 | 3300053134 | Bacteria | 16873 |
| 1502 | Ga0500559_0000636 | 3300053136 | Bacteria | 23688 |
| 1503 | Ga0500559_0028883 | 3300053136 | Bacteria | 2371 |
| 1504 | Ga0500568_0091746 | 3300053139 | Bacteria | 1145 |
| 1505 | Ga0500574_006587 | 3300053141 | Bacteria | 2349 |
| 1506 | Ga0500574_045910 | 3300053141 | Bacteria | 1234 |
| 1507 | Ga0500604_0004012 | 3300053151 | Bacteria | 3927 |
| 1508 | Ga0500616_0005410 | 3300053153 | Bacteria | 8667 |
| 1509 | Ga0500619_002284 | 3300053154 | Bacteria | 3653 |
| 1510 | Ga0500622_0000149 | 3300053156 | Bacteria | 73646 |
| 1511 | Ga0500622_0006654 | 3300053156 | Bacteria | 6659 |
| 1512 | Ga0500627_0018056 | 3300053158 | Bacteria | 2785 |
| 1513 | Ga0500634_0005197 | 3300053161 | Bacteria | 6145 |
| 1514 | Ga0500570_107409 | 3300053724 | Bacteria | 1147 |
| 1515 | Ga0500645_001492 | 3300053730 | Bacteria | 11733 |
| 1516 | Ga0500645_003076 | 3300053730 | Bacteria | 6996 |
| 1517 | Ga0500645_046735 | 3300053730 | Bacteria | 1270 |
| 1518 | Ga0501084_0002314 | 3300054114 | Bacteria | 15300 |
| 1519 | Ga0466962_0054867 | 3300061719 | Bacteria | 1904 |
| 1520 | Ga0530510_0016427 | 3300061734 | Bacteria | 5239 |
| 1521 | 2501082193 | 2501025502 | Bacteria | 9641094 |
| 1522 | 2900635022 | 2900634093 | Bacteria | 10263517 |
| 1523 | Ga0182007_10004797 | |||
| 1524 | JGI24740J21852_10016314 | |||
| 1525 | JGI25155J39150_1000049 | |||
| 1526 | JGI25155J39150_1000145 | |||
| 1527 | JGI25155J39150_1000235 | |||
| 1528 | JGI25156J39149_1000023 | |||
| 1529 | JGI25156J39149_1000220 | |||
| 1530 | JGI25156J39149_1000290 | |||
| 1531 | JGI25156J39149_1001073 | |||
| 1532 | JGI25156J39149_1004387 | |||
| 1533 | JGI25162J39368_1000369 | |||
| 1534 | JGI25154J39366_1000036 | |||
| 1535 | JGI25154J39366_1000265 | |||
| 1536 | JGI25154J39366_1000422 | |||
| 1537 | JGI25154J39366_1000669 | |||
| 1538 | JGI25157J39369_1000023 | |||
| 1539 | JGI25157J39369_1000135 | |||
| 1540 | JGI25157J39369_1000186 | |||
| 1541 | JGI25163J39215_1004222 | |||
| 1542 | JGI25164J39214_1001832 | |||
| 1543 | JGI25152J39213_1004068 | |||
| 1544 | JGI25152J39213_1013350 | |||
| 1545 | JGI25150J39212_1005722 | |||
| 1546 | JGI25150J39212_1014895 | |||
| 1547 | JGI25159J45721_1001073 | |||
| 1548 | JGI25159J45721_1001804 | |||
| 1549 | JGI25159J45721_1010573 | |||
| 1550 | JGI25151J46595_10000095 | |||
| 1551 | JGI25151J46595_10000682 | |||
| 1552 | JGI25151J46595_10001217 | |||
| 1553 | JGI25151J46595_10004016 | |||
| 1554 | JGI25151J46595_10011646 | |||
| 1555 | JGI25151J46595_10015494 | |||
| 1556 | JGI25151J46595_10025218 | |||
| 1557 | JGI25165J46597_1000022 | |||
| 1558 | JGI25160J50197_1000256 | |||
| 1559 | JGI25160J50197_1000260 | |||
| 1560 | JGI25161J50226_1000015 | |||
| 1561 | JGI25161J50226_1003370 | |||
| 1562 | Ga0055538_1000011 | |||
| 1563 | Ga0055538_1000211 | |||
| 1564 | Ga0055538_1004347 | |||
| 1565 | Ga0055539_1000016 | |||
| 1566 | Ga0055539_1000253 | |||
| 1567 | Ga0055533_1000019 | |||
| 1568 | Ga0055533_1000244 | |||
| 1569 | Ga0055533_1006875 | |||
| 1570 | Ga0055532_1000002 | |||
| 1571 | Ga0055532_1000029 | |||
| 1572 | Ga0055532_1000077 | |||
| 1573 | Ga0055525_1000042 | |||
| 1574 | Ga0055525_1000341 | |||
| 1575 | Ga0055535_1001340 | |||
| 1576 | Ga0055535_1013422 | |||
| 1577 | Ga0055535_1016064 | |||
| 1578 | Ga0055542_1000114 | |||
| 1579 | Ga0055529_1000062 | |||
| 1580 | Ga0055526_1001344 | |||
| 1581 | Ga0055526_1003598 | |||
| 1582 | Ga0055526_1006059 | |||
| 1583 | Ga0055526_1006704 | |||
| 1584 | Ga0055526_1027625 | |||
| 1585 | Ga0055537_1000135 | |||
| 1586 | Ga0055537_1000972 | |||
| 1587 | Ga0055537_1004059 | |||
| 1588 | Ga0055537_1007985 | |||
| 1589 | Ga0055537_1011803 | |||
| 1590 | Ga0055524_1000016 | |||
| 1591 | Ga0055524_1001369 | |||
| 1592 | Ga0055524_1027203 | |||
| 1593 | Ga0055536_1001508 | |||
| 1594 | Ga0055536_1002393 | |||
| 1595 | Ga0055536_1002988 | |||
| 1596 | Ga0055536_1003001 | |||
| 1597 | Ga0055536_1005027 | |||
| 1598 | Ga0055536_1012339 | |||
| 1599 | Ga0055534_1000222 | |||
| 1600 | Ga0055534_1003866 | |||
| 1601 | Ga0055534_1004171 | |||
| 1602 | Ga0055534_1004254 | |||
| 1603 | Ga0055528_1000423 | |||
| 1604 | Ga0055528_1021001 | |||
| 1605 | Ga0055528_1041767 | |||
| 1606 | Ga0055530_10000293 | |||
| 1607 | Ga0055530_10000951 | |||
| 1608 | Ga0055530_10010819 | |||
| 1609 | Ga0055530_10027026 | |||
| 1610 | Ga0055540_1000144 | |||
| 1611 | Ga0055540_1001605 | |||
| 1612 | Ga0055531_10003930 | |||
| 1613 | Ga0055531_10006565 | |||
| 1614 | Ga0055541_1000017 | |||
| 1615 | Ga0055541_1000152 | |||
| 1616 | Ga0055541_1008688 | |||
| 1617 | Ga0065165_1002529 | |||
| 1618 | Ga0065165_1003560 | |||
| 1619 | Ga0065714_10027786 | |||
| 1620 | Ga0065714_10110956 | |||
| 1621 | Ga0065704_10196170 | |||
| 1622 | Ga0065712_10033510 | |||
| 1623 | Ga0065712_10215458 | |||
| 1624 | Ga0065715_10018889 | |||
| 1625 | Ga0065707_10097541 | |||
| 1626 | Ga0070658_10003267 | |||
| 1627 | Ga0070658_10006087 | |||
| 1628 | Ga0070658_10078641 | |||
| 1629 | Ga0070658_10125923 | |||
| 1630 | Ga0070658_10189808 | |||
| 1631 | Ga0070658_10266896 | |||
| 1632 | Ga0070676_10000320 | |||
| 1633 | Ga0070676_10031111 | |||
| 1634 | Ga0070676_10095452 | |||
| 1635 | Ga0070690_100006125 | |||
| 1636 | Ga0070690_100199822 | |||
| 1637 | Ga0070690_100283513 | |||
| 1638 | Ga0070670_100010983 | |||
| 1639 | Ga0070670_100435533 | |||
| 1640 | Ga0070677_10004319 | |||
| 1641 | Ga0070677_10055158 | |||
| 1642 | Ga0070677_10064821 | |||
| 1643 | Ga0068869_100002410 | |||
| 1644 | Ga0068869_100033892 | |||
| 1645 | Ga0068869_100070788 | |||
| 1646 | Ga0068869_100085929 | |||
| 1647 | Ga0070666_10083850 | |||
| 1648 | Ga0070680_100016218 | |||
| 1649 | Ga0070680_100040031 | |||
| 1650 | Ga0070680_100162083 | |||
| 1651 | Ga0068868_100019122 | |||
| 1652 | Ga0068868_100114968 | |||
| 1653 | Ga0068868_100210467 | |||
| 1654 | Ga0070660_100021552 | |||
| 1655 | Ga0070660_100056605 | |||
| 1656 | Ga0070660_100433757 | |||
| 1657 | Ga0070689_100069856 | |||
| 1658 | Ga0070689_100105242 | |||
| 1659 | Ga0070689_100262439 | |||
| 1660 | Ga0070691_10040465 | |||
| 1661 | Ga0070687_100372175 | |||
| 1662 | Ga0070661_100016420 | |||
| 1663 | Ga0070661_100034875 | |||
| 1664 | Ga0070692_10010718 | |||
| 1665 | Ga0070668_100027748 | |||
| 1666 | Ga0070668_100033774 | |||
| 1667 | Ga0070668_100037347 | |||
| 1668 | Ga0070669_100024401 | |||
| 1669 | Ga0070669_100029937 | |||
| 1670 | Ga0070675_100001927 | |||
| 1671 | Ga0070675_100047101 | |||
| 1672 | Ga0070675_100101858 | |||
| 1673 | Ga0070675_100362323 | |||
| 1674 | Ga0070671_100084995 | |||
| 1675 | Ga0070671_100272223 | |||
| 1676 | Ga0070671_100308037 | |||
| 1677 | Ga0070671_100324383 | |||
| 1678 | Ga0070671_100395609 | |||
| 1679 | Ga0070674_100029239 | |||
| 1680 | Ga0070674_100073669 | |||
| 1681 | Ga0070673_100037884 | |||
| 1682 | Ga0070673_100061084 | |||
| 1683 | Ga0070673_100065980 | |||
| 1684 | Ga0070688_100257944 | |||
| 1685 | Ga0070659_100001576 | |||
| 1686 | Ga0070659_100012726 | |||
| 1687 | Ga0070659_100013884 | |||
| 1688 | Ga0070659_100239492 | |||
| 1689 | Ga0070659_100324925 | |||
| 1690 | Ga0070667_100044049 | |||
| 1691 | Ga0070667_100048082 | |||
| 1692 | Ga0070667_100071496 | |||
| 1693 | Ga0070667_100249764 | |||
| 1694 | Ga0070714_100019818 | |||
| 1695 | Ga0070701_10003477 | |||
| 1696 | Ga0070705_100025900 | |||
| 1697 | Ga0070705_100029002 | |||
| 1698 | Ga0070705_100379738 | |||
| 1699 | Ga0070700_100010396 | |||
| 1700 | Ga0070663_100007977 | |||
| 1701 | Ga0070663_100039272 | |||
| 1702 | Ga0070678_100002841 | |||
| 1703 | Ga0070678_100017631 | |||
| 1704 | Ga0070678_100066761 | |||
| 1705 | Ga0070678_100169788 | |||
| 1706 | Ga0070678_100226554 | |||
| 1707 | Ga0070662_100008031 | |||
| 1708 | Ga0070662_100032246 | |||
| 1709 | Ga0070662_100081197 | |||
| 1710 | Ga0070662_100185248 | |||
| 1711 | Ga0070662_100193596 | |||
| 1712 | Ga0070681_10016317 | |||
| 1713 | Ga0068867_100001486 | |||
| 1714 | Ga0068867_100015713 | |||
| 1715 | Ga0068867_100022223 | |||
| 1716 | Ga0068867_100104915 | |||
| 1717 | Ga0068867_100106500 | |||
| 1718 | Ga0068867_100164030 | |||
| 1719 | Ga0068867_100257839 | |||
| 1720 | Ga0070685_10146818 | |||
| 1721 | Ga0070706_100027210 | |||
| 1722 | Ga0070706_100035650 | |||
| 1723 | Ga0070706_100405324 | |||
| 1724 | Ga0070707_100018087 | |||
| 1725 | Ga0070707_100266192 | |||
| 1726 | Ga0070698_100008886 | |||
| 1727 | Ga0070698_100187757 | |||
| 1728 | Ga0070699_100063404 | |||
| 1729 | Ga0070699_100195495 | |||
| 1730 | Ga0070679_100007311 | |||
| 1731 | Ga0070679_100064860 | |||
| 1732 | Ga0070679_100127769 | |||
| 1733 | Ga0070679_100144109 | |||
| 1734 | Ga0070679_100162507 | |||
| 1735 | Ga0070679_100300381 | |||
| 1736 | Ga0070684_100017377 | |||
| 1737 | Ga0070684_100204439 | |||
| 1738 | Ga0068853_100039942 | |||
| 1739 | Ga0068853_100090444 | |||
| 1740 | Ga0068853_100110475 | |||
| 1741 | Ga0068853_100286302 | |||
| 1742 | Ga0068853_100301975 | |||
| 1743 | Ga0068853_100438804 | |||
| 1744 | Ga0070672_100000455 | |||
| 1745 | Ga0070672_100001146 | |||
| 1746 | Ga0070672_100021909 | |||
| 1747 | Ga0070672_100046548 | |||
| 1748 | Ga0070686_100154140 | |||
| 1749 | Ga0070686_100177581 | |||
| 1750 | Ga0070686_100209010 | |||
| 1751 | Ga0070686_100209064 | |||
| 1752 | Ga0070686_100266902 | |||
| 1753 | Ga0070686_100291640 | |||
| 1754 | Ga0070695_100140069 | |||
| 1755 | Ga0070695_100251517 | |||
| 1756 | Ga0070693_100003698 | |||
| 1757 | Ga0070693_100012198 | |||
| 1758 | Ga0070693_100047433 | |||
| 1759 | Ga0070693_100273485 | |||
| 1760 | Ga0070693_100307521 | |||
| 1761 | Ga0070665_100011648 | |||
| 1762 | Ga0070665_100060646 | |||
| 1763 | Ga0070665_100066266 | |||
| 1764 | Ga0070704_100438152 | |||
| 1765 | Ga0068855_100012616 | |||
| 1766 | Ga0068855_100022837 | |||
| 1767 | Ga0068855_100033825 | |||
| 1768 | Ga0068855_100061531 | |||
| 1769 | Ga0068855_100066997 | |||
| 1770 | Ga0068855_100077991 | |||
| 1771 | Ga0068855_100140452 | |||
| 1772 | Ga0068855_100142557 | |||
| 1773 | Ga0068855_100255587 | |||
| 1774 | Ga0070664_100014870 | |||
| 1775 | Ga0070664_100125613 | |||
| 1776 | Ga0070664_100140084 | |||
| 1777 | Ga0070664_100204104 | |||
| 1778 | Ga0070664_100308755 | |||
| 1779 | Ga0070664_100309817 | |||
| 1780 | Ga0070664_100365647 | |||
| 1781 | Ga0070664_100487770 | |||
| 1782 | Ga0068857_100001496 | |||
| 1783 | Ga0068857_100010173 | |||
| 1784 | Ga0068857_100051914 | |||
| 1785 | Ga0068857_100077855 | |||
| 1786 | Ga0068854_100002285 | |||
| 1787 | Ga0068854_100004431 | |||
| 1788 | Ga0068854_100009632 | |||
| 1789 | Ga0068854_100021798 | |||
| 1790 | Ga0068854_100046047 | |||
| 1791 | Ga0068854_100068368 | |||
| 1792 | Ga0068856_100009070 | |||
| 1793 | Ga0068856_100018538 | |||
| 1794 | Ga0068856_100061885 | |||
| 1795 | Ga0068856_100120537 | |||
| 1796 | Ga0068856_100193901 | |||
| 1797 | Ga0068856_100241011 | |||
| 1798 | Ga0068856_100481611 | |||
| 1799 | Ga0070702_100010386 | |||
| 1800 | Ga0070702_100015341 | |||
| 1801 | Ga0068852_100001380 | |||
| 1802 | Ga0068852_100039666 | |||
| 1803 | Ga0068852_100061872 | |||
| 1804 | Ga0068852_100068072 | |||
| 1805 | Ga0068852_100129822 | |||
| 1806 | Ga0068852_100216993 | |||
| 1807 | Ga0068852_100219269 | |||
| 1808 | Ga0068852_100526901 | |||
| 1809 | Ga0068859_100007275 | |||
| 1810 | Ga0068859_100016209 | |||
| 1811 | Ga0068859_100082328 | |||
| 1812 | Ga0068859_100154983 | |||
| 1813 | Ga0068859_100513955 | |||
| 1814 | Ga0068864_100010520 | |||
| 1815 | Ga0068864_100031907 | |||
| 1816 | Ga0068864_100044791 | |||
| 1817 | Ga0068864_100060611 | |||
| 1818 | Ga0068866_10005198 | |||
| 1819 | Ga0068866_10025134 | |||
| 1820 | Ga0068866_10154427 | |||
| 1821 | Ga0068861_100003094 | |||
| 1822 | Ga0068861_100032543 | |||
| 1823 | Ga0068861_100041906 | |||
| 1824 | Ga0068861_100043682 | |||
| 1825 | Ga0068861_100284323 | |||
| 1826 | Ga0068851_10013725 | |||
| 1827 | Ga0068851_10047436 | |||
| 1828 | Ga0068851_10075684 | |||
| 1829 | Ga0068851_10101961 | |||
| 1830 | Ga0068851_10133598 | |||
| 1831 | Ga0068870_10016636 | |||
| 1832 | Ga0068870_10023363 | |||
| 1833 | Ga0068863_100001744 | |||
| 1834 | Ga0068863_100022783 | |||
| 1835 | Ga0068858_100029306 | |||
| 1836 | Ga0068858_100053295 | |||
| 1837 | Ga0068858_100077271 | |||
| 1838 | Ga0068858_100402312 | |||
| 1839 | Ga0068860_100035652 | |||
| 1840 | Ga0068860_100050343 | |||
| 1841 | Ga0068860_100100749 | |||
| 1842 | Ga0068860_100256243 | |||
| 1843 | Ga0068862_100015247 | |||
| 1844 | Ga0068862_100020890 | |||
| 1845 | Ga0068862_100039407 | |||
| 1846 | Ga0068862_100056495 | |||
| 1847 | Ga0081455_10001395 | |||
| 1848 | Ga0081455_10002648 | |||
| 1849 | Ga0081455_10010547 | |||
| 1850 | Ga0081539_10015865 | |||
| 1851 | Ga0075365_10002444 | |||
| 1852 | Ga0075365_10044317 | |||
| 1853 | Ga0075365_10121602 | |||
| 1854 | Ga0075365_10123674 | |||
| 1855 | Ga0075365_10142884 | |||
| 1856 | Ga0075368_10015636 | |||
| 1857 | Ga0075368_10015867 | |||
| 1858 | Ga0075363_100017418 | |||
| 1859 | Ga0075363_100027807 | |||
| 1860 | Ga0075363_100038847 | |||
| 1861 | Ga0075363_100046661 | |||
| 1862 | Ga0075364_10037915 | |||
| 1863 | Ga0075364_10064427 | |||
| 1864 | Ga0075364_10090544 | |||
| 1865 | Ga0075364_10118418 | |||
| 1866 | Ga0075432_10003417 | |||
| 1867 | Ga0070715_10013631 | |||
| 1868 | Ga0070712_100318561 | |||
| 1869 | Ga0075362_10003711 | |||
| 1870 | Ga0075362_10004022 | |||
| 1871 | Ga0075362_10009604 | |||
| 1872 | Ga0075362_10015470 | |||
| 1873 | Ga0075362_10027448 | |||
| 1874 | Ga0075362_10047479 | |||
| 1875 | Ga0075362_10074111 | |||
| 1876 | Ga0075362_10121470 | |||
| 1877 | Ga0075367_10008214 | |||
| 1878 | Ga0075367_10095447 | |||
| 1879 | Ga0075367_10103121 | |||
| 1880 | Ga0075367_10106172 | |||
| 1881 | Ga0075367_10106780 | |||
| 1882 | Ga0075367_10182577 | |||
| 1883 | Ga0075369_10000736 | |||
| 1884 | Ga0075369_10014986 | |||
| 1885 | Ga0075366_10008204 | |||
| 1886 | Ga0075366_10020307 | |||
| 1887 | Ga0075366_10023577 | |||
| 1888 | Ga0075366_10025110 | |||
| 1889 | Ga0075366_10039213 | |||
| 1890 | Ga0075366_10048713 | |||
| 1891 | Ga0075366_10064808 | |||
| 1892 | Ga0075366_10124617 | |||
| 1893 | Ga0075366_10139857 | |||
| 1894 | Ga0075366_10202852 | |||
| 1895 | Ga0097621_100005368 | |||
| 1896 | Ga0097621_100046253 | |||
| 1897 | Ga0097621_100046943 | |||
| 1898 | Ga0097621_100052233 | |||
| 1899 | Ga0097621_100062452 | |||
| 1900 | Ga0097621_100300081 | |||
| 1901 | Ga0075370_10001756 | |||
| 1902 | Ga0075370_10004393 | |||
| 1903 | Ga0075370_10005564 | |||
| 1904 | Ga0075370_10008738 | |||
| 1905 | Ga0075370_10008946 | |||
| 1906 | Ga0075370_10012183 | |||
| 1907 | Ga0075370_10017291 | |||
| 1908 | Ga0075370_10062019 | |||
| 1909 | Ga0075370_10173554 | |||
| 1910 | Ga0068871_100011498 | |||
| 1911 | Ga0068871_100014985 | |||
| 1912 | Ga0068871_100027274 | |||
| 1913 | Ga0068871_100032191 | |||
| 1914 | Ga0068871_100038841 | |||
| 1915 | Ga0068871_100364516 | |||
| 1916 | Ga0068871_100542427 | |||
| 1917 | Ga0075434_100828613 | |||
| 1918 | Ga0068865_100024637 | |||
| 1919 | Ga0068865_100029315 | |||
| 1920 | Ga0068865_100082262 | |||
| 1921 | Ga0097620_100007275 | |||
| 1922 | Ga0097620_100016209 | |||
| 1923 | Ga0097620_100082323 | |||
| 1924 | Ga0097620_100154981 | |||
| 1925 | Ga0097620_100513937 | |||
| 1926 | Ga0099824_1046569 | |||
| 1927 | Ga0099826_10000020 | |||
| 1928 | Ga0099826_10004782 | |||
| 1929 | Ga0099826_10139654 | |||
| 1930 | Ga0099794_10043265 | |||
| 1931 | Ga0099794_10061160 | |||
| 1932 | Ga0099794_10217919 | |||
| 1933 | Ga0105251_10001533 | |||
| 1934 | Ga0105251_10072524 | |||
| 1935 | Ga0105251_10164173 | |||
| 1936 | Ga0105244_10005141 | |||
| 1937 | Ga0105244_10114075 | |||
| 1938 | Ga0105240_10002847 | |||
| 1939 | Ga0105240_10004008 | |||
| 1940 | Ga0105240_10004595 | |||
| 1941 | Ga0105240_10006708 | |||
| 1942 | Ga0105240_10010502 | |||
| 1943 | Ga0105240_10021598 | |||
| 1944 | Ga0105240_10050266 | |||
| 1945 | Ga0105240_10052126 | |||
| 1946 | Ga0105240_10180266 | |||
| 1947 | Ga0105240_10409667 | |||
| 1948 | Ga0105245_10038308 | |||
| 1949 | Ga0105245_10057603 | |||
| 1950 | Ga0105245_10077594 | |||
| 1951 | Ga0105245_10120427 | |||
| 1952 | Ga0105245_10471504 | |||
| 1953 | Ga0105245_10826227 | |||
| 1954 | Ga0105245_10886509 | |||
| 1955 | Ga0114129_10477035 | |||
| 1956 | Ga0105243_10000972 | |||
| 1957 | Ga0105243_10001957 | |||
| 1958 | Ga0105243_10006686 | |||
| 1959 | Ga0105243_10029263 | |||
| 1960 | Ga0105243_10032140 | |||
| 1961 | Ga0105243_10141151 | |||
| 1962 | Ga0105243_10179457 | |||
| 1963 | Ga0105243_10257390 | |||
| 1964 | Ga0105243_10283723 | |||
| 1965 | Ga0105241_10167409 | |||
| 1966 | Ga0105241_10247434 | |||
| 1967 | Ga0105242_10011903 | |||
| 1968 | Ga0105242_10023227 | |||
| 1969 | Ga0105242_10117227 | |||
| 1970 | Ga0105242_10267954 | |||
| 1971 | Ga0105248_10006623 | |||
| 1972 | Ga0105248_10323809 | |||
| 1973 | Ga0105248_10372280 | |||
| 1974 | Ga0105248_11268441 | |||
| 1975 | Ga0105237_10001856 | |||
| 1976 | Ga0105237_10004431 | |||
| 1977 | Ga0105237_10010879 | |||
| 1978 | Ga0105237_10033848 | |||
| 1979 | Ga0105237_10257728 | |||
| 1980 | Ga0105237_10559222 | |||
| 1981 | Ga0105238_10000006 | |||
| 1982 | Ga0105238_10010668 | |||
| 1983 | Ga0105238_10036320 | |||
| 1984 | Ga0105238_10062761 | |||
| 1985 | Ga0105238_10106908 | |||
| 1986 | Ga0105238_10155806 | |||
| 1987 | Ga0105238_10377118 | |||
| 1988 | Ga0105249_10025103 | |||
| 1989 | Ga0105249_10052442 | |||
| 1990 | Ga0105249_10237353 | |||
| 1991 | Ga0105249_10413878 | |||
| 1992 | Ga0105239_10001826 | |||
| 1993 | Ga0105239_10006997 | |||
| 1994 | Ga0105239_10066463 | |||
| 1995 | Ga0105239_10102505 | |||
| 1996 | Ga0105239_10675601 | |||
| 1997 | Ga0105239_10837932 | |||
| 1998 | Ga0105246_10099723 | |||
| 1999 | Ga0105246_10230233 | |||
| 2000 | Ga0157371_10065548 | |||
| 2001 | Ga0157371_10116637 | |||
| 2002 | Ga0157370_10007222 | |||
| 2003 | Ga0157370_10019942 | |||
| 2004 | Ga0157370_10154548 | |||
| 2005 | Ga0157370_10447941 | |||
| 2006 | Ga0157369_10002332 | |||
| 2007 | Ga0157369_10041430 | |||
| 2008 | Ga0157369_10080187 | |||
| 2009 | Ga0157369_10086670 | |||
| 2010 | Ga0157369_10087324 | |||
| 2011 | Ga0157369_10326096 | |||
| 2012 | Ga0157369_10441847 | |||
| 2013 | Ga0157374_10019483 | |||
| 2014 | Ga0157374_10030208 | |||
| 2015 | Ga0157374_10109104 | |||
| 2016 | Ga0157378_10021050 | |||
| 2017 | Ga0157378_10243075 | |||
| 2018 | Ga0157378_10371985 | |||
| 2019 | Ga0163162_10009232 | |||
| 2020 | Ga0163162_10023582 | |||
| 2021 | Ga0163162_10074809 | |||
| 2022 | Ga0163162_10269541 | |||
| 2023 | Ga0163162_10356051 | |||
| 2024 | Ga0157372_10000824 | |||
| 2025 | Ga0157372_10045482 | |||
| 2026 | Ga0157372_10085341 | |||
| 2027 | Ga0157372_10219693 | |||
| 2028 | Ga0157372_10271276 | |||
| 2029 | Ga0157372_10290053 | |||
| 2030 | Ga0157372_11097025 | |||
| 2031 | Ga0157375_10108568 | |||
| 2032 | Ga0157375_10146754 | |||
| 2033 | Ga0157375_10160675 | |||
| 2034 | Ga0157375_10164555 | |||
| 2035 | Ga0157375_10294349 | |||
| 2036 | Ga0157375_10340146 | |||
| 2037 | Ga0157375_10915607 | |||
| 2038 | Ga0163163_10617822 | |||
| 2039 | Ga0157380_10038996 | |||
| 2040 | Ga0157380_10090437 | |||
| 2041 | Ga0157380_10455407 | |||
| 2042 | Ga0182008_10000729 | |||
| 2043 | Ga0182008_10003871 | |||
| 2044 | Ga0182008_10016800 | |||
| 2045 | Ga0182008_10019464 | |||
| 2046 | Ga0182008_10036706 | |||
| 2047 | Ga0182008_10069564 | |||
| 2048 | Ga0182008_10075108 | |||
| 2049 | Ga0157377_10009636 | |||
| 2050 | Ga0157379_10005798 | |||
| 2051 | Ga0157379_10015108 | |||
| 2052 | Ga0157379_10157387 | |||
| 2053 | Ga0157379_10253212 | |||
| 2054 | Ga0157376_10008025 | |||
| 2055 | Ga0157376_10032170 | |||
| 2056 | Ga0157376_10435700 | |||
| 2057 | Ga0157376_10740834 | |||
| 2058 | Ga0182006_1000680 | |||
| 2059 | Ga0182006_1003026 | |||
| 2060 | Ga0182006_1008332 | |||
| 2061 | Ga0182006_1037486 | |||
| 2062 | Ga0182006_1048476 | |||
| 2063 | Ga0182007_10000164 | |||
| 2064 | Ga0182007_10002069 | |||
| 2065 | Ga0182007_10008922 | |||
| 2066 | Ga0182007_10012543 | |||
| 2067 | Ga0182005_1000986 | |||
| 2068 | Ga0182005_1053904 | |||
| 2069 | Ga0183361_10013 | |||
| 2070 | Ga0163161_10007253 | |||
| 2071 | Ga0163161_10009227 | |||
| 2072 | Ga0163161_10010284 | |||
| 2073 | Ga0163161_10030116 | |||
| 2074 | Ga0163161_10032692 | |||
| 2075 | Ga0163161_10058577 | |||
| 2076 | Ga0163161_10108933 | |||
| 2077 | Ga0213872_10001779 | |||
| 2078 | Ga0213872_10035049 | |||
| 2079 | Ga0209435_100001 | |||
| 2080 | Ga0209435_100048 | |||
| 2081 | Ga0209435_100221 | |||
| 2082 | Ga0209760_100904 | |||
| 2083 | Ga0209784_100009 | |||
| 2084 | Ga0209784_100019 | |||
| 2085 | Ga0209784_102760 | |||
| 2086 | Ga0209566_100007 | |||
| 2087 | Ga0209566_100017 | |||
| 2088 | Ga0209674_100018 | |||
| 2089 | Ga0209674_100031 | |||
| 2090 | Ga0209674_106377 | |||
| 2091 | Ga0209672_100052 | |||
| 2092 | Ga0209672_100190 | |||
| 2093 | Ga0209672_101186 | |||
| 2094 | Ga0209147_100002 | |||
| 2095 | Ga0209147_100122 | |||
| 2096 | Ga0209563_100020 | |||
| 2097 | Ga0209563_100035 | |||
| 2098 | Ga0209563_111684 | |||
| 2099 | Ga0207427_100296 | |||
| 2100 | Ga0207427_101737 | |||
| 2101 | Ga0209437_100038 | |||
| 2102 | Ga0209437_100081 | |||
| 2103 | Ga0209258_100002 | |||
| 2104 | Ga0209258_100225 | |||
| 2105 | Ga0209258_100230 | |||
| 2106 | Ga0209258_100869 | |||
| 2107 | Ga0207425_1000149 | |||
| 2108 | Ga0207425_1000530 | |||
| 2109 | Ga0207425_1002683 | |||
| 2110 | Ga0207425_1007888 | |||
| 2111 | Ga0209646_1000001 | |||
| 2112 | Ga0209646_1000130 | |||
| 2113 | Ga0209646_1000152 | |||
| 2114 | Ga0209646_1000214 | |||
| 2115 | Ga0209026_1000003 | |||
| 2116 | Ga0209026_1000059 | |||
| 2117 | Ga0209026_1000126 | |||
| 2118 | Ga0209677_100010 | |||
| 2119 | Ga0209677_100020 | |||
| 2120 | Ga0209677_100226 | |||
| 2121 | Ga0209148_1000040 | |||
| 2122 | Ga0209148_1003376 | |||
| 2123 | Ga0209759_1000001 | |||
| 2124 | Ga0209759_1000188 | |||
| 2125 | Ga0209759_1000193 | |||
| 2126 | Ga0209759_1000365 | |||
| 2127 | Ga0209759_1000509 | |||
| 2128 | Ga0209759_1015272 | |||
| 2129 | Ga0209129_1000007 | |||
| 2130 | Ga0209129_1000119 | |||
| 2131 | Ga0209233_1000049 | |||
| 2132 | Ga0209565_1000004 | |||
| 2133 | Ga0209565_1000085 | |||
| 2134 | Ga0209565_1000092 | |||
| 2135 | Ga0209565_1000365 | |||
| 2136 | Ga0209565_1000394 | |||
| 2137 | Ga0209565_1004286 | |||
| 2138 | Ga0209565_1014546 | |||
| 2139 | Ga0209455_1000021 | |||
| 2140 | Ga0209673_1000045 | |||
| 2141 | Ga0209673_1000133 | |||
| 2142 | Ga0209673_1000445 | |||
| 2143 | Ga0209673_1003004 | |||
| 2144 | Ga0209673_1005760 | |||
| 2145 | Ga0209673_1027752 | |||
| 2146 | Ga0209130_1000056 | |||
| 2147 | Ga0209130_1000070 | |||
| 2148 | Ga0209130_1000634 | |||
| 2149 | Ga0209130_1001057 | |||
| 2150 | Ga0209130_1004319 | |||
| 2151 | Ga0209675_1000083 | |||
| 2152 | Ga0209675_1000411 | |||
| 2153 | Ga0209675_1000809 | |||
| 2154 | Ga0209675_1000951 | |||
| 2155 | Ga0209675_1002465 | |||
| 2156 | Ga0209675_1007014 | |||
| 2157 | Ga0209675_1007810 | |||
| 2158 | Ga0209675_1013763 | |||
| 2159 | Ga0209675_1041373 | |||
| 2160 | Ga0209676_1000004 | |||
| 2161 | Ga0209676_1000007 | |||
| 2162 | Ga0209676_1000012 | |||
| 2163 | Ga0209676_1000268 | |||
| 2164 | Ga0209676_1000565 | |||
| 2165 | Ga0209676_1006485 | |||
| 2166 | Ga0209676_1013164 | |||
| 2167 | Ga0209025_1000055 | |||
| 2168 | Ga0209025_1000111 | |||
| 2169 | Ga0209025_1000455 | |||
| 2170 | Ga0209025_1000529 | |||
| 2171 | Ga0209025_1000892 | |||
| 2172 | Ga0209025_1001053 | |||
| 2173 | Ga0209025_1001159 | |||
| 2174 | Ga0209025_1001484 | |||
| 2175 | Ga0209025_1003293 | |||
| 2176 | Ga0209025_1004030 | |||
| 2177 | Ga0209025_1007672 | |||
| 2178 | Ga0209025_1034371 | |||
| 2179 | Ga0209564_1000024 | |||
| 2180 | Ga0209564_1000772 | |||
| 2181 | Ga0209564_1001095 | |||
| 2182 | Ga0209564_1001593 | |||
| 2183 | Ga0209564_1002067 | |||
| 2184 | Ga0209564_1002203 | |||
| 2185 | Ga0209564_1004894 | |||
| 2186 | Ga0209758_1000025 | |||
| 2187 | Ga0209758_1000194 | |||
| 2188 | Ga0209758_1010717 | |||
| 2189 | Ga0209758_1032044 | |||
| 2190 | Ga0209050_1000002 | |||
| 2191 | Ga0209050_1000003 | |||
| 2192 | Ga0209050_1000855 | |||
| 2193 | Ga0209050_1000965 | |||
| 2194 | Ga0209050_1002597 | |||
| 2195 | Ga0209050_1011581 | |||
| 2196 | Ga0209050_1024573 | |||
| 2197 | Ga0209050_1029763 | |||
| 2198 | Ga0209256_1000001 | |||
| 2199 | Ga0209256_1000050 | |||
| 2200 | Ga0209256_1000063 | |||
| 2201 | Ga0209256_1000804 | |||
| 2202 | Ga0209256_1001280 | |||
| 2203 | Ga0209256_1035621 | |||
| 2204 | Ga0207426_1000001 | |||
| 2205 | Ga0207426_1000025 | |||
| 2206 | Ga0207426_1000028 | |||
| 2207 | Ga0207426_1000050 | |||
| 2208 | Ga0209051_1000002 | |||
| 2209 | Ga0209051_1000003 | |||
| 2210 | Ga0209051_1000471 | |||
| 2211 | Ga0209051_1000653 | |||
| 2212 | Ga0209051_1000868 | |||
| 2213 | Ga0209051_1005176 | |||
| 2214 | Ga0209051_1033026 | |||
| 2215 | Ga0209051_1038832 | |||
| 2216 | Ga0209051_1051899 | |||
| 2217 | Ga0209257_1000002 | |||
| 2218 | Ga0209257_1000018 | |||
| 2219 | Ga0209257_1000333 | |||
| 2220 | Ga0209257_1001358 | |||
| 2221 | Ga0209257_1011611 | |||
| 2222 | Ga0209257_1024648 | |||
| 2223 | Ga0207697_10002378 | |||
| 2224 | Ga0207697_10020586 | |||
| 2225 | Ga0207656_10000643 | |||
| 2226 | Ga0207656_10020269 | |||
| 2227 | Ga0207656_10098013 | |||
| 2228 | Ga0207655_1001500 | |||
| 2229 | Ga0207713_1001321 | |||
| 2230 | Ga0207713_1044765 | |||
| 2231 | Ga0207682_10003666 | |||
| 2232 | Ga0207692_10182444 | |||
| 2233 | Ga0207642_10003514 | |||
| 2234 | Ga0207642_10038886 | |||
| 2235 | Ga0207688_10012507 | |||
| 2236 | Ga0207680_10010960 | |||
| 2237 | Ga0207647_10014923 | |||
| 2238 | Ga0207645_10001135 | |||
| 2239 | Ga0207645_10007822 | |||
| 2240 | Ga0207645_10017063 | |||
| 2241 | Ga0207645_10053658 | |||
| 2242 | Ga0207645_10113351 | |||
| 2243 | Ga0207643_10019545 | |||
| 2244 | Ga0207705_10018161 | |||
| 2245 | Ga0207684_10131874 | |||
| 2246 | Ga0207684_10277967 | |||
| 2247 | Ga0207684_10479346 | |||
| 2248 | Ga0207695_10001505 | |||
| 2249 | Ga0207695_10006633 | |||
| 2250 | Ga0207695_10008251 | |||
| 2251 | Ga0207695_10029238 | |||
| 2252 | Ga0207695_10030526 | |||
| 2253 | Ga0207695_10039904 | |||
| 2254 | Ga0207695_10084680 | |||
| 2255 | Ga0207695_10163830 | |||
| 2256 | Ga0207695_10311798 | |||
| 2257 | Ga0207695_10405949 | |||
| 2258 | Ga0207671_10004003 | |||
| 2259 | Ga0207671_10009919 | |||
| 2260 | Ga0207671_10026658 | |||
| 2261 | Ga0207660_10036117 | |||
| 2262 | Ga0207660_10037492 | |||
| 2263 | Ga0207660_10126285 | |||
| 2264 | Ga0207660_10164733 | |||
| 2265 | Ga0207662_10064263 | |||
| 2266 | Ga0207662_10190480 | |||
| 2267 | Ga0207657_10020709 | |||
| 2268 | Ga0207657_10073322 | |||
| 2269 | Ga0207657_10378386 | |||
| 2270 | Ga0207649_10013461 | |||
| 2271 | Ga0207649_10029598 | |||
| 2272 | Ga0207649_10056277 | |||
| 2273 | Ga0207649_10068702 | |||
| 2274 | Ga0207652_10015548 | |||
| 2275 | Ga0207652_10068117 | |||
| 2276 | Ga0207652_10075901 | |||
| 2277 | Ga0207652_10137247 | |||
| 2278 | Ga0207646_10121103 | |||
| 2279 | Ga0207681_10000793 | |||
| 2280 | Ga0207681_10002665 | |||
| 2281 | Ga0207681_10224062 | |||
| 2282 | Ga0207681_10395454 | |||
| 2283 | Ga0207694_10000207 | |||
| 2284 | Ga0207694_10022635 | |||
| 2285 | Ga0207694_10069738 | |||
| 2286 | Ga0207694_10120675 | |||
| 2287 | Ga0207694_10334054 | |||
| 2288 | Ga0207694_10400193 | |||
| 2289 | Ga0207650_10001429 | |||
| 2290 | Ga0207650_10185806 | |||
| 2291 | Ga0207650_10380644 | |||
| 2292 | Ga0207659_10021910 | |||
| 2293 | Ga0207659_10027526 | |||
| 2294 | Ga0207659_10078376 | |||
| 2295 | Ga0207659_10123770 | |||
| 2296 | Ga0207659_10178957 | |||
| 2297 | Ga0207687_10029646 | |||
| 2298 | Ga0207687_10035677 | |||
| 2299 | Ga0207687_10053889 | |||
| 2300 | Ga0207687_10067070 | |||
| 2301 | Ga0207687_10112874 | |||
| 2302 | Ga0207687_10124264 | |||
| 2303 | Ga0207687_10195877 | |||
| 2304 | Ga0207644_10003406 | |||
| 2305 | Ga0207644_10015176 | |||
| 2306 | Ga0207644_10162524 | |||
| 2307 | Ga0207690_10023271 | |||
| 2308 | Ga0207690_10057688 | |||
| 2309 | Ga0207690_10059063 | |||
| 2310 | Ga0207706_10009396 | |||
| 2311 | Ga0207706_10022480 | |||
| 2312 | Ga0207706_10075459 | |||
| 2313 | Ga0207706_10090343 | |||
| 2314 | Ga0207706_10110879 | |||
| 2315 | Ga0207686_10011111 | |||
| 2316 | Ga0207686_10024302 | |||
| 2317 | Ga0207686_10041020 | |||
| 2318 | Ga0207686_10133878 | |||
| 2319 | Ga0207709_10000684 | |||
| 2320 | Ga0207709_10001331 | |||
| 2321 | Ga0207709_10010515 | |||
| 2322 | Ga0207709_10012802 | |||
| 2323 | Ga0207709_10026682 | |||
| 2324 | Ga0207709_10040360 | |||
| 2325 | Ga0207709_10334856 | |||
| 2326 | Ga0207670_10049946 | |||
| 2327 | Ga0207670_10307838 | |||
| 2328 | Ga0207670_10540158 | |||
| 2329 | Ga0207669_10006488 | |||
| 2330 | Ga0207704_10039248 | |||
| 2331 | Ga0207704_10044782 | |||
| 2332 | Ga0207704_10052843 | |||
| 2333 | Ga0207704_10064635 | |||
| 2334 | Ga0207704_10106398 | |||
| 2335 | Ga0207665_10185562 | |||
| 2336 | Ga0207691_10000973 | |||
| 2337 | Ga0207691_10001288 | |||
| 2338 | Ga0207691_10003133 | |||
| 2339 | Ga0207691_10005935 | |||
| 2340 | Ga0207691_10406246 | |||
| 2341 | Ga0207711_10012438 | |||
| 2342 | Ga0207711_10012450 | |||
| 2343 | Ga0207711_10069679 | |||
| 2344 | Ga0207711_10307326 | |||
| 2345 | Ga0207689_10000591 | |||
| 2346 | Ga0207689_10013054 | |||
| 2347 | Ga0207689_10019585 | |||
| 2348 | Ga0207689_10024609 | |||
| 2349 | Ga0207689_10051124 | |||
| 2350 | Ga0207689_10084343 | |||
| 2351 | Ga0207661_10029479 | |||
| 2352 | Ga0207679_10017656 | |||
| 2353 | Ga0207679_10053658 | |||
| 2354 | Ga0207679_10154175 | |||
| 2355 | Ga0207679_10593778 | |||
| 2356 | Ga0207667_10002183 | |||
| 2357 | Ga0207667_10013188 | |||
| 2358 | Ga0207667_10017157 | |||
| 2359 | Ga0207667_10063697 | |||
| 2360 | Ga0207667_10063933 | |||
| 2361 | Ga0207667_10108543 | |||
| 2362 | Ga0207651_10004181 | |||
| 2363 | Ga0207651_10015790 | |||
| 2364 | Ga0207651_10088607 | |||
| 2365 | Ga0207651_10532444 | |||
| 2366 | Ga0207651_10541120 | |||
| 2367 | Ga0207712_10023222 | |||
| 2368 | Ga0207712_10133316 | |||
| 2369 | Ga0207712_10296309 | |||
| 2370 | Ga0207668_10027270 | |||
| 2371 | Ga0207668_10043298 | |||
| 2372 | Ga0207668_10065671 | |||
| 2373 | Ga0207640_10005404 | |||
| 2374 | Ga0207640_10027941 | |||
| 2375 | Ga0207640_10128730 | |||
| 2376 | Ga0207640_10133594 | |||
| 2377 | Ga0207658_10022892 | |||
| 2378 | Ga0207658_10037007 | |||
| 2379 | Ga0207658_10055388 | |||
| 2380 | Ga0207658_10170296 | |||
| 2381 | Ga0207658_10384393 | |||
| 2382 | Ga0207677_10019626 | |||
| 2383 | Ga0207677_10026789 | |||
| 2384 | Ga0207677_10185856 | |||
| 2385 | Ga0207677_10228816 | |||
| 2386 | Ga0207677_10266010 | |||
| 2387 | Ga0207703_10002400 | |||
| 2388 | Ga0207703_10046087 | |||
| 2389 | Ga0207639_10005602 | |||
| 2390 | Ga0207639_10132266 | |||
| 2391 | Ga0207639_10302799 | |||
| 2392 | Ga0207639_10469301 | |||
| 2393 | Ga0207639_10628078 | |||
| 2394 | Ga0207678_10014575 | |||
| 2395 | Ga0207678_10063186 | |||
| 2396 | Ga0207678_10152644 | |||
| 2397 | Ga0207678_10309787 | |||
| 2398 | Ga0207708_10005823 | |||
| 2399 | Ga0207708_10013196 | |||
| 2400 | Ga0207702_10001439 | |||
| 2401 | Ga0207702_10093495 | |||
| 2402 | Ga0207702_10176941 | |||
| 2403 | Ga0207641_10003472 | |||
| 2404 | Ga0207641_10006729 | |||
| 2405 | Ga0207641_10193440 | |||
| 2406 | Ga0207648_10002124 | |||
| 2407 | Ga0207648_10006556 | |||
| 2408 | Ga0207648_10011202 | |||
| 2409 | Ga0207648_10109510 | |||
| 2410 | Ga0207648_10126629 | |||
| 2411 | Ga0207648_10135160 | |||
| 2412 | Ga0207648_10173204 | |||
| 2413 | Ga0207676_10006970 | |||
| 2414 | Ga0207676_10035437 | |||
| 2415 | Ga0207676_10205549 | |||
| 2416 | Ga0207674_10005404 | |||
| 2417 | Ga0207674_10011591 | |||
| 2418 | Ga0207674_10013504 | |||
| 2419 | Ga0207674_10019948 | |||
| 2420 | Ga0207674_10034569 | |||
| 2421 | Ga0207674_10085480 | |||
| 2422 | Ga0207674_10120677 | |||
| 2423 | Ga0207675_100000138 | |||
| 2424 | Ga0207675_100147211 | |||
| 2425 | Ga0207683_10000520 | |||
| 2426 | Ga0207683_10006544 | |||
| 2427 | Ga0207683_10070843 | |||
| 2428 | Ga0207683_10072389 | |||
| 2429 | Ga0207683_10091702 | |||
| 2430 | Ga0207683_10318365 | |||
| 2431 | Ga0207683_10519571 | |||
| 2432 | Ga0207698_10017736 | |||
| 2433 | Ga0207698_10018165 | |||
| 2434 | Ga0207698_10046884 | |||
| 2435 | Ga0207698_10323058 | |||
| 2436 | Ga0209970_1006899 | |||
| 2437 | Ga0209282_1000045 | |||
| 2438 | Ga0209282_1001910 | |||
| 2439 | Ga0209282_1154304 | |||
| 2440 | Ga0209588_1022047 | |||
| 2441 | Ga0209588_1039580 | |||
| 2442 | Ga0209813_10006509 | |||
| 2443 | Ga0207428_10191856 | |||
| 2444 | Ga0268266_10029677 | |||
| 2445 | Ga0268266_10122024 | |||
| 2446 | Ga0268266_10194168 | |||
| 2447 | Ga0268266_10222027 | |||
| 2448 | Ga0268266_10387456 | |||
| 2449 | Ga0268265_10005157 | |||
| 2450 | Ga0268265_10204842 | |||
| 2451 | Ga0268264_10045892 | |||
| 2452 | Ga0268264_10052991 | |||
| 2453 | Ga0268264_10056049 | |||
| 2454 | Ga0268264_10268348 | |||
| 2455 | Ga0307517_10000228 | |||
| 2456 | Ga0307517_10070147 | |||
| 2457 | Ga0307517_10172646 | |||
| 2458 | Ga0307515_10000013 | |||
| 2459 | Ga0307515_10000037 | |||
| 2460 | Ga0307515_10000428 | |||
| 2461 | Ga0307515_10006133 | |||
| 2462 | Ga0307515_10009239 | |||
| 2463 | Ga0307515_10016260 | |||
| 2464 | Ga0307515_10029046 | |||
| 2465 | Ga0307515_10224608 | |||
| 2466 | Ga0265338_10000022 | |||
| 2467 | Ga0265338_10000281 | |||
| 2468 | Ga0307511_10000671 | |||
| 2469 | Ga0307512_10028786 | |||
| 2470 | Ga0316177_1157730 | |||
| 2471 | Ga0314311_1139236 | |||
| 2472 | Ga0316180_1015378 | |||
| 2473 | Ga0316183_1110270 | |||
| 2474 | Ga0316181_1005389 | |||
| 2475 | Ga0316182_1383921 | |||
| 2476 | Ga0265327_10000689 | |||
| 2477 | Ga0265327_10050387 | |||
| 2478 | Ga0265327_10098071 | |||
| 2479 | Ga0307513_10000010 | |||
| 2480 | Ga0307513_10000121 | |||
| 2481 | Ga0307513_10014924 | |||
| 2482 | Ga0307513_10019112 | |||
| 2483 | Ga0307509_10000426 | |||
| 2484 | Ga0307509_10044488 | |||
| 2485 | Ga0307509_10078868 | |||
| 2486 | Ga0307509_10081835 | |||
| 2487 | Ga0307509_10098023 | |||
| 2488 | Ga0307509_10143290 | |||
| 2489 | Ga0307509_10424653 | |||
| 2490 | Ga0307408_100010028 | |||
| 2491 | Ga0307408_100051176 | |||
| 2492 | Ga0307408_100117334 | |||
| 2493 | Ga0307408_100118412 | |||
| 2494 | Ga0307408_100127321 | |||
| 2495 | Ga0307408_100284214 | |||
| 2496 | Ga0307408_100463756 | |||
| 2497 | Ga0307408_100563380 | |||
| 2498 | Ga0307508_10000096 | |||
| 2499 | Ga0307508_10000273 | |||
| 2500 | Ga0307508_10003742 | |||
| 2501 | Ga0307508_10070041 | |||
| 2502 | Ga0307514_10001887 | |||
| 2503 | Ga0307514_10049636 | |||
| 2504 | Ga0307514_10069075 | |||
| 2505 | Ga0265314_10030091 | |||
| 2506 | Ga0265342_10046019 | |||
| 2507 | Ga0307516_10002590 | |||
| 2508 | Ga0307516_10003708 | |||
| 2509 | Ga0307516_10007835 | |||
| 2510 | Ga0307516_10014241 | |||
| 2511 | Ga0307516_10104851 | |||
| 2512 | Ga0307516_10318387 | |||
| 2513 | Ga0307405_10002872 | |||
| 2514 | Ga0307405_10016578 | |||
| 2515 | Ga0307405_10068124 | |||
| 2516 | Ga0307405_10400363 | |||
| 2517 | Ga0307518_10236745 | |||
| 2518 | Ga0307410_10006084 | |||
| 2519 | Ga0307410_10117073 | |||
| 2520 | Ga0307406_10005443 | |||
| 2521 | Ga0307406_10055913 | |||
| 2522 | Ga0307406_10181417 | |||
| 2523 | Ga0307407_10033949 | |||
| 2524 | Ga0307412_10001959 | |||
| 2525 | Ga0307412_10009352 | |||
| 2526 | Ga0307412_10017384 | |||
| 2527 | Ga0307412_10146700 | |||
| 2528 | Ga0307412_10473196 | |||
| 2529 | Ga0307409_100099675 | |||
| 2530 | Ga0307409_100506732 | |||
| 2531 | Ga0307416_100002887 | |||
| 2532 | Ga0307416_100007370 | |||
| 2533 | Ga0307416_100060673 | |||
| 2534 | Ga0307416_100089116 | |||
| 2535 | Ga0307416_100464400 | |||
| 2536 | Ga0307414_10008727 | |||
| 2537 | Ga0307411_10019230 | |||
| 2538 | Ga0307411_10239023 | |||
| 2539 | Ga0307415_100004219 | |||
| 2540 | Ga0307415_100191188 | |||
| 2541 | Ga0307507_10079515 | |||
| 2542 | Ga0307507_10094219 | |||
| 2543 | Ga0307510_10000088 | |||
| 2544 | Ga0307510_10000967 | |||
| 2545 | Ga0307510_10103592 | |||
| 2546 | Ga0373938_0007458 | |||
| 2547 | Ga0373934_0016737 | |||
| 2548 | Ga0373944_0040673 | |||
| 2549 | Ga0373952_0050698 | |||
| 2550 | Ga0373939_0005037 | |||
| 2551 | Ga0373953_0130583 | |||
| 2552 | Ga0373955_0015132 | |||
| 2553 | Ga0373955_0029829 | |||
| 2554 | Ga0373924_0104364 | |||
| 2555 | Ga0373931_0000719 | |||
| 2556 | Ga0373931_0108854 | |||
| 2557 | Ga0373931_0214130 | |||
| 2558 | Ga0373935_0131175 | |||
| 2559 | Ga0373947_0043204 | |||
| 2560 | Ga0373937_0025212 | |||
| 2561 | Ga0373937_0097776 | |||
| 2562 | Ga0373925_0059226 | |||
| 2563 | Ga0373925_0077689 | |||
| 2564 | Ga0373925_0217678 | |||
| 2565 | Ga0373925_0539505 | |||
| 2566 | Ga0395899_0003004 | |||
| 2567 | Ga0395899_0003834 | |||
| 2568 | Ga0395899_0023766 | |||
| 2569 | Ga0395899_0042037 | |||
| 2570 | Ga0395899_0188340 | |||
| 2571 | Ga0395900_0003666 | |||
| 2572 | Ga0395900_0012705 | |||
| 2573 | Ga0395900_0027220 | |||
| 2574 | Ga0395900_0032723 | |||
| 2575 | Ga0395900_0035522 | |||
| 2576 | Ga0395900_0066108 | |||
| 2577 | Ga0395900_0132453 | |||
| 2578 | Ga0395900_0135443 | |||
| 2579 | Ga0395900_0468270 | |||
| 2580 | Ga0395898_0002485 | |||
| 2581 | Ga0395898_0006527 | |||
| 2582 | Ga0395898_0036335 | |||
| 2583 | Ga0395898_0213390 | |||
| 2584 | Ga0395898_0261930 | |||
| 2585 | Ga0395905_0000041 | |||
| 2586 | Ga0395905_0000766 | |||
| 2587 | Ga0395905_0001291 | |||
| 2588 | Ga0395905_0001867 | |||
| 2589 | Ga0395905_0002404 | |||
| 2590 | Ga0395905_0006699 | |||
| 2591 | Ga0395905_0016311 | |||
| 2592 | Ga0395905_0022080 | |||
| 2593 | Ga0395905_0087687 | |||
| 2594 | Ga0395905_0240311 | |||
| 2595 | Ga0395905_0333913 | |||
| 2596 | Ga0395905_0429056 | |||
| 2597 | Ga0395905_0514960 | |||
| 2598 | Ga0436364_1452872 | |||
| 2599 | Ga0395901_0119273 | |||
| 2600 | Ga0395901_0164122 | |||
| 2601 | Ga0395901_0196832 | |||
| 2602 | Ga0436365_1069362 | |||
| 2603 | Ga0436361_0263782 | |||
| 2604 | Ga0436361_0706582 | |||
| 2605 | Ga0439436_0000271 | |||
| 2606 | Ga0439439_0008230 | |||
| 2607 | Ga0439439_0022327 | |||
| 2608 | Ga0439439_0024456 | |||
| 2609 | Ga0439447_018176 | |||
| 2610 | Ga0439465_0004740 | |||
| 2611 | Ga0451795_0371926 | |||
| 2612 | Ga0451807_2138912 | |||
| 2613 | Ga0451839_1172444 | |||
| 2614 | Ga0451841_0043643 | |||
| 2615 | Ga0451853_3303108 | |||
| 2616 | Ga0439431_0002491 | |||
| 2617 | Ga0439441_005125 | |||
| 2618 | Ga0439441_008564 | |||
| 2619 | Ga0439442_007787 | |||
| 2620 | Ga0439445_0000101 | |||
| 2621 | Ga0439432_003935 | |||
| 2622 | Ga0439449_0000836 | |||
| 2623 | Ga0439449_0003108 | |||
| 2624 | Ga0439449_0009194 | |||
| 2625 | Ga0439452_001575 | |||
| 2626 | Ga0439452_003824 | |||
| 2627 | Ga0439457_004271 | |||
| 2628 | Ga0439462_0005109 | |||
| 2629 | Ga0450894_005633 | |||
| 2630 | Ga0450889_007214 | |||
| 2631 | Ga0439446_0002170 | |||
| 2632 | Ga0450908_002671 | |||
| 2633 | Ga0450909_002890 | |||
| 2634 | Ga0439434_0001592 | |||
| 2635 | Ga0439434_0002659 | |||
| 2636 | Ga0439464_0017700 | |||
| 2637 | Ga0439460_0045072 | |||
| 2638 | Ga0450918_000258 | |||
| 2639 | Ga0451577_0045661 | |||
| 2640 | Ga0466969_0003266 | |||
| 2641 | Ga0466969_0159489 | |||
| 2642 | Ga0466972_0009395 | |||
| 2643 | Ga0466977_0000064 | |||
| 2644 | Ga0453683_0003262 | |||
| 2645 | Ga0466966_0003451 | |||
| 2646 | Ga0466961_0054667 | |||
| 2647 | Ga0453684_0003387 | |||
| 2648 | Ga0453684_0592183 | |||
| 2649 | Ga0466970_0017755 | |||
| 2650 | Ga0466970_0104668 | |||
| 2651 | Ga0466957_0007962 | |||
| 2652 | Ga0466957_0222836 | |||
| 2653 | Ga0451576_0007232 | |||
| 2654 | Ga0451576_0015307 | |||
| 2655 | Ga0451576_0048014 | |||
| 2656 | Ga0451576_0095976 | |||
| 2657 | Ga0451576_0186369 | |||
| 2658 | Ga0451576_0288095 | |||
| 2659 | Ga0451576_0300925 | |||
| 2660 | Ga0495592_0000307 | |||
| 2661 | Ga0495592_0005284 | |||
| 2662 | Ga0495590_0016152 | |||
| 2663 | Ga0495590_0019964 | |||
| 2664 | Ga0495629_0016193 | |||
| 2665 | Ga0495638_0009369 | |||
| 2666 | Ga0495638_0041320 | |||
| 2667 | Ga0495638_0094762 | |||
| 2668 | Ga0495651_0007788 | |||
| 2669 | Ga0495651_0058881 | |||
| 2670 | Ga0495651_0122775 | |||
| 2671 | Ga0495653_0031899 | |||
| 2672 | Ga0495653_0082601 | |||
| 2673 | Ga0495650_0002401 | |||
| 2674 | Ga0495650_0039741 | |||
| 2675 | Ga0495580_0012377 | |||
| 2676 | Ga0495580_0090482 | |||
| 2677 | Ga0495605_0003271 | |||
| 2678 | Ga0495605_0006415 | |||
| 2679 | Ga0495605_0010207 | |||
| 2680 | Ga0495639_0011603 | |||
| 2681 | Ga0495662_0023350 | |||
| 2682 | Ga0495584_0022556 | |||
| 2683 | Ga0495585_0000600 | |||
| 2684 | Ga0495585_0023825 | |||
| 2685 | Ga0495596_0000531 | |||
| 2686 | Ga0495596_0001392 | |||
| 2687 | Ga0495607_0000104 | |||
| 2688 | Ga0495607_0079164 | |||
| 2689 | Ga0495583_0000068 | |||
| 2690 | Ga0495583_0020770 | |||
| 2691 | Ga0495606_0031176 | |||
| 2692 | Ga0495606_0115978 | |||
| 2693 | Ga0495608_0009037 | |||
| 2694 | Ga0495608_0036970 | |||
| 2695 | Ga0495608_0043811 | |||
| 2696 | Ga0495608_0060615 | |||
| 2697 | Ga0495610_0000402 | |||
| 2698 | Ga0495610_0027502 | |||
| 2699 | Ga0495610_0034215 | |||
| 2700 | Ga0495616_0001588 | |||
| 2701 | Ga0495618_0009013 | |||
| 2702 | Ga0495618_0225602 | |||
| 2703 | Ga0495620_0023629 | |||
| 2704 | Ga0495620_0043753 | |||
| 2705 | Ga0495628_0000094 | |||
| 2706 | Ga0495628_0001686 | |||
| 2707 | Ga0495628_0010603 | |||
| 2708 | Ga0495630_0005175 | |||
| 2709 | Ga0495630_0023999 | |||
| 2710 | Ga0495630_0187311 | |||
| 2711 | Ga0495631_0007349 | |||
| 2712 | Ga0495632_0005817 | |||
| 2713 | Ga0495632_0016163 | |||
| 2714 | Ga0495644_0070785 | |||
| 2715 | Ga0495648_0077652 | |||
| 2716 | Ga0495642_0016179 | |||
| 2717 | Ga0495642_0017986 | |||
| 2718 | Ga0495642_0080640 | |||
| 2719 | Ga0495652_0053180 | |||
| 2720 | Ga0495652_0071724 | |||
| 2721 | Ga0495652_0151060 | |||
| 2722 | Ga0495652_0282927 | |||
| 2723 | Ga0495654_0001128 | |||
| 2724 | Ga0495654_0024039 | |||
| 2725 | Ga0495640_0003973 | |||
| 2726 | Ga0495586_0002666 | |||
| 2727 | Ga0495587_0032496 | |||
| 2728 | Ga0495609_0005608 | |||
| 2729 | Ga0495621_0042632 | |||
| 2730 | Ga0495621_0053686 | |||
| 2731 | Ga0495597_0004406 | |||
| 2732 | Ga0495597_0028022 | |||
| 2733 | Ga0495645_0004283 | |||
| 2734 | Ga0495645_0018404 | |||
| 2735 | Ga0495645_0097404 | |||
| 2736 | Ga0495645_0163979 | |||
| 2737 | Ga0495622_0123567 | |||
| 2738 | Ga0495667_0016481 | |||
| 2739 | Ga0495667_0220772 | |||
| 2740 | Ga0495656_0006029 | |||
| 2741 | Ga0495656_0075661 | |||
| 2742 | Ga0495668_0027061 | |||
| 2743 | Ga0495611_0008098 | |||
| 2744 | Ga0495611_0205991 | |||
| 2745 | Ga0495625_0000811 | |||
| 2746 | Ga0495625_0002034 | |||
| 2747 | Ga0495625_0002147 | |||
| 2748 | Ga0495625_0013100 | |||
| 2749 | Ga0495625_0083948 | |||
| 2750 | Ga0495625_0147508 | |||
| 2751 | Ga0495661_0028289 | |||
| 2752 | Ga0495661_0037991 | |||
| 2753 | Ga0495661_0118774 | |||
| 2754 | Ga0495588_0025415 | |||
| 2755 | Ga0495588_0058570 | |||
| 2756 | Ga0495588_0134792 | |||
| 2757 | Ga0495657_0134798 | |||
| 2758 | Ga0495599_0002663 | |||
| 2759 | Ga0495599_0007337 | |||
| 2760 | Ga0495599_0007691 | |||
| 2761 | Ga0495623_0015463 | |||
| 2762 | Ga0495623_0021980 | |||
| 2763 | Ga0495623_0069969 | |||
| 2764 | Ga0495646_0101850 | |||
| 2765 | Ga0495658_0017838 | |||
| 2766 | Ga0495658_0124256 | |||
| 2767 | Ga0495613_0035150 | |||
| 2768 | Ga0495671_0000949 | |||
| 2769 | Ga0495671_0003079 | |||
| 2770 | Ga0495671_0051467 | |||
| 2771 | Ga0495671_0116445 | |||
| 2772 | Ga0495649_0000902 | |||
| 2773 | Ga0495649_0019136 | |||
| 2774 | Ga0495649_0054994 | |||
| 2775 | Ga0495600_0000395 | |||
| 2776 | Ga0495660_0151431 | |||
| 2777 | Ga0495604_0005126 | |||
| 2778 | Ga0495636_0028531 | |||
| 2779 | Ga0495674_0001417 | |||
| 2780 | Ga0495674_0021472 | |||
| 2781 | Ga0495674_0153891 | |||
| 2782 | Ga0495672_0024306 | |||
| 2783 | Ga0495676_0053294 | |||
| 2784 | Ga0495676_0114514 | |||
| 2785 | Ga0495680_0004617 | |||
| 2786 | Ga0495683_0036120 | |||
| 2787 | Ga0495687_000330 | |||
| 2788 | Ga0495687_003745 | |||
| 2789 | Ga0495687_007018 | |||
| 2790 | Ga0495687_008919 | |||
| 2791 | Ga0495679_000094 | |||
| 2792 | Ga0495673_0010894 | |||
| 2793 | Ga0495673_0011584 | |||
| 2794 | Ga0495684_0039710 | |||
| 2795 | Ga0495684_0291632 | |||
| 2796 | Ga0495686_0080473 | |||
| 2797 | Ga0495686_0114885 | |||
| 2798 | Ga0495593_0007103 | |||
| 2799 | Ga0495593_0036853 | |||
| 2800 | Ga0495602_0094606 | |||
| 2801 | Ga0495614_0115970 | |||
| 2802 | Ga0495615_0013150 | |||
| 2803 | Ga0495626_0004972 | |||
| 2804 | Ga0495626_0072964 | |||
| 2805 | Ga0496100_0003901 | |||
| 2806 | Ga0496100_0030272 | |||
| 2807 | Ga0496101_0001350 | |||
| 2808 | Ga0496101_0002565 | |||
| 2809 | Ga0496101_0076323 | |||
| 2810 | Ga0496102_0000863 | |||
| 2811 | Ga0496102_0002579 | |||
| 2812 | Ga0496102_0045016 | |||
| 2813 | Ga0496103_0001427 | |||
| 2814 | Ga0496103_0041940 | |||
| 2815 | Ga0496103_0057061 | |||
| 2816 | Ga0496103_0208958 | |||
| 2817 | Ga0496104_0022955 | |||
| 2818 | Ga0496104_0046945 | |||
| 2819 | Ga0496104_0169712 | |||
| 2820 | Ga0496104_0335815 | |||
| 2821 | Ga0496104_0480170 | |||
| 2822 | Ga0496105_0003513 | |||
| 2823 | Ga0496105_0008623 | |||
| 2824 | Ga0496105_0059239 | |||
| 2825 | Ga0496106_0004306 | |||
| 2826 | Ga0496106_0006498 | |||
| 2827 | Ga0496106_0052015 | |||
| 2828 | Ga0496106_0094112 | |||
| 2829 | Ga0496107_0010565 | |||
| 2830 | Ga0496107_0386226 | |||
| 2831 | Ga0496108_0236644 | |||
| 2832 | Ga0496109_0004487 | |||
| 2833 | Ga0496109_0677770 | |||
| 2834 | Ga0496110_0024210 | |||
| 2835 | Ga0496110_0048777 | |||
| 2836 | Ga0496110_0209482 | |||
| 2837 | Ga0496111_0040125 | |||
| 2838 | Ga0496112_0001203 | |||
| 2839 | Ga0496113_0041941 | |||
| 2840 | Ga0496113_0044410 | |||
| 2841 | Ga0496113_0046906 | |||
| 2842 | Ga0496113_0459545 | |||
| 2843 | Ga0496114_0089693 | |||
| 2844 | Ga0496114_0134655 | |||
| 2845 | Ga0496114_0236300 | |||
| 2846 | Ga0496115_0003898 | |||
| 2847 | Ga0496116_0003609 | |||
| 2848 | Ga0496116_0011291 | |||
| 2849 | Ga0496116_0013523 | |||
| 2850 | Ga0496116_0015998 | |||
| 2851 | Ga0496116_0020876 | |||
| 2852 | Ga0496116_0066795 | |||
| 2853 | Ga0496117_0002329 | |||
| 2854 | Ga0496117_0012972 | |||
| 2855 | Ga0496117_0023493 | |||
| 2856 | Ga0496117_0122537 | |||
| 2857 | Ga0496118_0005797 | |||
| 2858 | Ga0496118_0006085 | |||
| 2859 | Ga0496118_0022991 | |||
| 2860 | Ga0496118_0025287 | |||
| 2861 | Ga0496118_0040421 | |||
| 2862 | Ga0496119_0008405 | |||
| 2863 | Ga0496119_0077189 | |||
| 2864 | Ga0496119_0087501 | |||
| 2865 | Ga0496120_0003056 | |||
| 2866 | Ga0496120_0140458 | |||
| 2867 | Ga0496121_0000140 | |||
| 2868 | Ga0496121_0000694 | |||
| 2869 | Ga0496121_0005950 | |||
| 2870 | Ga0496121_0023470 | |||
| 2871 | Ga0496121_0026586 | |||
| 2872 | Ga0496121_0031014 | |||
| 2873 | Ga0496121_0036546 | |||
| 2874 | Ga0496121_0182840 | |||
| 2875 | Ga0496122_0000227 | |||
| 2876 | Ga0496122_0001089 | |||
| 2877 | Ga0496122_0001677 | |||
| 2878 | Ga0496122_0002020 | |||
| 2879 | Ga0496122_0146954 | |||
| 2880 | Ga0496123_0000141 | |||
| 2881 | Ga0496123_0000265 | |||
| 2882 | Ga0496123_0000826 | |||
| 2883 | Ga0496123_0028714 | |||
| 2884 | Ga0496124_0017865 | |||
| 2885 | Ga0496124_0042725 | |||
| 2886 | Ga0496124_0070406 | |||
| 2887 | Ga0496124_0070752 | |||
| 2888 | Ga0496124_0080196 | |||
| 2889 | Ga0496124_0169278 | |||
| 2890 | Ga0496125_0000190 | |||
| 2891 | Ga0496125_0004085 | |||
| 2892 | Ga0496125_0036252 | |||
| 2893 | Ga0496125_0113381 | |||
| 2894 | Ga0496126_0015524 | |||
| 2895 | Ga0496126_0083485 | |||
| 2896 | Ga0495678_011176 | |||
| 2897 | Ga0495678_023409 | |||
| 2898 | Ga0501031_0002275 | |||
| 2899 | Ga0501031_0013733 | |||
| 2900 | Ga0501031_0245625 | |||
| 2901 | Ga0501032_0008003 | |||
| 2902 | Ga0501032_0206696 | |||
| 2903 | Ga0501033_0000561 | |||
| 2904 | Ga0501033_0033574 | |||
| 2905 | Ga0501034_0000530 | |||
| 2906 | Ga0501034_0021788 | |||
| 2907 | Ga0501034_0070473 | |||
| 2908 | Ga0501034_0078178 | |||
| 2909 | Ga0501034_0116453 | |||
| 2910 | Ga0501034_0117453 | |||
| 2911 | Ga0501034_0139003 | |||
| 2912 | Ga0501034_0642255 | |||
| 2913 | Ga0501036_0002030 | |||
| 2914 | Ga0501036_0150387 | |||
| 2915 | Ga0501037_0001491 | |||
| 2916 | Ga0501037_0060230 | |||
| 2917 | Ga0501038_0002799 | |||
| 2918 | Ga0501038_0045659 | |||
| 2919 | Ga0501038_0111840 | |||
| 2920 | Ga0501039_0015640 | |||
| 2921 | Ga0501041_0099466 | |||
| 2922 | Ga0501043_0015551 | |||
| 2923 | Ga0501046_0008826 | |||
| 2924 | Ga0501046_0031581 | |||
| 2925 | Ga0501046_0043246 | |||
| 2926 | Ga0501047_0016207 | |||
| 2927 | Ga0501047_0048942 | |||
| 2928 | Ga0501047_0199893 | |||
| 2929 | Ga0501067_0087511 | |||
| 2930 | Ga0501070_0116211 | |||
| 2931 | Ga0501071_0001109 | |||
| 2932 | Ga0501072_0004585 | |||
| 2933 | Ga0501073_0013789 | |||
| 2934 | Ga0501075_0036646 | |||
| 2935 | Ga0501076_0000902 | |||
| 2936 | Ga0501246_002775 | |||
| 2937 | Ga0501225_0015135 | |||
| 2938 | Ga0501079_0029789 | |||
| 2939 | Ga0501083_0020137 | |||
| 2940 | Ga0501083_0144163 | |||
| 2941 | Ga0501241_009979 | |||
| 2942 | Ga0501262_000181 | |||
| 2943 | Ga0501262_002123 | |||
| 2944 | Ga0501035_0002736 | |||
| 2945 | Ga0501035_0015212 | |||
| 2946 | Ga0501035_0022017 | |||
| 2947 | Ga0501044_0001803 | |||
| 2948 | Ga0501044_0002507 | |||
| 2949 | Ga0501044_0003761 | |||
| 2950 | Ga0501044_0061861 | |||
| 2951 | Ga0501044_0178955 | |||
| 2952 | Ga0501045_0056270 | |||
| 2953 | nmdc:mga03683_12216_c1 | |||
| 2954 | nmdc:mga03683_35302_c1 | |||
| 2955 | nmdc:mga03683_4492_c1 | |||
| 2956 | nmdc:mga03683_4655_c1 | |||
| 2957 | nmdc:mga03683_5619_c1 | |||
| 2958 | nmdc:mga03683_6955_c1 | |||
| 2959 | nmdc:mga03n38_17488_c1 | |||
| 2960 | nmdc:mga03n38_26844_c1 | |||
| 2961 | nmdc:mga03n38_30837_c1 | |||
| 2962 | nmdc:mga03n38_85573_c1 | |||
| 2963 | nmdc:mga03n38_98519_c1 | |||
| 2964 | nmdc:mga00v17_104432_c1 | |||
| 2965 | nmdc:mga00v17_33119_c1 | |||
| 2966 | nmdc:mga00v17_58800_c1 | |||
| 2967 | nmdc:mga0yw44_148517_c1 | |||
| 2968 | nmdc:mga0yw44_84836_c1 | |||
| 2969 | nmdc:mga0k408_1081_c1 | |||
| 2970 | nmdc:mga0k408_108584_c1 | |||
| 2971 | nmdc:mga0k408_137202_c1 | |||
| 2972 | nmdc:mga0k408_13834_c1 | |||
| 2973 | nmdc:mga0k408_19496_c1 | |||
| 2974 | nmdc:mga0k408_25391_c1 | |||
| 2975 | nmdc:mga0k408_4664_c1 | |||
| 2976 | nmdc:mga0k408_52279_c1 | |||
| 2977 | nmdc:mga0k408_5276_c1 | |||
| 2978 | nmdc:mga0k408_6711_c1 | |||
| 2979 | nmdc:mga0k408_75326_c1 | |||
| 2980 | nmdc:mga06z11_153292_c1 | |||
| 2981 | nmdc:mga06z11_3666_c1 | |||
| 2982 | nmdc:mga06z11_57755_c1 | |||
| 2983 | nmdc:mga04h51_7806_c1 | |||
| 2984 | nmdc:mga04h51_81838_c1 | |||
| 2985 | nmdc:mga07m45_1155_c1 | |||
| 2986 | nmdc:mga07m45_152014_c1 | |||
| 2987 | nmdc:mga07m45_179669_c1 | |||
| 2988 | nmdc:mga07m45_2192_c1 | |||
| 2989 | nmdc:mga07m45_22422_c1 | |||
| 2990 | nmdc:mga07m45_225999_c1 | |||
| 2991 | nmdc:mga07m45_40714_c1 | |||
| 2992 | nmdc:mga07m45_42714_c2 | |||
| 2993 | nmdc:mga07m45_7463_c1 | |||
| 2994 | nmdc:mga07m45_7550_c1 | |||
| 2995 | nmdc:mga07m45_9064_c1 | |||
| 2996 | nmdc:mga0n895_790177_c1 | |||
| 2997 | nmdc:mga0sz30_1372_c1 | |||
| 2998 | nmdc:mga0sz30_424_c1 | |||
| 2999 | Ga0495601_0005754 | |||
| 3000 | Ga0495601_0111250 | |||
| 3001 | Ga0495601_0412530 | |||
| 3002 | Ga0500610_0009289 | |||
| 3003 | Ga0500635_0000055 | |||
| 3004 | Ga0495595_0004360 | |||
| 3005 | Ga0495619_0010788 | |||
| 3006 | Ga0495619_0413361 | |||
| 3007 | Ga0500578_0001033 | |||
| 3008 | Ga0500643_004846 | |||
| 3009 | Ga0500644_0044020 | |||
| 3010 | Ga0500646_0015828 | |||
| 3011 | Ga0500651_0000324 | |||
| 3012 | Ga0500651_0009686 | |||
| 3013 | Ga0500651_0155072 | |||
| 3014 | Ga0500641_0007988 | |||
| 3015 | Ga0500641_0020272 | |||
| 3016 | Ga0500571_000080 | |||
| 3017 | Ga0500595_001317 | |||
| 3018 | Ga0500608_034717 | |||
| 3019 | Ga0500618_009424 | |||
| 3020 | Ga0500642_0008169 | |||
| 3021 | Ga0500652_000391 | |||
| 3022 | Ga0500658_0000210 | |||
| 3023 | Ga0500658_0000493 | |||
| 3024 | Ga0500559_0000636 | |||
| 3025 | Ga0500559_0028883 | |||
| 3026 | Ga0500568_0091746 | |||
| 3027 | Ga0500574_006587 | |||
| 3028 | Ga0500574_045910 | |||
| 3029 | Ga0500604_0004012 | |||
| 3030 | Ga0500616_0005410 | |||
| 3031 | Ga0500619_002284 | |||
| 3032 | Ga0500622_0000149 | |||
| 3033 | Ga0500622_0006654 | |||
| 3034 | Ga0500627_0018056 | |||
| 3035 | Ga0500634_0005197 | |||
| 3036 | Ga0500570_107409 | |||
| 3037 | Ga0500645_001492 | |||
| 3038 | Ga0500645_003076 | |||
| 3039 | Ga0500645_046735 | |||
| 3040 | Ga0501084_0002314 | |||
| 3041 | Ga0466962_0054867 | |||
| 3042 | Ga0530510_0016427 | |||
| 3043 | 2501082193 | |||
| 3044 | 2900635022 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
183
279
0.98
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.3936 | 81 | 247 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.3293 | 81 | 247 |
| 2onk-assembly2.cif.gz_I | abc transporter modbc in complex with its binding protein moda | 0.3152 | 6 | 247 |
| 2onk-assembly2.cif.gz_I | abc transporter modbc in complex with its binding protein moda | 0.3043 | 6 | 247 |
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.287 | 130 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AGH5_85_292_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.4298 | 151 | 247 | 1.10.3720.10 |
| af_O69723_10_204_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.4144 | 149 | 249 | 1.10.3720.10 |
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.3793 | 146 | 250 | 1.10.3720.10 |
| af_P71746_10_267_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.3738 | 158 | 250 | 1.10.3720.10 |
| af_Q2FYQ5_85_305_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.3676 | 149 | 258 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519ETS4-F1-model_v4 | ABC transporter permease | 0.7938 | 2 | 127 |
GO:0005886
GO:0055085 |
| AF-A0A519ETS4-F1-model_v4 | ABC transporter permease | 0.7825 | 2 | 127 |
GO:0005886
GO:0055085 |
| AF-A0A258PZM4-F1-model_v4 | deleted | 0.7737 | 1 | 112 |
|
| AF-A0A258PZM4-F1-model_v4 | deleted | 0.7372 | 1 | 112 |
|
| AF-A0A519ZA18-F1-model_v4 | ABC transporter permease | 0.7046 | 1 | 157 |
GO:0005886
GO:0055085 |