F494541

General Info

Members Datasets Scaffolds Average Seq Length
1522 525 3044 247

Family's Representative Sequence

Representative Sequence 3300015262|Ga0182007_10004797|Ga0182007_100047972
Length 290
Sequence MTEFLAVAVTTEFRTTRKNGTMWKAIKPNYKNLRIYQALVLVIFFIIWHLATRNPQTAFFFGEPIKVLQRVWQWFTVGSGSLEVGFGDHTWFTMTFPAEIYSHLLITLTETMLAFGIGTVFGLAVGLWLALSPLTSAILDPYIKASNAMPRVILAPIFAMWFGLGIWSKVALAGVKEVSPVVLANARMLGANQRQLLRTVYLPSATSWVFSSLHTSVGLAFVGVIVGEYLGSARGVGYLILQAEGAFDINTVFAGILVLTAFALVLDTVVGMIEKRLMKWQPKSGETERL

Samples

Sample ID Description Type Environment
1 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
39 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
52 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
53 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
75 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
76 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
77 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
78 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
112 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
125 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
126 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
127 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
128 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
133 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
134 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
135 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
136 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
156 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
157 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
160 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
161 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
169 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
170 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
172 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
173 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
174 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
177 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
178 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
179 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
183 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
188 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
191 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
255 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
257 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
258 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
262 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
263 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
264 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
265 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
266 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
267 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
268 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
269 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
270 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
271 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
272 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
273 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
274 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
275 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
276 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
277 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
278 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
279 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
280 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
281 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
282 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
283 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
284 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
285 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
286 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
287 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
288 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
289 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
290 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
291 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
292 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
293 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
294 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
295 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
296 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
297 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
298 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
299 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
300 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
301 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
302 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
303 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
304 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
305 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
306 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
307 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
308 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
309 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
310 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
311 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
312 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
313 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
314 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
315 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
316 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
317 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
318 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
319 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
320 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
321 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
322 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
323 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
324 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
325 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
326 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
327 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
328 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
329 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
330 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
331 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
332 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
333 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
334 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
335 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
336 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
337 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
338 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
339 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
340 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
341 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
342 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
343 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
344 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
345 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
346 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
347 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
348 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
349 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
350 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
351 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
352 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
353 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
354 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
355 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
356 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
357 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
358 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
359 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
360 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
361 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
362 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
363 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
364 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
365 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
366 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
367 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
368 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
369 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
370 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
371 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
372 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
373 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
374 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
375 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
376 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
377 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
378 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
379 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
380 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
381 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
382 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
383 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
384 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
385 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
386 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
387 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
388 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
389 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
390 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
391 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
392 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
393 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
394 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
395 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
396 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
397 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
398 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
399 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
400 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
401 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
402 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
403 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
404 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
405 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
406 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
407 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
408 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
409 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
410 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
411 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
412 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
413 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
414 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
415 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
416 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
417 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
418 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
419 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
420 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
421 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
422 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
423 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
424 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
425 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
426 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
427 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
428 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
429 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
430 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
431 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
432 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
433 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
434 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
435 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
436 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
437 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
438 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
439 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
440 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
441 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
442 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
443 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
444 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
445 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
446 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
447 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
448 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
449 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
450 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
451 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
452 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
453 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
454 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
467 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
468 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
469 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
470 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
471 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
472 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
473 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
474 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
475 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
476 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
477 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
478 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
479 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
480 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
482 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
483 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
484 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
485 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
486 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
487 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
488 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
489 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
490 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
491 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
492 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
493 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
494 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
495 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
496 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
497 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
498 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
499 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
500 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
501 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
502 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
503 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
504 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
505 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
506 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
507 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
508 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
509 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
510 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
511 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
512 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
513 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
514 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
515 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
516 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
517 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
518 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
519 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
520 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
521 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
522 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
523 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
524 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
525 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.21
Nodule 0.46
Rhizoplane 2.89
Rhizosphere 65.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182007_10004797 3300015262 Bacteria 6072
2 JGI24740J21852_10016314 3300001979 Bacteria 2686
3 JGI25155J39150_1000049 3300002704 Bacteria 78961
4 JGI25155J39150_1000145 3300002704 Bacteria 32917
5 JGI25155J39150_1000235 3300002704 Bacteria 21541
6 JGI25156J39149_1000023 3300002705 Bacteria 146831
7 JGI25156J39149_1000220 3300002705 Bacteria 39809
8 JGI25156J39149_1000290 3300002705 Bacteria 33901
9 JGI25156J39149_1001073 3300002705 Bacteria 12573
10 JGI25156J39149_1004387 3300002705 Bacteria 4312
11 JGI25162J39368_1000369 3300002737 Bacteria 38411
12 JGI25154J39366_1000036 3300002738 Bacteria 161697
13 JGI25154J39366_1000265 3300002738 Bacteria 33226
14 JGI25154J39366_1000422 3300002738 Bacteria 22674
15 JGI25154J39366_1000669 3300002738 Bacteria 15992
16 JGI25157J39369_1000023 3300002741 Bacteria 161697
17 JGI25157J39369_1000135 3300002741 Bacteria 61510
18 JGI25157J39369_1000186 3300002741 Bacteria 52214
19 JGI25163J39215_1004222 3300002771 Bacteria 1037
20 JGI25164J39214_1001832 3300002772 Bacteria 4046
21 JGI25152J39213_1004068 3300002773 Bacteria 4749
22 JGI25152J39213_1013350 3300002773 Bacteria 1716
23 JGI25150J39212_1005722 3300002774 Bacteria 2630
24 JGI25150J39212_1014895 3300002774 Bacteria 1308
25 JGI25159J45721_1001073 3300002987 Bacteria 11684
26 JGI25159J45721_1001804 3300002987 Bacteria 8589
27 JGI25159J45721_1010573 3300002987 Bacteria 2340
28 JGI25151J46595_10000095 3300003187 Bacteria 118630
29 JGI25151J46595_10000682 3300003187 Bacteria 28683
30 JGI25151J46595_10001217 3300003187 Bacteria 18394
31 JGI25151J46595_10004016 3300003187 Bacteria 7904
32 JGI25151J46595_10011646 3300003187 Bacteria 4035
33 JGI25151J46595_10015494 3300003187 Bacteria 3356
34 JGI25151J46595_10025218 3300003187 Bacteria 2422
35 JGI25165J46597_1000022 3300003214 Bacteria 357959
36 JGI25160J50197_1000256 3300003354 Bacteria 40310
37 JGI25160J50197_1000260 3300003354 Bacteria 39829
38 JGI25161J50226_1000015 3300003374 Bacteria 183773
39 JGI25161J50226_1003370 3300003374 Bacteria 3683
40 Ga0055538_1000011 3300003751 Bacteria 357959
41 Ga0055538_1000211 3300003751 Bacteria 34108
42 Ga0055538_1004347 3300003751 Bacteria 1622
43 Ga0055539_1000016 3300003752 Bacteria 358248
44 Ga0055539_1000253 3300003752 Bacteria 34108
45 Ga0055533_1000019 3300003756 Bacteria 357959
46 Ga0055533_1000244 3300003756 Bacteria 34108
47 Ga0055533_1006875 3300003756 Bacteria 1616
48 Ga0055532_1000002 3300003758 Bacteria 576000
49 Ga0055532_1000029 3300003758 Bacteria 232900
50 Ga0055532_1000077 3300003758 Bacteria 122193
51 Ga0055525_1000042 3300003759 Bacteria 279804
52 Ga0055525_1000341 3300003759 Bacteria 34108
53 Ga0055535_1001340 3300003761 Bacteria 13000
54 Ga0055535_1013422 3300003761 Bacteria 1209
55 Ga0055535_1016064 3300003761 Bacteria 1033
56 Ga0055542_1000114 3300003762 Bacteria 107058
57 Ga0055529_1000062 3300003763 Bacteria 183782
58 Ga0055526_1001344 3300003771 Bacteria 17606
59 Ga0055526_1003598 3300003771 Bacteria 9725
60 Ga0055526_1006059 3300003771 Bacteria 6692
61 Ga0055526_1006704 3300003771 Bacteria 6172
62 Ga0055526_1027625 3300003771 Bacteria 1746
63 Ga0055537_1000135 3300003773 Bacteria 55914
64 Ga0055537_1000972 3300003773 Bacteria 13040
65 Ga0055537_1004059 3300003773 Bacteria 4293
66 Ga0055537_1007985 3300003773 Bacteria 2487
67 Ga0055537_1011803 3300003773 Bacteria 1746
68 Ga0055524_1000016 3300003775 Bacteria 244926
69 Ga0055524_1001369 3300003775 Bacteria 14151
70 Ga0055524_1027203 3300003775 Bacteria 1742
71 Ga0055536_1001508 3300003781 Bacteria 13983
72 Ga0055536_1002393 3300003781 Bacteria 10572
73 Ga0055536_1002988 3300003781 Bacteria 9264
74 Ga0055536_1003001 3300003781 Bacteria 9240
75 Ga0055536_1005027 3300003781 Bacteria 6569
76 Ga0055536_1012339 3300003781 Bacteria 3180
77 Ga0055534_1000222 3300003784 Bacteria 41454
78 Ga0055534_1003866 3300003784 Bacteria 4564
79 Ga0055534_1004171 3300003784 Bacteria 4274
80 Ga0055534_1004254 3300003784 Bacteria 4212
81 Ga0055528_1000423 3300003790 Bacteria 33986
82 Ga0055528_1021001 3300003790 Bacteria 2093
83 Ga0055528_1041767 3300003790 Bacteria 1018
84 Ga0055530_10000293 3300003791 Bacteria 45497
85 Ga0055530_10000951 3300003791 Bacteria 23683
86 Ga0055530_10010819 3300003791 Bacteria 3332
87 Ga0055530_10027026 3300003791 Bacteria 1573
88 Ga0055540_1000144 3300003792 Bacteria 71420
89 Ga0055540_1001605 3300003792 Bacteria 13184
90 Ga0055531_10003930 3300003794 Bacteria 9242
91 Ga0055531_10006565 3300003794 Bacteria 6573
92 Ga0055541_1000017 3300003841 Bacteria 286811
93 Ga0055541_1000152 3300003841 Bacteria 34108
94 Ga0055541_1008688 3300003841 Bacteria 1608
95 Ga0065165_1002529 3300005262 Bacteria 15207
96 Ga0065165_1003560 3300005262 Bacteria 10765
97 Ga0065714_10027786 3300005288 Bacteria 1330
98 Ga0065714_10110956 3300005288 Bacteria 1473
99 Ga0065704_10196170 3300005289 Bacteria 1166
100 Ga0065712_10033510 3300005290 Bacteria 1314
101 Ga0065712_10215458 3300005290 Bacteria 1058
102 Ga0065715_10018889 3300005293 Bacteria 1990
103 Ga0065707_10097541 3300005295 Bacteria 3166
104 Ga0070658_10003267 3300005327 Bacteria 13383
105 Ga0070658_10006087 3300005327 Bacteria 9786
106 Ga0070658_10078641 3300005327 Bacteria 2708
107 Ga0070658_10125923 3300005327 Bacteria 2132
108 Ga0070658_10189808 3300005327 Bacteria 1732
109 Ga0070658_10266896 3300005327 Bacteria 1455
110 Ga0070676_10000320 3300005328 Bacteria 21774
111 Ga0070676_10031111 3300005328 Bacteria 3047
112 Ga0070676_10095452 3300005328 Bacteria 1828
113 Ga0070690_100006125 3300005330 Bacteria 6807
114 Ga0070690_100199822 3300005330 Bacteria 1390
115 Ga0070690_100283513 3300005330 Bacteria 1182
116 Ga0070670_100010983 3300005331 Bacteria 7735
117 Ga0070670_100435533 3300005331 Bacteria 1160
118 Ga0070677_10004319 3300005333 Bacteria 4629
119 Ga0070677_10055158 3300005333 Bacteria 1621
120 Ga0070677_10064821 3300005333 Bacteria 1518
121 Ga0068869_100002410 3300005334 Bacteria 11271
122 Ga0068869_100033892 3300005334 Bacteria 3609
123 Ga0068869_100070788 3300005334 Bacteria 2581
124 Ga0068869_100085929 3300005334 Bacteria 2357
125 Ga0070666_10083850 3300005335 Bacteria 2180
126 Ga0070680_100016218 3300005336 Bacteria 5859
127 Ga0070680_100040031 3300005336 Bacteria 3793
128 Ga0070680_100162083 3300005336 Bacteria 1879
129 Ga0068868_100019122 3300005338 Bacteria 5130
130 Ga0068868_100114968 3300005338 Bacteria 2190
131 Ga0068868_100210467 3300005338 Bacteria 1625
132 Ga0070660_100021552 3300005339 Bacteria 4754
133 Ga0070660_100056605 3300005339 Bacteria 3034
134 Ga0070660_100433757 3300005339 Bacteria 1089
135 Ga0070689_100069856 3300005340 Bacteria 2741
136 Ga0070689_100105242 3300005340 Bacteria 2238
137 Ga0070689_100262439 3300005340 Bacteria 1428
138 Ga0070691_10040465 3300005341 Bacteria 2203
139 Ga0070687_100372175 3300005343 Bacteria 928
140 Ga0070661_100016420 3300005344 Bacteria 5233
141 Ga0070661_100034875 3300005344 Bacteria 3651
142 Ga0070692_10010718 3300005345 Bacteria 4184
143 Ga0070668_100027748 3300005347 Bacteria 4297
144 Ga0070668_100033774 3300005347 Bacteria 3897
145 Ga0070668_100037347 3300005347 Bacteria 3709
146 Ga0070669_100024401 3300005353 Bacteria 4335
147 Ga0070669_100029937 3300005353 Bacteria 3926
148 Ga0070675_100001927 3300005354 Bacteria 15350
149 Ga0070675_100047101 3300005354 Bacteria 3532
150 Ga0070675_100101858 3300005354 Bacteria 2419
151 Ga0070675_100362323 3300005354 Bacteria 1287
152 Ga0070671_100084995 3300005355 Bacteria 2646
153 Ga0070671_100272223 3300005355 Bacteria 1439
154 Ga0070671_100308037 3300005355 Bacteria 1349
155 Ga0070671_100324383 3300005355 Bacteria 1312
156 Ga0070671_100395609 3300005355 Bacteria 1182
157 Ga0070674_100029239 3300005356 Bacteria 3627
158 Ga0070674_100073669 3300005356 Bacteria 2421
159 Ga0070673_100037884 3300005364 Bacteria 3678
160 Ga0070673_100061084 3300005364 Bacteria 2988
161 Ga0070673_100065980 3300005364 Bacteria 2890
162 Ga0070688_100257944 3300005365 Bacteria 1244
163 Ga0070659_100001576 3300005366 Bacteria 16422
164 Ga0070659_100012726 3300005366 Bacteria 6244
165 Ga0070659_100013884 3300005366 Bacteria 6009
166 Ga0070659_100239492 3300005366 Bacteria 1501
167 Ga0070659_100324925 3300005366 Bacteria 1287
168 Ga0070667_100044049 3300005367 Bacteria 3746
169 Ga0070667_100048082 3300005367 Bacteria 3590
170 Ga0070667_100071496 3300005367 Bacteria 2955
171 Ga0070667_100249764 3300005367 Bacteria 1586
172 Ga0070714_100019818 3300005435 Bacteria 5485
173 Ga0070701_10003477 3300005438 Bacteria 6240
174 Ga0070705_100025900 3300005440 Bacteria 3186
175 Ga0070705_100029002 3300005440 Bacteria 3037
176 Ga0070705_100379738 3300005440 Bacteria 1040
177 Ga0070700_100010396 3300005441 Bacteria 5137
178 Ga0070663_100007977 3300005455 Bacteria 6488
179 Ga0070663_100039272 3300005455 Bacteria 3307
180 Ga0070678_100002841 3300005456 Bacteria 9579
181 Ga0070678_100017631 3300005456 Bacteria 4605
182 Ga0070678_100066761 3300005456 Bacteria 2675
183 Ga0070678_100169788 3300005456 Bacteria 1775
184 Ga0070678_100226554 3300005456 Bacteria 1556
185 Ga0070662_100008031 3300005457 Bacteria 6866
186 Ga0070662_100032246 3300005457 Bacteria 3681
187 Ga0070662_100081197 3300005457 Bacteria 2415
188 Ga0070662_100185248 3300005457 Bacteria 1643
189 Ga0070662_100193596 3300005457 Bacteria 1610
190 Ga0070681_10016317 3300005458 Bacteria 7413
191 Ga0068867_100001486 3300005459 Bacteria 16233
192 Ga0068867_100015713 3300005459 Bacteria 5371
193 Ga0068867_100022223 3300005459 Bacteria 4534
194 Ga0068867_100104915 3300005459 Bacteria 2164
195 Ga0068867_100106500 3300005459 Bacteria 2148
196 Ga0068867_100164030 3300005459 Bacteria 1754
197 Ga0068867_100257839 3300005459 Bacteria 1420
198 Ga0070685_10146818 3300005466 Bacteria 1491
199 Ga0070706_100027210 3300005467 Bacteria 5262
200 Ga0070706_100035650 3300005467 Bacteria 4592
201 Ga0070706_100405324 3300005467 Bacteria 1269
202 Ga0070707_100018087 3300005468 Bacteria 6630
203 Ga0070707_100266192 3300005468 Bacteria 1667
204 Ga0070698_100008886 3300005471 Bacteria 10799
205 Ga0070698_100187757 3300005471 Bacteria 2004
206 Ga0070699_100063404 3300005518 Bacteria 3205
207 Ga0070699_100195495 3300005518 Bacteria 1798
208 Ga0070679_100007311 3300005530 Bacteria 10317
209 Ga0070679_100064860 3300005530 Bacteria 3641
210 Ga0070679_100127769 3300005530 Bacteria 2523
211 Ga0070679_100144109 3300005530 Bacteria 2361
212 Ga0070679_100162507 3300005530 Bacteria 2207
213 Ga0070679_100300381 3300005530 Bacteria 1556
214 Ga0070684_100017377 3300005535 Bacteria 5902
215 Ga0070684_100204439 3300005535 Bacteria 1799
216 Ga0068853_100039942 3300005539 Bacteria 4002
217 Ga0068853_100090444 3300005539 Bacteria 2690
218 Ga0068853_100110475 3300005539 Bacteria 2442
219 Ga0068853_100286302 3300005539 Bacteria 1520
220 Ga0068853_100301975 3300005539 Bacteria 1480
221 Ga0068853_100438804 3300005539 Bacteria 1227
222 Ga0070672_100000455 3300005543 Bacteria 23832
223 Ga0070672_100001146 3300005543 Bacteria 16215
224 Ga0070672_100021909 3300005543 Bacteria 4683
225 Ga0070672_100046548 3300005543 Bacteria 3361
226 Ga0070686_100154140 3300005544 Bacteria 1612
227 Ga0070686_100177581 3300005544 Bacteria 1511
228 Ga0070686_100209010 3300005544 Bacteria 1404
229 Ga0070686_100209064 3300005544 Bacteria 1403
230 Ga0070686_100266902 3300005544 Bacteria 1257
231 Ga0070686_100291640 3300005544 Bacteria 1207
232 Ga0070695_100140069 3300005545 Bacteria 1676
233 Ga0070695_100251517 3300005545 Bacteria 1286
234 Ga0070693_100003698 3300005547 Bacteria 7151
235 Ga0070693_100012198 3300005547 Bacteria 4346
236 Ga0070693_100047433 3300005547 Bacteria 2444
237 Ga0070693_100273485 3300005547 Bacteria 1128
238 Ga0070693_100307521 3300005547 Bacteria 1071
239 Ga0070665_100011648 3300005548 Bacteria 8888
240 Ga0070665_100060646 3300005548 Bacteria 3792
241 Ga0070665_100066266 3300005548 Bacteria 3623
242 Ga0070704_100438152 3300005549 Bacteria 1122
243 Ga0068855_100012616 3300005563 Bacteria 10198
244 Ga0068855_100022837 3300005563 Bacteria 7497
245 Ga0068855_100033825 3300005563 Bacteria 6097
246 Ga0068855_100061531 3300005563 Bacteria 4386
247 Ga0068855_100066997 3300005563 Bacteria 4185
248 Ga0068855_100077991 3300005563 Bacteria 3843
249 Ga0068855_100140452 3300005563 Bacteria 2754
250 Ga0068855_100142557 3300005563 Bacteria 2730
251 Ga0068855_100255587 3300005563 Bacteria 1953
252 Ga0070664_100014870 3300005564 Bacteria 6351
253 Ga0070664_100125613 3300005564 Bacteria 2250
254 Ga0070664_100140084 3300005564 Bacteria 2129
255 Ga0070664_100204104 3300005564 Bacteria 1765
256 Ga0070664_100308755 3300005564 Bacteria 1431
257 Ga0070664_100309817 3300005564 Bacteria 1428
258 Ga0070664_100365647 3300005564 Bacteria 1314
259 Ga0070664_100487770 3300005564 Bacteria 1135
260 Ga0068857_100001496 3300005577 Bacteria 18618
261 Ga0068857_100010173 3300005577 Bacteria 8178
262 Ga0068857_100051914 3300005577 Bacteria 3639
263 Ga0068857_100077855 3300005577 Bacteria 2959
264 Ga0068854_100002285 3300005578 Bacteria 11791
265 Ga0068854_100004431 3300005578 Bacteria 8857
266 Ga0068854_100009632 3300005578 Bacteria 6238
267 Ga0068854_100021798 3300005578 Bacteria 4354
268 Ga0068854_100046047 3300005578 Bacteria 3104
269 Ga0068854_100068368 3300005578 Bacteria 2590
270 Ga0068856_100009070 3300005614 Bacteria 9678
271 Ga0068856_100018538 3300005614 Bacteria 6745
272 Ga0068856_100061885 3300005614 Bacteria 3697
273 Ga0068856_100120537 3300005614 Bacteria 2624
274 Ga0068856_100193901 3300005614 Bacteria 2045
275 Ga0068856_100241011 3300005614 Bacteria 1823
276 Ga0068856_100481611 3300005614 Bacteria 1262
277 Ga0070702_100010386 3300005615 Bacteria 4584
278 Ga0070702_100015341 3300005615 Bacteria 3911
279 Ga0068852_100001380 3300005616 Bacteria 16305
280 Ga0068852_100039666 3300005616 Bacteria 3966
281 Ga0068852_100061872 3300005616 Bacteria 3254
282 Ga0068852_100068072 3300005616 Bacteria 3114
283 Ga0068852_100129822 3300005616 Bacteria 2319
284 Ga0068852_100216993 3300005616 Bacteria 1818
285 Ga0068852_100219269 3300005616 Bacteria 1808
286 Ga0068852_100526901 3300005616 Bacteria 1179
287 Ga0068859_100007275 3300005617 Bacteria 11228
288 Ga0068859_100016209 3300005617 Bacteria 7485
289 Ga0068859_100082328 3300005617 Bacteria 3261
290 Ga0068859_100154983 3300005617 Bacteria 2368
291 Ga0068859_100513955 3300005617 Bacteria 1293
292 Ga0068864_100010520 3300005618 Bacteria 7646
293 Ga0068864_100031907 3300005618 Bacteria 4472
294 Ga0068864_100044791 3300005618 Bacteria 3794
295 Ga0068864_100060611 3300005618 Bacteria 3276
296 Ga0068866_10005198 3300005718 Bacteria 5360
297 Ga0068866_10025134 3300005718 Bacteria 2796
298 Ga0068866_10154427 3300005718 Bacteria 1332
299 Ga0068861_100003094 3300005719 Bacteria 10994
300 Ga0068861_100032543 3300005719 Bacteria 3839
301 Ga0068861_100041906 3300005719 Bacteria 3431
302 Ga0068861_100043682 3300005719 Bacteria 3366
303 Ga0068861_100284323 3300005719 Bacteria 1426
304 Ga0068851_10013725 3300005834 Bacteria 3835
305 Ga0068851_10047436 3300005834 Bacteria 2175
306 Ga0068851_10075684 3300005834 Bacteria 1750
307 Ga0068851_10101961 3300005834 Bacteria 1524
308 Ga0068851_10133598 3300005834 Bacteria 1344
309 Ga0068870_10016636 3300005840 Bacteria 3519
310 Ga0068870_10023363 3300005840 Bacteria 3048
311 Ga0068863_100001744 3300005841 Bacteria 21556
312 Ga0068863_100022783 3300005841 Bacteria 5983
313 Ga0068858_100029306 3300005842 Bacteria 5110
314 Ga0068858_100053295 3300005842 Bacteria 3742
315 Ga0068858_100077271 3300005842 Bacteria 3092
316 Ga0068858_100402312 3300005842 Bacteria 1316
317 Ga0068860_100035652 3300005843 Bacteria 4770
318 Ga0068860_100050343 3300005843 Bacteria 3966
319 Ga0068860_100100749 3300005843 Bacteria 2756
320 Ga0068860_100256243 3300005843 Bacteria 1705
321 Ga0068862_100015247 3300005844 Bacteria 6382
322 Ga0068862_100020890 3300005844 Bacteria 5470
323 Ga0068862_100039407 3300005844 Bacteria 4012
324 Ga0068862_100056495 3300005844 Bacteria 3363
325 Ga0081455_10001395 3300005937 Bacteria 29860
326 Ga0081455_10002648 3300005937 Bacteria 21189
327 Ga0081455_10010547 3300005937 Bacteria 9363
328 Ga0081539_10015865 3300005985 Bacteria 5433
329 Ga0075365_10002444 3300006038 Bacteria 9116
330 Ga0075365_10044317 3300006038 Bacteria 2914
331 Ga0075365_10121602 3300006038 Bacteria 1801
332 Ga0075365_10123674 3300006038 Bacteria 1786
333 Ga0075365_10142884 3300006038 Bacteria 1662
334 Ga0075368_10015636 3300006042 Bacteria 2818
335 Ga0075368_10015867 3300006042 Bacteria 2799
336 Ga0075363_100017418 3300006048 Bacteria 3563
337 Ga0075363_100027807 3300006048 Bacteria 2903
338 Ga0075363_100038847 3300006048 Bacteria 2504
339 Ga0075363_100046661 3300006048 Bacteria 2299
340 Ga0075364_10037915 3300006051 Bacteria 3122
341 Ga0075364_10064427 3300006051 Bacteria 2406
342 Ga0075364_10090544 3300006051 Bacteria 2029
343 Ga0075364_10118418 3300006051 Bacteria 1771
344 Ga0075432_10003417 3300006058 Bacteria 5378
345 Ga0070715_10013631 3300006163 Bacteria 2990
346 Ga0070712_100318561 3300006175 Bacteria 1264
347 Ga0075362_10003711 3300006177 Bacteria 5395
348 Ga0075362_10004022 3300006177 Bacteria 5234
349 Ga0075362_10009604 3300006177 Bacteria 3748
350 Ga0075362_10015470 3300006177 Bacteria 3103
351 Ga0075362_10027448 3300006177 Bacteria 2438
352 Ga0075362_10047479 3300006177 Bacteria 1913
353 Ga0075362_10074111 3300006177 Bacteria 1559
354 Ga0075362_10121470 3300006177 Bacteria 1237
355 Ga0075367_10008214 3300006178 Bacteria 5396
356 Ga0075367_10095447 3300006178 Bacteria 1814
357 Ga0075367_10103121 3300006178 Bacteria 1746
358 Ga0075367_10106172 3300006178 Bacteria 1720
359 Ga0075367_10106780 3300006178 Bacteria 1716
360 Ga0075367_10182577 3300006178 Bacteria 1308
361 Ga0075369_10000736 3300006186 Bacteria 10608
362 Ga0075369_10014986 3300006186 Bacteria 3104
363 Ga0075366_10008204 3300006195 Bacteria 5794
364 Ga0075366_10020307 3300006195 Bacteria 3853
365 Ga0075366_10023577 3300006195 Bacteria 3586
366 Ga0075366_10025110 3300006195 Bacteria 3478
367 Ga0075366_10039213 3300006195 Bacteria 2800
368 Ga0075366_10048713 3300006195 Bacteria 2513
369 Ga0075366_10064808 3300006195 Bacteria 2173
370 Ga0075366_10124617 3300006195 Bacteria 1553
371 Ga0075366_10139857 3300006195 Bacteria 1463
372 Ga0075366_10202852 3300006195 Bacteria 1206
373 Ga0097621_100005368 3300006237 Bacteria 9031
374 Ga0097621_100046253 3300006237 Bacteria 3520
375 Ga0097621_100046943 3300006237 Bacteria 3497
376 Ga0097621_100052233 3300006237 Bacteria 3329
377 Ga0097621_100062452 3300006237 Bacteria 3058
378 Ga0097621_100300081 3300006237 Bacteria 1418
379 Ga0075370_10001756 3300006353 Bacteria 9663
380 Ga0075370_10004393 3300006353 Bacteria 6839
381 Ga0075370_10005564 3300006353 Bacteria 6278
382 Ga0075370_10008738 3300006353 Bacteria 5226
383 Ga0075370_10008946 3300006353 Bacteria 5177
384 Ga0075370_10012183 3300006353 Bacteria 4538
385 Ga0075370_10017291 3300006353 Bacteria 3895
386 Ga0075370_10062019 3300006353 Bacteria 2130
387 Ga0075370_10173554 3300006353 Bacteria 1268
388 Ga0068871_100011498 3300006358 Bacteria 6492
389 Ga0068871_100014985 3300006358 Bacteria 5796
390 Ga0068871_100027274 3300006358 Bacteria 4465
391 Ga0068871_100032191 3300006358 Bacteria 4140
392 Ga0068871_100038841 3300006358 Bacteria 3805
393 Ga0068871_100364516 3300006358 Bacteria 1281
394 Ga0068871_100542427 3300006358 Bacteria 1052
395 Ga0075434_100828613 3300006871 Bacteria 941
396 Ga0068865_100024637 3300006881 Bacteria 3950
397 Ga0068865_100029315 3300006881 Bacteria 3650
398 Ga0068865_100082262 3300006881 Bacteria 2314
399 Ga0097620_100007275 3300006931 Bacteria 11228
400 Ga0097620_100016209 3300006931 Bacteria 7485
401 Ga0097620_100082323 3300006931 Bacteria 3261
402 Ga0097620_100154981 3300006931 Bacteria 2368
403 Ga0097620_100513937 3300006931 Bacteria 1293
404 Ga0099824_1046569 3300006942 Bacteria 888
405 Ga0099826_10000020 3300006948 Bacteria 183920
406 Ga0099826_10004782 3300006948 Bacteria 9564
407 Ga0099826_10139654 3300006948 Bacteria 1401
408 Ga0099794_10043265 3300007265 Bacteria 2149
409 Ga0099794_10061160 3300007265 Bacteria 1829
410 Ga0099794_10217919 3300007265 Bacteria 980
411 Ga0105251_10001533 3300009011 Bacteria 19826
412 Ga0105251_10072524 3300009011 Bacteria 1601
413 Ga0105251_10164173 3300009011 Bacteria 1001
414 Ga0105244_10005141 3300009036 Bacteria 8771
415 Ga0105244_10114075 3300009036 Bacteria 1312
416 Ga0105240_10002847 3300009093 Bacteria 27330
417 Ga0105240_10004008 3300009093 Bacteria 22687
418 Ga0105240_10004595 3300009093 Bacteria 20920
419 Ga0105240_10006708 3300009093 Bacteria 16865
420 Ga0105240_10010502 3300009093 Bacteria 13014
421 Ga0105240_10021598 3300009093 Bacteria 8560
422 Ga0105240_10050266 3300009093 Bacteria 5258
423 Ga0105240_10052126 3300009093 Bacteria 5144
424 Ga0105240_10180266 3300009093 Bacteria 2493
425 Ga0105240_10409667 3300009093 Bacteria 1525
426 Ga0105245_10038308 3300009098 Bacteria 4265
427 Ga0105245_10057603 3300009098 Bacteria 3495
428 Ga0105245_10077594 3300009098 Bacteria 3029
429 Ga0105245_10120427 3300009098 Bacteria 2451
430 Ga0105245_10471504 3300009098 Bacteria 1267
431 Ga0105245_10826227 3300009098 Bacteria 966
432 Ga0105245_10886509 3300009098 Bacteria 933
433 Ga0114129_10477035 3300009147 Bacteria 1633
434 Ga0105243_10000972 3300009148 Bacteria 26663
435 Ga0105243_10001957 3300009148 Bacteria 17541
436 Ga0105243_10006686 3300009148 Bacteria 8904
437 Ga0105243_10029263 3300009148 Bacteria 4235
438 Ga0105243_10032140 3300009148 Bacteria 4052
439 Ga0105243_10141151 3300009148 Bacteria 2055
440 Ga0105243_10179457 3300009148 Bacteria 1840
441 Ga0105243_10257390 3300009148 Bacteria 1561
442 Ga0105243_10283723 3300009148 Bacteria 1493
443 Ga0105241_10167409 3300009174 Bacteria 1812
444 Ga0105241_10247434 3300009174 Bacteria 1510
445 Ga0105242_10011903 3300009176 Bacteria 6695
446 Ga0105242_10023227 3300009176 Bacteria 4888
447 Ga0105242_10117227 3300009176 Bacteria 2279
448 Ga0105242_10267954 3300009176 Bacteria 1546
449 Ga0105248_10006623 3300009177 Bacteria 12697
450 Ga0105248_10323809 3300009177 Bacteria 1736
451 Ga0105248_10372280 3300009177 Bacteria 1608
452 Ga0105248_11268441 3300009177 Bacteria 833
453 Ga0105237_10001856 3300009545 Bacteria 27034
454 Ga0105237_10004431 3300009545 Bacteria 16270
455 Ga0105237_10010879 3300009545 Bacteria 9654
456 Ga0105237_10033848 3300009545 Bacteria 5177
457 Ga0105237_10257728 3300009545 Bacteria 1746
458 Ga0105237_10559222 3300009545 Bacteria 1151
459 Ga0105238_10000006 3300009551 Bacteria 346249
460 Ga0105238_10010668 3300009551 Bacteria 9228
461 Ga0105238_10036320 3300009551 Bacteria 5008
462 Ga0105238_10062761 3300009551 Bacteria 3716
463 Ga0105238_10106908 3300009551 Bacteria 2779
464 Ga0105238_10155806 3300009551 Bacteria 2259
465 Ga0105238_10377118 3300009551 Bacteria 1409
466 Ga0105249_10025103 3300009553 Bacteria 5364
467 Ga0105249_10052442 3300009553 Bacteria 3725
468 Ga0105249_10237353 3300009553 Bacteria 1801
469 Ga0105249_10413878 3300009553 Bacteria 1381
470 Ga0105239_10001826 3300010375 Bacteria 27875
471 Ga0105239_10006997 3300010375 Bacteria 12984
472 Ga0105239_10066463 3300010375 Bacteria 3961
473 Ga0105239_10102505 3300010375 Bacteria 3167
474 Ga0105239_10675601 3300010375 Bacteria 1180
475 Ga0105239_10837932 3300010375 Bacteria 1054
476 Ga0105246_10099723 3300011119 Bacteria 2112
477 Ga0105246_10230233 3300011119 Bacteria 1459
478 Ga0157371_10065548 3300013102 Bacteria 2572
479 Ga0157371_10116637 3300013102 Bacteria 1897
480 Ga0157370_10007222 3300013104 Bacteria 12124
481 Ga0157370_10019942 3300013104 Bacteria 6707
482 Ga0157370_10154548 3300013104 Bacteria 2135
483 Ga0157370_10447941 3300013104 Bacteria 1187
484 Ga0157369_10002332 3300013105 Bacteria 22844
485 Ga0157369_10041430 3300013105 Bacteria 5027
486 Ga0157369_10080187 3300013105 Bacteria 3495
487 Ga0157369_10086670 3300013105 Bacteria 3344
488 Ga0157369_10087324 3300013105 Bacteria 3330
489 Ga0157369_10326096 3300013105 Bacteria 1596
490 Ga0157369_10441847 3300013105 Bacteria 1347
491 Ga0157374_10019483 3300013296 Bacteria 6005
492 Ga0157374_10030208 3300013296 Bacteria 4916
493 Ga0157374_10109104 3300013296 Bacteria 2661
494 Ga0157378_10021050 3300013297 Bacteria 5737
495 Ga0157378_10243075 3300013297 Bacteria 1720
496 Ga0157378_10371985 3300013297 Bacteria 1401
497 Ga0163162_10009232 3300013306 Bacteria 9594
498 Ga0163162_10023582 3300013306 Bacteria 6075
499 Ga0163162_10074809 3300013306 Bacteria 3446
500 Ga0163162_10269541 3300013306 Bacteria 1834
501 Ga0163162_10356051 3300013306 Bacteria 1596
502 Ga0157372_10000824 3300013307 Bacteria 33574
503 Ga0157372_10045482 3300013307 Bacteria 4870
504 Ga0157372_10085341 3300013307 Bacteria 3580
505 Ga0157372_10219693 3300013307 Bacteria 2203
506 Ga0157372_10271276 3300013307 Bacteria 1971
507 Ga0157372_10290053 3300013307 Bacteria 1903
508 Ga0157372_11097025 3300013307 Bacteria 921
509 Ga0157375_10108568 3300013308 Bacteria 2870
510 Ga0157375_10146754 3300013308 Bacteria 2490
511 Ga0157375_10160675 3300013308 Bacteria 2388
512 Ga0157375_10164555 3300013308 Bacteria 2362
513 Ga0157375_10294349 3300013308 Bacteria 1786
514 Ga0157375_10340146 3300013308 Bacteria 1666
515 Ga0157375_10915607 3300013308 Bacteria 1020
516 Ga0163163_10617822 3300014325 Bacteria 1147
517 Ga0157380_10038996 3300014326 Bacteria 3692
518 Ga0157380_10090437 3300014326 Bacteria 2525
519 Ga0157380_10455407 3300014326 Bacteria 1230
520 Ga0182008_10000729 3300014497 Bacteria 23349
521 Ga0182008_10003871 3300014497 Bacteria 8892
522 Ga0182008_10016800 3300014497 Bacteria 3796
523 Ga0182008_10019464 3300014497 Bacteria 3503
524 Ga0182008_10036706 3300014497 Bacteria 2452
525 Ga0182008_10069564 3300014497 Bacteria 1732
526 Ga0182008_10075108 3300014497 Bacteria 1663
527 Ga0157377_10009636 3300014745 Bacteria 4750
528 Ga0157379_10005798 3300014968 Bacteria 10628
529 Ga0157379_10015108 3300014968 Bacteria 6772
530 Ga0157379_10157387 3300014968 Bacteria 2050
531 Ga0157379_10253212 3300014968 Bacteria 1599
532 Ga0157376_10008025 3300014969 Bacteria 7581
533 Ga0157376_10032170 3300014969 Bacteria 4209
534 Ga0157376_10435700 3300014969 Bacteria 1275
535 Ga0157376_10740834 3300014969 Bacteria 991
536 Ga0182006_1000680 3300015261 Bacteria 23835
537 Ga0182006_1003026 3300015261 Bacteria 8847
538 Ga0182006_1008332 3300015261 Bacteria 4699
539 Ga0182006_1037486 3300015261 Bacteria 1921
540 Ga0182006_1048476 3300015261 Bacteria 1643
541 Ga0182007_10000164 3300015262 Bacteria 45789
542 Ga0182007_10002069 3300015262 Bacteria 10313
543 Ga0182007_10008922 3300015262 Bacteria 4083
544 Ga0182007_10012543 3300015262 Bacteria 3255
545 Ga0182005_1000986 3300015265 Bacteria 12316
546 Ga0182005_1053904 3300015265 Bacteria 1095
547 Ga0183361_10013 3300016635 Bacteria 179680
548 Ga0163161_10007253 3300017792 Bacteria 7658
549 Ga0163161_10009227 3300017792 Bacteria 6819
550 Ga0163161_10010284 3300017792 Bacteria 6480
551 Ga0163161_10030116 3300017792 Bacteria 3861
552 Ga0163161_10032692 3300017792 Bacteria 3716
553 Ga0163161_10058577 3300017792 Bacteria 2800
554 Ga0163161_10108933 3300017792 Bacteria 2069
555 Ga0213872_10001779 3300021361 Bacteria 13462
556 Ga0213872_10035049 3300021361 Bacteria 2295
557 Ga0209435_100001 3300025206 Bacteria 1424171
558 Ga0209435_100048 3300025206 Bacteria 92746
559 Ga0209435_100221 3300025206 Bacteria 16116
560 Ga0209760_100904 3300025207 Bacteria 3720
561 Ga0209784_100009 3300025224 Bacteria 688031
562 Ga0209784_100019 3300025224 Bacteria 453558
563 Ga0209784_102760 3300025224 Bacteria 1670
564 Ga0209566_100007 3300025225 Bacteria 688031
565 Ga0209566_100017 3300025225 Bacteria 453558
566 Ga0209674_100018 3300025226 Bacteria 688031
567 Ga0209674_100031 3300025226 Bacteria 453558
568 Ga0209674_106377 3300025226 Bacteria 1614
569 Ga0209672_100052 3300025228 Bacteria 231179
570 Ga0209672_100190 3300025228 Bacteria 49762
571 Ga0209672_101186 3300025228 Bacteria 10604
572 Ga0209147_100002 3300025229 Bacteria 2158988
573 Ga0209147_100122 3300025229 Bacteria 138553
574 Ga0209563_100020 3300025230 Bacteria 688031
575 Ga0209563_100035 3300025230 Bacteria 453558
576 Ga0209563_111684 3300025230 Bacteria 1231
577 Ga0207427_100296 3300025231 Bacteria 34920
578 Ga0207427_101737 3300025231 Bacteria 7155
579 Ga0209437_100038 3300025233 Bacteria 453558
580 Ga0209437_100081 3300025233 Bacteria 271072
581 Ga0209258_100002 3300025242 Bacteria 2158988
582 Ga0209258_100225 3300025242 Bacteria 107138
583 Ga0209258_100230 3300025242 Bacteria 104468
584 Ga0209258_100869 3300025242 Bacteria 16009
585 Ga0207425_1000149 3300025245 Bacteria 59740
586 Ga0207425_1000530 3300025245 Bacteria 23292
587 Ga0207425_1002683 3300025245 Bacteria 6093
588 Ga0207425_1007888 3300025245 Bacteria 2771
589 Ga0209646_1000001 3300025246 Bacteria 3092932
590 Ga0209646_1000130 3300025246 Bacteria 128556
591 Ga0209646_1000152 3300025246 Bacteria 97484
592 Ga0209646_1000214 3300025246 Bacteria 64093
593 Ga0209026_1000003 3300025250 Bacteria 1060571
594 Ga0209026_1000059 3300025250 Bacteria 226652
595 Ga0209026_1000126 3300025250 Bacteria 122422
596 Ga0209677_100010 3300025253 Bacteria 688031
597 Ga0209677_100020 3300025253 Bacteria 453558
598 Ga0209677_100226 3300025253 Bacteria 40136
599 Ga0209148_1000040 3300025254 Bacteria 473531
600 Ga0209148_1003376 3300025254 Bacteria 4465
601 Ga0209759_1000001 3300025256 Bacteria 2799452
602 Ga0209759_1000188 3300025256 Bacteria 99987
603 Ga0209759_1000193 3300025256 Bacteria 97484
604 Ga0209759_1000365 3300025256 Bacteria 56836
605 Ga0209759_1000509 3300025256 Bacteria 42206
606 Ga0209759_1015272 3300025256 Bacteria 1987
607 Ga0209129_1000007 3300025258 Bacteria 771325
608 Ga0209129_1000119 3300025258 Bacteria 138904
609 Ga0209233_1000049 3300025261 Bacteria 453558
610 Ga0209565_1000004 3300025263 Bacteria 983150
611 Ga0209565_1000085 3300025263 Bacteria 153075
612 Ga0209565_1000092 3300025263 Bacteria 141563
613 Ga0209565_1000365 3300025263 Bacteria 38942
614 Ga0209565_1000394 3300025263 Bacteria 36822
615 Ga0209565_1004286 3300025263 Bacteria 4392
616 Ga0209565_1014546 3300025263 Bacteria 1802
617 Ga0209455_1000021 3300025272 Bacteria 699993
618 Ga0209673_1000045 3300025273 Bacteria 290531
619 Ga0209673_1000133 3300025273 Bacteria 161740
620 Ga0209673_1000445 3300025273 Bacteria 70702
621 Ga0209673_1003004 3300025273 Bacteria 10492
622 Ga0209673_1005760 3300025273 Bacteria 6167
623 Ga0209673_1027752 3300025273 Bacteria 1836
624 Ga0209130_1000056 3300025284 Bacteria 210851
625 Ga0209130_1000070 3300025284 Bacteria 179057
626 Ga0209130_1000634 3300025284 Bacteria 33021
627 Ga0209130_1001057 3300025284 Bacteria 20883
628 Ga0209130_1004319 3300025284 Bacteria 5467
629 Ga0209675_1000083 3300025291 Bacteria 153075
630 Ga0209675_1000411 3300025291 Bacteria 35155
631 Ga0209675_1000809 3300025291 Bacteria 20627
632 Ga0209675_1000951 3300025291 Bacteria 18424
633 Ga0209675_1002465 3300025291 Bacteria 9496
634 Ga0209675_1007014 3300025291 Bacteria 4399
635 Ga0209675_1007810 3300025291 Bacteria 4030
636 Ga0209675_1013763 3300025291 Bacteria 2507
637 Ga0209675_1041373 3300025291 Bacteria 1006
638 Ga0209676_1000004 3300025292 Bacteria 1138360
639 Ga0209676_1000007 3300025292 Bacteria 1029371
640 Ga0209676_1000012 3300025292 Bacteria 841431
641 Ga0209676_1000268 3300025292 Bacteria 108430
642 Ga0209676_1000565 3300025292 Bacteria 55881
643 Ga0209676_1006485 3300025292 Bacteria 5762
644 Ga0209676_1013164 3300025292 Bacteria 3197
645 Ga0209025_1000055 3300025294 Bacteria 316748
646 Ga0209025_1000111 3300025294 Bacteria 218982
647 Ga0209025_1000455 3300025294 Bacteria 79964
648 Ga0209025_1000529 3300025294 Bacteria 72736
649 Ga0209025_1000892 3300025294 Bacteria 46436
650 Ga0209025_1001053 3300025294 Bacteria 40223
651 Ga0209025_1001159 3300025294 Bacteria 37305
652 Ga0209025_1001484 3300025294 Bacteria 30443
653 Ga0209025_1003293 3300025294 Bacteria 15544
654 Ga0209025_1004030 3300025294 Bacteria 13170
655 Ga0209025_1007672 3300025294 Bacteria 7971
656 Ga0209025_1034371 3300025294 Bacteria 2316
657 Ga0209564_1000024 3300025295 Bacteria 535041
658 Ga0209564_1000772 3300025295 Bacteria 44476
659 Ga0209564_1001095 3300025295 Bacteria 32240
660 Ga0209564_1001593 3300025295 Bacteria 22188
661 Ga0209564_1002067 3300025295 Bacteria 17262
662 Ga0209564_1002203 3300025295 Bacteria 16266
663 Ga0209564_1004894 3300025295 Bacteria 7945
664 Ga0209758_1000025 3300025297 Bacteria 586687
665 Ga0209758_1000194 3300025297 Bacteria 134196
666 Ga0209758_1010717 3300025297 Bacteria 5438
667 Ga0209758_1032044 3300025297 Bacteria 2143
668 Ga0209050_1000002 3300025298 Bacteria 1792849
669 Ga0209050_1000003 3300025298 Bacteria 1609245
670 Ga0209050_1000855 3300025298 Bacteria 41306
671 Ga0209050_1000965 3300025298 Bacteria 37080
672 Ga0209050_1002597 3300025298 Bacteria 14964
673 Ga0209050_1011581 3300025298 Bacteria 4158
674 Ga0209050_1024573 3300025298 Bacteria 2079
675 Ga0209050_1029763 3300025298 Bacteria 1737
676 Ga0209256_1000001 3300025299 Bacteria 2166974
677 Ga0209256_1000050 3300025299 Bacteria 308622
678 Ga0209256_1000063 3300025299 Bacteria 252716
679 Ga0209256_1000804 3300025299 Bacteria 40181
680 Ga0209256_1001280 3300025299 Bacteria 27204
681 Ga0209256_1035621 3300025299 Bacteria 1313
682 Ga0207426_1000001 3300025302 Bacteria 1341301
683 Ga0207426_1000025 3300025302 Bacteria 532921
684 Ga0207426_1000028 3300025302 Bacteria 483955
685 Ga0207426_1000050 3300025302 Bacteria 393022
686 Ga0209051_1000002 3300025303 Bacteria 1631846
687 Ga0209051_1000003 3300025303 Bacteria 1609245
688 Ga0209051_1000471 3300025303 Bacteria 52463
689 Ga0209051_1000653 3300025303 Bacteria 39211
690 Ga0209051_1000868 3300025303 Bacteria 30598
691 Ga0209051_1005176 3300025303 Bacteria 7726
692 Ga0209051_1033026 3300025303 Bacteria 1963
693 Ga0209051_1038832 3300025303 Bacteria 1728
694 Ga0209051_1051899 3300025303 Bacteria 1360
695 Ga0209257_1000002 3300025304 Bacteria 1767052
696 Ga0209257_1000018 3300025304 Bacteria 836016
697 Ga0209257_1000333 3300025304 Bacteria 98599
698 Ga0209257_1001358 3300025304 Bacteria 29602
699 Ga0209257_1011611 3300025304 Bacteria 4213
700 Ga0209257_1024648 3300025304 Bacteria 2077
701 Ga0207697_10002378 3300025315 Bacteria 9799
702 Ga0207697_10020586 3300025315 Bacteria 2700
703 Ga0207656_10000643 3300025321 Bacteria 11407
704 Ga0207656_10020269 3300025321 Bacteria 2641
705 Ga0207656_10098013 3300025321 Bacteria 1340
706 Ga0207655_1001500 3300025728 Bacteria 21323
707 Ga0207713_1001321 3300025735 Bacteria 20334
708 Ga0207713_1044765 3300025735 Bacteria 1814
709 Ga0207682_10003666 3300025893 Bacteria 6627
710 Ga0207692_10182444 3300025898 Bacteria 1223
711 Ga0207642_10003514 3300025899 Bacteria 4957
712 Ga0207642_10038886 3300025899 Bacteria 2062
713 Ga0207688_10012507 3300025901 Bacteria 4619
714 Ga0207680_10010960 3300025903 Bacteria 4558
715 Ga0207647_10014923 3300025904 Bacteria 5339
716 Ga0207645_10001135 3300025907 Bacteria 22045
717 Ga0207645_10007822 3300025907 Bacteria 7517
718 Ga0207645_10017063 3300025907 Bacteria 4797
719 Ga0207645_10053658 3300025907 Bacteria 2576
720 Ga0207645_10113351 3300025907 Bacteria 1756
721 Ga0207643_10019545 3300025908 Bacteria 3713
722 Ga0207705_10018161 3300025909 Bacteria 5028
723 Ga0207684_10131874 3300025910 Bacteria 2145
724 Ga0207684_10277967 3300025910 Bacteria 1444
725 Ga0207684_10479346 3300025910 Bacteria 1067
726 Ga0207695_10001505 3300025913 Bacteria 38722
727 Ga0207695_10006633 3300025913 Bacteria 14949
728 Ga0207695_10008251 3300025913 Bacteria 13072
729 Ga0207695_10029238 3300025913 Bacteria 6095
730 Ga0207695_10030526 3300025913 Bacteria 5932
731 Ga0207695_10039904 3300025913 Bacteria 5041
732 Ga0207695_10084680 3300025913 Bacteria 3201
733 Ga0207695_10163830 3300025913 Bacteria 2153
734 Ga0207695_10311798 3300025913 Bacteria 1463
735 Ga0207695_10405949 3300025913 Bacteria 1247
736 Ga0207671_10004003 3300025914 Bacteria 14317
737 Ga0207671_10009919 3300025914 Bacteria 7915
738 Ga0207671_10026658 3300025914 Bacteria 4327
739 Ga0207660_10036117 3300025917 Bacteria 3435
740 Ga0207660_10037492 3300025917 Bacteria 3379
741 Ga0207660_10126285 3300025917 Bacteria 1943
742 Ga0207660_10164733 3300025917 Bacteria 1713
743 Ga0207662_10064263 3300025918 Bacteria 2208
744 Ga0207662_10190480 3300025918 Bacteria 1323
745 Ga0207657_10020709 3300025919 Bacteria 6208
746 Ga0207657_10073322 3300025919 Bacteria 2893
747 Ga0207657_10378386 3300025919 Bacteria 1115
748 Ga0207649_10013461 3300025920 Bacteria 4567
749 Ga0207649_10029598 3300025920 Bacteria 3235
750 Ga0207649_10056277 3300025920 Bacteria 2455
751 Ga0207649_10068702 3300025920 Bacteria 2254
752 Ga0207652_10015548 3300025921 Bacteria 6190
753 Ga0207652_10068117 3300025921 Bacteria 3087
754 Ga0207652_10075901 3300025921 Bacteria 2930
755 Ga0207652_10137247 3300025921 Bacteria 2185
756 Ga0207646_10121103 3300025922 Bacteria 2351
757 Ga0207681_10000793 3300025923 Bacteria 20836
758 Ga0207681_10002665 3300025923 Bacteria 11317
759 Ga0207681_10224062 3300025923 Bacteria 1456
760 Ga0207681_10395454 3300025923 Bacteria 1115
761 Ga0207694_10000207 3300025924 Bacteria 58059
762 Ga0207694_10022635 3300025924 Bacteria 4768
763 Ga0207694_10069738 3300025924 Bacteria 2747
764 Ga0207694_10120675 3300025924 Bacteria 2093
765 Ga0207694_10334054 3300025924 Bacteria 1252
766 Ga0207694_10400193 3300025924 Bacteria 1142
767 Ga0207650_10001429 3300025925 Bacteria 17220
768 Ga0207650_10185806 3300025925 Bacteria 1658
769 Ga0207650_10380644 3300025925 Bacteria 1165
770 Ga0207659_10021910 3300025926 Bacteria 4249
771 Ga0207659_10027526 3300025926 Bacteria 3850
772 Ga0207659_10078376 3300025926 Bacteria 2434
773 Ga0207659_10123770 3300025926 Bacteria 1985
774 Ga0207659_10178957 3300025926 Bacteria 1678
775 Ga0207687_10029646 3300025927 Bacteria 3682
776 Ga0207687_10035677 3300025927 Bacteria 3384
777 Ga0207687_10053889 3300025927 Bacteria 2812
778 Ga0207687_10067070 3300025927 Bacteria 2552
779 Ga0207687_10112874 3300025927 Bacteria 2020
780 Ga0207687_10124264 3300025927 Bacteria 1934
781 Ga0207687_10195877 3300025927 Bacteria 1576
782 Ga0207644_10003406 3300025931 Bacteria 10259
783 Ga0207644_10015176 3300025931 Bacteria 5168
784 Ga0207644_10162524 3300025931 Bacteria 1737
785 Ga0207690_10023271 3300025932 Bacteria 3865
786 Ga0207690_10057688 3300025932 Bacteria 2624
787 Ga0207690_10059063 3300025932 Bacteria 2597
788 Ga0207706_10009396 3300025933 Bacteria 8975
789 Ga0207706_10022480 3300025933 Bacteria 5659
790 Ga0207706_10075459 3300025933 Bacteria 2965
791 Ga0207706_10090343 3300025933 Bacteria 2693
792 Ga0207706_10110879 3300025933 Bacteria 2414
793 Ga0207686_10011111 3300025934 Bacteria 4921
794 Ga0207686_10024302 3300025934 Bacteria 3510
795 Ga0207686_10041020 3300025934 Bacteria 2819
796 Ga0207686_10133878 3300025934 Bacteria 1704
797 Ga0207709_10000684 3300025935 Bacteria 27353
798 Ga0207709_10001331 3300025935 Bacteria 17454
799 Ga0207709_10010515 3300025935 Bacteria 5095
800 Ga0207709_10012802 3300025935 Bacteria 4625
801 Ga0207709_10026682 3300025935 Bacteria 3320
802 Ga0207709_10040360 3300025935 Bacteria 2794
803 Ga0207709_10334856 3300025935 Bacteria 1137
804 Ga0207670_10049946 3300025936 Bacteria 2800
805 Ga0207670_10307838 3300025936 Bacteria 1242
806 Ga0207670_10540158 3300025936 Bacteria 951
807 Ga0207669_10006488 3300025937 Bacteria 5353
808 Ga0207704_10039248 3300025938 Bacteria 2755
809 Ga0207704_10044782 3300025938 Bacteria 2624
810 Ga0207704_10052843 3300025938 Bacteria 2465
811 Ga0207704_10064635 3300025938 Bacteria 2287
812 Ga0207704_10106398 3300025938 Bacteria 1884
813 Ga0207665_10185562 3300025939 Bacteria 1508
814 Ga0207691_10000973 3300025940 Bacteria 28494
815 Ga0207691_10001288 3300025940 Bacteria 25003
816 Ga0207691_10003133 3300025940 Bacteria 16161
817 Ga0207691_10005935 3300025940 Bacteria 11791
818 Ga0207691_10406246 3300025940 Bacteria 1161
819 Ga0207711_10012438 3300025941 Bacteria 7074
820 Ga0207711_10012450 3300025941 Bacteria 7070
821 Ga0207711_10069679 3300025941 Bacteria 3049
822 Ga0207711_10307326 3300025941 Bacteria 1463
823 Ga0207689_10000591 3300025942 Bacteria 34621
824 Ga0207689_10013054 3300025942 Bacteria 7094
825 Ga0207689_10019585 3300025942 Bacteria 5702
826 Ga0207689_10024609 3300025942 Bacteria 5049
827 Ga0207689_10051124 3300025942 Bacteria 3407
828 Ga0207689_10084343 3300025942 Bacteria 2612
829 Ga0207661_10029479 3300025944 Bacteria 4215
830 Ga0207679_10017656 3300025945 Bacteria 4764
831 Ga0207679_10053658 3300025945 Bacteria 2964
832 Ga0207679_10154175 3300025945 Bacteria 1874
833 Ga0207679_10593778 3300025945 Bacteria 997
834 Ga0207667_10002183 3300025949 Bacteria 24557
835 Ga0207667_10013188 3300025949 Bacteria 9474
836 Ga0207667_10017157 3300025949 Bacteria 8161
837 Ga0207667_10063697 3300025949 Bacteria 3852
838 Ga0207667_10063933 3300025949 Bacteria 3844
839 Ga0207667_10108543 3300025949 Bacteria 2863
840 Ga0207651_10004181 3300025960 Bacteria 7224
841 Ga0207651_10015790 3300025960 Bacteria 4400
842 Ga0207651_10088607 3300025960 Bacteria 2256
843 Ga0207651_10532444 3300025960 Bacteria 1019
844 Ga0207651_10541120 3300025960 Bacteria 1011
845 Ga0207712_10023222 3300025961 Bacteria 4091
846 Ga0207712_10133316 3300025961 Bacteria 1896
847 Ga0207712_10296309 3300025961 Bacteria 1325
848 Ga0207668_10027270 3300025972 Bacteria 3719
849 Ga0207668_10043298 3300025972 Bacteria 3054
850 Ga0207668_10065671 3300025972 Bacteria 2569
851 Ga0207640_10005404 3300025981 Bacteria 6965
852 Ga0207640_10027941 3300025981 Bacteria 3442
853 Ga0207640_10128730 3300025981 Bacteria 1826
854 Ga0207640_10133594 3300025981 Bacteria 1797
855 Ga0207658_10022892 3300025986 Bacteria 4354
856 Ga0207658_10037007 3300025986 Bacteria 3502
857 Ga0207658_10055388 3300025986 Bacteria 2938
858 Ga0207658_10170296 3300025986 Bacteria 1793
859 Ga0207658_10384393 3300025986 Bacteria 1230
860 Ga0207677_10019626 3300026023 Bacteria 4087
861 Ga0207677_10026789 3300026023 Bacteria 3620
862 Ga0207677_10185856 3300026023 Bacteria 1639
863 Ga0207677_10228816 3300026023 Bacteria 1496
864 Ga0207677_10266010 3300026023 Bacteria 1400
865 Ga0207703_10002400 3300026035 Bacteria 16286
866 Ga0207703_10046087 3300026035 Bacteria 3510
867 Ga0207639_10005602 3300026041 Bacteria 8497
868 Ga0207639_10132266 3300026041 Bacteria 2067
869 Ga0207639_10302799 3300026041 Bacteria 1414
870 Ga0207639_10469301 3300026041 Bacteria 1145
871 Ga0207639_10628078 3300026041 Bacteria 992
872 Ga0207678_10014575 3300026067 Bacteria 6917
873 Ga0207678_10063186 3300026067 Bacteria 3182
874 Ga0207678_10152644 3300026067 Bacteria 1972
875 Ga0207678_10309787 3300026067 Bacteria 1357
876 Ga0207708_10005823 3300026075 Bacteria 9117
877 Ga0207708_10013196 3300026075 Bacteria 6169
878 Ga0207702_10001439 3300026078 Bacteria 23650
879 Ga0207702_10093495 3300026078 Bacteria 2637
880 Ga0207702_10176941 3300026078 Bacteria 1961
881 Ga0207641_10003472 3300026088 Bacteria 13960
882 Ga0207641_10006729 3300026088 Bacteria 9631
883 Ga0207641_10193440 3300026088 Bacteria 1871
884 Ga0207648_10002124 3300026089 Bacteria 21566
885 Ga0207648_10006556 3300026089 Bacteria 11561
886 Ga0207648_10011202 3300026089 Bacteria 8454
887 Ga0207648_10109510 3300026089 Bacteria 2425
888 Ga0207648_10126629 3300026089 Bacteria 2247
889 Ga0207648_10135160 3300026089 Bacteria 2172
890 Ga0207648_10173204 3300026089 Bacteria 1908
891 Ga0207676_10006970 3300026095 Bacteria 8010
892 Ga0207676_10035437 3300026095 Bacteria 3787
893 Ga0207676_10205549 3300026095 Bacteria 1743
894 Ga0207674_10005404 3300026116 Bacteria 15190
895 Ga0207674_10011591 3300026116 Bacteria 9901
896 Ga0207674_10013504 3300026116 Bacteria 9056
897 Ga0207674_10019948 3300026116 Bacteria 7254
898 Ga0207674_10034569 3300026116 Bacteria 5281
899 Ga0207674_10085480 3300026116 Bacteria 3150
900 Ga0207674_10120677 3300026116 Bacteria 2589
901 Ga0207675_100000138 3300026118 Bacteria 62372
902 Ga0207675_100147211 3300026118 Bacteria 2240
903 Ga0207683_10000520 3300026121 Bacteria 35614
904 Ga0207683_10006544 3300026121 Bacteria 9978
905 Ga0207683_10070843 3300026121 Bacteria 3081
906 Ga0207683_10072389 3300026121 Bacteria 3048
907 Ga0207683_10091702 3300026121 Bacteria 2707
908 Ga0207683_10318365 3300026121 Bacteria 1425
909 Ga0207683_10519571 3300026121 Bacteria 1100
910 Ga0207698_10017736 3300026142 Bacteria 4838
911 Ga0207698_10018165 3300026142 Bacteria 4786
912 Ga0207698_10046884 3300026142 Bacteria 3268
913 Ga0207698_10323058 3300026142 Bacteria 1446
914 Ga0209970_1006899 3300027614 Bacteria 1864
915 Ga0209282_1000045 3300027666 Bacteria 118401
916 Ga0209282_1001910 3300027666 Bacteria 11760
917 Ga0209282_1154304 3300027666 Bacteria 1105
918 Ga0209588_1022047 3300027671 Bacteria 2004
919 Ga0209588_1039580 3300027671 Bacteria 1520
920 Ga0209813_10006509 3300027866 Bacteria 2889
921 Ga0207428_10191856 3300027907 Bacteria 1540
922 Ga0268266_10029677 3300028379 Bacteria 4647
923 Ga0268266_10122024 3300028379 Bacteria 2320
924 Ga0268266_10194168 3300028379 Bacteria 1855
925 Ga0268266_10222027 3300028379 Bacteria 1737
926 Ga0268266_10387456 3300028379 Bacteria 1319
927 Ga0268265_10005157 3300028380 Bacteria 8946
928 Ga0268265_10204842 3300028380 Bacteria 1714
929 Ga0268264_10045892 3300028381 Bacteria 3629
930 Ga0268264_10052991 3300028381 Bacteria 3384
931 Ga0268264_10056049 3300028381 Bacteria 3294
932 Ga0268264_10268348 3300028381 Bacteria 1593
933 Ga0307517_10000228 3300028786 Bacteria 94852
934 Ga0307517_10070147 3300028786 Bacteria 3162
935 Ga0307517_10172646 3300028786 Bacteria 1417
936 Ga0307515_10000013 3300028794 Bacteria 568456
937 Ga0307515_10000037 3300028794 Bacteria 331970
938 Ga0307515_10000428 3300028794 Bacteria 101247
939 Ga0307515_10006133 3300028794 Bacteria 24177
940 Ga0307515_10009239 3300028794 Bacteria 19087
941 Ga0307515_10016260 3300028794 Bacteria 13636
942 Ga0307515_10029046 3300028794 Bacteria 9368
943 Ga0307515_10224608 3300028794 Bacteria 1686
944 Ga0265338_10000022 3300028800 Bacteria 308414
945 Ga0265338_10000281 3300028800 Bacteria 91847
946 Ga0307511_10000671 3300030521 Bacteria 36432
947 Ga0307512_10028786 3300030522 Bacteria 4863
948 Ga0316177_1157730 3300030731 Bacteria 3153
949 Ga0314311_1139236 3300030733 Bacteria 10237
950 Ga0316180_1015378 3300030736 Bacteria 1607
951 Ga0316183_1110270 3300030742 Bacteria 1296
952 Ga0316181_1005389 3300030744 Bacteria 3102
953 Ga0316182_1383921 3300030745 Bacteria 2426
954 Ga0265327_10000689 3300031251 Bacteria 54050
955 Ga0265327_10050387 3300031251 Bacteria 2179
956 Ga0265327_10098071 3300031251 Bacteria 1419
957 Ga0307513_10000010 3300031456 Bacteria 360812
958 Ga0307513_10000121 3300031456 Bacteria 109551
959 Ga0307513_10014924 3300031456 Bacteria 9439
960 Ga0307513_10019112 3300031456 Bacteria 8166
961 Ga0307509_10000426 3300031507 Bacteria 70899
962 Ga0307509_10044488 3300031507 Bacteria 4797
963 Ga0307509_10078868 3300031507 Bacteria 3410
964 Ga0307509_10081835 3300031507 Bacteria 3333
965 Ga0307509_10098023 3300031507 Bacteria 2978
966 Ga0307509_10143290 3300031507 Bacteria 2320
967 Ga0307509_10424653 3300031507 Bacteria 1029
968 Ga0307408_100010028 3300031548 Bacteria 6243
969 Ga0307408_100051176 3300031548 Bacteria 2974
970 Ga0307408_100117334 3300031548 Bacteria 2055
971 Ga0307408_100118412 3300031548 Bacteria 2047
972 Ga0307408_100127321 3300031548 Bacteria 1982
973 Ga0307408_100284214 3300031548 Bacteria 1379
974 Ga0307408_100463756 3300031548 Bacteria 1101
975 Ga0307408_100563380 3300031548 Bacteria 1007
976 Ga0307508_10000096 3300031616 Bacteria 103730
977 Ga0307508_10000273 3300031616 Bacteria 63550
978 Ga0307508_10003742 3300031616 Bacteria 15206
979 Ga0307508_10070041 3300031616 Bacteria 3079
980 Ga0307514_10001887 3300031649 Bacteria 23094
981 Ga0307514_10049636 3300031649 Bacteria 3262
982 Ga0307514_10069075 3300031649 Bacteria 2660
983 Ga0265314_10030091 3300031711 Bacteria 4024
984 Ga0265342_10046019 3300031712 Bacteria 2624
985 Ga0307516_10002590 3300031730 Bacteria 24022
986 Ga0307516_10003708 3300031730 Bacteria 19431
987 Ga0307516_10007835 3300031730 Bacteria 12183
988 Ga0307516_10014241 3300031730 Bacteria 8424
989 Ga0307516_10104851 3300031730 Bacteria 2639
990 Ga0307516_10318387 3300031730 Bacteria 1227
991 Ga0307405_10002872 3300031731 Bacteria 7745
992 Ga0307405_10016578 3300031731 Bacteria 4020
993 Ga0307405_10068124 3300031731 Bacteria 2276
994 Ga0307405_10400363 3300031731 Bacteria 1074
995 Ga0307518_10236745 3300031838 Bacteria 1176
996 Ga0307410_10006084 3300031852 Bacteria 6471
997 Ga0307410_10117073 3300031852 Bacteria 1937
998 Ga0307406_10005443 3300031901 Bacteria 6966
999 Ga0307406_10055913 3300031901 Bacteria 2524
1000 Ga0307406_10181417 3300031901 Bacteria 1533
1001 Ga0307407_10033949 3300031903 Bacteria 2788
1002 Ga0307412_10001959 3300031911 Bacteria 11395
1003 Ga0307412_10009352 3300031911 Bacteria 5621
1004 Ga0307412_10017384 3300031911 Bacteria 4304
1005 Ga0307412_10146700 3300031911 Bacteria 1735
1006 Ga0307412_10473196 3300031911 Bacteria 1037
1007 Ga0307409_100099675 3300031995 Bacteria 2406
1008 Ga0307409_100506732 3300031995 Bacteria 1176
1009 Ga0307416_100002887 3300032002 Bacteria 10015
1010 Ga0307416_100007370 3300032002 Bacteria 6989
1011 Ga0307416_100060673 3300032002 Bacteria 3082
1012 Ga0307416_100089116 3300032002 Bacteria 2640
1013 Ga0307416_100464400 3300032002 Bacteria 1322
1014 Ga0307414_10008727 3300032004 Bacteria 5776
1015 Ga0307411_10019230 3300032005 Bacteria 3941
1016 Ga0307411_10239023 3300032005 Bacteria 1420
1017 Ga0307415_100004219 3300032126 Bacteria 7426
1018 Ga0307415_100191188 3300032126 Bacteria 1615
1019 Ga0307507_10079515 3300033179 Bacteria 2897
1020 Ga0307507_10094219 3300033179 Bacteria 2547
1021 Ga0307510_10000088 3300033180 Bacteria 69071
1022 Ga0307510_10000967 3300033180 Bacteria 30417
1023 Ga0307510_10103592 3300033180 Bacteria 2622
1024 Ga0373938_0007458 3300034957 Bacteria 1925
1025 Ga0373934_0016737 3300035086 Bacteria 2789
1026 Ga0373944_0040673 3300035089 Bacteria 1436
1027 Ga0373952_0050698 3300035092 Bacteria 989
1028 Ga0373939_0005037 3300035114 Bacteria 3140
1029 Ga0373953_0130583 3300035117 Bacteria 1071
1030 Ga0373955_0015132 3300035172 Bacteria 3770
1031 Ga0373955_0029829 3300035172 Bacteria 2841
1032 Ga0373924_0104364 3300035410 Bacteria 1221
1033 Ga0373931_0000719 3300035691 Bacteria 13733
1034 Ga0373931_0108854 3300035691 Bacteria 1569
1035 Ga0373931_0214130 3300035691 Bacteria 1157
1036 Ga0373935_0131175 3300035692 Bacteria 1684
1037 Ga0373947_0043204 3300035725 Bacteria 2692
1038 Ga0373937_0025212 3300036401 Bacteria 5369
1039 Ga0373937_0097776 3300036401 Bacteria 2723
1040 Ga0373925_0059226 3300037068 Bacteria 2873
1041 Ga0373925_0077689 3300037068 Bacteria 2520
1042 Ga0373925_0217678 3300037068 Bacteria 1523
1043 Ga0373925_0539505 3300037068 Bacteria 959
1044 Ga0395899_0003004 3300037312 Bacteria 13478
1045 Ga0395899_0003834 3300037312 Bacteria 11864
1046 Ga0395899_0023766 3300037312 Bacteria 4638
1047 Ga0395899_0042037 3300037312 Bacteria 3413
1048 Ga0395899_0188340 3300037312 Bacteria 1445
1049 Ga0395900_0003666 3300037418 Bacteria 16510
1050 Ga0395900_0012705 3300037418 Bacteria 8603
1051 Ga0395900_0027220 3300037418 Bacteria 5855
1052 Ga0395900_0032723 3300037418 Bacteria 5348
1053 Ga0395900_0035522 3300037418 Bacteria 5133
1054 Ga0395900_0066108 3300037418 Bacteria 3716
1055 Ga0395900_0132453 3300037418 Bacteria 2554
1056 Ga0395900_0135443 3300037418 Bacteria 2523
1057 Ga0395900_0468270 3300037418 Bacteria 1214
1058 Ga0395898_0002485 3300037466 Bacteria 21682
1059 Ga0395898_0006527 3300037466 Bacteria 12459
1060 Ga0395898_0036335 3300037466 Bacteria 4891
1061 Ga0395898_0213390 3300037466 Bacteria 1841
1062 Ga0395898_0261930 3300037466 Bacteria 1649
1063 Ga0395905_0000041 3300037471 Bacteria 250958
1064 Ga0395905_0000766 3300037471 Bacteria 42342
1065 Ga0395905_0001291 3300037471 Bacteria 30780
1066 Ga0395905_0001867 3300037471 Bacteria 24262
1067 Ga0395905_0002404 3300037471 Bacteria 20821
1068 Ga0395905_0006699 3300037471 Bacteria 11542
1069 Ga0395905_0016311 3300037471 Bacteria 7059
1070 Ga0395905_0022080 3300037471 Bacteria 6020
1071 Ga0395905_0087687 3300037471 Bacteria 2917
1072 Ga0395905_0240311 3300037471 Bacteria 1692
1073 Ga0395905_0333913 3300037471 Bacteria 1406
1074 Ga0395905_0429056 3300037471 Bacteria 1218
1075 Ga0395905_0514960 3300037471 Bacteria 1097
1076 Ga0436364_1452872 3300037853 Bacteria 1565
1077 Ga0395901_0119273 3300038443 Bacteria 2772
1078 Ga0395901_0164122 3300038443 Bacteria 2332
1079 Ga0395901_0196832 3300038443 Bacteria 2113
1080 Ga0436365_1069362 3300039437 Bacteria 2056
1081 Ga0436361_0263782 3300039447 Bacteria 4960
1082 Ga0436361_0706582 3300039447 Bacteria 17668
1083 Ga0439436_0000271 3300041404 Bacteria 12488
1084 Ga0439439_0008230 3300041406 Bacteria 2458
1085 Ga0439439_0022327 3300041406 Bacteria 1580
1086 Ga0439439_0024456 3300041406 Bacteria 1516
1087 Ga0439447_018176 3300041407 Bacteria 1901
1088 Ga0439465_0004740 3300041413 Bacteria 4381
1089 Ga0451795_0371926 3300041456 Bacteria 1198
1090 Ga0451807_2138912 3300041486 Bacteria 1632
1091 Ga0451839_1172444 3300041496 Bacteria 1038
1092 Ga0451841_0043643 3300041498 Bacteria 1297
1093 Ga0451853_3303108 3300041512 Bacteria 1521
1094 Ga0439431_0002491 3300041997 Bacteria 4075
1095 Ga0439441_005125 3300042001 Bacteria 2020
1096 Ga0439441_008564 3300042001 Bacteria 1674
1097 Ga0439442_007787 3300042002 Bacteria 2161
1098 Ga0439445_0000101 3300042004 Bacteria 14009
1099 Ga0439432_003935 3300042006 Bacteria 5462
1100 Ga0439449_0000836 3300042007 Bacteria 11922
1101 Ga0439449_0003108 3300042007 Bacteria 6468
1102 Ga0439449_0009194 3300042007 Bacteria 3745
1103 Ga0439452_001575 3300042010 Bacteria 9083
1104 Ga0439452_003824 3300042010 Bacteria 5171
1105 Ga0439457_004271 3300042014 Bacteria 3760
1106 Ga0439462_0005109 3300042015 Bacteria 3219
1107 Ga0450894_005633 3300042131 Bacteria 1622
1108 Ga0450889_007214 3300042144 Bacteria 1121
1109 Ga0439446_0002170 3300042156 Bacteria 4670
1110 Ga0450908_002671 3300042184 Bacteria 3487
1111 Ga0450909_002890 3300042185 Bacteria 2440
1112 Ga0439434_0001592 3300042435 Bacteria 6546
1113 Ga0439434_0002659 3300042435 Bacteria 5206
1114 Ga0439464_0017700 3300042439 Bacteria 1934
1115 Ga0439460_0045072 3300042461 Bacteria 1307
1116 Ga0450918_000258 3300042531 Bacteria 11913
1117 Ga0451577_0045661 3300042876 Bacteria 3921
1118 Ga0466969_0003266 3300044656 Bacteria 8619
1119 Ga0466969_0159489 3300044656 Bacteria 1037
1120 Ga0466972_0009395 3300044658 Bacteria 4913
1121 Ga0466977_0000064 3300044666 Bacteria 19913
1122 Ga0453683_0003262 3300044673 Bacteria 12057
1123 Ga0466966_0003451 3300044684 Bacteria 10419
1124 Ga0466961_0054667 3300044693 Bacteria 2546
1125 Ga0453684_0003387 3300044712 Bacteria 36051
1126 Ga0453684_0592183 3300044712 Bacteria 1216
1127 Ga0466970_0017755 3300044765 Bacteria 3679
1128 Ga0466970_0104668 3300044765 Bacteria 1543
1129 Ga0466957_0007962 3300044842 Bacteria 6013
1130 Ga0466957_0222836 3300044842 Bacteria 1246
1131 Ga0451576_0007232 3300045051 Bacteria 13370
1132 Ga0451576_0015307 3300045051 Bacteria 8501
1133 Ga0451576_0048014 3300045051 Bacteria 4486
1134 Ga0451576_0095976 3300045051 Bacteria 3084
1135 Ga0451576_0186369 3300045051 Bacteria 2167
1136 Ga0451576_0288095 3300045051 Bacteria 1717
1137 Ga0451576_0300925 3300045051 Bacteria 1678
1138 Ga0495592_0000307 3300046454 Bacteria 41229
1139 Ga0495592_0005284 3300046454 Bacteria 9518
1140 Ga0495590_0016152 3300046457 Bacteria 2698
1141 Ga0495590_0019964 3300046457 Bacteria 2383
1142 Ga0495629_0016193 3300046459 Bacteria 5352
1143 Ga0495638_0009369 3300046460 Bacteria 6884
1144 Ga0495638_0041320 3300046460 Bacteria 2918
1145 Ga0495638_0094762 3300046460 Bacteria 1794
1146 Ga0495651_0007788 3300046462 Bacteria 8195
1147 Ga0495651_0058881 3300046462 Bacteria 2947
1148 Ga0495651_0122775 3300046462 Bacteria 1905
1149 Ga0495653_0031899 3300046463 Bacteria 4186
1150 Ga0495653_0082601 3300046463 Bacteria 2371
1151 Ga0495650_0002401 3300046471 Bacteria 15286
1152 Ga0495650_0039741 3300046471 Bacteria 2027
1153 Ga0495580_0012377 3300046472 Bacteria 6542
1154 Ga0495580_0090482 3300046472 Bacteria 2130
1155 Ga0495605_0003271 3300046474 Bacteria 9720
1156 Ga0495605_0006415 3300046474 Bacteria 6768
1157 Ga0495605_0010207 3300046474 Bacteria 5259
1158 Ga0495639_0011603 3300046475 Bacteria 3801
1159 Ga0495662_0023350 3300046476 Bacteria 2986
1160 Ga0495584_0022556 3300046491 Bacteria 3193
1161 Ga0495585_0000600 3300046492 Bacteria 33658
1162 Ga0495585_0023825 3300046492 Bacteria 3512
1163 Ga0495596_0000531 3300046500 Bacteria 23934
1164 Ga0495596_0001392 3300046500 Bacteria 13894
1165 Ga0495607_0000104 3300046501 Bacteria 89641
1166 Ga0495607_0079164 3300046501 Bacteria 1811
1167 Ga0495583_0000068 3300046506 Bacteria 188922
1168 Ga0495583_0020770 3300046506 Bacteria 3391
1169 Ga0495606_0031176 3300046507 Bacteria 3710
1170 Ga0495606_0115978 3300046507 Bacteria 1609
1171 Ga0495608_0009037 3300046511 Bacteria 6971
1172 Ga0495608_0036970 3300046511 Bacteria 3284
1173 Ga0495608_0043811 3300046511 Bacteria 2989
1174 Ga0495608_0060615 3300046511 Bacteria 2489
1175 Ga0495610_0000402 3300046512 Bacteria 44548
1176 Ga0495610_0027502 3300046512 Bacteria 3021
1177 Ga0495610_0034215 3300046512 Bacteria 2619
1178 Ga0495616_0001588 3300046513 Bacteria 15594
1179 Ga0495618_0009013 3300046514 Bacteria 6020
1180 Ga0495618_0225602 3300046514 Bacteria 1181
1181 Ga0495620_0023629 3300046515 Bacteria 2936
1182 Ga0495620_0043753 3300046515 Bacteria 1949
1183 Ga0495628_0000094 3300046516 Bacteria 71069
1184 Ga0495628_0001686 3300046516 Bacteria 20158
1185 Ga0495628_0010603 3300046516 Bacteria 7819
1186 Ga0495630_0005175 3300046517 Bacteria 9190
1187 Ga0495630_0023999 3300046517 Bacteria 4509
1188 Ga0495630_0187311 3300046517 Bacteria 1579
1189 Ga0495631_0007349 3300046518 Bacteria 5608
1190 Ga0495632_0005817 3300046519 Bacteria 8077
1191 Ga0495632_0016163 3300046519 Bacteria 4159
1192 Ga0495644_0070785 3300046523 Bacteria 1310
1193 Ga0495648_0077652 3300046524 Bacteria 1902
1194 Ga0495642_0016179 3300046528 Bacteria 2906
1195 Ga0495642_0017986 3300046528 Bacteria 2764
1196 Ga0495642_0080640 3300046528 Bacteria 1370
1197 Ga0495652_0053180 3300046529 Bacteria 3452
1198 Ga0495652_0071724 3300046529 Bacteria 2889
1199 Ga0495652_0151060 3300046529 Bacteria 1815
1200 Ga0495652_0282927 3300046529 Bacteria 1213
1201 Ga0495654_0001128 3300046530 Bacteria 19241
1202 Ga0495654_0024039 3300046530 Bacteria 3151
1203 Ga0495640_0003973 3300046533 Bacteria 11833
1204 Ga0495586_0002666 3300046535 Bacteria 9649
1205 Ga0495587_0032496 3300046536 Bacteria 3155
1206 Ga0495609_0005608 3300046538 Bacteria 6544
1207 Ga0495621_0042632 3300046539 Bacteria 1598
1208 Ga0495621_0053686 3300046539 Bacteria 1447
1209 Ga0495597_0004406 3300046542 Bacteria 7745
1210 Ga0495597_0028022 3300046542 Bacteria 2580
1211 Ga0495645_0004283 3300046543 Bacteria 9748
1212 Ga0495645_0018404 3300046543 Bacteria 5015
1213 Ga0495645_0097404 3300046543 Bacteria 2095
1214 Ga0495645_0163979 3300046543 Bacteria 1534
1215 Ga0495622_0123567 3300046557 Bacteria 1181
1216 Ga0495667_0016481 3300046559 Bacteria 4992
1217 Ga0495667_0220772 3300046559 Bacteria 1210
1218 Ga0495656_0006029 3300046615 Bacteria 4222
1219 Ga0495656_0075661 3300046615 Bacteria 1507
1220 Ga0495668_0027061 3300046616 Bacteria 3250
1221 Ga0495611_0008098 3300046648 Bacteria 4459
1222 Ga0495611_0205991 3300046648 Bacteria 916
1223 Ga0495625_0000811 3300046660 Bacteria 43302
1224 Ga0495625_0002034 3300046660 Bacteria 22774
1225 Ga0495625_0002147 3300046660 Bacteria 21938
1226 Ga0495625_0013100 3300046660 Bacteria 6680
1227 Ga0495625_0083948 3300046660 Bacteria 2213
1228 Ga0495625_0147508 3300046660 Bacteria 1583
1229 Ga0495661_0028289 3300046665 Bacteria 3589
1230 Ga0495661_0037991 3300046665 Bacteria 3003
1231 Ga0495661_0118774 3300046665 Bacteria 1463
1232 Ga0495588_0025415 3300046674 Bacteria 2950
1233 Ga0495588_0058570 3300046674 Bacteria 1991
1234 Ga0495588_0134792 3300046674 Bacteria 1303
1235 Ga0495657_0134798 3300046675 Bacteria 1544
1236 Ga0495599_0002663 3300046678 Bacteria 10417
1237 Ga0495599_0007337 3300046678 Bacteria 6683
1238 Ga0495599_0007691 3300046678 Bacteria 6547
1239 Ga0495623_0015463 3300046679 Bacteria 4934
1240 Ga0495623_0021980 3300046679 Bacteria 4120
1241 Ga0495623_0069969 3300046679 Bacteria 2186
1242 Ga0495646_0101850 3300046680 Bacteria 1645
1243 Ga0495658_0017838 3300046683 Bacteria 3677
1244 Ga0495658_0124256 3300046683 Bacteria 1564
1245 Ga0495613_0035150 3300046689 Bacteria 3720
1246 Ga0495671_0000949 3300046692 Bacteria 20400
1247 Ga0495671_0003079 3300046692 Bacteria 10361
1248 Ga0495671_0051467 3300046692 Bacteria 2048
1249 Ga0495671_0116445 3300046692 Bacteria 1305
1250 Ga0495649_0000902 3300046694 Bacteria 23546
1251 Ga0495649_0019136 3300046694 Bacteria 3848
1252 Ga0495649_0054994 3300046694 Bacteria 2151
1253 Ga0495600_0000395 3300046809 Bacteria 22545
1254 Ga0495660_0151431 3300046810 Bacteria 1145
1255 Ga0495604_0005126 3300047317 Bacteria 10368
1256 Ga0495636_0028531 3300047318 Bacteria 2277
1257 Ga0495674_0001417 3300047319 Bacteria 23473
1258 Ga0495674_0021472 3300047319 Bacteria 5972
1259 Ga0495674_0153891 3300047319 Bacteria 1927
1260 Ga0495672_0024306 3300047320 Bacteria 3906
1261 Ga0495676_0053294 3300047321 Bacteria 3224
1262 Ga0495676_0114514 3300047321 Bacteria 1973
1263 Ga0495680_0004617 3300047322 Bacteria 13122
1264 Ga0495683_0036120 3300047323 Bacteria 2509
1265 Ga0495687_000330 3300047443 Bacteria 60838
1266 Ga0495687_003745 3300047443 Bacteria 10759
1267 Ga0495687_007018 3300047443 Bacteria 6755
1268 Ga0495687_008919 3300047443 Bacteria 5678
1269 Ga0495679_000094 3300047446 Bacteria 81416
1270 Ga0495673_0010894 3300047469 Bacteria 4919
1271 Ga0495673_0011584 3300047469 Bacteria 4732
1272 Ga0495684_0039710 3300047471 Bacteria 3608
1273 Ga0495684_0291632 3300047471 Bacteria 1174
1274 Ga0495686_0080473 3300047472 Bacteria 1991
1275 Ga0495686_0114885 3300047472 Bacteria 1610
1276 Ga0495593_0007103 3300047673 Bacteria 6565
1277 Ga0495593_0036853 3300047673 Bacteria 2649
1278 Ga0495602_0094606 3300048088 Bacteria 2468
1279 Ga0495614_0115970 3300048089 Bacteria 1178
1280 Ga0495615_0013150 3300048090 Bacteria 1724
1281 Ga0495626_0004972 3300048091 Bacteria 7959
1282 Ga0495626_0072964 3300048091 Bacteria 1538
1283 Ga0496100_0003901 3300048903 Bacteria 7832
1284 Ga0496100_0030272 3300048903 Bacteria 3356
1285 Ga0496101_0001350 3300048904 Bacteria 14712
1286 Ga0496101_0002565 3300048904 Bacteria 11148
1287 Ga0496101_0076323 3300048904 Bacteria 2468
1288 Ga0496102_0000863 3300048905 Bacteria 29024
1289 Ga0496102_0002579 3300048905 Bacteria 15452
1290 Ga0496102_0045016 3300048905 Bacteria 4005
1291 Ga0496103_0001427 3300048906 Bacteria 16015
1292 Ga0496103_0041940 3300048906 Bacteria 2814
1293 Ga0496103_0057061 3300048906 Bacteria 2424
1294 Ga0496103_0208958 3300048906 Bacteria 1255
1295 Ga0496104_0022955 3300048907 Bacteria 5734
1296 Ga0496104_0046945 3300048907 Bacteria 4069
1297 Ga0496104_0169712 3300048907 Bacteria 2092
1298 Ga0496104_0335815 3300048907 Bacteria 1424
1299 Ga0496104_0480170 3300048907 Bacteria 1154
1300 Ga0496105_0003513 3300048908 Bacteria 11613
1301 Ga0496105_0008623 3300048908 Bacteria 7926
1302 Ga0496105_0059239 3300048908 Bacteria 3160
1303 Ga0496106_0004306 3300048909 Bacteria 10570
1304 Ga0496106_0006498 3300048909 Bacteria 8658
1305 Ga0496106_0052015 3300048909 Bacteria 3089
1306 Ga0496106_0094112 3300048909 Bacteria 2316
1307 Ga0496107_0010565 3300048910 Bacteria 6418
1308 Ga0496107_0386226 3300048910 Bacteria 1041
1309 Ga0496108_0236644 3300048911 Bacteria 1588
1310 Ga0496109_0004487 3300048912 Bacteria 11665
1311 Ga0496109_0677770 3300048912 Bacteria 968
1312 Ga0496110_0024210 3300048913 Bacteria 5171
1313 Ga0496110_0048777 3300048913 Bacteria 3712
1314 Ga0496110_0209482 3300048913 Bacteria 1772
1315 Ga0496111_0040125 3300048914 Bacteria 3357
1316 Ga0496112_0001203 3300048915 Bacteria 19412
1317 Ga0496113_0041941 3300048916 Bacteria 3379
1318 Ga0496113_0044410 3300048916 Bacteria 3292
1319 Ga0496113_0046906 3300048916 Bacteria 3209
1320 Ga0496113_0459545 3300048916 Bacteria 1023
1321 Ga0496114_0089693 3300048917 Bacteria 2609
1322 Ga0496114_0134655 3300048917 Bacteria 2136
1323 Ga0496114_0236300 3300048917 Bacteria 1606
1324 Ga0496115_0003898 3300048918 Bacteria 10750
1325 Ga0496116_0003609 3300048919 Bacteria 15226
1326 Ga0496116_0011291 3300048919 Bacteria 7411
1327 Ga0496116_0013523 3300048919 Bacteria 6571
1328 Ga0496116_0015998 3300048919 Bacteria 5897
1329 Ga0496116_0020876 3300048919 Bacteria 4958
1330 Ga0496116_0066795 3300048919 Bacteria 2300
1331 Ga0496117_0002329 3300048920 Bacteria 24307
1332 Ga0496117_0012972 3300048920 Bacteria 7298
1333 Ga0496117_0023493 3300048920 Bacteria 4909
1334 Ga0496117_0122537 3300048920 Bacteria 1594
1335 Ga0496118_0005797 3300048921 Bacteria 13855
1336 Ga0496118_0006085 3300048921 Bacteria 13425
1337 Ga0496118_0022991 3300048921 Bacteria 5428
1338 Ga0496118_0025287 3300048921 Bacteria 5097
1339 Ga0496118_0040421 3300048921 Bacteria 3708
1340 Ga0496119_0008405 3300048922 Bacteria 9069
1341 Ga0496119_0077189 3300048922 Bacteria 1930
1342 Ga0496119_0087501 3300048922 Bacteria 1778
1343 Ga0496120_0003056 3300048923 Bacteria 15793
1344 Ga0496120_0140458 3300048923 Bacteria 1227
1345 Ga0496121_0000140 3300048924 Bacteria 162689
1346 Ga0496121_0000694 3300048924 Bacteria 62818
1347 Ga0496121_0005950 3300048924 Bacteria 15421
1348 Ga0496121_0023470 3300048924 Bacteria 5939
1349 Ga0496121_0026586 3300048924 Bacteria 5446
1350 Ga0496121_0031014 3300048924 Bacteria 4897
1351 Ga0496121_0036546 3300048924 Bacteria 4376
1352 Ga0496121_0182840 3300048924 Bacteria 1511
1353 Ga0496122_0000227 3300048925 Bacteria 125743
1354 Ga0496122_0001089 3300048925 Bacteria 47126
1355 Ga0496122_0001677 3300048925 Bacteria 34347
1356 Ga0496122_0002020 3300048925 Bacteria 30158
1357 Ga0496122_0146954 3300048925 Bacteria 1463
1358 Ga0496123_0000141 3300048926 Bacteria 147111
1359 Ga0496123_0000265 3300048926 Bacteria 104723
1360 Ga0496123_0000826 3300048926 Bacteria 49740
1361 Ga0496123_0028714 3300048926 Bacteria 4111
1362 Ga0496124_0017865 3300048927 Bacteria 6667
1363 Ga0496124_0042725 3300048927 Bacteria 3901
1364 Ga0496124_0070406 3300048927 Bacteria 2901
1365 Ga0496124_0070752 3300048927 Bacteria 2893
1366 Ga0496124_0080196 3300048927 Bacteria 2686
1367 Ga0496124_0169278 3300048927 Bacteria 1694
1368 Ga0496125_0000190 3300048928 Bacteria 132540
1369 Ga0496125_0004085 3300048928 Bacteria 17079
1370 Ga0496125_0036252 3300048928 Bacteria 4310
1371 Ga0496125_0113381 3300048928 Bacteria 1956
1372 Ga0496126_0015524 3300048929 Bacteria 7656
1373 Ga0496126_0083485 3300048929 Bacteria 2820
1374 Ga0495678_011176 3300049459 Bacteria 4315
1375 Ga0495678_023409 3300049459 Bacteria 2684
1376 Ga0501031_0002275 3300049568 Bacteria 12168
1377 Ga0501031_0013733 3300049568 Bacteria 5279
1378 Ga0501031_0245625 3300049568 Bacteria 1163
1379 Ga0501032_0008003 3300049569 Bacteria 7705
1380 Ga0501032_0206696 3300049569 Bacteria 1281
1381 Ga0501033_0000561 3300049570 Bacteria 34537
1382 Ga0501033_0033574 3300049570 Bacteria 3853
1383 Ga0501034_0000530 3300049571 Bacteria 60898
1384 Ga0501034_0021788 3300049571 Bacteria 6529
1385 Ga0501034_0070473 3300049571 Bacteria 3507
1386 Ga0501034_0078178 3300049571 Bacteria 3313
1387 Ga0501034_0116453 3300049571 Bacteria 2660
1388 Ga0501034_0117453 3300049571 Bacteria 2647
1389 Ga0501034_0139003 3300049571 Bacteria 2409
1390 Ga0501034_0642255 3300049571 Bacteria 964
1391 Ga0501036_0002030 3300049572 Bacteria 15759
1392 Ga0501036_0150387 3300049572 Bacteria 1964
1393 Ga0501037_0001491 3300049573 Bacteria 17103
1394 Ga0501037_0060230 3300049573 Bacteria 2769
1395 Ga0501038_0002799 3300049574 Bacteria 16238
1396 Ga0501038_0045659 3300049574 Bacteria 3802
1397 Ga0501038_0111840 3300049574 Bacteria 2262
1398 Ga0501039_0015640 3300049575 Bacteria 5807
1399 Ga0501041_0099466 3300049577 Bacteria 1799
1400 Ga0501043_0015551 3300049579 Bacteria 5963
1401 Ga0501046_0008826 3300049580 Bacteria 8756
1402 Ga0501046_0031581 3300049580 Bacteria 4291
1403 Ga0501046_0043246 3300049580 Bacteria 3587
1404 Ga0501047_0016207 3300049581 Bacteria 7111
1405 Ga0501047_0048942 3300049581 Bacteria 4081
1406 Ga0501047_0199893 3300049581 Bacteria 1860
1407 Ga0501067_0087511 3300049583 Bacteria 1729
1408 Ga0501070_0116211 3300049586 Bacteria 2209
1409 Ga0501071_0001109 3300049587 Bacteria 15021
1410 Ga0501072_0004585 3300049588 Bacteria 10519
1411 Ga0501073_0013789 3300049589 Bacteria 5876
1412 Ga0501075_0036646 3300049591 Bacteria 3661
1413 Ga0501076_0000902 3300049592 Bacteria 19332
1414 Ga0501246_002775 3300049676 Bacteria 1390
1415 Ga0501225_0015135 3300049705 Bacteria 2151
1416 Ga0501079_0029789 3300049741 Bacteria 4192
1417 Ga0501083_0020137 3300049744 Bacteria 4642
1418 Ga0501083_0144163 3300049744 Bacteria 1559
1419 Ga0501241_009979 3300049758 Bacteria 1727
1420 Ga0501262_000181 3300049759 Bacteria 7854
1421 Ga0501262_002123 3300049759 Bacteria 2243
1422 Ga0501035_0002736 3300049822 Bacteria 17098
1423 Ga0501035_0015212 3300049822 Bacteria 7102
1424 Ga0501035_0022017 3300049822 Bacteria 5855
1425 Ga0501044_0001803 3300049823 Bacteria 24994
1426 Ga0501044_0002507 3300049823 Bacteria 20937
1427 Ga0501044_0003761 3300049823 Bacteria 17052
1428 Ga0501044_0061861 3300049823 Bacteria 3829
1429 Ga0501044_0178955 3300049823 Bacteria 2088
1430 Ga0501045_0056270 3300049824 Bacteria 2876
1431 nmdc:mga03683_12216_c1 3300050489 Bacteria 3131
1432 nmdc:mga03683_35302_c1 3300050489 Bacteria 2027
1433 nmdc:mga03683_4492_c1 3300050489 Bacteria 4638
1434 nmdc:mga03683_4655_c1 3300050489 Bacteria 4570
1435 nmdc:mga03683_5619_c1 3300050489 Bacteria 4243
1436 nmdc:mga03683_6955_c1 3300050489 Bacteria 3901
1437 nmdc:mga03n38_17488_c1 3300050490 Bacteria 2809
1438 nmdc:mga03n38_26844_c1 3300050490 Bacteria 2382
1439 nmdc:mga03n38_30837_c1 3300050490 Bacteria 2258
1440 nmdc:mga03n38_85573_c1 3300050490 Bacteria 1491
1441 nmdc:mga03n38_98519_c1 3300050490 Bacteria 1406
1442 nmdc:mga00v17_104432_c1 3300050491 Bacteria 1791
1443 nmdc:mga00v17_33119_c1 3300050491 Bacteria 3060
1444 nmdc:mga00v17_58800_c1 3300050491 Bacteria 2356
1445 nmdc:mga0yw44_148517_c1 3300050492 Bacteria 1528
1446 nmdc:mga0yw44_84836_c1 3300050492 Bacteria 1992
1447 nmdc:mga0k408_1081_c1 3300050493 Bacteria 14950
1448 nmdc:mga0k408_108584_c1 3300050493 Bacteria 1639
1449 nmdc:mga0k408_137202_c1 3300050493 Bacteria 1454
1450 nmdc:mga0k408_13834_c1 3300050493 Bacteria 4433
1451 nmdc:mga0k408_19496_c1 3300050493 Bacteria 3792
1452 nmdc:mga0k408_25391_c1 3300050493 Bacteria 3356
1453 nmdc:mga0k408_4664_c1 3300050493 Bacteria 7262
1454 nmdc:mga0k408_52279_c1 3300050493 Bacteria 2368
1455 nmdc:mga0k408_5276_c1 3300050493 Bacteria 6862
1456 nmdc:mga0k408_6711_c1 3300050493 Bacteria 4018
1457 nmdc:mga0k408_75326_c1 3300050493 Bacteria 1972
1458 nmdc:mga06z11_153292_c1 3300050494 Bacteria 1312
1459 nmdc:mga06z11_3666_c1 3300050494 Bacteria 5963
1460 nmdc:mga06z11_57755_c1 3300050494 Bacteria 2011
1461 nmdc:mga04h51_7806_c1 3300050495 Bacteria 2840
1462 nmdc:mga04h51_81838_c1 3300050495 Bacteria 1147
1463 nmdc:mga07m45_1155_c1 3300050496 Bacteria 11859
1464 nmdc:mga07m45_152014_c1 3300050496 Bacteria 1342
1465 nmdc:mga07m45_179669_c1 3300050496 Bacteria 1230
1466 nmdc:mga07m45_2192_c1 3300050496 Bacteria 9114
1467 nmdc:mga07m45_22422_c1 3300050496 Bacteria 3447
1468 nmdc:mga07m45_225999_c1 3300050496 Bacteria 1089
1469 nmdc:mga07m45_40714_c1 3300050496 Bacteria 2600
1470 nmdc:mga07m45_42714_c2 3300050496 Bacteria 1607
1471 nmdc:mga07m45_7463_c1 3300050496 Bacteria 5590
1472 nmdc:mga07m45_7550_c1 3300050496 Bacteria 4275
1473 nmdc:mga07m45_9064_c1 3300050496 Bacteria 5142
1474 nmdc:mga0n895_790177_c1 3300050512 Bacteria 940
1475 nmdc:mga0sz30_1372_c1 3300050516 Bacteria 8712
1476 nmdc:mga0sz30_424_c1 3300050516 Bacteria 15989
1477 Ga0495601_0005754 3300053077 Bacteria 7228
1478 Ga0495601_0111250 3300053077 Bacteria 1774
1479 Ga0495601_0412530 3300053077 Bacteria 875
1480 Ga0500610_0009289 3300053079 Bacteria 4346
1481 Ga0500635_0000055 3300053080 Bacteria 74107
1482 Ga0495595_0004360 3300053084 Bacteria 5696
1483 Ga0495619_0010788 3300053085 Bacteria 5749
1484 Ga0495619_0413361 3300053085 Bacteria 931
1485 Ga0500578_0001033 3300053086 Bacteria 30501
1486 Ga0500643_004846 3300053087 Bacteria 5942
1487 Ga0500644_0044020 3300053088 Bacteria 1497
1488 Ga0500646_0015828 3300053090 Bacteria 1966
1489 Ga0500651_0000324 3300053093 Bacteria 27187
1490 Ga0500651_0009686 3300053093 Bacteria 5741
1491 Ga0500651_0155072 3300053093 Bacteria 1373
1492 Ga0500641_0007988 3300053096 Bacteria 3770
1493 Ga0500641_0020272 3300053096 Bacteria 2523
1494 Ga0500571_000080 3300053110 Bacteria 30359
1495 Ga0500595_001317 3300053119 Bacteria 13455
1496 Ga0500608_034717 3300053122 Bacteria 2403
1497 Ga0500618_009424 3300053125 Bacteria 2665
1498 Ga0500642_0008169 3300053130 Bacteria 3565
1499 Ga0500652_000391 3300053131 Bacteria 15723
1500 Ga0500658_0000210 3300053134 Bacteria 27749
1501 Ga0500658_0000493 3300053134 Bacteria 16873
1502 Ga0500559_0000636 3300053136 Bacteria 23688
1503 Ga0500559_0028883 3300053136 Bacteria 2371
1504 Ga0500568_0091746 3300053139 Bacteria 1145
1505 Ga0500574_006587 3300053141 Bacteria 2349
1506 Ga0500574_045910 3300053141 Bacteria 1234
1507 Ga0500604_0004012 3300053151 Bacteria 3927
1508 Ga0500616_0005410 3300053153 Bacteria 8667
1509 Ga0500619_002284 3300053154 Bacteria 3653
1510 Ga0500622_0000149 3300053156 Bacteria 73646
1511 Ga0500622_0006654 3300053156 Bacteria 6659
1512 Ga0500627_0018056 3300053158 Bacteria 2785
1513 Ga0500634_0005197 3300053161 Bacteria 6145
1514 Ga0500570_107409 3300053724 Bacteria 1147
1515 Ga0500645_001492 3300053730 Bacteria 11733
1516 Ga0500645_003076 3300053730 Bacteria 6996
1517 Ga0500645_046735 3300053730 Bacteria 1270
1518 Ga0501084_0002314 3300054114 Bacteria 15300
1519 Ga0466962_0054867 3300061719 Bacteria 1904
1520 Ga0530510_0016427 3300061734 Bacteria 5239
1521 2501082193 2501025502 Bacteria 9641094
1522 2900635022 2900634093 Bacteria 10263517
1523 Ga0182007_10004797
1524 JGI24740J21852_10016314
1525 JGI25155J39150_1000049
1526 JGI25155J39150_1000145
1527 JGI25155J39150_1000235
1528 JGI25156J39149_1000023
1529 JGI25156J39149_1000220
1530 JGI25156J39149_1000290
1531 JGI25156J39149_1001073
1532 JGI25156J39149_1004387
1533 JGI25162J39368_1000369
1534 JGI25154J39366_1000036
1535 JGI25154J39366_1000265
1536 JGI25154J39366_1000422
1537 JGI25154J39366_1000669
1538 JGI25157J39369_1000023
1539 JGI25157J39369_1000135
1540 JGI25157J39369_1000186
1541 JGI25163J39215_1004222
1542 JGI25164J39214_1001832
1543 JGI25152J39213_1004068
1544 JGI25152J39213_1013350
1545 JGI25150J39212_1005722
1546 JGI25150J39212_1014895
1547 JGI25159J45721_1001073
1548 JGI25159J45721_1001804
1549 JGI25159J45721_1010573
1550 JGI25151J46595_10000095
1551 JGI25151J46595_10000682
1552 JGI25151J46595_10001217
1553 JGI25151J46595_10004016
1554 JGI25151J46595_10011646
1555 JGI25151J46595_10015494
1556 JGI25151J46595_10025218
1557 JGI25165J46597_1000022
1558 JGI25160J50197_1000256
1559 JGI25160J50197_1000260
1560 JGI25161J50226_1000015
1561 JGI25161J50226_1003370
1562 Ga0055538_1000011
1563 Ga0055538_1000211
1564 Ga0055538_1004347
1565 Ga0055539_1000016
1566 Ga0055539_1000253
1567 Ga0055533_1000019
1568 Ga0055533_1000244
1569 Ga0055533_1006875
1570 Ga0055532_1000002
1571 Ga0055532_1000029
1572 Ga0055532_1000077
1573 Ga0055525_1000042
1574 Ga0055525_1000341
1575 Ga0055535_1001340
1576 Ga0055535_1013422
1577 Ga0055535_1016064
1578 Ga0055542_1000114
1579 Ga0055529_1000062
1580 Ga0055526_1001344
1581 Ga0055526_1003598
1582 Ga0055526_1006059
1583 Ga0055526_1006704
1584 Ga0055526_1027625
1585 Ga0055537_1000135
1586 Ga0055537_1000972
1587 Ga0055537_1004059
1588 Ga0055537_1007985
1589 Ga0055537_1011803
1590 Ga0055524_1000016
1591 Ga0055524_1001369
1592 Ga0055524_1027203
1593 Ga0055536_1001508
1594 Ga0055536_1002393
1595 Ga0055536_1002988
1596 Ga0055536_1003001
1597 Ga0055536_1005027
1598 Ga0055536_1012339
1599 Ga0055534_1000222
1600 Ga0055534_1003866
1601 Ga0055534_1004171
1602 Ga0055534_1004254
1603 Ga0055528_1000423
1604 Ga0055528_1021001
1605 Ga0055528_1041767
1606 Ga0055530_10000293
1607 Ga0055530_10000951
1608 Ga0055530_10010819
1609 Ga0055530_10027026
1610 Ga0055540_1000144
1611 Ga0055540_1001605
1612 Ga0055531_10003930
1613 Ga0055531_10006565
1614 Ga0055541_1000017
1615 Ga0055541_1000152
1616 Ga0055541_1008688
1617 Ga0065165_1002529
1618 Ga0065165_1003560
1619 Ga0065714_10027786
1620 Ga0065714_10110956
1621 Ga0065704_10196170
1622 Ga0065712_10033510
1623 Ga0065712_10215458
1624 Ga0065715_10018889
1625 Ga0065707_10097541
1626 Ga0070658_10003267
1627 Ga0070658_10006087
1628 Ga0070658_10078641
1629 Ga0070658_10125923
1630 Ga0070658_10189808
1631 Ga0070658_10266896
1632 Ga0070676_10000320
1633 Ga0070676_10031111
1634 Ga0070676_10095452
1635 Ga0070690_100006125
1636 Ga0070690_100199822
1637 Ga0070690_100283513
1638 Ga0070670_100010983
1639 Ga0070670_100435533
1640 Ga0070677_10004319
1641 Ga0070677_10055158
1642 Ga0070677_10064821
1643 Ga0068869_100002410
1644 Ga0068869_100033892
1645 Ga0068869_100070788
1646 Ga0068869_100085929
1647 Ga0070666_10083850
1648 Ga0070680_100016218
1649 Ga0070680_100040031
1650 Ga0070680_100162083
1651 Ga0068868_100019122
1652 Ga0068868_100114968
1653 Ga0068868_100210467
1654 Ga0070660_100021552
1655 Ga0070660_100056605
1656 Ga0070660_100433757
1657 Ga0070689_100069856
1658 Ga0070689_100105242
1659 Ga0070689_100262439
1660 Ga0070691_10040465
1661 Ga0070687_100372175
1662 Ga0070661_100016420
1663 Ga0070661_100034875
1664 Ga0070692_10010718
1665 Ga0070668_100027748
1666 Ga0070668_100033774
1667 Ga0070668_100037347
1668 Ga0070669_100024401
1669 Ga0070669_100029937
1670 Ga0070675_100001927
1671 Ga0070675_100047101
1672 Ga0070675_100101858
1673 Ga0070675_100362323
1674 Ga0070671_100084995
1675 Ga0070671_100272223
1676 Ga0070671_100308037
1677 Ga0070671_100324383
1678 Ga0070671_100395609
1679 Ga0070674_100029239
1680 Ga0070674_100073669
1681 Ga0070673_100037884
1682 Ga0070673_100061084
1683 Ga0070673_100065980
1684 Ga0070688_100257944
1685 Ga0070659_100001576
1686 Ga0070659_100012726
1687 Ga0070659_100013884
1688 Ga0070659_100239492
1689 Ga0070659_100324925
1690 Ga0070667_100044049
1691 Ga0070667_100048082
1692 Ga0070667_100071496
1693 Ga0070667_100249764
1694 Ga0070714_100019818
1695 Ga0070701_10003477
1696 Ga0070705_100025900
1697 Ga0070705_100029002
1698 Ga0070705_100379738
1699 Ga0070700_100010396
1700 Ga0070663_100007977
1701 Ga0070663_100039272
1702 Ga0070678_100002841
1703 Ga0070678_100017631
1704 Ga0070678_100066761
1705 Ga0070678_100169788
1706 Ga0070678_100226554
1707 Ga0070662_100008031
1708 Ga0070662_100032246
1709 Ga0070662_100081197
1710 Ga0070662_100185248
1711 Ga0070662_100193596
1712 Ga0070681_10016317
1713 Ga0068867_100001486
1714 Ga0068867_100015713
1715 Ga0068867_100022223
1716 Ga0068867_100104915
1717 Ga0068867_100106500
1718 Ga0068867_100164030
1719 Ga0068867_100257839
1720 Ga0070685_10146818
1721 Ga0070706_100027210
1722 Ga0070706_100035650
1723 Ga0070706_100405324
1724 Ga0070707_100018087
1725 Ga0070707_100266192
1726 Ga0070698_100008886
1727 Ga0070698_100187757
1728 Ga0070699_100063404
1729 Ga0070699_100195495
1730 Ga0070679_100007311
1731 Ga0070679_100064860
1732 Ga0070679_100127769
1733 Ga0070679_100144109
1734 Ga0070679_100162507
1735 Ga0070679_100300381
1736 Ga0070684_100017377
1737 Ga0070684_100204439
1738 Ga0068853_100039942
1739 Ga0068853_100090444
1740 Ga0068853_100110475
1741 Ga0068853_100286302
1742 Ga0068853_100301975
1743 Ga0068853_100438804
1744 Ga0070672_100000455
1745 Ga0070672_100001146
1746 Ga0070672_100021909
1747 Ga0070672_100046548
1748 Ga0070686_100154140
1749 Ga0070686_100177581
1750 Ga0070686_100209010
1751 Ga0070686_100209064
1752 Ga0070686_100266902
1753 Ga0070686_100291640
1754 Ga0070695_100140069
1755 Ga0070695_100251517
1756 Ga0070693_100003698
1757 Ga0070693_100012198
1758 Ga0070693_100047433
1759 Ga0070693_100273485
1760 Ga0070693_100307521
1761 Ga0070665_100011648
1762 Ga0070665_100060646
1763 Ga0070665_100066266
1764 Ga0070704_100438152
1765 Ga0068855_100012616
1766 Ga0068855_100022837
1767 Ga0068855_100033825
1768 Ga0068855_100061531
1769 Ga0068855_100066997
1770 Ga0068855_100077991
1771 Ga0068855_100140452
1772 Ga0068855_100142557
1773 Ga0068855_100255587
1774 Ga0070664_100014870
1775 Ga0070664_100125613
1776 Ga0070664_100140084
1777 Ga0070664_100204104
1778 Ga0070664_100308755
1779 Ga0070664_100309817
1780 Ga0070664_100365647
1781 Ga0070664_100487770
1782 Ga0068857_100001496
1783 Ga0068857_100010173
1784 Ga0068857_100051914
1785 Ga0068857_100077855
1786 Ga0068854_100002285
1787 Ga0068854_100004431
1788 Ga0068854_100009632
1789 Ga0068854_100021798
1790 Ga0068854_100046047
1791 Ga0068854_100068368
1792 Ga0068856_100009070
1793 Ga0068856_100018538
1794 Ga0068856_100061885
1795 Ga0068856_100120537
1796 Ga0068856_100193901
1797 Ga0068856_100241011
1798 Ga0068856_100481611
1799 Ga0070702_100010386
1800 Ga0070702_100015341
1801 Ga0068852_100001380
1802 Ga0068852_100039666
1803 Ga0068852_100061872
1804 Ga0068852_100068072
1805 Ga0068852_100129822
1806 Ga0068852_100216993
1807 Ga0068852_100219269
1808 Ga0068852_100526901
1809 Ga0068859_100007275
1810 Ga0068859_100016209
1811 Ga0068859_100082328
1812 Ga0068859_100154983
1813 Ga0068859_100513955
1814 Ga0068864_100010520
1815 Ga0068864_100031907
1816 Ga0068864_100044791
1817 Ga0068864_100060611
1818 Ga0068866_10005198
1819 Ga0068866_10025134
1820 Ga0068866_10154427
1821 Ga0068861_100003094
1822 Ga0068861_100032543
1823 Ga0068861_100041906
1824 Ga0068861_100043682
1825 Ga0068861_100284323
1826 Ga0068851_10013725
1827 Ga0068851_10047436
1828 Ga0068851_10075684
1829 Ga0068851_10101961
1830 Ga0068851_10133598
1831 Ga0068870_10016636
1832 Ga0068870_10023363
1833 Ga0068863_100001744
1834 Ga0068863_100022783
1835 Ga0068858_100029306
1836 Ga0068858_100053295
1837 Ga0068858_100077271
1838 Ga0068858_100402312
1839 Ga0068860_100035652
1840 Ga0068860_100050343
1841 Ga0068860_100100749
1842 Ga0068860_100256243
1843 Ga0068862_100015247
1844 Ga0068862_100020890
1845 Ga0068862_100039407
1846 Ga0068862_100056495
1847 Ga0081455_10001395
1848 Ga0081455_10002648
1849 Ga0081455_10010547
1850 Ga0081539_10015865
1851 Ga0075365_10002444
1852 Ga0075365_10044317
1853 Ga0075365_10121602
1854 Ga0075365_10123674
1855 Ga0075365_10142884
1856 Ga0075368_10015636
1857 Ga0075368_10015867
1858 Ga0075363_100017418
1859 Ga0075363_100027807
1860 Ga0075363_100038847
1861 Ga0075363_100046661
1862 Ga0075364_10037915
1863 Ga0075364_10064427
1864 Ga0075364_10090544
1865 Ga0075364_10118418
1866 Ga0075432_10003417
1867 Ga0070715_10013631
1868 Ga0070712_100318561
1869 Ga0075362_10003711
1870 Ga0075362_10004022
1871 Ga0075362_10009604
1872 Ga0075362_10015470
1873 Ga0075362_10027448
1874 Ga0075362_10047479
1875 Ga0075362_10074111
1876 Ga0075362_10121470
1877 Ga0075367_10008214
1878 Ga0075367_10095447
1879 Ga0075367_10103121
1880 Ga0075367_10106172
1881 Ga0075367_10106780
1882 Ga0075367_10182577
1883 Ga0075369_10000736
1884 Ga0075369_10014986
1885 Ga0075366_10008204
1886 Ga0075366_10020307
1887 Ga0075366_10023577
1888 Ga0075366_10025110
1889 Ga0075366_10039213
1890 Ga0075366_10048713
1891 Ga0075366_10064808
1892 Ga0075366_10124617
1893 Ga0075366_10139857
1894 Ga0075366_10202852
1895 Ga0097621_100005368
1896 Ga0097621_100046253
1897 Ga0097621_100046943
1898 Ga0097621_100052233
1899 Ga0097621_100062452
1900 Ga0097621_100300081
1901 Ga0075370_10001756
1902 Ga0075370_10004393
1903 Ga0075370_10005564
1904 Ga0075370_10008738
1905 Ga0075370_10008946
1906 Ga0075370_10012183
1907 Ga0075370_10017291
1908 Ga0075370_10062019
1909 Ga0075370_10173554
1910 Ga0068871_100011498
1911 Ga0068871_100014985
1912 Ga0068871_100027274
1913 Ga0068871_100032191
1914 Ga0068871_100038841
1915 Ga0068871_100364516
1916 Ga0068871_100542427
1917 Ga0075434_100828613
1918 Ga0068865_100024637
1919 Ga0068865_100029315
1920 Ga0068865_100082262
1921 Ga0097620_100007275
1922 Ga0097620_100016209
1923 Ga0097620_100082323
1924 Ga0097620_100154981
1925 Ga0097620_100513937
1926 Ga0099824_1046569
1927 Ga0099826_10000020
1928 Ga0099826_10004782
1929 Ga0099826_10139654
1930 Ga0099794_10043265
1931 Ga0099794_10061160
1932 Ga0099794_10217919
1933 Ga0105251_10001533
1934 Ga0105251_10072524
1935 Ga0105251_10164173
1936 Ga0105244_10005141
1937 Ga0105244_10114075
1938 Ga0105240_10002847
1939 Ga0105240_10004008
1940 Ga0105240_10004595
1941 Ga0105240_10006708
1942 Ga0105240_10010502
1943 Ga0105240_10021598
1944 Ga0105240_10050266
1945 Ga0105240_10052126
1946 Ga0105240_10180266
1947 Ga0105240_10409667
1948 Ga0105245_10038308
1949 Ga0105245_10057603
1950 Ga0105245_10077594
1951 Ga0105245_10120427
1952 Ga0105245_10471504
1953 Ga0105245_10826227
1954 Ga0105245_10886509
1955 Ga0114129_10477035
1956 Ga0105243_10000972
1957 Ga0105243_10001957
1958 Ga0105243_10006686
1959 Ga0105243_10029263
1960 Ga0105243_10032140
1961 Ga0105243_10141151
1962 Ga0105243_10179457
1963 Ga0105243_10257390
1964 Ga0105243_10283723
1965 Ga0105241_10167409
1966 Ga0105241_10247434
1967 Ga0105242_10011903
1968 Ga0105242_10023227
1969 Ga0105242_10117227
1970 Ga0105242_10267954
1971 Ga0105248_10006623
1972 Ga0105248_10323809
1973 Ga0105248_10372280
1974 Ga0105248_11268441
1975 Ga0105237_10001856
1976 Ga0105237_10004431
1977 Ga0105237_10010879
1978 Ga0105237_10033848
1979 Ga0105237_10257728
1980 Ga0105237_10559222
1981 Ga0105238_10000006
1982 Ga0105238_10010668
1983 Ga0105238_10036320
1984 Ga0105238_10062761
1985 Ga0105238_10106908
1986 Ga0105238_10155806
1987 Ga0105238_10377118
1988 Ga0105249_10025103
1989 Ga0105249_10052442
1990 Ga0105249_10237353
1991 Ga0105249_10413878
1992 Ga0105239_10001826
1993 Ga0105239_10006997
1994 Ga0105239_10066463
1995 Ga0105239_10102505
1996 Ga0105239_10675601
1997 Ga0105239_10837932
1998 Ga0105246_10099723
1999 Ga0105246_10230233
2000 Ga0157371_10065548
2001 Ga0157371_10116637
2002 Ga0157370_10007222
2003 Ga0157370_10019942
2004 Ga0157370_10154548
2005 Ga0157370_10447941
2006 Ga0157369_10002332
2007 Ga0157369_10041430
2008 Ga0157369_10080187
2009 Ga0157369_10086670
2010 Ga0157369_10087324
2011 Ga0157369_10326096
2012 Ga0157369_10441847
2013 Ga0157374_10019483
2014 Ga0157374_10030208
2015 Ga0157374_10109104
2016 Ga0157378_10021050
2017 Ga0157378_10243075
2018 Ga0157378_10371985
2019 Ga0163162_10009232
2020 Ga0163162_10023582
2021 Ga0163162_10074809
2022 Ga0163162_10269541
2023 Ga0163162_10356051
2024 Ga0157372_10000824
2025 Ga0157372_10045482
2026 Ga0157372_10085341
2027 Ga0157372_10219693
2028 Ga0157372_10271276
2029 Ga0157372_10290053
2030 Ga0157372_11097025
2031 Ga0157375_10108568
2032 Ga0157375_10146754
2033 Ga0157375_10160675
2034 Ga0157375_10164555
2035 Ga0157375_10294349
2036 Ga0157375_10340146
2037 Ga0157375_10915607
2038 Ga0163163_10617822
2039 Ga0157380_10038996
2040 Ga0157380_10090437
2041 Ga0157380_10455407
2042 Ga0182008_10000729
2043 Ga0182008_10003871
2044 Ga0182008_10016800
2045 Ga0182008_10019464
2046 Ga0182008_10036706
2047 Ga0182008_10069564
2048 Ga0182008_10075108
2049 Ga0157377_10009636
2050 Ga0157379_10005798
2051 Ga0157379_10015108
2052 Ga0157379_10157387
2053 Ga0157379_10253212
2054 Ga0157376_10008025
2055 Ga0157376_10032170
2056 Ga0157376_10435700
2057 Ga0157376_10740834
2058 Ga0182006_1000680
2059 Ga0182006_1003026
2060 Ga0182006_1008332
2061 Ga0182006_1037486
2062 Ga0182006_1048476
2063 Ga0182007_10000164
2064 Ga0182007_10002069
2065 Ga0182007_10008922
2066 Ga0182007_10012543
2067 Ga0182005_1000986
2068 Ga0182005_1053904
2069 Ga0183361_10013
2070 Ga0163161_10007253
2071 Ga0163161_10009227
2072 Ga0163161_10010284
2073 Ga0163161_10030116
2074 Ga0163161_10032692
2075 Ga0163161_10058577
2076 Ga0163161_10108933
2077 Ga0213872_10001779
2078 Ga0213872_10035049
2079 Ga0209435_100001
2080 Ga0209435_100048
2081 Ga0209435_100221
2082 Ga0209760_100904
2083 Ga0209784_100009
2084 Ga0209784_100019
2085 Ga0209784_102760
2086 Ga0209566_100007
2087 Ga0209566_100017
2088 Ga0209674_100018
2089 Ga0209674_100031
2090 Ga0209674_106377
2091 Ga0209672_100052
2092 Ga0209672_100190
2093 Ga0209672_101186
2094 Ga0209147_100002
2095 Ga0209147_100122
2096 Ga0209563_100020
2097 Ga0209563_100035
2098 Ga0209563_111684
2099 Ga0207427_100296
2100 Ga0207427_101737
2101 Ga0209437_100038
2102 Ga0209437_100081
2103 Ga0209258_100002
2104 Ga0209258_100225
2105 Ga0209258_100230
2106 Ga0209258_100869
2107 Ga0207425_1000149
2108 Ga0207425_1000530
2109 Ga0207425_1002683
2110 Ga0207425_1007888
2111 Ga0209646_1000001
2112 Ga0209646_1000130
2113 Ga0209646_1000152
2114 Ga0209646_1000214
2115 Ga0209026_1000003
2116 Ga0209026_1000059
2117 Ga0209026_1000126
2118 Ga0209677_100010
2119 Ga0209677_100020
2120 Ga0209677_100226
2121 Ga0209148_1000040
2122 Ga0209148_1003376
2123 Ga0209759_1000001
2124 Ga0209759_1000188
2125 Ga0209759_1000193
2126 Ga0209759_1000365
2127 Ga0209759_1000509
2128 Ga0209759_1015272
2129 Ga0209129_1000007
2130 Ga0209129_1000119
2131 Ga0209233_1000049
2132 Ga0209565_1000004
2133 Ga0209565_1000085
2134 Ga0209565_1000092
2135 Ga0209565_1000365
2136 Ga0209565_1000394
2137 Ga0209565_1004286
2138 Ga0209565_1014546
2139 Ga0209455_1000021
2140 Ga0209673_1000045
2141 Ga0209673_1000133
2142 Ga0209673_1000445
2143 Ga0209673_1003004
2144 Ga0209673_1005760
2145 Ga0209673_1027752
2146 Ga0209130_1000056
2147 Ga0209130_1000070
2148 Ga0209130_1000634
2149 Ga0209130_1001057
2150 Ga0209130_1004319
2151 Ga0209675_1000083
2152 Ga0209675_1000411
2153 Ga0209675_1000809
2154 Ga0209675_1000951
2155 Ga0209675_1002465
2156 Ga0209675_1007014
2157 Ga0209675_1007810
2158 Ga0209675_1013763
2159 Ga0209675_1041373
2160 Ga0209676_1000004
2161 Ga0209676_1000007
2162 Ga0209676_1000012
2163 Ga0209676_1000268
2164 Ga0209676_1000565
2165 Ga0209676_1006485
2166 Ga0209676_1013164
2167 Ga0209025_1000055
2168 Ga0209025_1000111
2169 Ga0209025_1000455
2170 Ga0209025_1000529
2171 Ga0209025_1000892
2172 Ga0209025_1001053
2173 Ga0209025_1001159
2174 Ga0209025_1001484
2175 Ga0209025_1003293
2176 Ga0209025_1004030
2177 Ga0209025_1007672
2178 Ga0209025_1034371
2179 Ga0209564_1000024
2180 Ga0209564_1000772
2181 Ga0209564_1001095
2182 Ga0209564_1001593
2183 Ga0209564_1002067
2184 Ga0209564_1002203
2185 Ga0209564_1004894
2186 Ga0209758_1000025
2187 Ga0209758_1000194
2188 Ga0209758_1010717
2189 Ga0209758_1032044
2190 Ga0209050_1000002
2191 Ga0209050_1000003
2192 Ga0209050_1000855
2193 Ga0209050_1000965
2194 Ga0209050_1002597
2195 Ga0209050_1011581
2196 Ga0209050_1024573
2197 Ga0209050_1029763
2198 Ga0209256_1000001
2199 Ga0209256_1000050
2200 Ga0209256_1000063
2201 Ga0209256_1000804
2202 Ga0209256_1001280
2203 Ga0209256_1035621
2204 Ga0207426_1000001
2205 Ga0207426_1000025
2206 Ga0207426_1000028
2207 Ga0207426_1000050
2208 Ga0209051_1000002
2209 Ga0209051_1000003
2210 Ga0209051_1000471
2211 Ga0209051_1000653
2212 Ga0209051_1000868
2213 Ga0209051_1005176
2214 Ga0209051_1033026
2215 Ga0209051_1038832
2216 Ga0209051_1051899
2217 Ga0209257_1000002
2218 Ga0209257_1000018
2219 Ga0209257_1000333
2220 Ga0209257_1001358
2221 Ga0209257_1011611
2222 Ga0209257_1024648
2223 Ga0207697_10002378
2224 Ga0207697_10020586
2225 Ga0207656_10000643
2226 Ga0207656_10020269
2227 Ga0207656_10098013
2228 Ga0207655_1001500
2229 Ga0207713_1001321
2230 Ga0207713_1044765
2231 Ga0207682_10003666
2232 Ga0207692_10182444
2233 Ga0207642_10003514
2234 Ga0207642_10038886
2235 Ga0207688_10012507
2236 Ga0207680_10010960
2237 Ga0207647_10014923
2238 Ga0207645_10001135
2239 Ga0207645_10007822
2240 Ga0207645_10017063
2241 Ga0207645_10053658
2242 Ga0207645_10113351
2243 Ga0207643_10019545
2244 Ga0207705_10018161
2245 Ga0207684_10131874
2246 Ga0207684_10277967
2247 Ga0207684_10479346
2248 Ga0207695_10001505
2249 Ga0207695_10006633
2250 Ga0207695_10008251
2251 Ga0207695_10029238
2252 Ga0207695_10030526
2253 Ga0207695_10039904
2254 Ga0207695_10084680
2255 Ga0207695_10163830
2256 Ga0207695_10311798
2257 Ga0207695_10405949
2258 Ga0207671_10004003
2259 Ga0207671_10009919
2260 Ga0207671_10026658
2261 Ga0207660_10036117
2262 Ga0207660_10037492
2263 Ga0207660_10126285
2264 Ga0207660_10164733
2265 Ga0207662_10064263
2266 Ga0207662_10190480
2267 Ga0207657_10020709
2268 Ga0207657_10073322
2269 Ga0207657_10378386
2270 Ga0207649_10013461
2271 Ga0207649_10029598
2272 Ga0207649_10056277
2273 Ga0207649_10068702
2274 Ga0207652_10015548
2275 Ga0207652_10068117
2276 Ga0207652_10075901
2277 Ga0207652_10137247
2278 Ga0207646_10121103
2279 Ga0207681_10000793
2280 Ga0207681_10002665
2281 Ga0207681_10224062
2282 Ga0207681_10395454
2283 Ga0207694_10000207
2284 Ga0207694_10022635
2285 Ga0207694_10069738
2286 Ga0207694_10120675
2287 Ga0207694_10334054
2288 Ga0207694_10400193
2289 Ga0207650_10001429
2290 Ga0207650_10185806
2291 Ga0207650_10380644
2292 Ga0207659_10021910
2293 Ga0207659_10027526
2294 Ga0207659_10078376
2295 Ga0207659_10123770
2296 Ga0207659_10178957
2297 Ga0207687_10029646
2298 Ga0207687_10035677
2299 Ga0207687_10053889
2300 Ga0207687_10067070
2301 Ga0207687_10112874
2302 Ga0207687_10124264
2303 Ga0207687_10195877
2304 Ga0207644_10003406
2305 Ga0207644_10015176
2306 Ga0207644_10162524
2307 Ga0207690_10023271
2308 Ga0207690_10057688
2309 Ga0207690_10059063
2310 Ga0207706_10009396
2311 Ga0207706_10022480
2312 Ga0207706_10075459
2313 Ga0207706_10090343
2314 Ga0207706_10110879
2315 Ga0207686_10011111
2316 Ga0207686_10024302
2317 Ga0207686_10041020
2318 Ga0207686_10133878
2319 Ga0207709_10000684
2320 Ga0207709_10001331
2321 Ga0207709_10010515
2322 Ga0207709_10012802
2323 Ga0207709_10026682
2324 Ga0207709_10040360
2325 Ga0207709_10334856
2326 Ga0207670_10049946
2327 Ga0207670_10307838
2328 Ga0207670_10540158
2329 Ga0207669_10006488
2330 Ga0207704_10039248
2331 Ga0207704_10044782
2332 Ga0207704_10052843
2333 Ga0207704_10064635
2334 Ga0207704_10106398
2335 Ga0207665_10185562
2336 Ga0207691_10000973
2337 Ga0207691_10001288
2338 Ga0207691_10003133
2339 Ga0207691_10005935
2340 Ga0207691_10406246
2341 Ga0207711_10012438
2342 Ga0207711_10012450
2343 Ga0207711_10069679
2344 Ga0207711_10307326
2345 Ga0207689_10000591
2346 Ga0207689_10013054
2347 Ga0207689_10019585
2348 Ga0207689_10024609
2349 Ga0207689_10051124
2350 Ga0207689_10084343
2351 Ga0207661_10029479
2352 Ga0207679_10017656
2353 Ga0207679_10053658
2354 Ga0207679_10154175
2355 Ga0207679_10593778
2356 Ga0207667_10002183
2357 Ga0207667_10013188
2358 Ga0207667_10017157
2359 Ga0207667_10063697
2360 Ga0207667_10063933
2361 Ga0207667_10108543
2362 Ga0207651_10004181
2363 Ga0207651_10015790
2364 Ga0207651_10088607
2365 Ga0207651_10532444
2366 Ga0207651_10541120
2367 Ga0207712_10023222
2368 Ga0207712_10133316
2369 Ga0207712_10296309
2370 Ga0207668_10027270
2371 Ga0207668_10043298
2372 Ga0207668_10065671
2373 Ga0207640_10005404
2374 Ga0207640_10027941
2375 Ga0207640_10128730
2376 Ga0207640_10133594
2377 Ga0207658_10022892
2378 Ga0207658_10037007
2379 Ga0207658_10055388
2380 Ga0207658_10170296
2381 Ga0207658_10384393
2382 Ga0207677_10019626
2383 Ga0207677_10026789
2384 Ga0207677_10185856
2385 Ga0207677_10228816
2386 Ga0207677_10266010
2387 Ga0207703_10002400
2388 Ga0207703_10046087
2389 Ga0207639_10005602
2390 Ga0207639_10132266
2391 Ga0207639_10302799
2392 Ga0207639_10469301
2393 Ga0207639_10628078
2394 Ga0207678_10014575
2395 Ga0207678_10063186
2396 Ga0207678_10152644
2397 Ga0207678_10309787
2398 Ga0207708_10005823
2399 Ga0207708_10013196
2400 Ga0207702_10001439
2401 Ga0207702_10093495
2402 Ga0207702_10176941
2403 Ga0207641_10003472
2404 Ga0207641_10006729
2405 Ga0207641_10193440
2406 Ga0207648_10002124
2407 Ga0207648_10006556
2408 Ga0207648_10011202
2409 Ga0207648_10109510
2410 Ga0207648_10126629
2411 Ga0207648_10135160
2412 Ga0207648_10173204
2413 Ga0207676_10006970
2414 Ga0207676_10035437
2415 Ga0207676_10205549
2416 Ga0207674_10005404
2417 Ga0207674_10011591
2418 Ga0207674_10013504
2419 Ga0207674_10019948
2420 Ga0207674_10034569
2421 Ga0207674_10085480
2422 Ga0207674_10120677
2423 Ga0207675_100000138
2424 Ga0207675_100147211
2425 Ga0207683_10000520
2426 Ga0207683_10006544
2427 Ga0207683_10070843
2428 Ga0207683_10072389
2429 Ga0207683_10091702
2430 Ga0207683_10318365
2431 Ga0207683_10519571
2432 Ga0207698_10017736
2433 Ga0207698_10018165
2434 Ga0207698_10046884
2435 Ga0207698_10323058
2436 Ga0209970_1006899
2437 Ga0209282_1000045
2438 Ga0209282_1001910
2439 Ga0209282_1154304
2440 Ga0209588_1022047
2441 Ga0209588_1039580
2442 Ga0209813_10006509
2443 Ga0207428_10191856
2444 Ga0268266_10029677
2445 Ga0268266_10122024
2446 Ga0268266_10194168
2447 Ga0268266_10222027
2448 Ga0268266_10387456
2449 Ga0268265_10005157
2450 Ga0268265_10204842
2451 Ga0268264_10045892
2452 Ga0268264_10052991
2453 Ga0268264_10056049
2454 Ga0268264_10268348
2455 Ga0307517_10000228
2456 Ga0307517_10070147
2457 Ga0307517_10172646
2458 Ga0307515_10000013
2459 Ga0307515_10000037
2460 Ga0307515_10000428
2461 Ga0307515_10006133
2462 Ga0307515_10009239
2463 Ga0307515_10016260
2464 Ga0307515_10029046
2465 Ga0307515_10224608
2466 Ga0265338_10000022
2467 Ga0265338_10000281
2468 Ga0307511_10000671
2469 Ga0307512_10028786
2470 Ga0316177_1157730
2471 Ga0314311_1139236
2472 Ga0316180_1015378
2473 Ga0316183_1110270
2474 Ga0316181_1005389
2475 Ga0316182_1383921
2476 Ga0265327_10000689
2477 Ga0265327_10050387
2478 Ga0265327_10098071
2479 Ga0307513_10000010
2480 Ga0307513_10000121
2481 Ga0307513_10014924
2482 Ga0307513_10019112
2483 Ga0307509_10000426
2484 Ga0307509_10044488
2485 Ga0307509_10078868
2486 Ga0307509_10081835
2487 Ga0307509_10098023
2488 Ga0307509_10143290
2489 Ga0307509_10424653
2490 Ga0307408_100010028
2491 Ga0307408_100051176
2492 Ga0307408_100117334
2493 Ga0307408_100118412
2494 Ga0307408_100127321
2495 Ga0307408_100284214
2496 Ga0307408_100463756
2497 Ga0307408_100563380
2498 Ga0307508_10000096
2499 Ga0307508_10000273
2500 Ga0307508_10003742
2501 Ga0307508_10070041
2502 Ga0307514_10001887
2503 Ga0307514_10049636
2504 Ga0307514_10069075
2505 Ga0265314_10030091
2506 Ga0265342_10046019
2507 Ga0307516_10002590
2508 Ga0307516_10003708
2509 Ga0307516_10007835
2510 Ga0307516_10014241
2511 Ga0307516_10104851
2512 Ga0307516_10318387
2513 Ga0307405_10002872
2514 Ga0307405_10016578
2515 Ga0307405_10068124
2516 Ga0307405_10400363
2517 Ga0307518_10236745
2518 Ga0307410_10006084
2519 Ga0307410_10117073
2520 Ga0307406_10005443
2521 Ga0307406_10055913
2522 Ga0307406_10181417
2523 Ga0307407_10033949
2524 Ga0307412_10001959
2525 Ga0307412_10009352
2526 Ga0307412_10017384
2527 Ga0307412_10146700
2528 Ga0307412_10473196
2529 Ga0307409_100099675
2530 Ga0307409_100506732
2531 Ga0307416_100002887
2532 Ga0307416_100007370
2533 Ga0307416_100060673
2534 Ga0307416_100089116
2535 Ga0307416_100464400
2536 Ga0307414_10008727
2537 Ga0307411_10019230
2538 Ga0307411_10239023
2539 Ga0307415_100004219
2540 Ga0307415_100191188
2541 Ga0307507_10079515
2542 Ga0307507_10094219
2543 Ga0307510_10000088
2544 Ga0307510_10000967
2545 Ga0307510_10103592
2546 Ga0373938_0007458
2547 Ga0373934_0016737
2548 Ga0373944_0040673
2549 Ga0373952_0050698
2550 Ga0373939_0005037
2551 Ga0373953_0130583
2552 Ga0373955_0015132
2553 Ga0373955_0029829
2554 Ga0373924_0104364
2555 Ga0373931_0000719
2556 Ga0373931_0108854
2557 Ga0373931_0214130
2558 Ga0373935_0131175
2559 Ga0373947_0043204
2560 Ga0373937_0025212
2561 Ga0373937_0097776
2562 Ga0373925_0059226
2563 Ga0373925_0077689
2564 Ga0373925_0217678
2565 Ga0373925_0539505
2566 Ga0395899_0003004
2567 Ga0395899_0003834
2568 Ga0395899_0023766
2569 Ga0395899_0042037
2570 Ga0395899_0188340
2571 Ga0395900_0003666
2572 Ga0395900_0012705
2573 Ga0395900_0027220
2574 Ga0395900_0032723
2575 Ga0395900_0035522
2576 Ga0395900_0066108
2577 Ga0395900_0132453
2578 Ga0395900_0135443
2579 Ga0395900_0468270
2580 Ga0395898_0002485
2581 Ga0395898_0006527
2582 Ga0395898_0036335
2583 Ga0395898_0213390
2584 Ga0395898_0261930
2585 Ga0395905_0000041
2586 Ga0395905_0000766
2587 Ga0395905_0001291
2588 Ga0395905_0001867
2589 Ga0395905_0002404
2590 Ga0395905_0006699
2591 Ga0395905_0016311
2592 Ga0395905_0022080
2593 Ga0395905_0087687
2594 Ga0395905_0240311
2595 Ga0395905_0333913
2596 Ga0395905_0429056
2597 Ga0395905_0514960
2598 Ga0436364_1452872
2599 Ga0395901_0119273
2600 Ga0395901_0164122
2601 Ga0395901_0196832
2602 Ga0436365_1069362
2603 Ga0436361_0263782
2604 Ga0436361_0706582
2605 Ga0439436_0000271
2606 Ga0439439_0008230
2607 Ga0439439_0022327
2608 Ga0439439_0024456
2609 Ga0439447_018176
2610 Ga0439465_0004740
2611 Ga0451795_0371926
2612 Ga0451807_2138912
2613 Ga0451839_1172444
2614 Ga0451841_0043643
2615 Ga0451853_3303108
2616 Ga0439431_0002491
2617 Ga0439441_005125
2618 Ga0439441_008564
2619 Ga0439442_007787
2620 Ga0439445_0000101
2621 Ga0439432_003935
2622 Ga0439449_0000836
2623 Ga0439449_0003108
2624 Ga0439449_0009194
2625 Ga0439452_001575
2626 Ga0439452_003824
2627 Ga0439457_004271
2628 Ga0439462_0005109
2629 Ga0450894_005633
2630 Ga0450889_007214
2631 Ga0439446_0002170
2632 Ga0450908_002671
2633 Ga0450909_002890
2634 Ga0439434_0001592
2635 Ga0439434_0002659
2636 Ga0439464_0017700
2637 Ga0439460_0045072
2638 Ga0450918_000258
2639 Ga0451577_0045661
2640 Ga0466969_0003266
2641 Ga0466969_0159489
2642 Ga0466972_0009395
2643 Ga0466977_0000064
2644 Ga0453683_0003262
2645 Ga0466966_0003451
2646 Ga0466961_0054667
2647 Ga0453684_0003387
2648 Ga0453684_0592183
2649 Ga0466970_0017755
2650 Ga0466970_0104668
2651 Ga0466957_0007962
2652 Ga0466957_0222836
2653 Ga0451576_0007232
2654 Ga0451576_0015307
2655 Ga0451576_0048014
2656 Ga0451576_0095976
2657 Ga0451576_0186369
2658 Ga0451576_0288095
2659 Ga0451576_0300925
2660 Ga0495592_0000307
2661 Ga0495592_0005284
2662 Ga0495590_0016152
2663 Ga0495590_0019964
2664 Ga0495629_0016193
2665 Ga0495638_0009369
2666 Ga0495638_0041320
2667 Ga0495638_0094762
2668 Ga0495651_0007788
2669 Ga0495651_0058881
2670 Ga0495651_0122775
2671 Ga0495653_0031899
2672 Ga0495653_0082601
2673 Ga0495650_0002401
2674 Ga0495650_0039741
2675 Ga0495580_0012377
2676 Ga0495580_0090482
2677 Ga0495605_0003271
2678 Ga0495605_0006415
2679 Ga0495605_0010207
2680 Ga0495639_0011603
2681 Ga0495662_0023350
2682 Ga0495584_0022556
2683 Ga0495585_0000600
2684 Ga0495585_0023825
2685 Ga0495596_0000531
2686 Ga0495596_0001392
2687 Ga0495607_0000104
2688 Ga0495607_0079164
2689 Ga0495583_0000068
2690 Ga0495583_0020770
2691 Ga0495606_0031176
2692 Ga0495606_0115978
2693 Ga0495608_0009037
2694 Ga0495608_0036970
2695 Ga0495608_0043811
2696 Ga0495608_0060615
2697 Ga0495610_0000402
2698 Ga0495610_0027502
2699 Ga0495610_0034215
2700 Ga0495616_0001588
2701 Ga0495618_0009013
2702 Ga0495618_0225602
2703 Ga0495620_0023629
2704 Ga0495620_0043753
2705 Ga0495628_0000094
2706 Ga0495628_0001686
2707 Ga0495628_0010603
2708 Ga0495630_0005175
2709 Ga0495630_0023999
2710 Ga0495630_0187311
2711 Ga0495631_0007349
2712 Ga0495632_0005817
2713 Ga0495632_0016163
2714 Ga0495644_0070785
2715 Ga0495648_0077652
2716 Ga0495642_0016179
2717 Ga0495642_0017986
2718 Ga0495642_0080640
2719 Ga0495652_0053180
2720 Ga0495652_0071724
2721 Ga0495652_0151060
2722 Ga0495652_0282927
2723 Ga0495654_0001128
2724 Ga0495654_0024039
2725 Ga0495640_0003973
2726 Ga0495586_0002666
2727 Ga0495587_0032496
2728 Ga0495609_0005608
2729 Ga0495621_0042632
2730 Ga0495621_0053686
2731 Ga0495597_0004406
2732 Ga0495597_0028022
2733 Ga0495645_0004283
2734 Ga0495645_0018404
2735 Ga0495645_0097404
2736 Ga0495645_0163979
2737 Ga0495622_0123567
2738 Ga0495667_0016481
2739 Ga0495667_0220772
2740 Ga0495656_0006029
2741 Ga0495656_0075661
2742 Ga0495668_0027061
2743 Ga0495611_0008098
2744 Ga0495611_0205991
2745 Ga0495625_0000811
2746 Ga0495625_0002034
2747 Ga0495625_0002147
2748 Ga0495625_0013100
2749 Ga0495625_0083948
2750 Ga0495625_0147508
2751 Ga0495661_0028289
2752 Ga0495661_0037991
2753 Ga0495661_0118774
2754 Ga0495588_0025415
2755 Ga0495588_0058570
2756 Ga0495588_0134792
2757 Ga0495657_0134798
2758 Ga0495599_0002663
2759 Ga0495599_0007337
2760 Ga0495599_0007691
2761 Ga0495623_0015463
2762 Ga0495623_0021980
2763 Ga0495623_0069969
2764 Ga0495646_0101850
2765 Ga0495658_0017838
2766 Ga0495658_0124256
2767 Ga0495613_0035150
2768 Ga0495671_0000949
2769 Ga0495671_0003079
2770 Ga0495671_0051467
2771 Ga0495671_0116445
2772 Ga0495649_0000902
2773 Ga0495649_0019136
2774 Ga0495649_0054994
2775 Ga0495600_0000395
2776 Ga0495660_0151431
2777 Ga0495604_0005126
2778 Ga0495636_0028531
2779 Ga0495674_0001417
2780 Ga0495674_0021472
2781 Ga0495674_0153891
2782 Ga0495672_0024306
2783 Ga0495676_0053294
2784 Ga0495676_0114514
2785 Ga0495680_0004617
2786 Ga0495683_0036120
2787 Ga0495687_000330
2788 Ga0495687_003745
2789 Ga0495687_007018
2790 Ga0495687_008919
2791 Ga0495679_000094
2792 Ga0495673_0010894
2793 Ga0495673_0011584
2794 Ga0495684_0039710
2795 Ga0495684_0291632
2796 Ga0495686_0080473
2797 Ga0495686_0114885
2798 Ga0495593_0007103
2799 Ga0495593_0036853
2800 Ga0495602_0094606
2801 Ga0495614_0115970
2802 Ga0495615_0013150
2803 Ga0495626_0004972
2804 Ga0495626_0072964
2805 Ga0496100_0003901
2806 Ga0496100_0030272
2807 Ga0496101_0001350
2808 Ga0496101_0002565
2809 Ga0496101_0076323
2810 Ga0496102_0000863
2811 Ga0496102_0002579
2812 Ga0496102_0045016
2813 Ga0496103_0001427
2814 Ga0496103_0041940
2815 Ga0496103_0057061
2816 Ga0496103_0208958
2817 Ga0496104_0022955
2818 Ga0496104_0046945
2819 Ga0496104_0169712
2820 Ga0496104_0335815
2821 Ga0496104_0480170
2822 Ga0496105_0003513
2823 Ga0496105_0008623
2824 Ga0496105_0059239
2825 Ga0496106_0004306
2826 Ga0496106_0006498
2827 Ga0496106_0052015
2828 Ga0496106_0094112
2829 Ga0496107_0010565
2830 Ga0496107_0386226
2831 Ga0496108_0236644
2832 Ga0496109_0004487
2833 Ga0496109_0677770
2834 Ga0496110_0024210
2835 Ga0496110_0048777
2836 Ga0496110_0209482
2837 Ga0496111_0040125
2838 Ga0496112_0001203
2839 Ga0496113_0041941
2840 Ga0496113_0044410
2841 Ga0496113_0046906
2842 Ga0496113_0459545
2843 Ga0496114_0089693
2844 Ga0496114_0134655
2845 Ga0496114_0236300
2846 Ga0496115_0003898
2847 Ga0496116_0003609
2848 Ga0496116_0011291
2849 Ga0496116_0013523
2850 Ga0496116_0015998
2851 Ga0496116_0020876
2852 Ga0496116_0066795
2853 Ga0496117_0002329
2854 Ga0496117_0012972
2855 Ga0496117_0023493
2856 Ga0496117_0122537
2857 Ga0496118_0005797
2858 Ga0496118_0006085
2859 Ga0496118_0022991
2860 Ga0496118_0025287
2861 Ga0496118_0040421
2862 Ga0496119_0008405
2863 Ga0496119_0077189
2864 Ga0496119_0087501
2865 Ga0496120_0003056
2866 Ga0496120_0140458
2867 Ga0496121_0000140
2868 Ga0496121_0000694
2869 Ga0496121_0005950
2870 Ga0496121_0023470
2871 Ga0496121_0026586
2872 Ga0496121_0031014
2873 Ga0496121_0036546
2874 Ga0496121_0182840
2875 Ga0496122_0000227
2876 Ga0496122_0001089
2877 Ga0496122_0001677
2878 Ga0496122_0002020
2879 Ga0496122_0146954
2880 Ga0496123_0000141
2881 Ga0496123_0000265
2882 Ga0496123_0000826
2883 Ga0496123_0028714
2884 Ga0496124_0017865
2885 Ga0496124_0042725
2886 Ga0496124_0070406
2887 Ga0496124_0070752
2888 Ga0496124_0080196
2889 Ga0496124_0169278
2890 Ga0496125_0000190
2891 Ga0496125_0004085
2892 Ga0496125_0036252
2893 Ga0496125_0113381
2894 Ga0496126_0015524
2895 Ga0496126_0083485
2896 Ga0495678_011176
2897 Ga0495678_023409
2898 Ga0501031_0002275
2899 Ga0501031_0013733
2900 Ga0501031_0245625
2901 Ga0501032_0008003
2902 Ga0501032_0206696
2903 Ga0501033_0000561
2904 Ga0501033_0033574
2905 Ga0501034_0000530
2906 Ga0501034_0021788
2907 Ga0501034_0070473
2908 Ga0501034_0078178
2909 Ga0501034_0116453
2910 Ga0501034_0117453
2911 Ga0501034_0139003
2912 Ga0501034_0642255
2913 Ga0501036_0002030
2914 Ga0501036_0150387
2915 Ga0501037_0001491
2916 Ga0501037_0060230
2917 Ga0501038_0002799
2918 Ga0501038_0045659
2919 Ga0501038_0111840
2920 Ga0501039_0015640
2921 Ga0501041_0099466
2922 Ga0501043_0015551
2923 Ga0501046_0008826
2924 Ga0501046_0031581
2925 Ga0501046_0043246
2926 Ga0501047_0016207
2927 Ga0501047_0048942
2928 Ga0501047_0199893
2929 Ga0501067_0087511
2930 Ga0501070_0116211
2931 Ga0501071_0001109
2932 Ga0501072_0004585
2933 Ga0501073_0013789
2934 Ga0501075_0036646
2935 Ga0501076_0000902
2936 Ga0501246_002775
2937 Ga0501225_0015135
2938 Ga0501079_0029789
2939 Ga0501083_0020137
2940 Ga0501083_0144163
2941 Ga0501241_009979
2942 Ga0501262_000181
2943 Ga0501262_002123
2944 Ga0501035_0002736
2945 Ga0501035_0015212
2946 Ga0501035_0022017
2947 Ga0501044_0001803
2948 Ga0501044_0002507
2949 Ga0501044_0003761
2950 Ga0501044_0061861
2951 Ga0501044_0178955
2952 Ga0501045_0056270
2953 nmdc:mga03683_12216_c1
2954 nmdc:mga03683_35302_c1
2955 nmdc:mga03683_4492_c1
2956 nmdc:mga03683_4655_c1
2957 nmdc:mga03683_5619_c1
2958 nmdc:mga03683_6955_c1
2959 nmdc:mga03n38_17488_c1
2960 nmdc:mga03n38_26844_c1
2961 nmdc:mga03n38_30837_c1
2962 nmdc:mga03n38_85573_c1
2963 nmdc:mga03n38_98519_c1
2964 nmdc:mga00v17_104432_c1
2965 nmdc:mga00v17_33119_c1
2966 nmdc:mga00v17_58800_c1
2967 nmdc:mga0yw44_148517_c1
2968 nmdc:mga0yw44_84836_c1
2969 nmdc:mga0k408_1081_c1
2970 nmdc:mga0k408_108584_c1
2971 nmdc:mga0k408_137202_c1
2972 nmdc:mga0k408_13834_c1
2973 nmdc:mga0k408_19496_c1
2974 nmdc:mga0k408_25391_c1
2975 nmdc:mga0k408_4664_c1
2976 nmdc:mga0k408_52279_c1
2977 nmdc:mga0k408_5276_c1
2978 nmdc:mga0k408_6711_c1
2979 nmdc:mga0k408_75326_c1
2980 nmdc:mga06z11_153292_c1
2981 nmdc:mga06z11_3666_c1
2982 nmdc:mga06z11_57755_c1
2983 nmdc:mga04h51_7806_c1
2984 nmdc:mga04h51_81838_c1
2985 nmdc:mga07m45_1155_c1
2986 nmdc:mga07m45_152014_c1
2987 nmdc:mga07m45_179669_c1
2988 nmdc:mga07m45_2192_c1
2989 nmdc:mga07m45_22422_c1
2990 nmdc:mga07m45_225999_c1
2991 nmdc:mga07m45_40714_c1
2992 nmdc:mga07m45_42714_c2
2993 nmdc:mga07m45_7463_c1
2994 nmdc:mga07m45_7550_c1
2995 nmdc:mga07m45_9064_c1
2996 nmdc:mga0n895_790177_c1
2997 nmdc:mga0sz30_1372_c1
2998 nmdc:mga0sz30_424_c1
2999 Ga0495601_0005754
3000 Ga0495601_0111250
3001 Ga0495601_0412530
3002 Ga0500610_0009289
3003 Ga0500635_0000055
3004 Ga0495595_0004360
3005 Ga0495619_0010788
3006 Ga0495619_0413361
3007 Ga0500578_0001033
3008 Ga0500643_004846
3009 Ga0500644_0044020
3010 Ga0500646_0015828
3011 Ga0500651_0000324
3012 Ga0500651_0009686
3013 Ga0500651_0155072
3014 Ga0500641_0007988
3015 Ga0500641_0020272
3016 Ga0500571_000080
3017 Ga0500595_001317
3018 Ga0500608_034717
3019 Ga0500618_009424
3020 Ga0500642_0008169
3021 Ga0500652_000391
3022 Ga0500658_0000210
3023 Ga0500658_0000493
3024 Ga0500559_0000636
3025 Ga0500559_0028883
3026 Ga0500568_0091746
3027 Ga0500574_006587
3028 Ga0500574_045910
3029 Ga0500604_0004012
3030 Ga0500616_0005410
3031 Ga0500619_002284
3032 Ga0500622_0000149
3033 Ga0500622_0006654
3034 Ga0500627_0018056
3035 Ga0500634_0005197
3036 Ga0500570_107409
3037 Ga0500645_001492
3038 Ga0500645_003076
3039 Ga0500645_046735
3040 Ga0501084_0002314
3041 Ga0466962_0054867
3042 Ga0530510_0016427
3043 2501082193
3044 2900635022

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

183

279

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.3936 81 247
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.3293 81 247
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.3152 6 247
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.3043 6 247
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.287 130 243
ID Description Score Start End Superfamily
af_P0AGH5_85_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4298 151 247 1.10.3720.10
af_O69723_10_204_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4144 149 249 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.3793 146 250 1.10.3720.10
af_P71746_10_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.3738 158 250 1.10.3720.10
af_Q2FYQ5_85_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.3676 149 258 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A519ETS4-F1-model_v4 ABC transporter permease 0.7938 2 127 GO:0005886
GO:0055085
AF-A0A519ETS4-F1-model_v4 ABC transporter permease 0.7825 2 127 GO:0005886
GO:0055085
AF-A0A258PZM4-F1-model_v4 deleted 0.7737 1 112
AF-A0A258PZM4-F1-model_v4 deleted 0.7372 1 112
AF-A0A519ZA18-F1-model_v4 ABC transporter permease 0.7046 1 157 GO:0005886
GO:0055085

Map