F494544
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1522 | 537 | 3045 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300046512|Ga0495610_0000757|Ga0495610_0000757_7734_8876 |
| Length | 380 |
| Sequence | LFKKYIQKGLPYGNPFFMPPASANWRRSDKQGGMGKLYLCILIPPLGGWGQMKQILNHLFEHKTFSREQSKGILMNIAQGKYNNAQMAAFMTAYCMRSITVEELEGFRDAMLELCLPVNLETEGLIDLCGTGGDGKDTFNISTLASFVVAGAGYKVAKHGNYGVSSGCGSSNVMEYLGYQFTNNIDELKRSADEANICFLHAPLFHPAMKTVAPIRKELGVKTFFNMLGPMVNPAKPDNQLVGVFNLELARVYAYLYQKSTTKYTIINALEGYDEISLTCDFKTFSADGEKINSVEDLGFELLDPKEIIGGDTVEASAAIFSNVLKGDGTPAQNNVVLANAALAIKTIGPEKTFGDCFYEAEEALFSKKALKSFNTLLQN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 97 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 213 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 220 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 221 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 222 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 224 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 225 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 226 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 227 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 228 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 229 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 230 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 231 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 232 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 233 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 235 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 237 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 238 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 240 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 241 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 242 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 243 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 246 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 247 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 248 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 249 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 252 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 254 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 256 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 257 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 258 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 259 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 260 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 261 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 262 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 263 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 264 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 265 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 266 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 267 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 268 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 269 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 271 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 272 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 273 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 274 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 275 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 276 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 277 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 278 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 279 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 280 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 281 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 282 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 283 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 284 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 285 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 286 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 287 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 288 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 289 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 290 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 291 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 334 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 335 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 336 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 337 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 338 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 339 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 340 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 341 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 342 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 343 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 344 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 345 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 347 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 348 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 364 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 365 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 366 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 367 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 368 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 369 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 370 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 371 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 372 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 373 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 374 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 375 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 376 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 377 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 378 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 379 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 380 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 381 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 385 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 386 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 387 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 388 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 389 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 390 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 393 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 394 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 398 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 399 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 400 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 401 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 402 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 403 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 404 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 405 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 406 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 407 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 408 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 409 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 412 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 413 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 414 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 415 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 416 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 417 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 418 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 419 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 420 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 421 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 423 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 424 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 425 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 426 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 427 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 428 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 429 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 430 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 431 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 432 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 433 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 434 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 435 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 436 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 437 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 438 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 439 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 440 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 441 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 442 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 443 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 444 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 445 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 446 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 447 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 448 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 449 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 450 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 451 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 452 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 453 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 454 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 455 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 456 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 457 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 458 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 459 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 460 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 461 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 462 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 463 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 464 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 465 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 466 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 467 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 468 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 469 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 470 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 471 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 472 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 473 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 474 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 475 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 476 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 477 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 478 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 479 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 480 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 481 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 482 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 483 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 484 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 485 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 486 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 487 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 488 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 489 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 490 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 491 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 492 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 493 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 494 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 495 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 496 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 497 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 498 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 499 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 500 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 501 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 502 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 503 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 504 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 505 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 506 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 507 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 508 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 509 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 510 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 511 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 512 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 513 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 514 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 515 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 516 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 517 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 518 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 519 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 520 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 521 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 522 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 523 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 524 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 525 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 526 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 527 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 528 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 529 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 530 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 531 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 532 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 533 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 534 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 535 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
| 536 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 537 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.38 |
| Metatranscriptomes | 0.07 |
| Isolates | 7.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.13 |
| Bulb | 0 |
| Endosphere | 6.83 |
| Nodule | 0.2 |
| Rhizoplane | 0.66 |
| Rhizosphere | 82.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495610_0000757 | 3300046512 | Bacteria | 30503 |
| 2 | SwRhRL2b_contig_1994362 | 2162886007 | Bacteria | 2992 |
| 3 | SwRhRL2b_contig_2088904 | 2162886007 | Bacteria | 1972 |
| 4 | SwRhRL2b_contig_3399644 | 2162886007 | Bacteria | 1678 |
| 5 | JGI24741J21665_1002082 | 3300001915 | Bacteria | 5348 |
| 6 | JGI24741J21665_1006025 | 3300001915 | Bacteria | 2472 |
| 7 | JGI24740J21852_10005751 | 3300001979 | Bacteria | 5210 |
| 8 | JGI24740J21852_10036460 | 3300001979 | Bacteria | 1527 |
| 9 | JGI24739J22299_10038781 | 3300001989 | Bacteria | 1600 |
| 10 | JGI24737J22298_10014703 | 3300001990 | Bacteria | 2539 |
| 11 | JGI24744J21845_10002612 | 3300002077 | Bacteria | 3681 |
| 12 | JGI25162J39368_1000017 | 3300002737 | Bacteria | 281385 |
| 13 | JGI25162J39368_1000614 | 3300002737 | Bacteria | 25616 |
| 14 | JGI25154J39366_1000040 | 3300002738 | Bacteria | 147410 |
| 15 | JGI25164J39214_1001787 | 3300002772 | Bacteria | 4180 |
| 16 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 17 | JGI25151J46595_10000005 | 3300003187 | Bacteria | 431598 |
| 18 | JGI25165J46597_1000634 | 3300003214 | Bacteria | 29066 |
| 19 | JGI25153J46596_10000040 | 3300003215 | Bacteria | 165523 |
| 20 | JGI25153J46596_10003346 | 3300003215 | Bacteria | 9003 |
| 21 | JGI25153J46596_10041566 | 3300003215 | Bacteria | 1412 |
| 22 | rootH1_10003601 | 3300003316 | Bacteria | 8624 |
| 23 | rootH1_10003601 | 3300003323 | Bacteria | 8581 |
| 24 | rootH1_10007102 | 3300003316 | Bacteria | 23916 |
| 25 | rootH1_10082958 | 3300003316 | Bacteria | 1273 |
| 26 | rootH1_10151462 | 3300003316 | Bacteria | 2036 |
| 27 | rootH2_10013635 | 3300003320 | Bacteria | 31266 |
| 28 | rootH2_10016199 | 3300003320 | Bacteria | 99895 |
| 29 | rootH2_10019144 | 3300003320 | Bacteria | 8706 |
| 30 | rootH2_10030072 | 3300003320 | Bacteria | 4856 |
| 31 | rootH2_10077704 | 3300003320 | Bacteria | 8498 |
| 32 | rootH2_10190169 | 3300003320 | Bacteria | 2218 |
| 33 | rootH2_10308990 | 3300003320 | Bacteria | 1586 |
| 34 | rootL2_10002914 | 3300003322 | Bacteria | 16634 |
| 35 | rootL2_10025842 | 3300003322 | Bacteria | 2271 |
| 36 | rootL2_10032238 | 3300003322 | Bacteria | 2626 |
| 37 | rootL2_10032239 | 3300003322 | Bacteria | 2459 |
| 38 | rootL2_10079467 | 3300003322 | Bacteria | 6903 |
| 39 | rootL2_10083418 | 3300003322 | Bacteria | 1603 |
| 40 | rootL2_10122039 | 3300003322 | Bacteria | 2235 |
| 41 | rootL2_10122858 | 3300003322 | Bacteria | 2150 |
| 42 | rootL2_10134929 | 3300003322 | Bacteria | 4501 |
| 43 | rootL2_10305032 | 3300003322 | Bacteria | 2251 |
| 44 | rootL2_10327582 | 3300003322 | Bacteria | 1538 |
| 45 | rootH1_10005821 | 3300003323 | Bacteria | 129122 |
| 46 | rootH1_10020847 | 3300003323 | Bacteria | 7444 |
| 47 | rootH1_10023753 | 3300003323 | Bacteria | 1453 |
| 48 | rootH1_10031683 | 3300003323 | Bacteria | 5917 |
| 49 | rootH1_10050118 | 3300003323 | Bacteria | 18955 |
| 50 | rootH1_10052662 | 3300003323 | Bacteria | 12054 |
| 51 | rootH1_10101577 | 3300003323 | Bacteria | 4765 |
| 52 | rootH1_10182853 | 3300003323 | Bacteria | 2552 |
| 53 | rootH1_10230655 | 3300003323 | Bacteria | 1855 |
| 54 | JGI25160J50197_1005075 | 3300003354 | Bacteria | 5557 |
| 55 | JGI25160J50197_1005718 | 3300003354 | Bacteria | 5138 |
| 56 | JGI25160J50197_1013229 | 3300003354 | Bacteria | 2823 |
| 57 | Ga0055535_1003449 | 3300003761 | Bacteria | 4482 |
| 58 | Ga0055536_1000564 | 3300003781 | Bacteria | 25322 |
| 59 | Ga0055528_1001650 | 3300003790 | Bacteria | 13115 |
| 60 | Ga0055530_10000387 | 3300003791 | Bacteria | 39558 |
| 61 | Ga0055530_10007698 | 3300003791 | Bacteria | 4481 |
| 62 | Ga0055531_10000131 | 3300003794 | Bacteria | 85257 |
| 63 | Ga0055531_10000156 | 3300003794 | Bacteria | 78858 |
| 64 | Ga0055543_1021355 | 3300004625 | Bacteria | 1181 |
| 65 | Ga0065165_1000102 | 3300005262 | Bacteria | 140917 |
| 66 | Ga0065165_1001626 | 3300005262 | Bacteria | 22857 |
| 67 | Ga0065714_10002826 | 3300005288 | Bacteria | 18386 |
| 68 | Ga0065714_10011701 | 3300005288 | Bacteria | 2858 |
| 69 | Ga0065714_10064551 | 3300005288 | Bacteria | 37166 |
| 70 | Ga0065714_10065701 | 3300005288 | Bacteria | 8816 |
| 71 | Ga0065714_10066278 | 3300005288 | Bacteria | 7219 |
| 72 | Ga0065714_10070733 | 3300005288 | Bacteria | 3779 |
| 73 | Ga0065714_10071292 | 3300005288 | Bacteria | 3606 |
| 74 | Ga0065714_10085181 | 3300005288 | Bacteria | 2127 |
| 75 | Ga0065714_10136175 | 3300005288 | Bacteria | 1207 |
| 76 | Ga0065704_10070466 | 3300005289 | Bacteria | 23732 |
| 77 | Ga0065704_10070721 | 3300005289 | Bacteria | 17058 |
| 78 | Ga0065704_10072255 | 3300005289 | Bacteria | 8855 |
| 79 | Ga0065704_10073358 | 3300005289 | Bacteria | 7256 |
| 80 | Ga0065704_10093766 | 3300005289 | Bacteria | 2579 |
| 81 | Ga0065704_10125453 | 3300005289 | Bacteria | 1702 |
| 82 | Ga0065712_10076829 | 3300005290 | Bacteria | 3583 |
| 83 | Ga0065712_10106080 | 3300005290 | Bacteria | 1896 |
| 84 | Ga0070658_10000091 | 3300005327 | Bacteria | 81263 |
| 85 | Ga0070658_10057776 | 3300005327 | Bacteria | 3156 |
| 86 | Ga0070676_10000336 | 3300005328 | Bacteria | 21357 |
| 87 | Ga0070676_10002755 | 3300005328 | Bacteria | 9076 |
| 88 | Ga0070676_10003243 | 3300005328 | Bacteria | 8443 |
| 89 | Ga0070676_10060138 | 3300005328 | Bacteria | 2255 |
| 90 | Ga0070683_100000725 | 3300005329 | Bacteria | 24107 |
| 91 | Ga0070683_100010872 | 3300005329 | Bacteria | 7837 |
| 92 | Ga0070683_100032588 | 3300005329 | Bacteria | 4746 |
| 93 | Ga0070683_100042317 | 3300005329 | Bacteria | 4194 |
| 94 | Ga0070690_100005983 | 3300005330 | Bacteria | 6872 |
| 95 | Ga0070690_100275978 | 3300005330 | Bacteria | 1197 |
| 96 | Ga0070670_100039428 | 3300005331 | Bacteria | 4062 |
| 97 | Ga0070670_100054985 | 3300005331 | Bacteria | 3417 |
| 98 | Ga0070670_100060696 | 3300005331 | Bacteria | 3246 |
| 99 | Ga0070670_100066481 | 3300005331 | Bacteria | 3094 |
| 100 | Ga0070670_100082144 | 3300005331 | Bacteria | 2769 |
| 101 | Ga0070670_100384887 | 3300005331 | Bacteria | 1236 |
| 102 | Ga0068869_100039941 | 3300005334 | Bacteria | 3352 |
| 103 | Ga0068869_100069980 | 3300005334 | Bacteria | 2595 |
| 104 | Ga0068869_100127915 | 3300005334 | Bacteria | 1950 |
| 105 | Ga0068869_100284187 | 3300005334 | Bacteria | 1331 |
| 106 | Ga0070666_10000051 | 3300005335 | Bacteria | 99740 |
| 107 | Ga0070666_10010156 | 3300005335 | Bacteria | 5881 |
| 108 | Ga0070666_10010207 | 3300005335 | Bacteria | 5868 |
| 109 | Ga0070666_10013609 | 3300005335 | Bacteria | 5165 |
| 110 | Ga0070666_10143122 | 3300005335 | Bacteria | 1666 |
| 111 | Ga0070680_100002139 | 3300005336 | Bacteria | 14605 |
| 112 | Ga0070680_100050858 | 3300005336 | Bacteria | 3380 |
| 113 | Ga0070680_100061374 | 3300005336 | Bacteria | 3077 |
| 114 | Ga0070680_100065624 | 3300005336 | Bacteria | 2975 |
| 115 | Ga0070680_100331896 | 3300005336 | Bacteria | 1292 |
| 116 | Ga0070682_100000060 | 3300005337 | Bacteria | 105136 |
| 117 | Ga0070682_100000596 | 3300005337 | Bacteria | 22012 |
| 118 | Ga0070682_100001275 | 3300005337 | Bacteria | 14290 |
| 119 | Ga0070682_100025241 | 3300005337 | Bacteria | 3545 |
| 120 | Ga0070682_100026905 | 3300005337 | Bacteria | 3446 |
| 121 | Ga0068868_100010338 | 3300005338 | Bacteria | 6749 |
| 122 | Ga0068868_100015086 | 3300005338 | Bacteria | 5708 |
| 123 | Ga0068868_100016530 | 3300005338 | Bacteria | 5482 |
| 124 | Ga0068868_100076548 | 3300005338 | Bacteria | 2675 |
| 125 | Ga0068868_100080003 | 3300005338 | Bacteria | 2618 |
| 126 | Ga0068868_100080631 | 3300005338 | Bacteria | 2608 |
| 127 | Ga0068868_100085678 | 3300005338 | Bacteria | 2532 |
| 128 | Ga0068868_100162816 | 3300005338 | Bacteria | 1843 |
| 129 | Ga0068868_100198670 | 3300005338 | Bacteria | 1671 |
| 130 | Ga0070660_100000800 | 3300005339 | Bacteria | 20862 |
| 131 | Ga0070660_100009297 | 3300005339 | Bacteria | 6907 |
| 132 | Ga0070660_100071902 | 3300005339 | Bacteria | 2702 |
| 133 | Ga0070660_100103890 | 3300005339 | Bacteria | 2253 |
| 134 | Ga0070660_100106276 | 3300005339 | Bacteria | 2229 |
| 135 | Ga0070660_100133278 | 3300005339 | Bacteria | 1989 |
| 136 | Ga0070689_100001732 | 3300005340 | Bacteria | 13951 |
| 137 | Ga0070689_100013351 | 3300005340 | Bacteria | 5941 |
| 138 | Ga0070689_100014808 | 3300005340 | Bacteria | 5674 |
| 139 | Ga0070689_100137929 | 3300005340 | Bacteria | 1959 |
| 140 | Ga0070691_10033514 | 3300005341 | Bacteria | 2417 |
| 141 | Ga0070687_100125604 | 3300005343 | Bacteria | 1474 |
| 142 | Ga0070661_100003143 | 3300005344 | Bacteria | 11357 |
| 143 | Ga0070661_100022549 | 3300005344 | Bacteria | 4508 |
| 144 | Ga0070661_100118026 | 3300005344 | Bacteria | 1985 |
| 145 | Ga0070668_100002494 | 3300005347 | Bacteria | 13548 |
| 146 | Ga0070668_100100239 | 3300005347 | Bacteria | 2294 |
| 147 | Ga0070668_100110332 | 3300005347 | Bacteria | 2189 |
| 148 | Ga0070668_100132503 | 3300005347 | Bacteria | 2001 |
| 149 | Ga0070669_100036574 | 3300005353 | Bacteria | 3558 |
| 150 | Ga0070669_100048455 | 3300005353 | Bacteria | 3101 |
| 151 | Ga0070669_100135719 | 3300005353 | Bacteria | 1892 |
| 152 | Ga0070669_100141137 | 3300005353 | Bacteria | 1857 |
| 153 | Ga0070669_100237791 | 3300005353 | Bacteria | 1446 |
| 154 | Ga0070675_100013600 | 3300005354 | Bacteria | 6399 |
| 155 | Ga0070675_100025711 | 3300005354 | Bacteria | 4720 |
| 156 | Ga0070675_100055173 | 3300005354 | Bacteria | 3270 |
| 157 | Ga0070675_100055271 | 3300005354 | Unclassified | 3268 |
| 158 | Ga0070675_100080740 | 3300005354 | Bacteria | 2711 |
| 159 | Ga0070675_100322491 | 3300005354 | Bacteria | 1365 |
| 160 | Ga0070671_100004357 | 3300005355 | Bacteria | 11192 |
| 161 | Ga0070671_100049587 | 3300005355 | Bacteria | 3493 |
| 162 | Ga0070671_100074043 | 3300005355 | Bacteria | 2845 |
| 163 | Ga0070671_100182326 | 3300005355 | Bacteria | 1778 |
| 164 | Ga0070671_100198762 | 3300005355 | Bacteria | 1700 |
| 165 | Ga0070671_100208844 | 3300005355 | Bacteria | 1656 |
| 166 | Ga0070674_100084152 | 3300005356 | Bacteria | 2280 |
| 167 | Ga0070673_100001990 | 3300005364 | Bacteria | 12324 |
| 168 | Ga0070673_100017265 | 3300005364 | Bacteria | 5126 |
| 169 | Ga0070673_100121048 | 3300005364 | Bacteria | 2183 |
| 170 | Ga0070688_100008021 | 3300005365 | Bacteria | 5714 |
| 171 | Ga0070688_100177611 | 3300005365 | Unclassified | 1474 |
| 172 | Ga0070659_100000854 | 3300005366 | Bacteria | 22245 |
| 173 | Ga0070659_100007938 | 3300005366 | Bacteria | 7732 |
| 174 | Ga0070659_100011576 | 3300005366 | Bacteria | 6529 |
| 175 | Ga0070659_100024762 | 3300005366 | Bacteria | 4603 |
| 176 | Ga0070659_100035580 | 3300005366 | Bacteria | 3878 |
| 177 | Ga0070659_100244042 | 3300005366 | Bacteria | 1487 |
| 178 | Ga0070667_100000492 | 3300005367 | Bacteria | 40164 |
| 179 | Ga0070667_100047694 | 3300005367 | Bacteria | 3604 |
| 180 | Ga0070667_100054456 | 3300005367 | Bacteria | 3378 |
| 181 | Ga0070667_100103565 | 3300005367 | Bacteria | 2460 |
| 182 | Ga0070667_100294027 | 3300005367 | Bacteria | 1461 |
| 183 | Ga0070701_10025529 | 3300005438 | Bacteria | 2870 |
| 184 | Ga0070701_10045950 | 3300005438 | Bacteria | 2242 |
| 185 | Ga0070700_100077166 | 3300005441 | Bacteria | 2141 |
| 186 | Ga0070663_100068570 | 3300005455 | Bacteria | 2575 |
| 187 | Ga0070678_100010791 | 3300005456 | Bacteria | 5599 |
| 188 | Ga0070678_100013945 | 3300005456 | Bacteria | 5054 |
| 189 | Ga0070678_100072331 | 3300005456 | Bacteria | 2584 |
| 190 | Ga0070678_100241240 | 3300005456 | Bacteria | 1511 |
| 191 | Ga0070662_100000011 | 3300005457 | Bacteria | 133652 |
| 192 | Ga0070662_100004086 | 3300005457 | Bacteria | 9167 |
| 193 | Ga0070662_100036135 | 3300005457 | Bacteria | 3493 |
| 194 | Ga0070662_100056097 | 3300005457 | Bacteria | 2860 |
| 195 | Ga0070662_100131800 | 3300005457 | Bacteria | 1928 |
| 196 | Ga0070662_100243812 | 3300005457 | Bacteria | 1442 |
| 197 | Ga0070662_100309850 | 3300005457 | Bacteria | 1285 |
| 198 | Ga0070681_10021777 | 3300005458 | Bacteria | 6428 |
| 199 | Ga0070681_10040812 | 3300005458 | Bacteria | 4649 |
| 200 | Ga0070681_10141139 | 3300005458 | Unclassified | 2339 |
| 201 | Ga0070681_10242445 | 3300005458 | Unclassified | 1716 |
| 202 | Ga0070681_10293673 | 3300005458 | Unclassified | 1535 |
| 203 | Ga0068867_100000841 | 3300005459 | Bacteria | 20653 |
| 204 | Ga0068867_100132144 | 3300005459 | Bacteria | 1941 |
| 205 | Ga0070685_10016536 | 3300005466 | Bacteria | 3932 |
| 206 | Ga0070698_100074506 | 3300005471 | Bacteria | 3400 |
| 207 | Ga0070679_100000575 | 3300005530 | Bacteria | 31162 |
| 208 | Ga0070679_100004536 | 3300005530 | Bacteria | 12825 |
| 209 | Ga0070679_100029492 | 3300005530 | Bacteria | 5413 |
| 210 | Ga0070679_100042885 | 3300005530 | Bacteria | 4506 |
| 211 | Ga0070679_100043938 | 3300005530 | Bacteria | 4450 |
| 212 | Ga0070679_100045741 | 3300005530 | Bacteria | 4361 |
| 213 | Ga0070679_100062675 | 3300005530 | Bacteria | 3707 |
| 214 | Ga0070679_100170887 | 3300005530 | Bacteria | 2147 |
| 215 | Ga0070684_100000228 | 3300005535 | Bacteria | 38984 |
| 216 | Ga0070684_100021275 | 3300005535 | Bacteria | 5394 |
| 217 | Ga0070684_100056123 | 3300005535 | Bacteria | 3436 |
| 218 | Ga0070684_100117942 | 3300005535 | Bacteria | 2385 |
| 219 | Ga0068853_100000221 | 3300005539 | Bacteria | 40294 |
| 220 | Ga0068853_100020583 | 3300005539 | Bacteria | 5487 |
| 221 | Ga0068853_100052784 | 3300005539 | Bacteria | 3501 |
| 222 | Ga0068853_100055688 | 3300005539 | Bacteria | 3409 |
| 223 | Ga0068853_100057721 | 3300005539 | Bacteria | 3350 |
| 224 | Ga0068853_100091008 | 3300005539 | Bacteria | 2682 |
| 225 | Ga0068853_100107829 | 3300005539 | Bacteria | 2470 |
| 226 | Ga0068853_100159796 | 3300005539 | Bacteria | 2033 |
| 227 | Ga0068853_100310572 | 3300005539 | Bacteria | 1459 |
| 228 | Ga0070672_100039481 | 3300005543 | Bacteria | 3616 |
| 229 | Ga0070672_100193930 | 3300005543 | Bacteria | 1697 |
| 230 | Ga0070672_100213679 | 3300005543 | Bacteria | 1616 |
| 231 | Ga0070686_100054827 | 3300005544 | Bacteria | 2551 |
| 232 | Ga0070686_100126038 | 3300005544 | Unclassified | 1764 |
| 233 | Ga0070686_100257432 | 3300005544 | Bacteria | 1278 |
| 234 | Ga0070693_100045539 | 3300005547 | Bacteria | 2487 |
| 235 | Ga0070693_100232174 | 3300005547 | Bacteria | 1214 |
| 236 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 237 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 238 | Ga0070665_100005742 | 3300005548 | Bacteria | 12739 |
| 239 | Ga0070665_100060884 | 3300005548 | Bacteria | 3784 |
| 240 | Ga0068855_100007886 | 3300005563 | Bacteria | 12858 |
| 241 | Ga0068855_100019632 | 3300005563 | Bacteria | 8119 |
| 242 | Ga0068855_100022883 | 3300005563 | Bacteria | 7490 |
| 243 | Ga0068855_100029930 | 3300005563 | Bacteria | 6511 |
| 244 | Ga0068855_100030208 | 3300005563 | Bacteria | 6482 |
| 245 | Ga0068855_100042513 | 3300005563 | Bacteria | 5384 |
| 246 | Ga0068855_100064567 | 3300005563 | Bacteria | 4270 |
| 247 | Ga0068855_100075213 | 3300005563 | Bacteria | 3922 |
| 248 | Ga0068855_100089498 | 3300005563 | Bacteria | 3554 |
| 249 | Ga0068855_100139292 | 3300005563 | Bacteria | 2767 |
| 250 | Ga0068855_100204082 | 3300005563 | Bacteria | 2224 |
| 251 | Ga0070664_100003241 | 3300005564 | Bacteria | 13152 |
| 252 | Ga0070664_100070355 | 3300005564 | Bacteria | 2996 |
| 253 | Ga0070664_100072381 | 3300005564 | Bacteria | 2956 |
| 254 | Ga0070664_100297839 | 3300005564 | Bacteria | 1457 |
| 255 | Ga0068857_100001119 | 3300005577 | Bacteria | 20854 |
| 256 | Ga0068857_100007157 | 3300005577 | Bacteria | 9611 |
| 257 | Ga0068857_100018337 | 3300005577 | Bacteria | 6141 |
| 258 | Ga0068857_100021607 | 3300005577 | Bacteria | 5663 |
| 259 | Ga0068857_100024160 | 3300005577 | Bacteria | 5350 |
| 260 | Ga0068857_100033737 | 3300005577 | Bacteria | 4527 |
| 261 | Ga0068857_100272891 | 3300005577 | Bacteria | 1554 |
| 262 | Ga0068854_100074699 | 3300005578 | Bacteria | 2487 |
| 263 | Ga0068854_100163987 | 3300005578 | Bacteria | 1724 |
| 264 | Ga0068854_100176276 | 3300005578 | Unclassified | 1667 |
| 265 | Ga0068854_100232744 | 3300005578 | Bacteria | 1463 |
| 266 | Ga0068856_100001307 | 3300005614 | Bacteria | 26219 |
| 267 | Ga0068856_100002043 | 3300005614 | Bacteria | 20938 |
| 268 | Ga0068856_100007064 | 3300005614 | Bacteria | 10963 |
| 269 | Ga0068856_100095550 | 3300005614 | Bacteria | 2960 |
| 270 | Ga0068856_100203889 | 3300005614 | Bacteria | 1992 |
| 271 | Ga0068856_100235515 | 3300005614 | Bacteria | 1846 |
| 272 | Ga0068856_100402951 | 3300005614 | Unclassified | 1388 |
| 273 | Ga0068852_100002006 | 3300005616 | Bacteria | 13883 |
| 274 | Ga0068852_100002446 | 3300005616 | Bacteria | 12784 |
| 275 | Ga0068852_100018674 | 3300005616 | Bacteria | 5466 |
| 276 | Ga0068852_100023547 | 3300005616 | Bacteria | 4958 |
| 277 | Ga0068852_100033393 | 3300005616 | Bacteria | 4271 |
| 278 | Ga0068852_100041003 | 3300005616 | Bacteria | 3910 |
| 279 | Ga0068852_100061600 | 3300005616 | Bacteria | 3261 |
| 280 | Ga0068852_100069230 | 3300005616 | Bacteria | 3092 |
| 281 | Ga0068852_100123507 | 3300005616 | Bacteria | 2374 |
| 282 | Ga0068852_100149038 | 3300005616 | Bacteria | 2174 |
| 283 | Ga0068852_100175121 | 3300005616 | Bacteria | 2014 |
| 284 | Ga0068852_100250677 | 3300005616 | Unclassified | 1696 |
| 285 | Ga0068852_100327119 | 3300005616 | Bacteria | 1490 |
| 286 | Ga0068852_100559387 | 3300005616 | Bacteria | 1145 |
| 287 | Ga0068859_100000023 | 3300005617 | Bacteria | 221914 |
| 288 | Ga0068859_100008109 | 3300005617 | Bacteria | 10653 |
| 289 | Ga0068859_100009853 | 3300005617 | Bacteria | 9646 |
| 290 | Ga0068859_100033356 | 3300005617 | Bacteria | 5169 |
| 291 | Ga0068859_100067422 | 3300005617 | Bacteria | 3613 |
| 292 | Ga0068859_100085184 | 3300005617 | Bacteria | 3206 |
| 293 | Ga0068859_100171254 | 3300005617 | Bacteria | 2252 |
| 294 | Ga0068859_100243384 | 3300005617 | Bacteria | 1888 |
| 295 | Ga0068859_100324535 | 3300005617 | Bacteria | 1633 |
| 296 | Ga0068859_100605749 | 3300005617 | Bacteria | 1188 |
| 297 | Ga0068864_100005800 | 3300005618 | Bacteria | 10131 |
| 298 | Ga0068864_100007839 | 3300005618 | Bacteria | 8801 |
| 299 | Ga0068864_100026175 | 3300005618 | Bacteria | 4918 |
| 300 | Ga0068864_100081365 | 3300005618 | Bacteria | 2839 |
| 301 | Ga0068864_100273851 | 3300005618 | Bacteria | 1574 |
| 302 | Ga0068864_100381557 | 3300005618 | Bacteria | 1336 |
| 303 | Ga0068861_100009306 | 3300005719 | Bacteria | 6779 |
| 304 | Ga0068861_100017858 | 3300005719 | Bacteria | 5041 |
| 305 | Ga0068861_100202055 | 3300005719 | Bacteria | 1669 |
| 306 | Ga0068861_100361265 | 3300005719 | Bacteria | 1277 |
| 307 | Ga0068861_100364196 | 3300005719 | Bacteria | 1272 |
| 308 | Ga0068870_10194693 | 3300005840 | Bacteria | 1225 |
| 309 | Ga0068863_100001812 | 3300005841 | Bacteria | 21216 |
| 310 | Ga0068863_100038562 | 3300005841 | Bacteria | 4545 |
| 311 | Ga0068863_100093702 | 3300005841 | Bacteria | 2850 |
| 312 | Ga0068863_100129455 | 3300005841 | Bacteria | 2409 |
| 313 | Ga0068863_100194530 | 3300005841 | Bacteria | 1949 |
| 314 | Ga0068858_100008485 | 3300005842 | Bacteria | 9874 |
| 315 | Ga0068858_100048079 | 3300005842 | Bacteria | 3954 |
| 316 | Ga0068858_100252575 | 3300005842 | Bacteria | 1675 |
| 317 | Ga0068858_100310467 | 3300005842 | Bacteria | 1506 |
| 318 | Ga0068860_100000046 | 3300005843 | Bacteria | 214800 |
| 319 | Ga0068860_100000916 | 3300005843 | Bacteria | 32698 |
| 320 | Ga0068860_100005408 | 3300005843 | Bacteria | 12959 |
| 321 | Ga0068860_100007358 | 3300005843 | Bacteria | 11008 |
| 322 | Ga0068860_100024991 | 3300005843 | Bacteria | 5767 |
| 323 | Ga0068860_100034035 | 3300005843 | Bacteria | 4887 |
| 324 | Ga0068862_100003779 | 3300005844 | Bacteria | 12914 |
| 325 | Ga0068862_100022881 | 3300005844 | Bacteria | 5231 |
| 326 | Ga0068862_100085090 | 3300005844 | Bacteria | 2748 |
| 327 | Ga0068862_100188580 | 3300005844 | Bacteria | 1854 |
| 328 | Ga0068862_100265707 | 3300005844 | Bacteria | 1567 |
| 329 | Ga0081540_1029157 | 3300005983 | Bacteria | 3081 |
| 330 | Ga0070716_100051038 | 3300006173 | Unclassified | 2350 |
| 331 | Ga0075366_10000333 | 3300006195 | Bacteria | 21671 |
| 332 | Ga0075366_10040925 | 3300006195 | Bacteria | 2742 |
| 333 | Ga0075366_10085039 | 3300006195 | Bacteria | 1892 |
| 334 | Ga0075366_10095111 | 3300006195 | Bacteria | 1786 |
| 335 | Ga0097621_100000150 | 3300006237 | Bacteria | 42846 |
| 336 | Ga0097621_100000847 | 3300006237 | Bacteria | 21541 |
| 337 | Ga0097621_100001572 | 3300006237 | Bacteria | 15606 |
| 338 | Ga0097621_100028478 | 3300006237 | Bacteria | 4402 |
| 339 | Ga0097621_100062269 | 3300006237 | Bacteria | 3063 |
| 340 | Ga0097621_100120542 | 3300006237 | Bacteria | 2224 |
| 341 | Ga0097621_100123615 | 3300006237 | Bacteria | 2197 |
| 342 | Ga0075370_10091284 | 3300006353 | Bacteria | 1757 |
| 343 | Ga0068871_100000027 | 3300006358 | Bacteria | 78588 |
| 344 | Ga0068871_100000354 | 3300006358 | Bacteria | 31915 |
| 345 | Ga0068871_100001006 | 3300006358 | Bacteria | 18890 |
| 346 | Ga0068871_100001864 | 3300006358 | Bacteria | 14258 |
| 347 | Ga0068871_100040970 | 3300006358 | Unclassified | 3712 |
| 348 | Ga0068871_100120184 | 3300006358 | Bacteria | 2218 |
| 349 | Ga0068871_100125590 | 3300006358 | Bacteria | 2171 |
| 350 | Ga0068871_100223279 | 3300006358 | Unclassified | 1633 |
| 351 | Ga0068871_100287080 | 3300006358 | Bacteria | 1441 |
| 352 | Ga0068871_100316893 | 3300006358 | Bacteria | 1372 |
| 353 | Ga0075428_100024587 | 3300006844 | Bacteria | 6666 |
| 354 | Ga0075428_100074722 | 3300006844 | Bacteria | 3702 |
| 355 | Ga0075430_100010054 | 3300006846 | Bacteria | 8005 |
| 356 | Ga0075431_100004434 | 3300006847 | Bacteria | 13760 |
| 357 | Ga0075429_100005840 | 3300006880 | Bacteria | 10619 |
| 358 | Ga0075429_100022996 | 3300006880 | Bacteria | 5403 |
| 359 | Ga0068865_100000547 | 3300006881 | Bacteria | 20866 |
| 360 | Ga0068865_100020901 | 3300006881 | Bacteria | 4251 |
| 361 | Ga0068865_100225179 | 3300006881 | Bacteria | 1468 |
| 362 | Ga0097620_100000023 | 3300006931 | Bacteria | 221914 |
| 363 | Ga0097620_100008109 | 3300006931 | Bacteria | 10653 |
| 364 | Ga0097620_100009853 | 3300006931 | Bacteria | 9646 |
| 365 | Ga0097620_100033356 | 3300006931 | Bacteria | 5169 |
| 366 | Ga0097620_100067425 | 3300006931 | Bacteria | 3613 |
| 367 | Ga0097620_100085179 | 3300006931 | Bacteria | 3206 |
| 368 | Ga0097620_100171243 | 3300006931 | Bacteria | 2252 |
| 369 | Ga0097620_100243357 | 3300006931 | Bacteria | 1888 |
| 370 | Ga0097620_100324543 | 3300006931 | Bacteria | 1633 |
| 371 | Ga0097620_100605775 | 3300006931 | Bacteria | 1188 |
| 372 | Ga0079104_1000178 | 3300006946 | Bacteria | 90393 |
| 373 | Ga0105244_10000002 | 3300009036 | Bacteria | 495554 |
| 374 | Ga0105240_10000074 | 3300009093 | Bacteria | 199611 |
| 375 | Ga0105240_10000598 | 3300009093 | Bacteria | 67006 |
| 376 | Ga0105240_10000626 | 3300009093 | Bacteria | 65179 |
| 377 | Ga0105240_10001595 | 3300009093 | Bacteria | 38516 |
| 378 | Ga0105240_10007062 | 3300009093 | Bacteria | 16373 |
| 379 | Ga0105240_10015708 | 3300009093 | Bacteria | 10273 |
| 380 | Ga0105240_10033651 | 3300009093 | Bacteria | 6617 |
| 381 | Ga0105240_10046672 | 3300009093 | Bacteria | 5488 |
| 382 | Ga0105240_10078410 | 3300009093 | Bacteria | 4068 |
| 383 | Ga0105240_10266249 | 3300009093 | Bacteria | 1975 |
| 384 | Ga0105240_10450625 | 3300009093 | Bacteria | 1440 |
| 385 | Ga0105240_10552688 | 3300009093 | Bacteria | 1274 |
| 386 | Ga0111539_10001328 | 3300009094 | Bacteria | 32966 |
| 387 | Ga0111539_10015483 | 3300009094 | Bacteria | 9481 |
| 388 | Ga0111539_10024925 | 3300009094 | Bacteria | 7332 |
| 389 | Ga0105245_10092150 | 3300009098 | Bacteria | 2790 |
| 390 | Ga0105247_10003751 | 3300009101 | Bacteria | 9849 |
| 391 | Ga0105247_10005412 | 3300009101 | Bacteria | 8044 |
| 392 | Ga0105247_10037118 | 3300009101 | Bacteria | 2972 |
| 393 | Ga0114129_10020916 | 3300009147 | Bacteria | 9296 |
| 394 | Ga0114129_10187025 | 3300009147 | Bacteria | 2814 |
| 395 | Ga0114129_10195324 | 3300009147 | Bacteria | 2744 |
| 396 | Ga0105243_10000018 | 3300009148 | Bacteria | 227618 |
| 397 | Ga0105243_10001177 | 3300009148 | Bacteria | 23661 |
| 398 | Ga0105241_10000659 | 3300009174 | Bacteria | 25872 |
| 399 | Ga0105241_10000881 | 3300009174 | Bacteria | 22671 |
| 400 | Ga0105241_10006159 | 3300009174 | Bacteria | 8846 |
| 401 | Ga0105241_10014580 | 3300009174 | Bacteria | 5756 |
| 402 | Ga0105241_10031709 | 3300009174 | Bacteria | 3958 |
| 403 | Ga0105241_10034893 | 3300009174 | Bacteria | 3782 |
| 404 | Ga0105241_10041058 | 3300009174 | Bacteria | 3494 |
| 405 | Ga0105241_10160453 | 3300009174 | Bacteria | 1848 |
| 406 | Ga0105241_10303576 | 3300009174 | Bacteria | 1371 |
| 407 | Ga0105242_10006091 | 3300009176 | Bacteria | 9297 |
| 408 | Ga0105242_10012454 | 3300009176 | Bacteria | 6549 |
| 409 | Ga0105242_10040286 | 3300009176 | Bacteria | 3764 |
| 410 | Ga0105242_10312645 | 3300009176 | Bacteria | 1438 |
| 411 | Ga0105242_10468062 | 3300009176 | Bacteria | 1192 |
| 412 | Ga0105248_10059502 | 3300009177 | Bacteria | 4291 |
| 413 | Ga0105237_10000755 | 3300009545 | Bacteria | 44312 |
| 414 | Ga0105237_10001361 | 3300009545 | Bacteria | 32387 |
| 415 | Ga0105237_10002829 | 3300009545 | Bacteria | 21108 |
| 416 | Ga0105237_10004143 | 3300009545 | Bacteria | 16893 |
| 417 | Ga0105237_10007407 | 3300009545 | Bacteria | 12017 |
| 418 | Ga0105237_10009395 | 3300009545 | Bacteria | 10472 |
| 419 | Ga0105237_10020135 | 3300009545 | Bacteria | 6886 |
| 420 | Ga0105237_10021690 | 3300009545 | Bacteria | 6601 |
| 421 | Ga0105237_10025001 | 3300009545 | Bacteria | 6110 |
| 422 | Ga0105237_10093900 | 3300009545 | Bacteria | 2989 |
| 423 | Ga0105237_10094887 | 3300009545 | Unclassified | 2972 |
| 424 | Ga0105237_10105937 | 3300009545 | Bacteria | 2803 |
| 425 | Ga0105237_10113562 | 3300009545 | Bacteria | 2701 |
| 426 | Ga0105237_10145894 | 3300009545 | Bacteria | 2361 |
| 427 | Ga0105237_10204008 | 3300009545 | Bacteria | 1977 |
| 428 | Ga0105238_10001132 | 3300009551 | Bacteria | 26885 |
| 429 | Ga0105238_10011571 | 3300009551 | Bacteria | 8890 |
| 430 | Ga0105238_10035958 | 3300009551 | Bacteria | 5035 |
| 431 | Ga0105238_10165317 | 3300009551 | Bacteria | 2188 |
| 432 | Ga0105249_10008464 | 3300009553 | Bacteria | 8963 |
| 433 | Ga0105249_10012834 | 3300009553 | Bacteria | 7392 |
| 434 | Ga0105249_10057441 | 3300009553 | Bacteria | 3565 |
| 435 | Ga0105249_10059671 | 3300009553 | Bacteria | 3499 |
| 436 | Ga0105249_10266201 | 3300009553 | Bacteria | 1705 |
| 437 | Ga0105239_10000002 | 3300010375 | Bacteria | 610298 |
| 438 | Ga0105239_10000012 | 3300010375 | Bacteria | 332279 |
| 439 | Ga0105239_10000048 | 3300010375 | Bacteria | 177855 |
| 440 | Ga0105239_10000055 | 3300010375 | Bacteria | 158211 |
| 441 | Ga0105239_10000204 | 3300010375 | Bacteria | 87242 |
| 442 | Ga0105239_10000785 | 3300010375 | Bacteria | 45044 |
| 443 | Ga0105239_10002090 | 3300010375 | Bacteria | 25893 |
| 444 | Ga0105239_10019429 | 3300010375 | Bacteria | 7501 |
| 445 | Ga0105239_10048437 | 3300010375 | Bacteria | 4660 |
| 446 | Ga0105239_10069310 | 3300010375 | Bacteria | 3875 |
| 447 | Ga0105239_10075461 | 3300010375 | Bacteria | 3707 |
| 448 | Ga0105239_10104224 | 3300010375 | Bacteria | 3141 |
| 449 | Ga0105239_10155609 | 3300010375 | Bacteria | 2552 |
| 450 | Ga0105239_10181833 | 3300010375 | Bacteria | 2352 |
| 451 | Ga0105239_10300916 | 3300010375 | Bacteria | 1806 |
| 452 | Ga0105246_10023007 | 3300011119 | Bacteria | 4028 |
| 453 | Ga0105246_10066024 | 3300011119 | Bacteria | 2532 |
| 454 | Ga0105246_10076160 | 3300011119 | Bacteria | 2377 |
| 455 | Ga0105246_10208673 | 3300011119 | Bacteria | 1523 |
| 456 | Ga0157373_10000001 | 3300013100 | Bacteria | 864756 |
| 457 | Ga0157373_10000029 | 3300013100 | Bacteria | 131988 |
| 458 | Ga0157373_10000094 | 3300013100 | Bacteria | 73332 |
| 459 | Ga0157373_10007113 | 3300013100 | Bacteria | 8342 |
| 460 | Ga0157373_10016080 | 3300013100 | Bacteria | 5462 |
| 461 | Ga0157373_10016186 | 3300013100 | Bacteria | 5442 |
| 462 | Ga0157373_10028385 | 3300013100 | Bacteria | 4036 |
| 463 | Ga0157373_10028554 | 3300013100 | Bacteria | 4024 |
| 464 | Ga0157373_10030973 | 3300013100 | Bacteria | 3849 |
| 465 | Ga0157373_10039128 | 3300013100 | Bacteria | 3396 |
| 466 | Ga0157373_10291476 | 3300013100 | Bacteria | 1157 |
| 467 | Ga0157371_10000119 | 3300013102 | Bacteria | 120350 |
| 468 | Ga0157371_10000216 | 3300013102 | Bacteria | 83975 |
| 469 | Ga0157371_10000523 | 3300013102 | Bacteria | 45888 |
| 470 | Ga0157371_10001598 | 3300013102 | Bacteria | 23238 |
| 471 | Ga0157371_10001727 | 3300013102 | Bacteria | 22180 |
| 472 | Ga0157371_10003284 | 3300013102 | Bacteria | 14807 |
| 473 | Ga0157371_10003654 | 3300013102 | Bacteria | 13849 |
| 474 | Ga0157371_10003809 | 3300013102 | Bacteria | 13493 |
| 475 | Ga0157371_10008389 | 3300013102 | Bacteria | 8237 |
| 476 | Ga0157371_10021342 | 3300013102 | Bacteria | 4755 |
| 477 | Ga0157371_10032895 | 3300013102 | Bacteria | 3729 |
| 478 | Ga0157371_10034773 | 3300013102 | Bacteria | 3613 |
| 479 | Ga0157371_10050101 | 3300013102 | Bacteria | 2967 |
| 480 | Ga0157371_10053609 | 3300013102 | Bacteria | 2864 |
| 481 | Ga0157371_10061232 | 3300013102 | Bacteria | 2669 |
| 482 | Ga0157371_10064775 | 3300013102 | Unclassified | 2589 |
| 483 | Ga0157371_10101283 | 3300013102 | Bacteria | 2043 |
| 484 | Ga0157371_10116938 | 3300013102 | Bacteria | 1895 |
| 485 | Ga0157371_10220581 | 3300013102 | Bacteria | 1362 |
| 486 | Ga0157370_10000261 | 3300013104 | Bacteria | 66927 |
| 487 | Ga0157370_10000436 | 3300013104 | Bacteria | 52041 |
| 488 | Ga0157370_10000839 | 3300013104 | Bacteria | 39014 |
| 489 | Ga0157370_10002210 | 3300013104 | Bacteria | 23756 |
| 490 | Ga0157370_10002385 | 3300013104 | Bacteria | 22662 |
| 491 | Ga0157370_10002663 | 3300013104 | Bacteria | 21427 |
| 492 | Ga0157370_10002692 | 3300013104 | Bacteria | 21301 |
| 493 | Ga0157370_10003916 | 3300013104 | Bacteria | 17340 |
| 494 | Ga0157370_10006823 | 3300013104 | Bacteria | 12514 |
| 495 | Ga0157370_10024136 | 3300013104 | Bacteria | 6027 |
| 496 | Ga0157370_10044524 | 3300013104 | Bacteria | 4264 |
| 497 | Ga0157370_10044573 | 3300013104 | Bacteria | 4261 |
| 498 | Ga0157370_10044996 | 3300013104 | Bacteria | 4238 |
| 499 | Ga0157370_10066079 | 3300013104 | Bacteria | 3421 |
| 500 | Ga0157370_10083264 | 3300013104 | Bacteria | 3008 |
| 501 | Ga0157370_10168122 | 3300013104 | Bacteria | 2039 |
| 502 | Ga0157370_10196428 | 3300013104 | Bacteria | 1872 |
| 503 | Ga0157370_10275610 | 3300013104 | Bacteria | 1554 |
| 504 | Ga0157370_10292841 | 3300013104 | Bacteria | 1503 |
| 505 | Ga0157370_10306932 | 3300013104 | Bacteria | 1464 |
| 506 | Ga0157370_10318568 | 3300013104 | Bacteria | 1435 |
| 507 | Ga0157370_10337807 | 3300013104 | Bacteria | 1388 |
| 508 | Ga0157369_10000004 | 3300013105 | Bacteria | 479764 |
| 509 | Ga0157369_10002019 | 3300013105 | Bacteria | 24475 |
| 510 | Ga0157369_10002652 | 3300013105 | Bacteria | 21364 |
| 511 | Ga0157369_10004820 | 3300013105 | Bacteria | 15839 |
| 512 | Ga0157369_10026016 | 3300013105 | Bacteria | 6493 |
| 513 | Ga0157369_10047784 | 3300013105 | Bacteria | 4645 |
| 514 | Ga0157369_10063536 | 3300013105 | Bacteria | 3977 |
| 515 | Ga0157369_10100053 | 3300013105 | Bacteria | 3090 |
| 516 | Ga0157369_10104624 | 3300013105 | Bacteria | 3014 |
| 517 | Ga0157369_10220360 | 3300013105 | Bacteria | 1986 |
| 518 | Ga0157369_10314250 | 3300013105 | Bacteria | 1629 |
| 519 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 520 | Ga0157374_10000647 | 3300013296 | Bacteria | 30685 |
| 521 | Ga0157374_10002171 | 3300013296 | Bacteria | 16542 |
| 522 | Ga0157374_10003665 | 3300013296 | Bacteria | 12913 |
| 523 | Ga0157374_10008464 | 3300013296 | Bacteria | 8797 |
| 524 | Ga0157374_10025420 | 3300013296 | Bacteria | 5318 |
| 525 | Ga0157374_10031171 | 3300013296 | Bacteria | 4844 |
| 526 | Ga0157374_10050525 | 3300013296 | Bacteria | 3865 |
| 527 | Ga0157374_10056944 | 3300013296 | Bacteria | 3650 |
| 528 | Ga0157374_10101752 | 3300013296 | Bacteria | 2755 |
| 529 | Ga0157374_10189714 | 3300013296 | Bacteria | 2010 |
| 530 | Ga0157374_10217994 | 3300013296 | Unclassified | 1872 |
| 531 | Ga0157374_10289281 | 3300013296 | Bacteria | 1619 |
| 532 | Ga0157374_10471222 | 3300013296 | Unclassified | 1258 |
| 533 | Ga0157378_10011078 | 3300013297 | Bacteria | 7892 |
| 534 | Ga0157378_10011450 | 3300013297 | Bacteria | 7762 |
| 535 | Ga0157378_10016222 | 3300013297 | Bacteria | 6524 |
| 536 | Ga0157378_10021827 | 3300013297 | Bacteria | 5630 |
| 537 | Ga0157378_10023453 | 3300013297 | Bacteria | 5431 |
| 538 | Ga0157378_10024439 | 3300013297 | Bacteria | 5317 |
| 539 | Ga0157378_10026056 | 3300013297 | Bacteria | 5154 |
| 540 | Ga0157378_10034378 | 3300013297 | Bacteria | 4483 |
| 541 | Ga0157378_10106642 | 3300013297 | Bacteria | 2563 |
| 542 | Ga0157378_10191429 | 3300013297 | Bacteria | 1929 |
| 543 | Ga0157378_10205182 | 3300013297 | Bacteria | 1866 |
| 544 | Ga0157378_10249257 | 3300013297 | Bacteria | 1699 |
| 545 | Ga0157378_10349223 | 3300013297 | Bacteria | 1444 |
| 546 | Ga0163162_10000024 | 3300013306 | Bacteria | 188515 |
| 547 | Ga0163162_10000205 | 3300013306 | Bacteria | 54827 |
| 548 | Ga0163162_10000331 | 3300013306 | Bacteria | 43319 |
| 549 | Ga0163162_10000967 | 3300013306 | Bacteria | 26666 |
| 550 | Ga0163162_10001657 | 3300013306 | Bacteria | 20874 |
| 551 | Ga0163162_10002520 | 3300013306 | Bacteria | 17318 |
| 552 | Ga0163162_10005326 | 3300013306 | Bacteria | 12412 |
| 553 | Ga0163162_10005839 | 3300013306 | Bacteria | 11903 |
| 554 | Ga0163162_10011763 | 3300013306 | Bacteria | 8536 |
| 555 | Ga0163162_10023196 | 3300013306 | Bacteria | 6122 |
| 556 | Ga0163162_10025607 | 3300013306 | Bacteria | 5831 |
| 557 | Ga0163162_10027741 | 3300013306 | Bacteria | 5600 |
| 558 | Ga0163162_10037946 | 3300013306 | Bacteria | 4809 |
| 559 | Ga0163162_10044468 | 3300013306 | Bacteria | 4448 |
| 560 | Ga0163162_10082702 | 3300013306 | Bacteria | 3283 |
| 561 | Ga0163162_10104877 | 3300013306 | Bacteria | 2921 |
| 562 | Ga0163162_10220637 | 3300013306 | Bacteria | 2026 |
| 563 | Ga0163162_10386237 | 3300013306 | Bacteria | 1533 |
| 564 | Ga0163162_10628741 | 3300013306 | Bacteria | 1198 |
| 565 | Ga0157372_10000011 | 3300013307 | Bacteria | 277202 |
| 566 | Ga0157372_10000196 | 3300013307 | Bacteria | 66430 |
| 567 | Ga0157372_10000921 | 3300013307 | Bacteria | 32008 |
| 568 | Ga0157372_10001904 | 3300013307 | Bacteria | 22644 |
| 569 | Ga0157372_10005934 | 3300013307 | Bacteria | 12984 |
| 570 | Ga0157372_10007158 | 3300013307 | Bacteria | 11876 |
| 571 | Ga0157372_10015967 | 3300013307 | Bacteria | 8054 |
| 572 | Ga0157372_10050754 | 3300013307 | Bacteria | 4614 |
| 573 | Ga0157372_10061677 | 3300013307 | Bacteria | 4199 |
| 574 | Ga0157372_10063919 | 3300013307 | Bacteria | 4129 |
| 575 | Ga0157372_10069226 | 3300013307 | Bacteria | 3969 |
| 576 | Ga0157372_10072860 | 3300013307 | Bacteria | 3871 |
| 577 | Ga0157372_10085260 | 3300013307 | Bacteria | 3582 |
| 578 | Ga0157372_10085973 | 3300013307 | Bacteria | 3568 |
| 579 | Ga0157372_10108951 | 3300013307 | Bacteria | 3171 |
| 580 | Ga0157372_10113649 | 3300013307 | Bacteria | 3103 |
| 581 | Ga0157372_10113694 | 3300013307 | Bacteria | 3103 |
| 582 | Ga0157372_10176871 | 3300013307 | Bacteria | 2470 |
| 583 | Ga0157372_10214259 | 3300013307 | Bacteria | 2232 |
| 584 | Ga0157372_10337954 | 3300013307 | Bacteria | 1754 |
| 585 | Ga0157372_10549923 | 3300013307 | Bacteria | 1346 |
| 586 | Ga0157372_10617486 | 3300013307 | Bacteria | 1263 |
| 587 | Ga0157372_10635185 | 3300013307 | Bacteria | 1244 |
| 588 | Ga0157375_10000229 | 3300013308 | Bacteria | 52257 |
| 589 | Ga0157375_10000257 | 3300013308 | Bacteria | 48156 |
| 590 | Ga0157375_10003117 | 3300013308 | Bacteria | 14392 |
| 591 | Ga0157375_10026758 | 3300013308 | Bacteria | 5382 |
| 592 | Ga0157375_10043753 | 3300013308 | Bacteria | 4345 |
| 593 | Ga0157375_10049275 | 3300013308 | Bacteria | 4126 |
| 594 | Ga0157375_10108563 | 3300013308 | Bacteria | 2870 |
| 595 | Ga0157375_10195972 | 3300013308 | Bacteria | 2175 |
| 596 | Ga0157375_10206911 | 3300013308 | Bacteria | 2119 |
| 597 | Ga0157375_10217627 | 3300013308 | Bacteria | 2068 |
| 598 | Ga0163163_10000653 | 3300014325 | Bacteria | 29691 |
| 599 | Ga0163163_10005525 | 3300014325 | Bacteria | 10945 |
| 600 | Ga0163163_10102281 | 3300014325 | Bacteria | 2889 |
| 601 | Ga0163163_10197303 | 3300014325 | Bacteria | 2061 |
| 602 | Ga0163163_10240688 | 3300014325 | Bacteria | 1859 |
| 603 | Ga0163163_10260289 | 3300014325 | Bacteria | 1786 |
| 604 | Ga0157380_10004261 | 3300014326 | Bacteria | 9900 |
| 605 | Ga0157380_10033396 | 3300014326 | Bacteria | 3961 |
| 606 | Ga0157380_10151009 | 3300014326 | Bacteria | 2008 |
| 607 | Ga0157380_10249108 | 3300014326 | Bacteria | 1607 |
| 608 | Ga0157380_10396639 | 3300014326 | Bacteria | 1308 |
| 609 | Ga0182008_10000008 | 3300014497 | Bacteria | 371823 |
| 610 | Ga0182008_10000026 | 3300014497 | Bacteria | 182845 |
| 611 | Ga0182008_10000080 | 3300014497 | Bacteria | 76626 |
| 612 | Ga0182008_10000687 | 3300014497 | Bacteria | 24388 |
| 613 | Ga0182008_10011464 | 3300014497 | Bacteria | 4714 |
| 614 | Ga0182008_10030579 | 3300014497 | Bacteria | 2714 |
| 615 | Ga0182008_10091087 | 3300014497 | Bacteria | 1503 |
| 616 | Ga0157377_10000932 | 3300014745 | Bacteria | 12243 |
| 617 | Ga0157377_10018348 | 3300014745 | Bacteria | 3635 |
| 618 | Ga0157377_10031423 | 3300014745 | Unclassified | 2885 |
| 619 | Ga0157377_10129759 | 3300014745 | Bacteria | 1538 |
| 620 | Ga0157377_10150301 | 3300014745 | Bacteria | 1439 |
| 621 | Ga0157379_10001640 | 3300014968 | Bacteria | 18479 |
| 622 | Ga0157379_10002723 | 3300014968 | Bacteria | 14918 |
| 623 | Ga0157379_10025305 | 3300014968 | Bacteria | 5273 |
| 624 | Ga0157379_10175810 | 3300014968 | Bacteria | 1933 |
| 625 | Ga0157379_10236611 | 3300014968 | Bacteria | 1656 |
| 626 | Ga0157379_10246240 | 3300014968 | Bacteria | 1622 |
| 627 | Ga0157376_10000721 | 3300014969 | Bacteria | 21396 |
| 628 | Ga0157376_10002682 | 3300014969 | Bacteria | 12095 |
| 629 | Ga0157376_10004414 | 3300014969 | Bacteria | 9794 |
| 630 | Ga0157376_10005888 | 3300014969 | Bacteria | 8604 |
| 631 | Ga0157376_10011043 | 3300014969 | Bacteria | 6640 |
| 632 | Ga0157376_10017174 | 3300014969 | Bacteria | 5512 |
| 633 | Ga0157376_10037066 | 3300014969 | Bacteria | 3954 |
| 634 | Ga0157376_10074336 | 3300014969 | Bacteria | 2897 |
| 635 | Ga0182006_1000039 | 3300015261 | Bacteria | 211568 |
| 636 | Ga0182006_1001557 | 3300015261 | Bacteria | 13693 |
| 637 | Ga0182006_1003104 | 3300015261 | Bacteria | 8708 |
| 638 | Ga0182006_1003392 | 3300015261 | Bacteria | 8160 |
| 639 | Ga0182006_1010187 | 3300015261 | Bacteria | 4189 |
| 640 | Ga0182007_10000027 | 3300015262 | Bacteria | 167235 |
| 641 | Ga0182007_10004301 | 3300015262 | Bacteria | 6483 |
| 642 | Ga0182005_1000263 | 3300015265 | Bacteria | 33328 |
| 643 | Ga0183373_1003 | 3300015682 | Bacteria | 558813 |
| 644 | Ga0163161_10006392 | 3300017792 | Bacteria | 8158 |
| 645 | Ga0163161_10007503 | 3300017792 | Bacteria | 7537 |
| 646 | Ga0163161_10011036 | 3300017792 | Bacteria | 6259 |
| 647 | Ga0163161_10067433 | 3300017792 | Bacteria | 2613 |
| 648 | Ga0163161_10187089 | 3300017792 | Bacteria | 1590 |
| 649 | Ga0163161_10397008 | 3300017792 | Bacteria | 1105 |
| 650 | Ga0206351_10902020 | 3300020077 | Bacteria | 1239 |
| 651 | Ga0213876_10001528 | 3300021384 | Bacteria | 14327 |
| 652 | Ga0213876_10022962 | 3300021384 | Bacteria | 3295 |
| 653 | Ga0209436_100493 | 3300025208 | Bacteria | 17414 |
| 654 | Ga0207427_100103 | 3300025231 | Bacteria | 119618 |
| 655 | Ga0209437_100024 | 3300025233 | Bacteria | 592878 |
| 656 | Ga0209437_100101 | 3300025233 | Bacteria | 226668 |
| 657 | Ga0209258_100151 | 3300025242 | Bacteria | 160444 |
| 658 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 659 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 660 | Ga0209646_1000823 | 3300025246 | Bacteria | 10466 |
| 661 | Ga0209026_1000434 | 3300025250 | Bacteria | 34861 |
| 662 | Ga0209148_1000154 | 3300025254 | Bacteria | 145214 |
| 663 | Ga0209148_1012278 | 3300025254 | Bacteria | 1570 |
| 664 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 665 | Ga0209233_1000124 | 3300025261 | Bacteria | 226743 |
| 666 | Ga0209233_1000396 | 3300025261 | Bacteria | 36455 |
| 667 | Ga0209233_1011704 | 3300025261 | Bacteria | 2577 |
| 668 | Ga0209455_1006267 | 3300025272 | Bacteria | 3539 |
| 669 | Ga0209673_1000208 | 3300025273 | Bacteria | 117755 |
| 670 | Ga0209130_1003361 | 3300025284 | Bacteria | 6880 |
| 671 | Ga0209675_1000042 | 3300025291 | Bacteria | 235989 |
| 672 | Ga0209676_1000008 | 3300025292 | Bacteria | 991778 |
| 673 | Ga0209676_1001383 | 3300025292 | Bacteria | 23647 |
| 674 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 675 | Ga0209564_1013616 | 3300025295 | Bacteria | 3435 |
| 676 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 677 | Ga0209758_1003065 | 3300025297 | Bacteria | 15894 |
| 678 | Ga0209758_1006777 | 3300025297 | Bacteria | 8046 |
| 679 | Ga0209050_1000134 | 3300025298 | Bacteria | 184417 |
| 680 | Ga0209050_1001255 | 3300025298 | Bacteria | 29270 |
| 681 | Ga0209050_1003936 | 3300025298 | Bacteria | 10504 |
| 682 | Ga0209050_1010474 | 3300025298 | Bacteria | 4563 |
| 683 | Ga0207426_1000030 | 3300025302 | Bacteria | 461478 |
| 684 | Ga0207426_1000051 | 3300025302 | Bacteria | 391700 |
| 685 | Ga0207426_1000497 | 3300025302 | Bacteria | 58506 |
| 686 | Ga0207426_1001981 | 3300025302 | Bacteria | 14539 |
| 687 | Ga0207426_1006084 | 3300025302 | Bacteria | 5323 |
| 688 | Ga0207426_1044109 | 3300025302 | Bacteria | 1365 |
| 689 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 690 | Ga0209257_1000005 | 3300025304 | Bacteria | 1592528 |
| 691 | Ga0209257_1001605 | 3300025304 | Bacteria | 25882 |
| 692 | Ga0207656_10041673 | 3300025321 | Bacteria | 1952 |
| 693 | Ga0207655_1000012 | 3300025728 | Bacteria | 640488 |
| 694 | Ga0207655_1000228 | 3300025728 | Bacteria | 93810 |
| 695 | Ga0207713_1079261 | 3300025735 | Bacteria | 1186 |
| 696 | Ga0207682_10009425 | 3300025893 | Bacteria | 3852 |
| 697 | Ga0207642_10117946 | 3300025899 | Bacteria | 1364 |
| 698 | Ga0207710_10002748 | 3300025900 | Bacteria | 8047 |
| 699 | Ga0207710_10043035 | 3300025900 | Bacteria | 2007 |
| 700 | Ga0207688_10043481 | 3300025901 | Bacteria | 2502 |
| 701 | Ga0207680_10000162 | 3300025903 | Bacteria | 32782 |
| 702 | Ga0207680_10011575 | 3300025903 | Bacteria | 4461 |
| 703 | Ga0207647_10000051 | 3300025904 | Bacteria | 87826 |
| 704 | Ga0207647_10000149 | 3300025904 | Bacteria | 55611 |
| 705 | Ga0207647_10000288 | 3300025904 | Bacteria | 41316 |
| 706 | Ga0207647_10018104 | 3300025904 | Bacteria | 4774 |
| 707 | Ga0207685_10055929 | 3300025905 | Bacteria | 1542 |
| 708 | Ga0207645_10000156 | 3300025907 | Bacteria | 53492 |
| 709 | Ga0207645_10000782 | 3300025907 | Bacteria | 26555 |
| 710 | Ga0207645_10009564 | 3300025907 | Bacteria | 6697 |
| 711 | Ga0207645_10032778 | 3300025907 | Bacteria | 3340 |
| 712 | Ga0207645_10109477 | 3300025907 | Bacteria | 1787 |
| 713 | Ga0207643_10003598 | 3300025908 | Bacteria | 8348 |
| 714 | Ga0207643_10084438 | 3300025908 | Bacteria | 1843 |
| 715 | Ga0207643_10188488 | 3300025908 | Bacteria | 1251 |
| 716 | Ga0207705_10000132 | 3300025909 | Bacteria | 81270 |
| 717 | Ga0207705_10017561 | 3300025909 | Bacteria | 5122 |
| 718 | Ga0207705_10050880 | 3300025909 | Bacteria | 2983 |
| 719 | Ga0207705_10073058 | 3300025909 | Bacteria | 2488 |
| 720 | Ga0207705_10116961 | 3300025909 | Bacteria | 1974 |
| 721 | Ga0207705_10177553 | 3300025909 | Bacteria | 1606 |
| 722 | Ga0207705_10198785 | 3300025909 | Bacteria | 1519 |
| 723 | Ga0207705_10257460 | 3300025909 | Bacteria | 1332 |
| 724 | Ga0207654_10106324 | 3300025911 | Bacteria | 1738 |
| 725 | Ga0207654_10144631 | 3300025911 | Unclassified | 1520 |
| 726 | Ga0207707_10000051 | 3300025912 | Bacteria | 117204 |
| 727 | Ga0207707_10028865 | 3300025912 | Bacteria | 4848 |
| 728 | Ga0207707_10096572 | 3300025912 | Bacteria | 2582 |
| 729 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 730 | Ga0207695_10000071 | 3300025913 | Bacteria | 315568 |
| 731 | Ga0207695_10000084 | 3300025913 | Bacteria | 282392 |
| 732 | Ga0207695_10000323 | 3300025913 | Bacteria | 114265 |
| 733 | Ga0207695_10004602 | 3300025913 | Bacteria | 18731 |
| 734 | Ga0207695_10007525 | 3300025913 | Bacteria | 13810 |
| 735 | Ga0207695_10012845 | 3300025913 | Bacteria | 10025 |
| 736 | Ga0207695_10020015 | 3300025913 | Bacteria | 7681 |
| 737 | Ga0207695_10030834 | 3300025913 | Bacteria | 5899 |
| 738 | Ga0207695_10261931 | 3300025913 | Bacteria | 1626 |
| 739 | Ga0207695_10340708 | 3300025913 | Bacteria | 1387 |
| 740 | Ga0207695_10473374 | 3300025913 | Bacteria | 1135 |
| 741 | Ga0207671_10001044 | 3300025914 | Bacteria | 33679 |
| 742 | Ga0207671_10002500 | 3300025914 | Bacteria | 19619 |
| 743 | Ga0207671_10002907 | 3300025914 | Bacteria | 17690 |
| 744 | Ga0207671_10003166 | 3300025914 | Bacteria | 16626 |
| 745 | Ga0207671_10003799 | 3300025914 | Bacteria | 14813 |
| 746 | Ga0207671_10003904 | 3300025914 | Bacteria | 14529 |
| 747 | Ga0207671_10003924 | 3300025914 | Bacteria | 14496 |
| 748 | Ga0207671_10008063 | 3300025914 | Bacteria | 8998 |
| 749 | Ga0207671_10018671 | 3300025914 | Bacteria | 5314 |
| 750 | Ga0207671_10023419 | 3300025914 | Bacteria | 4657 |
| 751 | Ga0207671_10047813 | 3300025914 | Bacteria | 3166 |
| 752 | Ga0207671_10053071 | 3300025914 | Bacteria | 3004 |
| 753 | Ga0207671_10054603 | 3300025914 | Bacteria | 2959 |
| 754 | Ga0207660_10005186 | 3300025917 | Bacteria | 8471 |
| 755 | Ga0207660_10013171 | 3300025917 | Bacteria | 5416 |
| 756 | Ga0207660_10013385 | 3300025917 | Bacteria | 5377 |
| 757 | Ga0207660_10276780 | 3300025917 | Bacteria | 1331 |
| 758 | Ga0207660_10306548 | 3300025917 | Bacteria | 1265 |
| 759 | Ga0207662_10012024 | 3300025918 | Bacteria | 4813 |
| 760 | Ga0207662_10072777 | 3300025918 | Bacteria | 2084 |
| 761 | Ga0207657_10010433 | 3300025919 | Bacteria | 9272 |
| 762 | Ga0207657_10024041 | 3300025919 | Bacteria | 5657 |
| 763 | Ga0207657_10027751 | 3300025919 | Bacteria | 5179 |
| 764 | Ga0207657_10037574 | 3300025919 | Bacteria | 4321 |
| 765 | Ga0207657_10042823 | 3300025919 | Bacteria | 3991 |
| 766 | Ga0207657_10088481 | 3300025919 | Bacteria | 2588 |
| 767 | Ga0207657_10088944 | 3300025919 | Bacteria | 2580 |
| 768 | Ga0207657_10213406 | 3300025919 | Unclassified | 1548 |
| 769 | Ga0207649_10009815 | 3300025920 | Bacteria | 5245 |
| 770 | Ga0207649_10224063 | 3300025920 | Bacteria | 1341 |
| 771 | Ga0207652_10000051 | 3300025921 | Bacteria | 120327 |
| 772 | Ga0207652_10000384 | 3300025921 | Bacteria | 46082 |
| 773 | Ga0207652_10020709 | 3300025921 | Bacteria | 5421 |
| 774 | Ga0207652_10039453 | 3300025921 | Bacteria | 4007 |
| 775 | Ga0207652_10045752 | 3300025921 | Bacteria | 3731 |
| 776 | Ga0207652_10148855 | 3300025921 | Bacteria | 2096 |
| 777 | Ga0207652_10446374 | 3300025921 | Bacteria | 1166 |
| 778 | Ga0207681_10109432 | 3300025923 | Bacteria | 2007 |
| 779 | Ga0207681_10136537 | 3300025923 | Bacteria | 1821 |
| 780 | Ga0207694_10007231 | 3300025924 | Bacteria | 8426 |
| 781 | Ga0207694_10216919 | 3300025924 | Bacteria | 1560 |
| 782 | Ga0207650_10004151 | 3300025925 | Bacteria | 9903 |
| 783 | Ga0207650_10029550 | 3300025925 | Bacteria | 3941 |
| 784 | Ga0207650_10044181 | 3300025925 | Bacteria | 3273 |
| 785 | Ga0207650_10084418 | 3300025925 | Bacteria | 2414 |
| 786 | Ga0207650_10161026 | 3300025925 | Bacteria | 1778 |
| 787 | Ga0207659_10148334 | 3300025926 | Bacteria | 1829 |
| 788 | Ga0207659_10346473 | 3300025926 | Unclassified | 1232 |
| 789 | Ga0207644_10002938 | 3300025931 | Bacteria | 10975 |
| 790 | Ga0207644_10184510 | 3300025931 | Bacteria | 1637 |
| 791 | Ga0207690_10004421 | 3300025932 | Bacteria | 8296 |
| 792 | Ga0207690_10004758 | 3300025932 | Bacteria | 8008 |
| 793 | Ga0207690_10007381 | 3300025932 | Bacteria | 6526 |
| 794 | Ga0207690_10103237 | 3300025932 | Bacteria | 2040 |
| 795 | Ga0207706_10000122 | 3300025933 | Bacteria | 83838 |
| 796 | Ga0207706_10006768 | 3300025933 | Bacteria | 10596 |
| 797 | Ga0207706_10009505 | 3300025933 | Bacteria | 8928 |
| 798 | Ga0207706_10060615 | 3300025933 | Bacteria | 3332 |
| 799 | Ga0207706_10095175 | 3300025933 | Bacteria | 2620 |
| 800 | Ga0207706_10409233 | 3300025933 | Unclassified | 1176 |
| 801 | Ga0207686_10003538 | 3300025934 | Bacteria | 8377 |
| 802 | Ga0207686_10013442 | 3300025934 | Bacteria | 4531 |
| 803 | Ga0207686_10031401 | 3300025934 | Bacteria | 3153 |
| 804 | Ga0207709_10000021 | 3300025935 | Bacteria | 386722 |
| 805 | Ga0207709_10000381 | 3300025935 | Bacteria | 44071 |
| 806 | Ga0207709_10106339 | 3300025935 | Bacteria | 1866 |
| 807 | Ga0207670_10251816 | 3300025936 | Unclassified | 1365 |
| 808 | Ga0207669_10173204 | 3300025937 | Bacteria | 1538 |
| 809 | Ga0207704_10000041 | 3300025938 | Bacteria | 89976 |
| 810 | Ga0207704_10186500 | 3300025938 | Bacteria | 1504 |
| 811 | Ga0207665_10123389 | 3300025939 | Bacteria | 1832 |
| 812 | Ga0207691_10002527 | 3300025940 | Bacteria | 17886 |
| 813 | Ga0207691_10004310 | 3300025940 | Bacteria | 13818 |
| 814 | Ga0207691_10082409 | 3300025940 | Bacteria | 2889 |
| 815 | Ga0207691_10107984 | 3300025940 | Bacteria | 2477 |
| 816 | Ga0207691_10349044 | 3300025940 | Bacteria | 1266 |
| 817 | Ga0207689_10001006 | 3300025942 | Bacteria | 27060 |
| 818 | Ga0207689_10011687 | 3300025942 | Bacteria | 7524 |
| 819 | Ga0207689_10051842 | 3300025942 | Bacteria | 3382 |
| 820 | Ga0207689_10069790 | 3300025942 | Bacteria | 2887 |
| 821 | Ga0207689_10209759 | 3300025942 | Bacteria | 1609 |
| 822 | Ga0207661_10006472 | 3300025944 | Bacteria | 8280 |
| 823 | Ga0207661_10042612 | 3300025944 | Bacteria | 3579 |
| 824 | Ga0207661_10127723 | 3300025944 | Bacteria | 2173 |
| 825 | Ga0207661_10491550 | 3300025944 | Bacteria | 1121 |
| 826 | Ga0207679_10003010 | 3300025945 | Bacteria | 10450 |
| 827 | Ga0207679_10067172 | 3300025945 | Bacteria | 2689 |
| 828 | Ga0207679_10104790 | 3300025945 | Bacteria | 2220 |
| 829 | Ga0207679_10201502 | 3300025945 | Bacteria | 1663 |
| 830 | Ga0207679_10272053 | 3300025945 | Bacteria | 1449 |
| 831 | Ga0207667_10000009 | 3300025949 | Bacteria | 603135 |
| 832 | Ga0207667_10000177 | 3300025949 | Bacteria | 92852 |
| 833 | Ga0207667_10000222 | 3300025949 | Bacteria | 79873 |
| 834 | Ga0207667_10014871 | 3300025949 | Bacteria | 8851 |
| 835 | Ga0207667_10015290 | 3300025949 | Bacteria | 8725 |
| 836 | Ga0207667_10015451 | 3300025949 | Bacteria | 8671 |
| 837 | Ga0207667_10021496 | 3300025949 | Bacteria | 7148 |
| 838 | Ga0207667_10044124 | 3300025949 | Bacteria | 4727 |
| 839 | Ga0207667_10086364 | 3300025949 | Bacteria | 3246 |
| 840 | Ga0207667_10294914 | 3300025949 | Unclassified | 1657 |
| 841 | Ga0207667_10596213 | 3300025949 | Unclassified | 1114 |
| 842 | Ga0207651_10001099 | 3300025960 | Bacteria | 12009 |
| 843 | Ga0207651_10010433 | 3300025960 | Bacteria | 5151 |
| 844 | Ga0207651_10075842 | 3300025960 | Bacteria | 2401 |
| 845 | Ga0207651_10087618 | 3300025960 | Bacteria | 2267 |
| 846 | Ga0207651_10346452 | 3300025960 | Bacteria | 1250 |
| 847 | Ga0207712_10011985 | 3300025961 | Bacteria | 5532 |
| 848 | Ga0207712_10033754 | 3300025961 | Bacteria | 3461 |
| 849 | Ga0207712_10072556 | 3300025961 | Bacteria | 2479 |
| 850 | Ga0207712_10230009 | 3300025961 | Bacteria | 1488 |
| 851 | Ga0207712_10332680 | 3300025961 | Bacteria | 1257 |
| 852 | Ga0207668_10000843 | 3300025972 | Bacteria | 18537 |
| 853 | Ga0207668_10045941 | 3300025972 | Bacteria | 2981 |
| 854 | Ga0207668_10081892 | 3300025972 | Bacteria | 2343 |
| 855 | Ga0207668_10095076 | 3300025972 | Bacteria | 2199 |
| 856 | Ga0207668_10301111 | 3300025972 | Bacteria | 1323 |
| 857 | Ga0207640_10011602 | 3300025981 | Bacteria | 4993 |
| 858 | Ga0207640_10012737 | 3300025981 | Bacteria | 4799 |
| 859 | Ga0207640_10049386 | 3300025981 | Bacteria | 2724 |
| 860 | Ga0207640_10234487 | 3300025981 | Bacteria | 1414 |
| 861 | Ga0207658_10015834 | 3300025986 | Bacteria | 5177 |
| 862 | Ga0207658_10262591 | 3300025986 | Unclassified | 1472 |
| 863 | Ga0207658_10301181 | 3300025986 | Bacteria | 1381 |
| 864 | Ga0207658_10532665 | 3300025986 | Unclassified | 1049 |
| 865 | Ga0207677_10008700 | 3300026023 | Bacteria | 5684 |
| 866 | Ga0207677_10034996 | 3300026023 | Bacteria | 3257 |
| 867 | Ga0207677_10061486 | 3300026023 | Unclassified | 2601 |
| 868 | Ga0207677_10083187 | 3300026023 | Bacteria | 2303 |
| 869 | Ga0207677_10180206 | 3300026023 | Bacteria | 1661 |
| 870 | Ga0207703_10005016 | 3300026035 | Bacteria | 10732 |
| 871 | Ga0207703_10252271 | 3300026035 | Bacteria | 1591 |
| 872 | Ga0207703_10293914 | 3300026035 | Unclassified | 1479 |
| 873 | Ga0207703_10444962 | 3300026035 | Bacteria | 1209 |
| 874 | Ga0207703_10486797 | 3300026035 | Bacteria | 1156 |
| 875 | Ga0207639_10003645 | 3300026041 | Bacteria | 10352 |
| 876 | Ga0207639_10031777 | 3300026041 | Bacteria | 3882 |
| 877 | Ga0207639_10048724 | 3300026041 | Bacteria | 3208 |
| 878 | Ga0207639_10061775 | 3300026041 | Bacteria | 2895 |
| 879 | Ga0207639_10081130 | 3300026041 | Bacteria | 2568 |
| 880 | Ga0207639_10095928 | 3300026041 | Bacteria | 2385 |
| 881 | Ga0207639_10269099 | 3300026041 | Bacteria | 1494 |
| 882 | Ga0207639_10395493 | 3300026041 | Unclassified | 1244 |
| 883 | Ga0207708_10127869 | 3300026075 | Bacteria | 1984 |
| 884 | Ga0207702_10000463 | 3300026078 | Bacteria | 45983 |
| 885 | Ga0207702_10016308 | 3300026078 | Bacteria | 6149 |
| 886 | Ga0207702_10021967 | 3300026078 | Bacteria | 5286 |
| 887 | Ga0207702_10182382 | 3300026078 | Bacteria | 1934 |
| 888 | Ga0207702_10220130 | 3300026078 | Bacteria | 1769 |
| 889 | Ga0207641_10000226 | 3300026088 | Bacteria | 72539 |
| 890 | Ga0207641_10001217 | 3300026088 | Bacteria | 25759 |
| 891 | Ga0207641_10004894 | 3300026088 | Bacteria | 11515 |
| 892 | Ga0207641_10039269 | 3300026088 | Bacteria | 3958 |
| 893 | Ga0207641_10064994 | 3300026088 | Bacteria | 3120 |
| 894 | Ga0207648_10003412 | 3300026089 | Bacteria | 16676 |
| 895 | Ga0207648_10003442 | 3300026089 | Bacteria | 16603 |
| 896 | Ga0207648_10010003 | 3300026089 | Bacteria | 9023 |
| 897 | Ga0207648_10064003 | 3300026089 | Bacteria | 3205 |
| 898 | Ga0207648_10075871 | 3300026089 | Bacteria | 2930 |
| 899 | Ga0207648_10119721 | 3300026089 | Unclassified | 2314 |
| 900 | Ga0207676_10009837 | 3300026095 | Bacteria | 6802 |
| 901 | Ga0207676_10022211 | 3300026095 | Bacteria | 4665 |
| 902 | Ga0207676_10034551 | 3300026095 | Bacteria | 3829 |
| 903 | Ga0207676_10082197 | 3300026095 | Bacteria | 2619 |
| 904 | Ga0207676_10218506 | 3300026095 | Bacteria | 1696 |
| 905 | Ga0207674_10000672 | 3300026116 | Bacteria | 44419 |
| 906 | Ga0207674_10009363 | 3300026116 | Bacteria | 11203 |
| 907 | Ga0207674_10035446 | 3300026116 | Bacteria | 5206 |
| 908 | Ga0207674_10047123 | 3300026116 | Bacteria | 4421 |
| 909 | Ga0207674_10053435 | 3300026116 | Bacteria | 4118 |
| 910 | Ga0207674_10167317 | 3300026116 | Bacteria | 2152 |
| 911 | Ga0207674_10180315 | 3300026116 | Bacteria | 2063 |
| 912 | Ga0207674_10218190 | 3300026116 | Bacteria | 1855 |
| 913 | Ga0207675_100000124 | 3300026118 | Bacteria | 63805 |
| 914 | Ga0207675_100066501 | 3300026118 | Bacteria | 3369 |
| 915 | Ga0207675_100295016 | 3300026118 | Bacteria | 1578 |
| 916 | Ga0207683_10010911 | 3300026121 | Bacteria | 7748 |
| 917 | Ga0207683_10015180 | 3300026121 | Bacteria | 6554 |
| 918 | Ga0207683_10205270 | 3300026121 | Unclassified | 1792 |
| 919 | Ga0207683_10503084 | 3300026121 | Bacteria | 1119 |
| 920 | Ga0207698_10001082 | 3300026142 | Bacteria | 15843 |
| 921 | Ga0207698_10004520 | 3300026142 | Bacteria | 8484 |
| 922 | Ga0207698_10008356 | 3300026142 | Bacteria | 6541 |
| 923 | Ga0207698_10018942 | 3300026142 | Bacteria | 4701 |
| 924 | Ga0207698_10022184 | 3300026142 | Bacteria | 4406 |
| 925 | Ga0207698_10201752 | 3300026142 | Bacteria | 1781 |
| 926 | Ga0207698_10398949 | 3300026142 | Bacteria | 1314 |
| 927 | Ga0209281_1000299 | 3300027111 | Bacteria | 90106 |
| 928 | Ga0209995_1006596 | 3300027471 | Bacteria | 1865 |
| 929 | Ga0207428_10121308 | 3300027907 | Bacteria | 2004 |
| 930 | Ga0268266_10000049 | 3300028379 | Bacteria | 307763 |
| 931 | Ga0268266_10000137 | 3300028379 | Bacteria | 140685 |
| 932 | Ga0268266_10052240 | 3300028379 | Bacteria | 3509 |
| 933 | Ga0268266_10373309 | 3300028379 | Unclassified | 1344 |
| 934 | Ga0268265_10060000 | 3300028380 | Bacteria | 2913 |
| 935 | Ga0268265_10130426 | 3300028380 | Bacteria | 2088 |
| 936 | Ga0268265_10189233 | 3300028380 | Bacteria | 1776 |
| 937 | Ga0268264_10000041 | 3300028381 | Bacteria | 372501 |
| 938 | Ga0268264_10001720 | 3300028381 | Bacteria | 20153 |
| 939 | Ga0268264_10003860 | 3300028381 | Bacteria | 12861 |
| 940 | Ga0268264_10015087 | 3300028381 | Bacteria | 6337 |
| 941 | Ga0268264_10018061 | 3300028381 | Bacteria | 5768 |
| 942 | Ga0268264_10076166 | 3300028381 | Bacteria | 2854 |
| 943 | Ga0268264_10233443 | 3300028381 | Bacteria | 1700 |
| 944 | Ga0265334_10065194 | 3300028573 | Bacteria | 1366 |
| 945 | Ga0265323_10000082 | 3300028653 | Bacteria | 54153 |
| 946 | Ga0307517_10002048 | 3300028786 | Bacteria | 32795 |
| 947 | Ga0307517_10009539 | 3300028786 | Bacteria | 13744 |
| 948 | Ga0307517_10132404 | 3300028786 | Bacteria | 1789 |
| 949 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 950 | Ga0307515_10000061 | 3300028794 | Bacteria | 251841 |
| 951 | Ga0307515_10009265 | 3300028794 | Bacteria | 19056 |
| 952 | Ga0307515_10022836 | 3300028794 | Bacteria | 11007 |
| 953 | Ga0265338_10036318 | 3300028800 | Unclassified | 4718 |
| 954 | Ga0265338_10094888 | 3300028800 | Bacteria | 2453 |
| 955 | Ga0265338_10130605 | 3300028800 | Bacteria | 1984 |
| 956 | Ga0307511_10000042 | 3300030521 | Bacteria | 102114 |
| 957 | Ga0316177_1032754 | 3300030731 | Bacteria | 20502 |
| 958 | Ga0316176_1030119 | 3300030732 | Bacteria | 23258 |
| 959 | Ga0316183_1088093 | 3300030742 | Bacteria | 36462 |
| 960 | Ga0316181_1244277 | 3300030744 | Bacteria | 1335 |
| 961 | Ga0265327_10000370 | 3300031251 | Bacteria | 84921 |
| 962 | Ga0265327_10000395 | 3300031251 | Bacteria | 81944 |
| 963 | Ga0265327_10000614 | 3300031251 | Bacteria | 58841 |
| 964 | Ga0265327_10009563 | 3300031251 | Bacteria | 6974 |
| 965 | Ga0265327_10011198 | 3300031251 | Bacteria | 6212 |
| 966 | Ga0265316_10000982 | 3300031344 | Bacteria | 30963 |
| 967 | Ga0265316_10005052 | 3300031344 | Bacteria | 12946 |
| 968 | Ga0265316_10007084 | 3300031344 | Bacteria | 10612 |
| 969 | Ga0307513_10247949 | 3300031456 | Bacteria | 1580 |
| 970 | Ga0307513_10368175 | 3300031456 | Bacteria | 1180 |
| 971 | Ga0307509_10077458 | 3300031507 | Bacteria | 3448 |
| 972 | Ga0307509_10109209 | 3300031507 | Bacteria | 2777 |
| 973 | Ga0307509_10175070 | 3300031507 | Bacteria | 2019 |
| 974 | Ga0307408_100001828 | 3300031548 | Bacteria | 15502 |
| 975 | Ga0307408_100002354 | 3300031548 | Bacteria | 13345 |
| 976 | Ga0307408_100003065 | 3300031548 | Bacteria | 11533 |
| 977 | Ga0307408_100008089 | 3300031548 | Bacteria | 6953 |
| 978 | Ga0307408_100009674 | 3300031548 | Bacteria | 6357 |
| 979 | Ga0307408_100042599 | 3300031548 | Bacteria | 3226 |
| 980 | Ga0265313_10025091 | 3300031595 | Bacteria | 3169 |
| 981 | Ga0307508_10002100 | 3300031616 | Bacteria | 21430 |
| 982 | Ga0265342_10077052 | 3300031712 | Bacteria | 1932 |
| 983 | Ga0316576_10019459 | 3300031727 | Bacteria | 4654 |
| 984 | Ga0316576_10136585 | 3300031727 | Bacteria | 1845 |
| 985 | Ga0307516_10001558 | 3300031730 | Bacteria | 31533 |
| 986 | Ga0307405_10000001 | 3300031731 | Bacteria | 1731270 |
| 987 | Ga0307405_10002108 | 3300031731 | Bacteria | 8664 |
| 988 | Ga0307405_10396170 | 3300031731 | Bacteria | 1079 |
| 989 | Ga0316577_10025236 | 3300031733 | Bacteria | 3306 |
| 990 | Ga0307413_10000106 | 3300031824 | Bacteria | 21433 |
| 991 | Ga0307413_10025336 | 3300031824 | Bacteria | 3251 |
| 992 | Ga0307406_10000055 | 3300031901 | Bacteria | 62544 |
| 993 | Ga0307406_10151508 | 3300031901 | Bacteria | 1655 |
| 994 | Ga0307407_10000130 | 3300031903 | Bacteria | 23045 |
| 995 | Ga0307412_10000023 | 3300031911 | Bacteria | 237005 |
| 996 | Ga0307412_10000034 | 3300031911 | Bacteria | 206033 |
| 997 | Ga0307412_10000431 | 3300031911 | Bacteria | 25291 |
| 998 | Ga0307412_10001853 | 3300031911 | Bacteria | 11714 |
| 999 | Ga0307412_10004743 | 3300031911 | Bacteria | 7590 |
| 1000 | Ga0307412_10011797 | 3300031911 | Bacteria | 5072 |
| 1001 | Ga0307412_10119710 | 3300031911 | Bacteria | 1894 |
| 1002 | Ga0307412_10236457 | 3300031911 | Unclassified | 1410 |
| 1003 | Ga0307416_100000004 | 3300032002 | Bacteria | 505535 |
| 1004 | Ga0307416_100000994 | 3300032002 | Bacteria | 14992 |
| 1005 | Ga0307416_100417085 | 3300032002 | Bacteria | 1385 |
| 1006 | Ga0307414_10000012 | 3300032004 | Bacteria | 322675 |
| 1007 | Ga0307414_10000067 | 3300032004 | Bacteria | 103245 |
| 1008 | Ga0307414_10000205 | 3300032004 | Bacteria | 39667 |
| 1009 | Ga0307414_10000368 | 3300032004 | Bacteria | 24667 |
| 1010 | Ga0307414_10018419 | 3300032004 | Bacteria | 4299 |
| 1011 | Ga0307414_10019912 | 3300032004 | Bacteria | 4169 |
| 1012 | Ga0307414_10034191 | 3300032004 | Bacteria | 3367 |
| 1013 | Ga0307414_10043161 | 3300032004 | Bacteria | 3069 |
| 1014 | Ga0307414_10065989 | 3300032004 | Bacteria | 2585 |
| 1015 | Ga0307414_10070691 | 3300032004 | Bacteria | 2514 |
| 1016 | Ga0307414_10073136 | 3300032004 | Bacteria | 2478 |
| 1017 | Ga0307414_10103927 | 3300032004 | Bacteria | 2145 |
| 1018 | Ga0307414_10303636 | 3300032004 | Bacteria | 1351 |
| 1019 | Ga0307414_10342649 | 3300032004 | Bacteria | 1280 |
| 1020 | Ga0307411_10000008 | 3300032005 | Bacteria | 321575 |
| 1021 | Ga0307411_10144215 | 3300032005 | Bacteria | 1760 |
| 1022 | Ga0307411_10227554 | 3300032005 | Bacteria | 1451 |
| 1023 | Ga0316580_10029814 | 3300032139 | Bacteria | 1689 |
| 1024 | Ga0307510_10000091 | 3300033180 | Bacteria | 68694 |
| 1025 | Ga0307510_10008820 | 3300033180 | Bacteria | 12018 |
| 1026 | Ga0307510_10091404 | 3300033180 | Bacteria | 2886 |
| 1027 | Ga0307510_10135566 | 3300033180 | Bacteria | 2120 |
| 1028 | Ga0373944_0030594 | 3300035089 | Bacteria | 1615 |
| 1029 | Ga0373941_0001716 | 3300035115 | Bacteria | 4704 |
| 1030 | Ga0373957_0106428 | 3300035120 | Bacteria | 1127 |
| 1031 | Ga0373955_0042786 | 3300035172 | Bacteria | 2434 |
| 1032 | Ga0316574_0070151 | 3300035398 | Bacteria | 2213 |
| 1033 | Ga0316574_0075563 | 3300035398 | Unclassified | 2134 |
| 1034 | Ga0373937_0055659 | 3300036401 | Bacteria | 3632 |
| 1035 | Ga0316582_0004909 | 3300036647 | Bacteria | 6832 |
| 1036 | Ga0316584_0031063 | 3300036712 | Bacteria | 3949 |
| 1037 | Ga0316584_0245998 | 3300036712 | Bacteria | 1307 |
| 1038 | Ga0395899_0000033 | 3300037312 | Bacteria | 306589 |
| 1039 | Ga0395899_0000037 | 3300037312 | Bacteria | 280224 |
| 1040 | Ga0395899_0000796 | 3300037312 | Bacteria | 30874 |
| 1041 | Ga0395899_0011488 | 3300037312 | Bacteria | 6779 |
| 1042 | Ga0395899_0040931 | 3300037312 | Unclassified | 3464 |
| 1043 | Ga0395899_0076882 | 3300037312 | Bacteria | 2436 |
| 1044 | Ga0395899_0176577 | 3300037312 | Bacteria | 1501 |
| 1045 | Ga0395899_0205736 | 3300037312 | Bacteria | 1370 |
| 1046 | Ga0395900_0000014 | 3300037418 | Bacteria | 386513 |
| 1047 | Ga0395900_0020025 | 3300037418 | Bacteria | 6822 |
| 1048 | Ga0395900_0025707 | 3300037418 | Bacteria | 6027 |
| 1049 | Ga0395900_0034282 | 3300037418 | Bacteria | 5226 |
| 1050 | Ga0395900_0053699 | 3300037418 | Bacteria | 4147 |
| 1051 | Ga0395900_0058215 | 3300037418 | Bacteria | 3978 |
| 1052 | Ga0395898_0063471 | 3300037466 | Unclassified | 3584 |
| 1053 | Ga0395898_0344382 | 3300037466 | Unclassified | 1421 |
| 1054 | Ga0395905_0000241 | 3300037471 | Bacteria | 82847 |
| 1055 | Ga0395905_0000254 | 3300037471 | Bacteria | 79953 |
| 1056 | Ga0395905_0000278 | 3300037471 | Bacteria | 75859 |
| 1057 | Ga0395905_0001456 | 3300037471 | Bacteria | 28398 |
| 1058 | Ga0395905_0102782 | 3300037471 | Bacteria | 2683 |
| 1059 | Ga0395905_0180636 | 3300037471 | Bacteria | 1981 |
| 1060 | Ga0395901_0000582 | 3300038443 | Bacteria | 42425 |
| 1061 | Ga0395901_0001349 | 3300038443 | Bacteria | 25743 |
| 1062 | Ga0395901_0001630 | 3300038443 | Bacteria | 23212 |
| 1063 | Ga0395901_0165590 | 3300038443 | Bacteria | 2321 |
| 1064 | Ga0400489_60749 | 3300039093 | Bacteria | 3591 |
| 1065 | Ga0436365_0881017 | 3300039437 | Bacteria | 14010 |
| 1066 | Ga0436365_1079918 | 3300039437 | Bacteria | 37760 |
| 1067 | Ga0436365_1575134 | 3300039437 | Unclassified | 1274 |
| 1068 | Ga0436361_0671868 | 3300039447 | Bacteria | 7057 |
| 1069 | Ga0439436_0033623 | 3300041404 | Bacteria | 1484 |
| 1070 | Ga0439447_000599 | 3300041407 | Bacteria | 13468 |
| 1071 | Ga0439466_0000733 | 3300041411 | Bacteria | 12417 |
| 1072 | Ga0439466_0029101 | 3300041411 | Bacteria | 1903 |
| 1073 | Ga0439465_0004154 | 3300041413 | Bacteria | 4710 |
| 1074 | Ga0451807_1223207 | 3300041486 | Bacteria | 1082 |
| 1075 | Ga0451837_0930931 | 3300041494 | Bacteria | 2172 |
| 1076 | Ga0451853_1077363 | 3300041512 | Bacteria | 1368 |
| 1077 | Ga0451853_1344014 | 3300041512 | Bacteria | 1337 |
| 1078 | Ga0439431_0001706 | 3300041997 | Bacteria | 4842 |
| 1079 | Ga0439431_0008024 | 3300041997 | Bacteria | 2366 |
| 1080 | Ga0439445_0002350 | 3300042004 | Bacteria | 4203 |
| 1081 | Ga0439448_0000765 | 3300042005 | Bacteria | 7805 |
| 1082 | Ga0439434_0003786 | 3300042435 | Bacteria | 4422 |
| 1083 | Ga0451577_0000732 | 3300042876 | Bacteria | 50760 |
| 1084 | Ga0451577_0002136 | 3300042876 | Bacteria | 24236 |
| 1085 | Ga0451577_0003767 | 3300042876 | Bacteria | 16532 |
| 1086 | Ga0451577_0005099 | 3300042876 | Bacteria | 13538 |
| 1087 | Ga0451577_0014810 | 3300042876 | Bacteria | 7266 |
| 1088 | Ga0451577_0033905 | 3300042876 | Bacteria | 4604 |
| 1089 | Ga0451577_0036864 | 3300042876 | Bacteria | 4403 |
| 1090 | Ga0451577_0054343 | 3300042876 | Bacteria | 3575 |
| 1091 | Ga0451577_0107530 | 3300042876 | Bacteria | 2493 |
| 1092 | Ga0451577_0135050 | 3300042876 | Bacteria | 2215 |
| 1093 | Ga0466969_0000584 | 3300044656 | Bacteria | 19813 |
| 1094 | Ga0466972_0000207 | 3300044658 | Bacteria | 42277 |
| 1095 | Ga0466972_0003815 | 3300044658 | Bacteria | 7496 |
| 1096 | Ga0466972_0007800 | 3300044658 | Bacteria | 5371 |
| 1097 | Ga0466982_0129100 | 3300044672 | Bacteria | 1556 |
| 1098 | Ga0453683_0000174 | 3300044673 | Bacteria | 89378 |
| 1099 | Ga0453683_0004567 | 3300044673 | Bacteria | 9791 |
| 1100 | Ga0453683_0011474 | 3300044673 | Bacteria | 5837 |
| 1101 | Ga0453683_0020068 | 3300044673 | Bacteria | 4273 |
| 1102 | Ga0453683_0069892 | 3300044673 | Bacteria | 2196 |
| 1103 | Ga0453683_0210473 | 3300044673 | Unclassified | 1235 |
| 1104 | Ga0466965_0023948 | 3300044683 | Bacteria | 2951 |
| 1105 | Ga0466966_0000136 | 3300044684 | Bacteria | 47038 |
| 1106 | Ga0466961_0042386 | 3300044693 | Bacteria | 2917 |
| 1107 | Ga0466961_0225162 | 3300044693 | Bacteria | 1155 |
| 1108 | Ga0466961_0303882 | 3300044693 | Bacteria | 974 |
| 1109 | Ga0466964_0033441 | 3300044706 | Bacteria | 2049 |
| 1110 | Ga0453684_0000167 | 3300044712 | Bacteria | 290200 |
| 1111 | Ga0453684_0000191 | 3300044712 | Bacteria | 267816 |
| 1112 | Ga0453684_0000202 | 3300044712 | Bacteria | 261894 |
| 1113 | Ga0453684_0000206 | 3300044712 | Bacteria | 257650 |
| 1114 | Ga0453684_0001141 | 3300044712 | Bacteria | 82874 |
| 1115 | Ga0453684_0001264 | 3300044712 | Bacteria | 76025 |
| 1116 | Ga0453684_0003500 | 3300044712 | Bacteria | 35253 |
| 1117 | Ga0453684_0003863 | 3300044712 | Bacteria | 32992 |
| 1118 | Ga0453684_0011041 | 3300044712 | Bacteria | 15260 |
| 1119 | Ga0453684_0012400 | 3300044712 | Bacteria | 14064 |
| 1120 | Ga0453684_0015367 | 3300044712 | Bacteria | 12121 |
| 1121 | Ga0453684_0026765 | 3300044712 | Bacteria | 8310 |
| 1122 | Ga0453684_0044759 | 3300044712 | Bacteria | 5915 |
| 1123 | Ga0453684_0051863 | 3300044712 | Bacteria | 5371 |
| 1124 | Ga0453684_0065811 | 3300044712 | Bacteria | 4620 |
| 1125 | Ga0453684_0066880 | 3300044712 | Bacteria | 4574 |
| 1126 | Ga0453684_0067315 | 3300044712 | Bacteria | 4555 |
| 1127 | Ga0453684_0076863 | 3300044712 | Bacteria | 4189 |
| 1128 | Ga0453684_0079972 | 3300044712 | Bacteria | 4084 |
| 1129 | Ga0453684_0086354 | 3300044712 | Bacteria | 3894 |
| 1130 | Ga0453684_0108767 | 3300044712 | Bacteria | 3373 |
| 1131 | Ga0453684_0116758 | 3300044712 | Bacteria | 3231 |
| 1132 | Ga0453684_0127953 | 3300044712 | Bacteria | 3053 |
| 1133 | Ga0453684_0132582 | 3300044712 | Bacteria | 2988 |
| 1134 | Ga0453684_0149655 | 3300044712 | Bacteria | 2776 |
| 1135 | Ga0453684_0151567 | 3300044712 | Bacteria | 2754 |
| 1136 | Ga0453684_0200916 | 3300044712 | Bacteria | 2324 |
| 1137 | Ga0453684_0248168 | 3300044712 | Bacteria | 2045 |
| 1138 | Ga0453684_0546075 | 3300044712 | Bacteria | 1277 |
| 1139 | Ga0466971_0032077 | 3300044719 | Bacteria | 2354 |
| 1140 | Ga0466970_0032860 | 3300044765 | Bacteria | 2742 |
| 1141 | Ga0466957_0007040 | 3300044842 | Bacteria | 6358 |
| 1142 | Ga0466957_0014895 | 3300044842 | Bacteria | 4535 |
| 1143 | Ga0466957_0051905 | 3300044842 | Bacteria | 2496 |
| 1144 | Ga0466957_0170116 | 3300044842 | Bacteria | 1419 |
| 1145 | Ga0466959_0000002 | 3300045049 | Bacteria | 362671 |
| 1146 | Ga0466959_0004264 | 3300045049 | Bacteria | 9538 |
| 1147 | Ga0466959_0063184 | 3300045049 | Bacteria | 2689 |
| 1148 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 1149 | Ga0451576_0000072 | 3300045051 | Bacteria | 257650 |
| 1150 | Ga0451576_0000088 | 3300045051 | Bacteria | 234139 |
| 1151 | Ga0451576_0000232 | 3300045051 | Bacteria | 135846 |
| 1152 | Ga0451576_0001854 | 3300045051 | Bacteria | 34226 |
| 1153 | Ga0451576_0006334 | 3300045051 | Bacteria | 14542 |
| 1154 | Ga0451576_0009893 | 3300045051 | Bacteria | 11012 |
| 1155 | Ga0451576_0010551 | 3300045051 | Bacteria | 10581 |
| 1156 | Ga0451576_0022082 | 3300045051 | Bacteria | 6905 |
| 1157 | Ga0451576_0112991 | 3300045051 | Bacteria | 2827 |
| 1158 | Ga0451576_0342262 | 3300045051 | Bacteria | 1566 |
| 1159 | Ga0451576_0405345 | 3300045051 | Unclassified | 1430 |
| 1160 | Ga0495627_000097 | 3300046453 | Bacteria | 107790 |
| 1161 | Ga0495627_005749 | 3300046453 | Bacteria | 4949 |
| 1162 | Ga0495627_012982 | 3300046453 | Bacteria | 2940 |
| 1163 | Ga0495627_021042 | 3300046453 | Bacteria | 2166 |
| 1164 | Ga0495629_0096536 | 3300046459 | Bacteria | 2062 |
| 1165 | Ga0495638_0000003 | 3300046460 | Bacteria | 888792 |
| 1166 | Ga0495638_0029092 | 3300046460 | Bacteria | 3564 |
| 1167 | Ga0495651_0038960 | 3300046462 | Bacteria | 3700 |
| 1168 | Ga0495653_0053573 | 3300046463 | Bacteria | 3086 |
| 1169 | Ga0495650_0000036 | 3300046471 | Bacteria | 400633 |
| 1170 | Ga0495580_0014773 | 3300046472 | Bacteria | 5916 |
| 1171 | Ga0495580_0039305 | 3300046472 | Bacteria | 3385 |
| 1172 | Ga0495585_0000831 | 3300046492 | Bacteria | 26632 |
| 1173 | Ga0495607_0032969 | 3300046501 | Bacteria | 3155 |
| 1174 | Ga0495606_0000008 | 3300046507 | Bacteria | 321373 |
| 1175 | Ga0495606_0003964 | 3300046507 | Bacteria | 15184 |
| 1176 | Ga0495606_0019321 | 3300046507 | Bacteria | 5075 |
| 1177 | Ga0495606_0025036 | 3300046507 | Bacteria | 4284 |
| 1178 | Ga0495606_0039090 | 3300046507 | Bacteria | 3203 |
| 1179 | Ga0495610_0000001 | 3300046512 | Bacteria | 1620061 |
| 1180 | Ga0495610_0000233 | 3300046512 | Bacteria | 59298 |
| 1181 | Ga0495610_0023416 | 3300046512 | Bacteria | 3359 |
| 1182 | Ga0495610_0112392 | 3300046512 | Bacteria | 1205 |
| 1183 | Ga0495616_0004581 | 3300046513 | Bacteria | 8701 |
| 1184 | Ga0495616_0007672 | 3300046513 | Bacteria | 6451 |
| 1185 | Ga0495630_0012164 | 3300046517 | Bacteria | 6242 |
| 1186 | Ga0495630_0038354 | 3300046517 | Bacteria | 3584 |
| 1187 | Ga0495632_0068748 | 3300046519 | Bacteria | 1706 |
| 1188 | Ga0495632_0128572 | 3300046519 | Bacteria | 1180 |
| 1189 | Ga0495644_0030099 | 3300046523 | Bacteria | 2050 |
| 1190 | Ga0495648_0003229 | 3300046524 | Bacteria | 14455 |
| 1191 | Ga0495648_0003874 | 3300046524 | Bacteria | 12979 |
| 1192 | Ga0495663_0000165 | 3300046525 | Bacteria | 26227 |
| 1193 | Ga0495654_0000001 | 3300046530 | Bacteria | 1513197 |
| 1194 | Ga0495609_0001065 | 3300046538 | Bacteria | 19213 |
| 1195 | Ga0495609_0012891 | 3300046538 | Bacteria | 3957 |
| 1196 | Ga0495645_0080467 | 3300046543 | Bacteria | 2339 |
| 1197 | Ga0495633_0000018 | 3300046558 | Bacteria | 243398 |
| 1198 | Ga0495633_0000080 | 3300046558 | Bacteria | 127703 |
| 1199 | Ga0495633_0000233 | 3300046558 | Bacteria | 67958 |
| 1200 | Ga0495633_0008035 | 3300046558 | Bacteria | 6001 |
| 1201 | Ga0495633_0008511 | 3300046558 | Bacteria | 5769 |
| 1202 | Ga0495668_0000044 | 3300046616 | Bacteria | 227585 |
| 1203 | Ga0495668_0000751 | 3300046616 | Bacteria | 38311 |
| 1204 | Ga0495634_0045371 | 3300046642 | Bacteria | 2972 |
| 1205 | Ga0495611_0001116 | 3300046648 | Bacteria | 14130 |
| 1206 | Ga0495625_0000379 | 3300046660 | Bacteria | 67828 |
| 1207 | Ga0495625_0000934 | 3300046660 | Bacteria | 39261 |
| 1208 | Ga0495625_0001653 | 3300046660 | Bacteria | 26125 |
| 1209 | Ga0495625_0034454 | 3300046660 | Bacteria | 3737 |
| 1210 | Ga0495661_0001087 | 3300046665 | Bacteria | 23875 |
| 1211 | Ga0495661_0001778 | 3300046665 | Bacteria | 17318 |
| 1212 | Ga0495661_0088121 | 3300046665 | Bacteria | 1772 |
| 1213 | Ga0495661_0092509 | 3300046665 | Bacteria | 1718 |
| 1214 | Ga0495657_0216696 | 3300046675 | Unclassified | 1162 |
| 1215 | Ga0495658_0087681 | 3300046683 | Bacteria | 1838 |
| 1216 | Ga0495671_0029844 | 3300046692 | Bacteria | 2797 |
| 1217 | Ga0495649_0000010 | 3300046694 | Bacteria | 430552 |
| 1218 | Ga0495649_0037561 | 3300046694 | Bacteria | 2658 |
| 1219 | Ga0495600_0071204 | 3300046809 | Bacteria | 2272 |
| 1220 | Ga0495674_0112806 | 3300047319 | Bacteria | 2303 |
| 1221 | Ga0495672_0018888 | 3300047320 | Bacteria | 4564 |
| 1222 | Ga0495672_0025973 | 3300047320 | Bacteria | 3743 |
| 1223 | Ga0495676_0070348 | 3300047321 | Bacteria | 2696 |
| 1224 | Ga0495680_0077801 | 3300047322 | Bacteria | 2512 |
| 1225 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 1226 | Ga0495687_000736 | 3300047443 | Bacteria | 35743 |
| 1227 | Ga0495687_002474 | 3300047443 | Bacteria | 14740 |
| 1228 | Ga0495685_018838 | 3300047447 | Bacteria | 2370 |
| 1229 | Ga0495684_0167137 | 3300047471 | Bacteria | 1638 |
| 1230 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 1231 | Ga0495686_0000022 | 3300047472 | Bacteria | 403456 |
| 1232 | Ga0495686_0000196 | 3300047472 | Bacteria | 112875 |
| 1233 | Ga0495686_0003522 | 3300047472 | Bacteria | 13510 |
| 1234 | Ga0495686_0011430 | 3300047472 | Bacteria | 6255 |
| 1235 | Ga0495686_0069737 | 3300047472 | Bacteria | 2167 |
| 1236 | Ga0496100_0085300 | 3300048903 | Bacteria | 2143 |
| 1237 | Ga0496101_0301226 | 3300048904 | Bacteria | 1256 |
| 1238 | Ga0496102_0046542 | 3300048905 | Bacteria | 3940 |
| 1239 | Ga0496110_0105873 | 3300048913 | Bacteria | 2524 |
| 1240 | Ga0496114_0024981 | 3300048917 | Bacteria | 4879 |
| 1241 | Ga0496114_0055009 | 3300048917 | Bacteria | 3318 |
| 1242 | Ga0496115_0040646 | 3300048918 | Bacteria | 3698 |
| 1243 | Ga0496115_0102109 | 3300048918 | Bacteria | 2352 |
| 1244 | Ga0496116_0000004 | 3300048919 | Bacteria | 839841 |
| 1245 | Ga0496116_0000027 | 3300048919 | Bacteria | 448077 |
| 1246 | Ga0496116_0002379 | 3300048919 | Bacteria | 19844 |
| 1247 | Ga0496117_0000021 | 3300048920 | Bacteria | 444168 |
| 1248 | Ga0496117_0002276 | 3300048920 | Bacteria | 24806 |
| 1249 | Ga0496117_0085221 | 3300048920 | Bacteria | 2058 |
| 1250 | Ga0496118_0001245 | 3300048921 | Bacteria | 39130 |
| 1251 | Ga0496118_0026652 | 3300048921 | Bacteria | 4916 |
| 1252 | Ga0496118_0104190 | 3300048921 | Bacteria | 1905 |
| 1253 | Ga0496119_0000004 | 3300048922 | Bacteria | 536344 |
| 1254 | Ga0496121_0000020 | 3300048924 | Bacteria | 498732 |
| 1255 | Ga0496121_0044433 | 3300048924 | Bacteria | 3832 |
| 1256 | Ga0496122_0000154 | 3300048925 | Bacteria | 160610 |
| 1257 | Ga0496122_0000352 | 3300048925 | Bacteria | 99090 |
| 1258 | Ga0496122_0000591 | 3300048925 | Bacteria | 74549 |
| 1259 | Ga0496122_0000613 | 3300048925 | Bacteria | 73259 |
| 1260 | Ga0496122_0001522 | 3300048925 | Bacteria | 36911 |
| 1261 | Ga0496122_0003469 | 3300048925 | Bacteria | 20744 |
| 1262 | Ga0496122_0015395 | 3300048925 | Bacteria | 7314 |
| 1263 | Ga0496123_0000580 | 3300048926 | Bacteria | 62313 |
| 1264 | Ga0496123_0018244 | 3300048926 | Bacteria | 5590 |
| 1265 | Ga0496123_0023338 | 3300048926 | Bacteria | 4736 |
| 1266 | Ga0496124_0006587 | 3300048927 | Bacteria | 12611 |
| 1267 | Ga0496124_0016074 | 3300048927 | Bacteria | 7138 |
| 1268 | Ga0496124_0048297 | 3300048927 | Bacteria | 3638 |
| 1269 | Ga0496124_0088833 | 3300048927 | Bacteria | 2525 |
| 1270 | Ga0496125_0000012 | 3300048928 | Bacteria | 651142 |
| 1271 | Ga0496125_0001291 | 3300048928 | Bacteria | 37141 |
| 1272 | Ga0496125_0001400 | 3300048928 | Bacteria | 35266 |
| 1273 | Ga0496125_0011050 | 3300048928 | Bacteria | 9061 |
| 1274 | Ga0496125_0013680 | 3300048928 | Bacteria | 7960 |
| 1275 | Ga0496126_0001970 | 3300048929 | Bacteria | 29097 |
| 1276 | Ga0496126_0025237 | 3300048929 | Bacteria | 5722 |
| 1277 | Ga0496126_0028741 | 3300048929 | Bacteria | 5293 |
| 1278 | Ga0496126_0196632 | 3300048929 | Bacteria | 1705 |
| 1279 | Ga0495678_010906 | 3300049459 | Bacteria | 4379 |
| 1280 | Ga0501292_009646 | 3300049515 | Bacteria | 1436 |
| 1281 | Ga0501300_003399 | 3300049523 | Bacteria | 2378 |
| 1282 | Ga0501031_0066891 | 3300049568 | Bacteria | 2341 |
| 1283 | Ga0501032_0016207 | 3300049569 | Bacteria | 5243 |
| 1284 | Ga0501032_0017496 | 3300049569 | Bacteria | 5034 |
| 1285 | Ga0501033_0029523 | 3300049570 | Bacteria | 4121 |
| 1286 | Ga0501034_0004012 | 3300049571 | Bacteria | 16517 |
| 1287 | Ga0501034_0053271 | 3300049571 | Bacteria | 4075 |
| 1288 | Ga0501034_0066614 | 3300049571 | Bacteria | 3614 |
| 1289 | Ga0501034_0077642 | 3300049571 | Bacteria | 3326 |
| 1290 | Ga0501034_0122716 | 3300049571 | Bacteria | 2584 |
| 1291 | Ga0501034_0346038 | 3300049571 | Bacteria | 1416 |
| 1292 | Ga0501036_0019980 | 3300049572 | Bacteria | 5623 |
| 1293 | Ga0501036_0121343 | 3300049572 | Bacteria | 2207 |
| 1294 | Ga0501036_0159885 | 3300049572 | Unclassified | 1899 |
| 1295 | Ga0501037_0007826 | 3300049573 | Bacteria | 7827 |
| 1296 | Ga0501038_0007220 | 3300049574 | Bacteria | 10263 |
| 1297 | Ga0501038_0033809 | 3300049574 | Bacteria | 4500 |
| 1298 | Ga0501038_0122962 | 3300049574 | Bacteria | 2138 |
| 1299 | Ga0501039_0019205 | 3300049575 | Bacteria | 5243 |
| 1300 | Ga0501039_0262508 | 3300049575 | Bacteria | 1357 |
| 1301 | Ga0501043_0008215 | 3300049579 | Bacteria | 8223 |
| 1302 | Ga0501043_0015257 | 3300049579 | Bacteria | 6018 |
| 1303 | Ga0501043_0417047 | 3300049579 | Bacteria | 1012 |
| 1304 | Ga0501047_0009183 | 3300049581 | Bacteria | 9336 |
| 1305 | Ga0501047_0084328 | 3300049581 | Bacteria | 3054 |
| 1306 | Ga0501047_0147600 | 3300049581 | Bacteria | 2228 |
| 1307 | Ga0501047_0161519 | 3300049581 | Bacteria | 2112 |
| 1308 | Ga0501067_0050839 | 3300049583 | Bacteria | 2297 |
| 1309 | Ga0501068_0026838 | 3300049584 | Bacteria | 3397 |
| 1310 | Ga0501069_0007664 | 3300049585 | Bacteria | 5663 |
| 1311 | Ga0501073_0006174 | 3300049589 | Bacteria | 8944 |
| 1312 | Ga0501074_0034616 | 3300049590 | Bacteria | 3661 |
| 1313 | Ga0501198_002350 | 3300049649 | Bacteria | 2543 |
| 1314 | Ga0501202_009071 | 3300049652 | Unclassified | 1821 |
| 1315 | Ga0501202_030457 | 3300049652 | Bacteria | 1123 |
| 1316 | Ga0501207_011064 | 3300049654 | Unclassified | 1338 |
| 1317 | Ga0501207_018468 | 3300049654 | Bacteria | 1097 |
| 1318 | Ga0501217_000618 | 3300049661 | Bacteria | 5991 |
| 1319 | Ga0501217_004619 | 3300049661 | Bacteria | 2838 |
| 1320 | Ga0501222_004886 | 3300049662 | Bacteria | 1820 |
| 1321 | Ga0501223_006285 | 3300049663 | Bacteria | 2463 |
| 1322 | Ga0501223_007672 | 3300049663 | Bacteria | 2204 |
| 1323 | Ga0501235_005341 | 3300049669 | Bacteria | 2794 |
| 1324 | Ga0501240_004330 | 3300049673 | Bacteria | 1641 |
| 1325 | Ga0501240_013486 | 3300049673 | Bacteria | 1134 |
| 1326 | Ga0501242_006477 | 3300049674 | Unclassified | 1335 |
| 1327 | Ga0501243_000451 | 3300049675 | Bacteria | 5469 |
| 1328 | Ga0501247_006417 | 3300049677 | Bacteria | 1331 |
| 1329 | Ga0501249_000027 | 3300049679 | Bacteria | 87387 |
| 1330 | Ga0501252_004165 | 3300049682 | Bacteria | 1531 |
| 1331 | Ga0501257_001311 | 3300049686 | Bacteria | 5126 |
| 1332 | Ga0501257_018063 | 3300049686 | Bacteria | 1643 |
| 1333 | Ga0501259_000660 | 3300049688 | Bacteria | 5531 |
| 1334 | Ga0501219_000230 | 3300049703 | Bacteria | 10699 |
| 1335 | Ga0501225_0004035 | 3300049705 | Bacteria | 4392 |
| 1336 | Ga0501225_0004470 | 3300049705 | Bacteria | 4163 |
| 1337 | Ga0501225_0006622 | 3300049705 | Bacteria | 3380 |
| 1338 | Ga0501245_005844 | 3300049708 | Bacteria | 1710 |
| 1339 | Ga0501079_0075469 | 3300049741 | Bacteria | 2607 |
| 1340 | Ga0501080_0194961 | 3300049742 | Bacteria | 1861 |
| 1341 | Ga0501083_0055458 | 3300049744 | Bacteria | 2657 |
| 1342 | Ga0501241_000012 | 3300049758 | Bacteria | 104953 |
| 1343 | Ga0501241_005162 | 3300049758 | Bacteria | 2438 |
| 1344 | Ga0501264_000335 | 3300049761 | Bacteria | 7341 |
| 1345 | Ga0501266_000004 | 3300049763 | Bacteria | 356286 |
| 1346 | Ga0501266_005253 | 3300049763 | Bacteria | 1614 |
| 1347 | Ga0501267_009653 | 3300049764 | Bacteria | 966 |
| 1348 | Ga0501269_000451 | 3300049766 | Bacteria | 8982 |
| 1349 | Ga0501280_000502 | 3300049776 | Bacteria | 9210 |
| 1350 | Ga0501035_0042854 | 3300049822 | Bacteria | 4080 |
| 1351 | Ga0501035_0043415 | 3300049822 | Bacteria | 4052 |
| 1352 | Ga0501035_0162925 | 3300049822 | Bacteria | 1930 |
| 1353 | Ga0501044_0016307 | 3300049823 | Bacteria | 7981 |
| 1354 | Ga0501044_0020946 | 3300049823 | Bacteria | 6981 |
| 1355 | Ga0501044_0021863 | 3300049823 | Bacteria | 6820 |
| 1356 | Ga0501044_0044831 | 3300049823 | Bacteria | 4586 |
| 1357 | Ga0501044_0161620 | 3300049823 | Unclassified | 2216 |
| 1358 | Ga0501044_0216066 | 3300049823 | Bacteria | 1870 |
| 1359 | Ga0501284_00029 | 3300050005 | Bacteria | 74818 |
| 1360 | nmdc:mga0k408_102151_c1 | 3300050493 | Bacteria | 1691 |
| 1361 | nmdc:mga0k408_105_c1 | 3300050493 | Bacteria | 39936 |
| 1362 | nmdc:mga0k408_13283_c1 | 3300050493 | Bacteria | 4195 |
| 1363 | nmdc:mga0k408_48_c1 | 3300050493 | Bacteria | 60474 |
| 1364 | nmdc:mga0k408_64279_c1 | 3300050493 | Bacteria | 2135 |
| 1365 | nmdc:mga05p37_285602_c1 | 3300050507 | Bacteria | 1966 |
| 1366 | nmdc:mga05p37_428740_c1 | 3300050507 | Bacteria | 1537 |
| 1367 | nmdc:mga0qj67_108041_c1 | 3300050509 | Bacteria | 2244 |
| 1368 | nmdc:mga08y16_142160_c1 | 3300050511 | Bacteria | 2495 |
| 1369 | nmdc:mga08y16_191002_c1 | 3300050511 | Bacteria | 2124 |
| 1370 | Ga0500635_0000796 | 3300053080 | Bacteria | 7818 |
| 1371 | Ga0500578_0000694 | 3300053086 | Bacteria | 40191 |
| 1372 | Ga0500578_0045759 | 3300053086 | Bacteria | 2808 |
| 1373 | Ga0500644_0000283 | 3300053088 | Bacteria | 28078 |
| 1374 | Ga0500646_0005658 | 3300053090 | Bacteria | 3165 |
| 1375 | Ga0500646_0027325 | 3300053090 | Bacteria | 1552 |
| 1376 | Ga0500647_0050815 | 3300053091 | Bacteria | 1994 |
| 1377 | Ga0500583_0000059 | 3300053092 | Bacteria | 68222 |
| 1378 | Ga0500651_0000253 | 3300053093 | Bacteria | 32192 |
| 1379 | Ga0500641_0000242 | 3300053096 | Bacteria | 20695 |
| 1380 | Ga0500557_033835 | 3300053105 | Bacteria | 1566 |
| 1381 | Ga0500562_014775 | 3300053108 | Bacteria | 2001 |
| 1382 | Ga0500607_018370 | 3300053121 | Bacteria | 3972 |
| 1383 | Ga0500608_027602 | 3300053122 | Bacteria | 2676 |
| 1384 | Ga0500608_073120 | 3300053122 | Bacteria | 1628 |
| 1385 | Ga0500618_000013 | 3300053125 | Bacteria | 183026 |
| 1386 | Ga0500618_011591 | 3300053125 | Bacteria | 2333 |
| 1387 | Ga0500658_0000010 | 3300053134 | Bacteria | 248149 |
| 1388 | Ga0500559_0006224 | 3300053136 | Bacteria | 5402 |
| 1389 | Ga0500568_0001626 | 3300053139 | Bacteria | 14158 |
| 1390 | Ga0500573_0117160 | 3300053140 | Bacteria | 1486 |
| 1391 | Ga0500577_0020859 | 3300053142 | Bacteria | 2150 |
| 1392 | Ga0500604_0006396 | 3300053151 | Bacteria | 3115 |
| 1393 | Ga0500604_0022589 | 3300053151 | Bacteria | 1787 |
| 1394 | Ga0500616_0000007 | 3300053153 | Bacteria | 836875 |
| 1395 | Ga0500616_0005429 | 3300053153 | Bacteria | 8651 |
| 1396 | Ga0500616_0009033 | 3300053153 | Bacteria | 6104 |
| 1397 | Ga0500616_0016083 | 3300053153 | Bacteria | 4268 |
| 1398 | Ga0500622_0000247 | 3300053156 | Bacteria | 55130 |
| 1399 | Ga0500622_0000515 | 3300053156 | Bacteria | 35966 |
| 1400 | Ga0500622_0000540 | 3300053156 | Bacteria | 34894 |
| 1401 | Ga0500622_0000777 | 3300053156 | Bacteria | 27709 |
| 1402 | Ga0500622_0001463 | 3300053156 | Bacteria | 18819 |
| 1403 | Ga0500624_000379 | 3300053157 | Bacteria | 14179 |
| 1404 | Ga0500633_0048877 | 3300053160 | Bacteria | 1452 |
| 1405 | Ga0500611_000034 | 3300053727 | Bacteria | 78957 |
| 1406 | Ga0501082_0112289 | 3300060353 | Bacteria | 2359 |
| 1407 | Ga0501082_0414103 | 3300060353 | Bacteria | 1177 |
| 1408 | Ga0466962_0005611 | 3300061719 | Bacteria | 6028 |
| 1409 | 2511234099 | 2511231000 | Bacteria | 4488346 |
| 1410 | 2513232253 | 2513020052 | Bacteria | 5120511 |
| 1411 | 2522547642 | 2522125168 | Bacteria | 7376607 |
| 1412 | 2524005564 | 2523533629 | Bacteria | 2982326 |
| 1413 | 2585144370 | 2582581278 | Bacteria | 5296881 |
| 1414 | 2585158996 | 2582581281 | Bacteria | 4487904 |
| 1415 | 2585163284 | 2582581282 | Bacteria | 4495830 |
| 1416 | 2585425382 | 2582581873 | Bacteria | 3032664 |
| 1417 | 2587677376 | 2585428045 | Bacteria | 5203023 |
| 1418 | 2587745500 | 2585428060 | Bacteria | 5304711 |
| 1419 | 2587750693 | 2585428061 | Bacteria | 3939663 |
| 1420 | 2587943784 | 2585428115 | Bacteria | 4420269 |
| 1421 | 2588208895 | 2585428182 | Bacteria | 5007281 |
| 1422 | 2588212397 | 2585428183 | Bacteria | 5166119 |
| 1423 | 2588225066 | 2585428185 | Bacteria | 4969476 |
| 1424 | 2588231606 | 2585428187 | Bacteria | 4629388 |
| 1425 | 2588445713 | 2588253712 | Bacteria | 5403181 |
| 1426 | 2590602332 | 2588254255 | Bacteria | 5014294 |
| 1427 | 2590611316 | 2588254257 | Bacteria | 5436094 |
| 1428 | 2599480990 | 2599185184 | Bacteria | 6430550 |
| 1429 | 2644009823 | 2643221600 | Bacteria | 5530138 |
| 1430 | 2644374219 | 2643221667 | Bacteria | 5627472 |
| 1431 | 2644683695 | 2643221725 | Bacteria | 5087956 |
| 1432 | 2722726497 | 2721755487 | Bacteria | 6357185 |
| 1433 | 2729202037 | 2728369107 | Bacteria | 5082720 |
| 1434 | 2738727059 | 2738541278 | Bacteria | 9755573 |
| 1435 | 2738760566 | 2738541284 | Bacteria | 5199923 |
| 1436 | 2739254997 | 2738543014 | Bacteria | 4048139 |
| 1437 | 2739300621 | 2738543023 | Bacteria | 6767879 |
| 1438 | 2739590407 | 2739367651 | Bacteria | 6359826 |
| 1439 | 2739617379 | 2739367656 | Bacteria | 5152243 |
| 1440 | 2739647571 | 2739367663 | Bacteria | 5040914 |
| 1441 | 2740002460 | 2739367857 | Bacteria | 5433684 |
| 1442 | 2740007276 | 2739367858 | Bacteria | 5432813 |
| 1443 | 2740033304 | 2739367866 | Bacteria | 4215900 |
| 1444 | 2740061480 | 2739367874 | Bacteria | 4872888 |
| 1445 | 2753671961 | 2751185877 | Bacteria | 4921427 |
| 1446 | 2765576891 | 2765235839 | Bacteria | 5314748 |
| 1447 | 2775673393 | 2775506739 | Bacteria | 3855222 |
| 1448 | 2776612699 | 2775506987 | Bacteria | 5373360 |
| 1449 | 2802652418 | 2802428842 | Bacteria | 4926114 |
| 1450 | 2816872184 | 2816332188 | Bacteria | 5133218 |
| 1451 | 2819548307 | 2818991437 | Bacteria | 5805520 |
| 1452 | 2819573629 | 2818991442 | Bacteria | 8318214 |
| 1453 | 2819680871 | 2818991460 | Bacteria | 7595395 |
| 1454 | 2821136963 | 2821136567 | Bacteria | 8080116 |
| 1455 | 2839991354 | 2839989709 | Bacteria | 3773432 |
| 1456 | 2842086659 | 2842083920 | Bacteria | 4857652 |
| 1457 | 2842906815 | 2842903701 | Bacteria | 6986368 |
| 1458 | 2849286733 | 2849281842 | Bacteria | 6065644 |
| 1459 | 2852623493 | 2852623160 | Bacteria | 4376875 |
| 1460 | 2852630140 | 2852627209 | Bacteria | 5896285 |
| 1461 | 2857615894 | 2857613821 | Bacteria | 4917088 |
| 1462 | 2857620360 | 2857618242 | Bacteria | 5635925 |
| 1463 | 2857632142 | 2857627736 | Bacteria | 5625397 |
| 1464 | 2871724350 | 2871720351 | Bacteria | 4862476 |
| 1465 | 2881362663 | 2881359912 | Bacteria | 4935907 |
| 1466 | 2883072585 | 2883068021 | Bacteria | 6192739 |
| 1467 | 2884637258 | 2884634485 | Bacteria | 3928637 |
| 1468 | 2884795628 | 2884791551 | Bacteria | 8511252 |
| 1469 | 2884937607 | 2884933994 | Bacteria | 4535041 |
| 1470 | 2889292556 | 2889290771 | Bacteria | 5530962 |
| 1471 | 2890737617 | 2890737413 | Bacteria | 4269751 |
| 1472 | 2895501638 | 2895498888 | Bacteria | 5283788 |
| 1473 | 2896087752 | 2896085136 | Bacteria | 6129793 |
| 1474 | 2896112542 | 2896109856 | Bacteria | 7140722 |
| 1475 | 2896319411 | 2896317667 | Bacteria | 4606601 |
| 1476 | 2896347003 | 2896344016 | Bacteria | 3811746 |
| 1477 | 2898713405 | 2898713307 | Bacteria | 4110805 |
| 1478 | 2903897866 | 2903895155 | Bacteria | 5258610 |
| 1479 | 2904422088 | 2904419702 | Bacteria | 5166287 |
| 1480 | 2904446100 | 2904445276 | Bacteria | 5310396 |
| 1481 | 2904468295 | 2904467357 | Bacteria | 8057758 |
| 1482 | 2904559074 | 2904555929 | Bacteria | 5218588 |
| 1483 | 2904783639 | 2904780799 | Bacteria | 5840761 |
| 1484 | 2906000464 | 2905999023 | Bacteria | 4591259 |
| 1485 | 2910248588 | 2910245624 | Bacteria | 6935613 |
| 1486 | 2914760597 | 2914759650 | Bacteria | 4701441 |
| 1487 | 2919097502 | 2919097161 | Bacteria | 3860339 |
| 1488 | 2919182190 | 2919177583 | Bacteria | 5641607 |
| 1489 | 2919189878 | 2919186247 | Bacteria | 6244071 |
| 1490 | 2919192101 | 2919191525 | Bacteria | 5765973 |
| 1491 | 2919400780 | 2919399522 | Bacteria | 5164947 |
| 1492 | 2919442597 | 2919437846 | Bacteria | 6199444 |
| 1493 | 2919686044 | 2919683626 | Bacteria | 5534354 |
| 1494 | 2919695416 | 2919692658 | Bacteria | 5943958 |
| 1495 | 2928080902 | 2928078545 | Bacteria | 6534839 |
| 1496 | 2928150191 | 2928147474 | Bacteria | 6512076 |
| 1497 | 2929154664 | 2929150217 | Bacteria | 5462483 |
| 1498 | 2929178801 | 2929177148 | Bacteria | 7883697 |
| 1499 | 2929241244 | 2929239360 | Bacteria | 7745570 |
| 1500 | 2929923240 | 2929921140 | Bacteria | 8649150 |
| 1501 | 2932088242 | 2932082852 | Bacteria | 6563563 |
| 1502 | 2939668158 | 2939664404 | Bacteria | 6364494 |
| 1503 | 2945927788 | 2945924605 | Bacteria | 4296724 |
| 1504 | 2945981205 | 2945977869 | Bacteria | 7777518 |
| 1505 | 2946019394 | 2946013367 | Bacteria | 7766675 |
| 1506 | 2946020604 | 2946019816 | Bacteria | 4621265 |
| 1507 | 2958459095 | 2958458903 | Bacteria | 5301041 |
| 1508 | 2958512513 | 2958512119 | Bacteria | 4528530 |
| 1509 | 2965323326 | 2965320100 | Bacteria | 3975600 |
| 1510 | 2977236774 | 2977232053 | Bacteria | 5485925 |
| 1511 | 2977246770 | 2977243572 | Bacteria | 4374394 |
| 1512 | 2977271498 | 2977268062 | Bacteria | 5243061 |
| 1513 | 2984575386 | 2984572630 | Bacteria | 4186940 |
| 1514 | 2984608840 | 2984606641 | Bacteria | 4186971 |
| 1515 | 2993374090 | 2993372514 | Bacteria | 4214139 |
| 1516 | 2993480992 | 2993480792 | Bacteria | 4022225 |
| 1517 | 3003233518 | 3003233435 | Bacteria | 4458031 |
| 1518 | 8003153683 | 8003151029 | Bacteria | 8187759 |
| 1519 | 8054310548 | 8054307821 | Bacteria | 5212224 |
| 1520 | 8055423024 | 8055419101 | Bacteria | 5289643 |
| 1521 | 8055590799 | 8055588893 | Bacteria | 3619545 |
| 1522 | 8055596625 | 8055592153 | Bacteria | 5961247 |
| 1523 | 8056442050 | 8056440228 | Bacteria | 4946504 |
| 1524 | Ga0495610_0000757 | |||
| 1525 | SwRhRL2b_contig_1994362 | |||
| 1526 | SwRhRL2b_contig_2088904 | |||
| 1527 | SwRhRL2b_contig_3399644 | |||
| 1528 | JGI24741J21665_1002082 | |||
| 1529 | JGI24741J21665_1006025 | |||
| 1530 | JGI24740J21852_10005751 | |||
| 1531 | JGI24740J21852_10036460 | |||
| 1532 | JGI24739J22299_10038781 | |||
| 1533 | JGI24737J22298_10014703 | |||
| 1534 | JGI24744J21845_10002612 | |||
| 1535 | JGI25162J39368_1000017 | |||
| 1536 | JGI25162J39368_1000614 | |||
| 1537 | JGI25154J39366_1000040 | |||
| 1538 | JGI25164J39214_1001787 | |||
| 1539 | JGI25150J39212_1000001 | |||
| 1540 | JGI25151J46595_10000005 | |||
| 1541 | JGI25165J46597_1000634 | |||
| 1542 | JGI25153J46596_10000040 | |||
| 1543 | JGI25153J46596_10003346 | |||
| 1544 | JGI25153J46596_10041566 | |||
| 1545 | rootH1_10003601 | |||
| 1546 | rootH1_10007102 | |||
| 1547 | rootH1_10082958 | |||
| 1548 | rootH1_10151462 | |||
| 1549 | rootH2_10013635 | |||
| 1550 | rootH2_10016199 | |||
| 1551 | rootH2_10019144 | |||
| 1552 | rootH2_10030072 | |||
| 1553 | rootH2_10077704 | |||
| 1554 | rootH2_10190169 | |||
| 1555 | rootH2_10308990 | |||
| 1556 | rootL2_10002914 | |||
| 1557 | rootL2_10025842 | |||
| 1558 | rootL2_10032238 | |||
| 1559 | rootL2_10032239 | |||
| 1560 | rootL2_10079467 | |||
| 1561 | rootL2_10083418 | |||
| 1562 | rootL2_10122039 | |||
| 1563 | rootL2_10122858 | |||
| 1564 | rootL2_10134929 | |||
| 1565 | rootL2_10305032 | |||
| 1566 | rootL2_10327582 | |||
| 1567 | rootH1_10005821 | |||
| 1568 | rootH1_10020847 | |||
| 1569 | rootH1_10023753 | |||
| 1570 | rootH1_10031683 | |||
| 1571 | rootH1_10050118 | |||
| 1572 | rootH1_10052662 | |||
| 1573 | rootH1_10101577 | |||
| 1574 | rootH1_10182853 | |||
| 1575 | rootH1_10230655 | |||
| 1576 | JGI25160J50197_1005075 | |||
| 1577 | JGI25160J50197_1005718 | |||
| 1578 | JGI25160J50197_1013229 | |||
| 1579 | Ga0055535_1003449 | |||
| 1580 | Ga0055536_1000564 | |||
| 1581 | Ga0055528_1001650 | |||
| 1582 | Ga0055530_10000387 | |||
| 1583 | Ga0055530_10007698 | |||
| 1584 | Ga0055531_10000131 | |||
| 1585 | Ga0055531_10000156 | |||
| 1586 | Ga0055543_1021355 | |||
| 1587 | Ga0065165_1000102 | |||
| 1588 | Ga0065165_1001626 | |||
| 1589 | Ga0065714_10002826 | |||
| 1590 | Ga0065714_10011701 | |||
| 1591 | Ga0065714_10064551 | |||
| 1592 | Ga0065714_10065701 | |||
| 1593 | Ga0065714_10066278 | |||
| 1594 | Ga0065714_10070733 | |||
| 1595 | Ga0065714_10071292 | |||
| 1596 | Ga0065714_10085181 | |||
| 1597 | Ga0065714_10136175 | |||
| 1598 | Ga0065704_10070466 | |||
| 1599 | Ga0065704_10070721 | |||
| 1600 | Ga0065704_10072255 | |||
| 1601 | Ga0065704_10073358 | |||
| 1602 | Ga0065704_10093766 | |||
| 1603 | Ga0065704_10125453 | |||
| 1604 | Ga0065712_10076829 | |||
| 1605 | Ga0065712_10106080 | |||
| 1606 | Ga0070658_10000091 | |||
| 1607 | Ga0070658_10057776 | |||
| 1608 | Ga0070676_10000336 | |||
| 1609 | Ga0070676_10002755 | |||
| 1610 | Ga0070676_10003243 | |||
| 1611 | Ga0070676_10060138 | |||
| 1612 | Ga0070683_100000725 | |||
| 1613 | Ga0070683_100010872 | |||
| 1614 | Ga0070683_100032588 | |||
| 1615 | Ga0070683_100042317 | |||
| 1616 | Ga0070690_100005983 | |||
| 1617 | Ga0070690_100275978 | |||
| 1618 | Ga0070670_100039428 | |||
| 1619 | Ga0070670_100054985 | |||
| 1620 | Ga0070670_100060696 | |||
| 1621 | Ga0070670_100066481 | |||
| 1622 | Ga0070670_100082144 | |||
| 1623 | Ga0070670_100384887 | |||
| 1624 | Ga0068869_100039941 | |||
| 1625 | Ga0068869_100069980 | |||
| 1626 | Ga0068869_100127915 | |||
| 1627 | Ga0068869_100284187 | |||
| 1628 | Ga0070666_10000051 | |||
| 1629 | Ga0070666_10010156 | |||
| 1630 | Ga0070666_10010207 | |||
| 1631 | Ga0070666_10013609 | |||
| 1632 | Ga0070666_10143122 | |||
| 1633 | Ga0070680_100002139 | |||
| 1634 | Ga0070680_100050858 | |||
| 1635 | Ga0070680_100061374 | |||
| 1636 | Ga0070680_100065624 | |||
| 1637 | Ga0070680_100331896 | |||
| 1638 | Ga0070682_100000060 | |||
| 1639 | Ga0070682_100000596 | |||
| 1640 | Ga0070682_100001275 | |||
| 1641 | Ga0070682_100025241 | |||
| 1642 | Ga0070682_100026905 | |||
| 1643 | Ga0068868_100010338 | |||
| 1644 | Ga0068868_100015086 | |||
| 1645 | Ga0068868_100016530 | |||
| 1646 | Ga0068868_100076548 | |||
| 1647 | Ga0068868_100080003 | |||
| 1648 | Ga0068868_100080631 | |||
| 1649 | Ga0068868_100085678 | |||
| 1650 | Ga0068868_100162816 | |||
| 1651 | Ga0068868_100198670 | |||
| 1652 | Ga0070660_100000800 | |||
| 1653 | Ga0070660_100009297 | |||
| 1654 | Ga0070660_100071902 | |||
| 1655 | Ga0070660_100103890 | |||
| 1656 | Ga0070660_100106276 | |||
| 1657 | Ga0070660_100133278 | |||
| 1658 | Ga0070689_100001732 | |||
| 1659 | Ga0070689_100013351 | |||
| 1660 | Ga0070689_100014808 | |||
| 1661 | Ga0070689_100137929 | |||
| 1662 | Ga0070691_10033514 | |||
| 1663 | Ga0070687_100125604 | |||
| 1664 | Ga0070661_100003143 | |||
| 1665 | Ga0070661_100022549 | |||
| 1666 | Ga0070661_100118026 | |||
| 1667 | Ga0070668_100002494 | |||
| 1668 | Ga0070668_100100239 | |||
| 1669 | Ga0070668_100110332 | |||
| 1670 | Ga0070668_100132503 | |||
| 1671 | Ga0070669_100036574 | |||
| 1672 | Ga0070669_100048455 | |||
| 1673 | Ga0070669_100135719 | |||
| 1674 | Ga0070669_100141137 | |||
| 1675 | Ga0070669_100237791 | |||
| 1676 | Ga0070675_100013600 | |||
| 1677 | Ga0070675_100025711 | |||
| 1678 | Ga0070675_100055173 | |||
| 1679 | Ga0070675_100055271 | |||
| 1680 | Ga0070675_100080740 | |||
| 1681 | Ga0070675_100322491 | |||
| 1682 | Ga0070671_100004357 | |||
| 1683 | Ga0070671_100049587 | |||
| 1684 | Ga0070671_100074043 | |||
| 1685 | Ga0070671_100182326 | |||
| 1686 | Ga0070671_100198762 | |||
| 1687 | Ga0070671_100208844 | |||
| 1688 | Ga0070674_100084152 | |||
| 1689 | Ga0070673_100001990 | |||
| 1690 | Ga0070673_100017265 | |||
| 1691 | Ga0070673_100121048 | |||
| 1692 | Ga0070688_100008021 | |||
| 1693 | Ga0070688_100177611 | |||
| 1694 | Ga0070659_100000854 | |||
| 1695 | Ga0070659_100007938 | |||
| 1696 | Ga0070659_100011576 | |||
| 1697 | Ga0070659_100024762 | |||
| 1698 | Ga0070659_100035580 | |||
| 1699 | Ga0070659_100244042 | |||
| 1700 | Ga0070667_100000492 | |||
| 1701 | Ga0070667_100047694 | |||
| 1702 | Ga0070667_100054456 | |||
| 1703 | Ga0070667_100103565 | |||
| 1704 | Ga0070667_100294027 | |||
| 1705 | Ga0070701_10025529 | |||
| 1706 | Ga0070701_10045950 | |||
| 1707 | Ga0070700_100077166 | |||
| 1708 | Ga0070663_100068570 | |||
| 1709 | Ga0070678_100010791 | |||
| 1710 | Ga0070678_100013945 | |||
| 1711 | Ga0070678_100072331 | |||
| 1712 | Ga0070678_100241240 | |||
| 1713 | Ga0070662_100000011 | |||
| 1714 | Ga0070662_100004086 | |||
| 1715 | Ga0070662_100036135 | |||
| 1716 | Ga0070662_100056097 | |||
| 1717 | Ga0070662_100131800 | |||
| 1718 | Ga0070662_100243812 | |||
| 1719 | Ga0070662_100309850 | |||
| 1720 | Ga0070681_10021777 | |||
| 1721 | Ga0070681_10040812 | |||
| 1722 | Ga0070681_10141139 | |||
| 1723 | Ga0070681_10242445 | |||
| 1724 | Ga0070681_10293673 | |||
| 1725 | Ga0068867_100000841 | |||
| 1726 | Ga0068867_100132144 | |||
| 1727 | Ga0070685_10016536 | |||
| 1728 | Ga0070698_100074506 | |||
| 1729 | Ga0070679_100000575 | |||
| 1730 | Ga0070679_100004536 | |||
| 1731 | Ga0070679_100029492 | |||
| 1732 | Ga0070679_100042885 | |||
| 1733 | Ga0070679_100043938 | |||
| 1734 | Ga0070679_100045741 | |||
| 1735 | Ga0070679_100062675 | |||
| 1736 | Ga0070679_100170887 | |||
| 1737 | Ga0070684_100000228 | |||
| 1738 | Ga0070684_100021275 | |||
| 1739 | Ga0070684_100056123 | |||
| 1740 | Ga0070684_100117942 | |||
| 1741 | Ga0068853_100000221 | |||
| 1742 | Ga0068853_100020583 | |||
| 1743 | Ga0068853_100052784 | |||
| 1744 | Ga0068853_100055688 | |||
| 1745 | Ga0068853_100057721 | |||
| 1746 | Ga0068853_100091008 | |||
| 1747 | Ga0068853_100107829 | |||
| 1748 | Ga0068853_100159796 | |||
| 1749 | Ga0068853_100310572 | |||
| 1750 | Ga0070672_100039481 | |||
| 1751 | Ga0070672_100193930 | |||
| 1752 | Ga0070672_100213679 | |||
| 1753 | Ga0070686_100054827 | |||
| 1754 | Ga0070686_100126038 | |||
| 1755 | Ga0070686_100257432 | |||
| 1756 | Ga0070693_100045539 | |||
| 1757 | Ga0070693_100232174 | |||
| 1758 | Ga0070665_100000001 | |||
| 1759 | Ga0070665_100000003 | |||
| 1760 | Ga0070665_100005742 | |||
| 1761 | Ga0070665_100060884 | |||
| 1762 | Ga0068855_100007886 | |||
| 1763 | Ga0068855_100019632 | |||
| 1764 | Ga0068855_100022883 | |||
| 1765 | Ga0068855_100029930 | |||
| 1766 | Ga0068855_100030208 | |||
| 1767 | Ga0068855_100042513 | |||
| 1768 | Ga0068855_100064567 | |||
| 1769 | Ga0068855_100075213 | |||
| 1770 | Ga0068855_100089498 | |||
| 1771 | Ga0068855_100139292 | |||
| 1772 | Ga0068855_100204082 | |||
| 1773 | Ga0070664_100003241 | |||
| 1774 | Ga0070664_100070355 | |||
| 1775 | Ga0070664_100072381 | |||
| 1776 | Ga0070664_100297839 | |||
| 1777 | Ga0068857_100001119 | |||
| 1778 | Ga0068857_100007157 | |||
| 1779 | Ga0068857_100018337 | |||
| 1780 | Ga0068857_100021607 | |||
| 1781 | Ga0068857_100024160 | |||
| 1782 | Ga0068857_100033737 | |||
| 1783 | Ga0068857_100272891 | |||
| 1784 | Ga0068854_100074699 | |||
| 1785 | Ga0068854_100163987 | |||
| 1786 | Ga0068854_100176276 | |||
| 1787 | Ga0068854_100232744 | |||
| 1788 | Ga0068856_100001307 | |||
| 1789 | Ga0068856_100002043 | |||
| 1790 | Ga0068856_100007064 | |||
| 1791 | Ga0068856_100095550 | |||
| 1792 | Ga0068856_100203889 | |||
| 1793 | Ga0068856_100235515 | |||
| 1794 | Ga0068856_100402951 | |||
| 1795 | Ga0068852_100002006 | |||
| 1796 | Ga0068852_100002446 | |||
| 1797 | Ga0068852_100018674 | |||
| 1798 | Ga0068852_100023547 | |||
| 1799 | Ga0068852_100033393 | |||
| 1800 | Ga0068852_100041003 | |||
| 1801 | Ga0068852_100061600 | |||
| 1802 | Ga0068852_100069230 | |||
| 1803 | Ga0068852_100123507 | |||
| 1804 | Ga0068852_100149038 | |||
| 1805 | Ga0068852_100175121 | |||
| 1806 | Ga0068852_100250677 | |||
| 1807 | Ga0068852_100327119 | |||
| 1808 | Ga0068852_100559387 | |||
| 1809 | Ga0068859_100000023 | |||
| 1810 | Ga0068859_100008109 | |||
| 1811 | Ga0068859_100009853 | |||
| 1812 | Ga0068859_100033356 | |||
| 1813 | Ga0068859_100067422 | |||
| 1814 | Ga0068859_100085184 | |||
| 1815 | Ga0068859_100171254 | |||
| 1816 | Ga0068859_100243384 | |||
| 1817 | Ga0068859_100324535 | |||
| 1818 | Ga0068859_100605749 | |||
| 1819 | Ga0068864_100005800 | |||
| 1820 | Ga0068864_100007839 | |||
| 1821 | Ga0068864_100026175 | |||
| 1822 | Ga0068864_100081365 | |||
| 1823 | Ga0068864_100273851 | |||
| 1824 | Ga0068864_100381557 | |||
| 1825 | Ga0068861_100009306 | |||
| 1826 | Ga0068861_100017858 | |||
| 1827 | Ga0068861_100202055 | |||
| 1828 | Ga0068861_100361265 | |||
| 1829 | Ga0068861_100364196 | |||
| 1830 | Ga0068870_10194693 | |||
| 1831 | Ga0068863_100001812 | |||
| 1832 | Ga0068863_100038562 | |||
| 1833 | Ga0068863_100093702 | |||
| 1834 | Ga0068863_100129455 | |||
| 1835 | Ga0068863_100194530 | |||
| 1836 | Ga0068858_100008485 | |||
| 1837 | Ga0068858_100048079 | |||
| 1838 | Ga0068858_100252575 | |||
| 1839 | Ga0068858_100310467 | |||
| 1840 | Ga0068860_100000046 | |||
| 1841 | Ga0068860_100000916 | |||
| 1842 | Ga0068860_100005408 | |||
| 1843 | Ga0068860_100007358 | |||
| 1844 | Ga0068860_100024991 | |||
| 1845 | Ga0068860_100034035 | |||
| 1846 | Ga0068862_100003779 | |||
| 1847 | Ga0068862_100022881 | |||
| 1848 | Ga0068862_100085090 | |||
| 1849 | Ga0068862_100188580 | |||
| 1850 | Ga0068862_100265707 | |||
| 1851 | Ga0081540_1029157 | |||
| 1852 | Ga0070716_100051038 | |||
| 1853 | Ga0075366_10000333 | |||
| 1854 | Ga0075366_10040925 | |||
| 1855 | Ga0075366_10085039 | |||
| 1856 | Ga0075366_10095111 | |||
| 1857 | Ga0097621_100000150 | |||
| 1858 | Ga0097621_100000847 | |||
| 1859 | Ga0097621_100001572 | |||
| 1860 | Ga0097621_100028478 | |||
| 1861 | Ga0097621_100062269 | |||
| 1862 | Ga0097621_100120542 | |||
| 1863 | Ga0097621_100123615 | |||
| 1864 | Ga0075370_10091284 | |||
| 1865 | Ga0068871_100000027 | |||
| 1866 | Ga0068871_100000354 | |||
| 1867 | Ga0068871_100001006 | |||
| 1868 | Ga0068871_100001864 | |||
| 1869 | Ga0068871_100040970 | |||
| 1870 | Ga0068871_100120184 | |||
| 1871 | Ga0068871_100125590 | |||
| 1872 | Ga0068871_100223279 | |||
| 1873 | Ga0068871_100287080 | |||
| 1874 | Ga0068871_100316893 | |||
| 1875 | Ga0075428_100024587 | |||
| 1876 | Ga0075428_100074722 | |||
| 1877 | Ga0075430_100010054 | |||
| 1878 | Ga0075431_100004434 | |||
| 1879 | Ga0075429_100005840 | |||
| 1880 | Ga0075429_100022996 | |||
| 1881 | Ga0068865_100000547 | |||
| 1882 | Ga0068865_100020901 | |||
| 1883 | Ga0068865_100225179 | |||
| 1884 | Ga0097620_100000023 | |||
| 1885 | Ga0097620_100008109 | |||
| 1886 | Ga0097620_100009853 | |||
| 1887 | Ga0097620_100033356 | |||
| 1888 | Ga0097620_100067425 | |||
| 1889 | Ga0097620_100085179 | |||
| 1890 | Ga0097620_100171243 | |||
| 1891 | Ga0097620_100243357 | |||
| 1892 | Ga0097620_100324543 | |||
| 1893 | Ga0097620_100605775 | |||
| 1894 | Ga0079104_1000178 | |||
| 1895 | Ga0105244_10000002 | |||
| 1896 | Ga0105240_10000074 | |||
| 1897 | Ga0105240_10000598 | |||
| 1898 | Ga0105240_10000626 | |||
| 1899 | Ga0105240_10001595 | |||
| 1900 | Ga0105240_10007062 | |||
| 1901 | Ga0105240_10015708 | |||
| 1902 | Ga0105240_10033651 | |||
| 1903 | Ga0105240_10046672 | |||
| 1904 | Ga0105240_10078410 | |||
| 1905 | Ga0105240_10266249 | |||
| 1906 | Ga0105240_10450625 | |||
| 1907 | Ga0105240_10552688 | |||
| 1908 | Ga0111539_10001328 | |||
| 1909 | Ga0111539_10015483 | |||
| 1910 | Ga0111539_10024925 | |||
| 1911 | Ga0105245_10092150 | |||
| 1912 | Ga0105247_10003751 | |||
| 1913 | Ga0105247_10005412 | |||
| 1914 | Ga0105247_10037118 | |||
| 1915 | Ga0114129_10020916 | |||
| 1916 | Ga0114129_10187025 | |||
| 1917 | Ga0114129_10195324 | |||
| 1918 | Ga0105243_10000018 | |||
| 1919 | Ga0105243_10001177 | |||
| 1920 | Ga0105241_10000659 | |||
| 1921 | Ga0105241_10000881 | |||
| 1922 | Ga0105241_10006159 | |||
| 1923 | Ga0105241_10014580 | |||
| 1924 | Ga0105241_10031709 | |||
| 1925 | Ga0105241_10034893 | |||
| 1926 | Ga0105241_10041058 | |||
| 1927 | Ga0105241_10160453 | |||
| 1928 | Ga0105241_10303576 | |||
| 1929 | Ga0105242_10006091 | |||
| 1930 | Ga0105242_10012454 | |||
| 1931 | Ga0105242_10040286 | |||
| 1932 | Ga0105242_10312645 | |||
| 1933 | Ga0105242_10468062 | |||
| 1934 | Ga0105248_10059502 | |||
| 1935 | Ga0105237_10000755 | |||
| 1936 | Ga0105237_10001361 | |||
| 1937 | Ga0105237_10002829 | |||
| 1938 | Ga0105237_10004143 | |||
| 1939 | Ga0105237_10007407 | |||
| 1940 | Ga0105237_10009395 | |||
| 1941 | Ga0105237_10020135 | |||
| 1942 | Ga0105237_10021690 | |||
| 1943 | Ga0105237_10025001 | |||
| 1944 | Ga0105237_10093900 | |||
| 1945 | Ga0105237_10094887 | |||
| 1946 | Ga0105237_10105937 | |||
| 1947 | Ga0105237_10113562 | |||
| 1948 | Ga0105237_10145894 | |||
| 1949 | Ga0105237_10204008 | |||
| 1950 | Ga0105238_10001132 | |||
| 1951 | Ga0105238_10011571 | |||
| 1952 | Ga0105238_10035958 | |||
| 1953 | Ga0105238_10165317 | |||
| 1954 | Ga0105249_10008464 | |||
| 1955 | Ga0105249_10012834 | |||
| 1956 | Ga0105249_10057441 | |||
| 1957 | Ga0105249_10059671 | |||
| 1958 | Ga0105249_10266201 | |||
| 1959 | Ga0105239_10000002 | |||
| 1960 | Ga0105239_10000012 | |||
| 1961 | Ga0105239_10000048 | |||
| 1962 | Ga0105239_10000055 | |||
| 1963 | Ga0105239_10000204 | |||
| 1964 | Ga0105239_10000785 | |||
| 1965 | Ga0105239_10002090 | |||
| 1966 | Ga0105239_10019429 | |||
| 1967 | Ga0105239_10048437 | |||
| 1968 | Ga0105239_10069310 | |||
| 1969 | Ga0105239_10075461 | |||
| 1970 | Ga0105239_10104224 | |||
| 1971 | Ga0105239_10155609 | |||
| 1972 | Ga0105239_10181833 | |||
| 1973 | Ga0105239_10300916 | |||
| 1974 | Ga0105246_10023007 | |||
| 1975 | Ga0105246_10066024 | |||
| 1976 | Ga0105246_10076160 | |||
| 1977 | Ga0105246_10208673 | |||
| 1978 | Ga0157373_10000001 | |||
| 1979 | Ga0157373_10000029 | |||
| 1980 | Ga0157373_10000094 | |||
| 1981 | Ga0157373_10007113 | |||
| 1982 | Ga0157373_10016080 | |||
| 1983 | Ga0157373_10016186 | |||
| 1984 | Ga0157373_10028385 | |||
| 1985 | Ga0157373_10028554 | |||
| 1986 | Ga0157373_10030973 | |||
| 1987 | Ga0157373_10039128 | |||
| 1988 | Ga0157373_10291476 | |||
| 1989 | Ga0157371_10000119 | |||
| 1990 | Ga0157371_10000216 | |||
| 1991 | Ga0157371_10000523 | |||
| 1992 | Ga0157371_10001598 | |||
| 1993 | Ga0157371_10001727 | |||
| 1994 | Ga0157371_10003284 | |||
| 1995 | Ga0157371_10003654 | |||
| 1996 | Ga0157371_10003809 | |||
| 1997 | Ga0157371_10008389 | |||
| 1998 | Ga0157371_10021342 | |||
| 1999 | Ga0157371_10032895 | |||
| 2000 | Ga0157371_10034773 | |||
| 2001 | Ga0157371_10050101 | |||
| 2002 | Ga0157371_10053609 | |||
| 2003 | Ga0157371_10061232 | |||
| 2004 | Ga0157371_10064775 | |||
| 2005 | Ga0157371_10101283 | |||
| 2006 | Ga0157371_10116938 | |||
| 2007 | Ga0157371_10220581 | |||
| 2008 | Ga0157370_10000261 | |||
| 2009 | Ga0157370_10000436 | |||
| 2010 | Ga0157370_10000839 | |||
| 2011 | Ga0157370_10002210 | |||
| 2012 | Ga0157370_10002385 | |||
| 2013 | Ga0157370_10002663 | |||
| 2014 | Ga0157370_10002692 | |||
| 2015 | Ga0157370_10003916 | |||
| 2016 | Ga0157370_10006823 | |||
| 2017 | Ga0157370_10024136 | |||
| 2018 | Ga0157370_10044524 | |||
| 2019 | Ga0157370_10044573 | |||
| 2020 | Ga0157370_10044996 | |||
| 2021 | Ga0157370_10066079 | |||
| 2022 | Ga0157370_10083264 | |||
| 2023 | Ga0157370_10168122 | |||
| 2024 | Ga0157370_10196428 | |||
| 2025 | Ga0157370_10275610 | |||
| 2026 | Ga0157370_10292841 | |||
| 2027 | Ga0157370_10306932 | |||
| 2028 | Ga0157370_10318568 | |||
| 2029 | Ga0157370_10337807 | |||
| 2030 | Ga0157369_10000004 | |||
| 2031 | Ga0157369_10002019 | |||
| 2032 | Ga0157369_10002652 | |||
| 2033 | Ga0157369_10004820 | |||
| 2034 | Ga0157369_10026016 | |||
| 2035 | Ga0157369_10047784 | |||
| 2036 | Ga0157369_10063536 | |||
| 2037 | Ga0157369_10100053 | |||
| 2038 | Ga0157369_10104624 | |||
| 2039 | Ga0157369_10220360 | |||
| 2040 | Ga0157369_10314250 | |||
| 2041 | Ga0157374_10000001 | |||
| 2042 | Ga0157374_10000647 | |||
| 2043 | Ga0157374_10002171 | |||
| 2044 | Ga0157374_10003665 | |||
| 2045 | Ga0157374_10008464 | |||
| 2046 | Ga0157374_10025420 | |||
| 2047 | Ga0157374_10031171 | |||
| 2048 | Ga0157374_10050525 | |||
| 2049 | Ga0157374_10056944 | |||
| 2050 | Ga0157374_10101752 | |||
| 2051 | Ga0157374_10189714 | |||
| 2052 | Ga0157374_10217994 | |||
| 2053 | Ga0157374_10289281 | |||
| 2054 | Ga0157374_10471222 | |||
| 2055 | Ga0157378_10011078 | |||
| 2056 | Ga0157378_10011450 | |||
| 2057 | Ga0157378_10016222 | |||
| 2058 | Ga0157378_10021827 | |||
| 2059 | Ga0157378_10023453 | |||
| 2060 | Ga0157378_10024439 | |||
| 2061 | Ga0157378_10026056 | |||
| 2062 | Ga0157378_10034378 | |||
| 2063 | Ga0157378_10106642 | |||
| 2064 | Ga0157378_10191429 | |||
| 2065 | Ga0157378_10205182 | |||
| 2066 | Ga0157378_10249257 | |||
| 2067 | Ga0157378_10349223 | |||
| 2068 | Ga0163162_10000024 | |||
| 2069 | Ga0163162_10000205 | |||
| 2070 | Ga0163162_10000331 | |||
| 2071 | Ga0163162_10000967 | |||
| 2072 | Ga0163162_10001657 | |||
| 2073 | Ga0163162_10002520 | |||
| 2074 | Ga0163162_10005326 | |||
| 2075 | Ga0163162_10005839 | |||
| 2076 | Ga0163162_10011763 | |||
| 2077 | Ga0163162_10023196 | |||
| 2078 | Ga0163162_10025607 | |||
| 2079 | Ga0163162_10027741 | |||
| 2080 | Ga0163162_10037946 | |||
| 2081 | Ga0163162_10044468 | |||
| 2082 | Ga0163162_10082702 | |||
| 2083 | Ga0163162_10104877 | |||
| 2084 | Ga0163162_10220637 | |||
| 2085 | Ga0163162_10386237 | |||
| 2086 | Ga0163162_10628741 | |||
| 2087 | Ga0157372_10000011 | |||
| 2088 | Ga0157372_10000196 | |||
| 2089 | Ga0157372_10000921 | |||
| 2090 | Ga0157372_10001904 | |||
| 2091 | Ga0157372_10005934 | |||
| 2092 | Ga0157372_10007158 | |||
| 2093 | Ga0157372_10015967 | |||
| 2094 | Ga0157372_10050754 | |||
| 2095 | Ga0157372_10061677 | |||
| 2096 | Ga0157372_10063919 | |||
| 2097 | Ga0157372_10069226 | |||
| 2098 | Ga0157372_10072860 | |||
| 2099 | Ga0157372_10085260 | |||
| 2100 | Ga0157372_10085973 | |||
| 2101 | Ga0157372_10108951 | |||
| 2102 | Ga0157372_10113649 | |||
| 2103 | Ga0157372_10113694 | |||
| 2104 | Ga0157372_10176871 | |||
| 2105 | Ga0157372_10214259 | |||
| 2106 | Ga0157372_10337954 | |||
| 2107 | Ga0157372_10549923 | |||
| 2108 | Ga0157372_10617486 | |||
| 2109 | Ga0157372_10635185 | |||
| 2110 | Ga0157375_10000229 | |||
| 2111 | Ga0157375_10000257 | |||
| 2112 | Ga0157375_10003117 | |||
| 2113 | Ga0157375_10026758 | |||
| 2114 | Ga0157375_10043753 | |||
| 2115 | Ga0157375_10049275 | |||
| 2116 | Ga0157375_10108563 | |||
| 2117 | Ga0157375_10195972 | |||
| 2118 | Ga0157375_10206911 | |||
| 2119 | Ga0157375_10217627 | |||
| 2120 | Ga0163163_10000653 | |||
| 2121 | Ga0163163_10005525 | |||
| 2122 | Ga0163163_10102281 | |||
| 2123 | Ga0163163_10197303 | |||
| 2124 | Ga0163163_10240688 | |||
| 2125 | Ga0163163_10260289 | |||
| 2126 | Ga0157380_10004261 | |||
| 2127 | Ga0157380_10033396 | |||
| 2128 | Ga0157380_10151009 | |||
| 2129 | Ga0157380_10249108 | |||
| 2130 | Ga0157380_10396639 | |||
| 2131 | Ga0182008_10000008 | |||
| 2132 | Ga0182008_10000026 | |||
| 2133 | Ga0182008_10000080 | |||
| 2134 | Ga0182008_10000687 | |||
| 2135 | Ga0182008_10011464 | |||
| 2136 | Ga0182008_10030579 | |||
| 2137 | Ga0182008_10091087 | |||
| 2138 | Ga0157377_10000932 | |||
| 2139 | Ga0157377_10018348 | |||
| 2140 | Ga0157377_10031423 | |||
| 2141 | Ga0157377_10129759 | |||
| 2142 | Ga0157377_10150301 | |||
| 2143 | Ga0157379_10001640 | |||
| 2144 | Ga0157379_10002723 | |||
| 2145 | Ga0157379_10025305 | |||
| 2146 | Ga0157379_10175810 | |||
| 2147 | Ga0157379_10236611 | |||
| 2148 | Ga0157379_10246240 | |||
| 2149 | Ga0157376_10000721 | |||
| 2150 | Ga0157376_10002682 | |||
| 2151 | Ga0157376_10004414 | |||
| 2152 | Ga0157376_10005888 | |||
| 2153 | Ga0157376_10011043 | |||
| 2154 | Ga0157376_10017174 | |||
| 2155 | Ga0157376_10037066 | |||
| 2156 | Ga0157376_10074336 | |||
| 2157 | Ga0182006_1000039 | |||
| 2158 | Ga0182006_1001557 | |||
| 2159 | Ga0182006_1003104 | |||
| 2160 | Ga0182006_1003392 | |||
| 2161 | Ga0182006_1010187 | |||
| 2162 | Ga0182007_10000027 | |||
| 2163 | Ga0182007_10004301 | |||
| 2164 | Ga0182005_1000263 | |||
| 2165 | Ga0183373_1003 | |||
| 2166 | Ga0163161_10006392 | |||
| 2167 | Ga0163161_10007503 | |||
| 2168 | Ga0163161_10011036 | |||
| 2169 | Ga0163161_10067433 | |||
| 2170 | Ga0163161_10187089 | |||
| 2171 | Ga0163161_10397008 | |||
| 2172 | Ga0206351_10902020 | |||
| 2173 | Ga0213876_10001528 | |||
| 2174 | Ga0213876_10022962 | |||
| 2175 | Ga0209436_100493 | |||
| 2176 | Ga0207427_100103 | |||
| 2177 | Ga0209437_100024 | |||
| 2178 | Ga0209437_100101 | |||
| 2179 | Ga0209258_100151 | |||
| 2180 | Ga0207425_1000002 | |||
| 2181 | Ga0209646_1000002 | |||
| 2182 | Ga0209646_1000823 | |||
| 2183 | Ga0209026_1000434 | |||
| 2184 | Ga0209148_1000154 | |||
| 2185 | Ga0209148_1012278 | |||
| 2186 | Ga0209129_1000002 | |||
| 2187 | Ga0209233_1000124 | |||
| 2188 | Ga0209233_1000396 | |||
| 2189 | Ga0209233_1011704 | |||
| 2190 | Ga0209455_1006267 | |||
| 2191 | Ga0209673_1000208 | |||
| 2192 | Ga0209130_1003361 | |||
| 2193 | Ga0209675_1000042 | |||
| 2194 | Ga0209676_1000008 | |||
| 2195 | Ga0209676_1001383 | |||
| 2196 | Ga0209025_1000004 | |||
| 2197 | Ga0209564_1013616 | |||
| 2198 | Ga0209758_1000006 | |||
| 2199 | Ga0209758_1003065 | |||
| 2200 | Ga0209758_1006777 | |||
| 2201 | Ga0209050_1000134 | |||
| 2202 | Ga0209050_1001255 | |||
| 2203 | Ga0209050_1003936 | |||
| 2204 | Ga0209050_1010474 | |||
| 2205 | Ga0207426_1000030 | |||
| 2206 | Ga0207426_1000051 | |||
| 2207 | Ga0207426_1000497 | |||
| 2208 | Ga0207426_1001981 | |||
| 2209 | Ga0207426_1006084 | |||
| 2210 | Ga0207426_1044109 | |||
| 2211 | Ga0209257_1000001 | |||
| 2212 | Ga0209257_1000005 | |||
| 2213 | Ga0209257_1001605 | |||
| 2214 | Ga0207656_10041673 | |||
| 2215 | Ga0207655_1000012 | |||
| 2216 | Ga0207655_1000228 | |||
| 2217 | Ga0207713_1079261 | |||
| 2218 | Ga0207682_10009425 | |||
| 2219 | Ga0207642_10117946 | |||
| 2220 | Ga0207710_10002748 | |||
| 2221 | Ga0207710_10043035 | |||
| 2222 | Ga0207688_10043481 | |||
| 2223 | Ga0207680_10000162 | |||
| 2224 | Ga0207680_10011575 | |||
| 2225 | Ga0207647_10000051 | |||
| 2226 | Ga0207647_10000149 | |||
| 2227 | Ga0207647_10000288 | |||
| 2228 | Ga0207647_10018104 | |||
| 2229 | Ga0207685_10055929 | |||
| 2230 | Ga0207645_10000156 | |||
| 2231 | Ga0207645_10000782 | |||
| 2232 | Ga0207645_10009564 | |||
| 2233 | Ga0207645_10032778 | |||
| 2234 | Ga0207645_10109477 | |||
| 2235 | Ga0207643_10003598 | |||
| 2236 | Ga0207643_10084438 | |||
| 2237 | Ga0207643_10188488 | |||
| 2238 | Ga0207705_10000132 | |||
| 2239 | Ga0207705_10017561 | |||
| 2240 | Ga0207705_10050880 | |||
| 2241 | Ga0207705_10073058 | |||
| 2242 | Ga0207705_10116961 | |||
| 2243 | Ga0207705_10177553 | |||
| 2244 | Ga0207705_10198785 | |||
| 2245 | Ga0207705_10257460 | |||
| 2246 | Ga0207654_10106324 | |||
| 2247 | Ga0207654_10144631 | |||
| 2248 | Ga0207707_10000051 | |||
| 2249 | Ga0207707_10028865 | |||
| 2250 | Ga0207707_10096572 | |||
| 2251 | Ga0207695_10000013 | |||
| 2252 | Ga0207695_10000071 | |||
| 2253 | Ga0207695_10000084 | |||
| 2254 | Ga0207695_10000323 | |||
| 2255 | Ga0207695_10004602 | |||
| 2256 | Ga0207695_10007525 | |||
| 2257 | Ga0207695_10012845 | |||
| 2258 | Ga0207695_10020015 | |||
| 2259 | Ga0207695_10030834 | |||
| 2260 | Ga0207695_10261931 | |||
| 2261 | Ga0207695_10340708 | |||
| 2262 | Ga0207695_10473374 | |||
| 2263 | Ga0207671_10001044 | |||
| 2264 | Ga0207671_10002500 | |||
| 2265 | Ga0207671_10002907 | |||
| 2266 | Ga0207671_10003166 | |||
| 2267 | Ga0207671_10003799 | |||
| 2268 | Ga0207671_10003904 | |||
| 2269 | Ga0207671_10003924 | |||
| 2270 | Ga0207671_10008063 | |||
| 2271 | Ga0207671_10018671 | |||
| 2272 | Ga0207671_10023419 | |||
| 2273 | Ga0207671_10047813 | |||
| 2274 | Ga0207671_10053071 | |||
| 2275 | Ga0207671_10054603 | |||
| 2276 | Ga0207660_10005186 | |||
| 2277 | Ga0207660_10013171 | |||
| 2278 | Ga0207660_10013385 | |||
| 2279 | Ga0207660_10276780 | |||
| 2280 | Ga0207660_10306548 | |||
| 2281 | Ga0207662_10012024 | |||
| 2282 | Ga0207662_10072777 | |||
| 2283 | Ga0207657_10010433 | |||
| 2284 | Ga0207657_10024041 | |||
| 2285 | Ga0207657_10027751 | |||
| 2286 | Ga0207657_10037574 | |||
| 2287 | Ga0207657_10042823 | |||
| 2288 | Ga0207657_10088481 | |||
| 2289 | Ga0207657_10088944 | |||
| 2290 | Ga0207657_10213406 | |||
| 2291 | Ga0207649_10009815 | |||
| 2292 | Ga0207649_10224063 | |||
| 2293 | Ga0207652_10000051 | |||
| 2294 | Ga0207652_10000384 | |||
| 2295 | Ga0207652_10020709 | |||
| 2296 | Ga0207652_10039453 | |||
| 2297 | Ga0207652_10045752 | |||
| 2298 | Ga0207652_10148855 | |||
| 2299 | Ga0207652_10446374 | |||
| 2300 | Ga0207681_10109432 | |||
| 2301 | Ga0207681_10136537 | |||
| 2302 | Ga0207694_10007231 | |||
| 2303 | Ga0207694_10216919 | |||
| 2304 | Ga0207650_10004151 | |||
| 2305 | Ga0207650_10029550 | |||
| 2306 | Ga0207650_10044181 | |||
| 2307 | Ga0207650_10084418 | |||
| 2308 | Ga0207650_10161026 | |||
| 2309 | Ga0207659_10148334 | |||
| 2310 | Ga0207659_10346473 | |||
| 2311 | Ga0207644_10002938 | |||
| 2312 | Ga0207644_10184510 | |||
| 2313 | Ga0207690_10004421 | |||
| 2314 | Ga0207690_10004758 | |||
| 2315 | Ga0207690_10007381 | |||
| 2316 | Ga0207690_10103237 | |||
| 2317 | Ga0207706_10000122 | |||
| 2318 | Ga0207706_10006768 | |||
| 2319 | Ga0207706_10009505 | |||
| 2320 | Ga0207706_10060615 | |||
| 2321 | Ga0207706_10095175 | |||
| 2322 | Ga0207706_10409233 | |||
| 2323 | Ga0207686_10003538 | |||
| 2324 | Ga0207686_10013442 | |||
| 2325 | Ga0207686_10031401 | |||
| 2326 | Ga0207709_10000021 | |||
| 2327 | Ga0207709_10000381 | |||
| 2328 | Ga0207709_10106339 | |||
| 2329 | Ga0207670_10251816 | |||
| 2330 | Ga0207669_10173204 | |||
| 2331 | Ga0207704_10000041 | |||
| 2332 | Ga0207704_10186500 | |||
| 2333 | Ga0207665_10123389 | |||
| 2334 | Ga0207691_10002527 | |||
| 2335 | Ga0207691_10004310 | |||
| 2336 | Ga0207691_10082409 | |||
| 2337 | Ga0207691_10107984 | |||
| 2338 | Ga0207691_10349044 | |||
| 2339 | Ga0207689_10001006 | |||
| 2340 | Ga0207689_10011687 | |||
| 2341 | Ga0207689_10051842 | |||
| 2342 | Ga0207689_10069790 | |||
| 2343 | Ga0207689_10209759 | |||
| 2344 | Ga0207661_10006472 | |||
| 2345 | Ga0207661_10042612 | |||
| 2346 | Ga0207661_10127723 | |||
| 2347 | Ga0207661_10491550 | |||
| 2348 | Ga0207679_10003010 | |||
| 2349 | Ga0207679_10067172 | |||
| 2350 | Ga0207679_10104790 | |||
| 2351 | Ga0207679_10201502 | |||
| 2352 | Ga0207679_10272053 | |||
| 2353 | Ga0207667_10000009 | |||
| 2354 | Ga0207667_10000177 | |||
| 2355 | Ga0207667_10000222 | |||
| 2356 | Ga0207667_10014871 | |||
| 2357 | Ga0207667_10015290 | |||
| 2358 | Ga0207667_10015451 | |||
| 2359 | Ga0207667_10021496 | |||
| 2360 | Ga0207667_10044124 | |||
| 2361 | Ga0207667_10086364 | |||
| 2362 | Ga0207667_10294914 | |||
| 2363 | Ga0207667_10596213 | |||
| 2364 | Ga0207651_10001099 | |||
| 2365 | Ga0207651_10010433 | |||
| 2366 | Ga0207651_10075842 | |||
| 2367 | Ga0207651_10087618 | |||
| 2368 | Ga0207651_10346452 | |||
| 2369 | Ga0207712_10011985 | |||
| 2370 | Ga0207712_10033754 | |||
| 2371 | Ga0207712_10072556 | |||
| 2372 | Ga0207712_10230009 | |||
| 2373 | Ga0207712_10332680 | |||
| 2374 | Ga0207668_10000843 | |||
| 2375 | Ga0207668_10045941 | |||
| 2376 | Ga0207668_10081892 | |||
| 2377 | Ga0207668_10095076 | |||
| 2378 | Ga0207668_10301111 | |||
| 2379 | Ga0207640_10011602 | |||
| 2380 | Ga0207640_10012737 | |||
| 2381 | Ga0207640_10049386 | |||
| 2382 | Ga0207640_10234487 | |||
| 2383 | Ga0207658_10015834 | |||
| 2384 | Ga0207658_10262591 | |||
| 2385 | Ga0207658_10301181 | |||
| 2386 | Ga0207658_10532665 | |||
| 2387 | Ga0207677_10008700 | |||
| 2388 | Ga0207677_10034996 | |||
| 2389 | Ga0207677_10061486 | |||
| 2390 | Ga0207677_10083187 | |||
| 2391 | Ga0207677_10180206 | |||
| 2392 | Ga0207703_10005016 | |||
| 2393 | Ga0207703_10252271 | |||
| 2394 | Ga0207703_10293914 | |||
| 2395 | Ga0207703_10444962 | |||
| 2396 | Ga0207703_10486797 | |||
| 2397 | Ga0207639_10003645 | |||
| 2398 | Ga0207639_10031777 | |||
| 2399 | Ga0207639_10048724 | |||
| 2400 | Ga0207639_10061775 | |||
| 2401 | Ga0207639_10081130 | |||
| 2402 | Ga0207639_10095928 | |||
| 2403 | Ga0207639_10269099 | |||
| 2404 | Ga0207639_10395493 | |||
| 2405 | Ga0207708_10127869 | |||
| 2406 | Ga0207702_10000463 | |||
| 2407 | Ga0207702_10016308 | |||
| 2408 | Ga0207702_10021967 | |||
| 2409 | Ga0207702_10182382 | |||
| 2410 | Ga0207702_10220130 | |||
| 2411 | Ga0207641_10000226 | |||
| 2412 | Ga0207641_10001217 | |||
| 2413 | Ga0207641_10004894 | |||
| 2414 | Ga0207641_10039269 | |||
| 2415 | Ga0207641_10064994 | |||
| 2416 | Ga0207648_10003412 | |||
| 2417 | Ga0207648_10003442 | |||
| 2418 | Ga0207648_10010003 | |||
| 2419 | Ga0207648_10064003 | |||
| 2420 | Ga0207648_10075871 | |||
| 2421 | Ga0207648_10119721 | |||
| 2422 | Ga0207676_10009837 | |||
| 2423 | Ga0207676_10022211 | |||
| 2424 | Ga0207676_10034551 | |||
| 2425 | Ga0207676_10082197 | |||
| 2426 | Ga0207676_10218506 | |||
| 2427 | Ga0207674_10000672 | |||
| 2428 | Ga0207674_10009363 | |||
| 2429 | Ga0207674_10035446 | |||
| 2430 | Ga0207674_10047123 | |||
| 2431 | Ga0207674_10053435 | |||
| 2432 | Ga0207674_10167317 | |||
| 2433 | Ga0207674_10180315 | |||
| 2434 | Ga0207674_10218190 | |||
| 2435 | Ga0207675_100000124 | |||
| 2436 | Ga0207675_100066501 | |||
| 2437 | Ga0207675_100295016 | |||
| 2438 | Ga0207683_10010911 | |||
| 2439 | Ga0207683_10015180 | |||
| 2440 | Ga0207683_10205270 | |||
| 2441 | Ga0207683_10503084 | |||
| 2442 | Ga0207698_10001082 | |||
| 2443 | Ga0207698_10004520 | |||
| 2444 | Ga0207698_10008356 | |||
| 2445 | Ga0207698_10018942 | |||
| 2446 | Ga0207698_10022184 | |||
| 2447 | Ga0207698_10201752 | |||
| 2448 | Ga0207698_10398949 | |||
| 2449 | Ga0209281_1000299 | |||
| 2450 | Ga0209995_1006596 | |||
| 2451 | Ga0207428_10121308 | |||
| 2452 | Ga0268266_10000049 | |||
| 2453 | Ga0268266_10000137 | |||
| 2454 | Ga0268266_10052240 | |||
| 2455 | Ga0268266_10373309 | |||
| 2456 | Ga0268265_10060000 | |||
| 2457 | Ga0268265_10130426 | |||
| 2458 | Ga0268265_10189233 | |||
| 2459 | Ga0268264_10000041 | |||
| 2460 | Ga0268264_10001720 | |||
| 2461 | Ga0268264_10003860 | |||
| 2462 | Ga0268264_10015087 | |||
| 2463 | Ga0268264_10018061 | |||
| 2464 | Ga0268264_10076166 | |||
| 2465 | Ga0268264_10233443 | |||
| 2466 | Ga0265334_10065194 | |||
| 2467 | Ga0265323_10000082 | |||
| 2468 | Ga0307517_10002048 | |||
| 2469 | Ga0307517_10009539 | |||
| 2470 | Ga0307517_10132404 | |||
| 2471 | Ga0307515_10000001 | |||
| 2472 | Ga0307515_10000061 | |||
| 2473 | Ga0307515_10009265 | |||
| 2474 | Ga0307515_10022836 | |||
| 2475 | Ga0265338_10036318 | |||
| 2476 | Ga0265338_10094888 | |||
| 2477 | Ga0265338_10130605 | |||
| 2478 | Ga0307511_10000042 | |||
| 2479 | Ga0316177_1032754 | |||
| 2480 | Ga0316176_1030119 | |||
| 2481 | Ga0316183_1088093 | |||
| 2482 | Ga0316181_1244277 | |||
| 2483 | Ga0265327_10000370 | |||
| 2484 | Ga0265327_10000395 | |||
| 2485 | Ga0265327_10000614 | |||
| 2486 | Ga0265327_10009563 | |||
| 2487 | Ga0265327_10011198 | |||
| 2488 | Ga0265316_10000982 | |||
| 2489 | Ga0265316_10005052 | |||
| 2490 | Ga0265316_10007084 | |||
| 2491 | Ga0307513_10247949 | |||
| 2492 | Ga0307513_10368175 | |||
| 2493 | Ga0307509_10077458 | |||
| 2494 | Ga0307509_10109209 | |||
| 2495 | Ga0307509_10175070 | |||
| 2496 | Ga0307408_100001828 | |||
| 2497 | Ga0307408_100002354 | |||
| 2498 | Ga0307408_100003065 | |||
| 2499 | Ga0307408_100008089 | |||
| 2500 | Ga0307408_100009674 | |||
| 2501 | Ga0307408_100042599 | |||
| 2502 | Ga0265313_10025091 | |||
| 2503 | Ga0307508_10002100 | |||
| 2504 | Ga0265342_10077052 | |||
| 2505 | Ga0316576_10019459 | |||
| 2506 | Ga0316576_10136585 | |||
| 2507 | Ga0307516_10001558 | |||
| 2508 | Ga0307405_10000001 | |||
| 2509 | Ga0307405_10002108 | |||
| 2510 | Ga0307405_10396170 | |||
| 2511 | Ga0316577_10025236 | |||
| 2512 | Ga0307413_10000106 | |||
| 2513 | Ga0307413_10025336 | |||
| 2514 | Ga0307406_10000055 | |||
| 2515 | Ga0307406_10151508 | |||
| 2516 | Ga0307407_10000130 | |||
| 2517 | Ga0307412_10000023 | |||
| 2518 | Ga0307412_10000034 | |||
| 2519 | Ga0307412_10000431 | |||
| 2520 | Ga0307412_10001853 | |||
| 2521 | Ga0307412_10004743 | |||
| 2522 | Ga0307412_10011797 | |||
| 2523 | Ga0307412_10119710 | |||
| 2524 | Ga0307412_10236457 | |||
| 2525 | Ga0307416_100000004 | |||
| 2526 | Ga0307416_100000994 | |||
| 2527 | Ga0307416_100417085 | |||
| 2528 | Ga0307414_10000012 | |||
| 2529 | Ga0307414_10000067 | |||
| 2530 | Ga0307414_10000205 | |||
| 2531 | Ga0307414_10000368 | |||
| 2532 | Ga0307414_10018419 | |||
| 2533 | Ga0307414_10019912 | |||
| 2534 | Ga0307414_10034191 | |||
| 2535 | Ga0307414_10043161 | |||
| 2536 | Ga0307414_10065989 | |||
| 2537 | Ga0307414_10070691 | |||
| 2538 | Ga0307414_10073136 | |||
| 2539 | Ga0307414_10103927 | |||
| 2540 | Ga0307414_10303636 | |||
| 2541 | Ga0307414_10342649 | |||
| 2542 | Ga0307411_10000008 | |||
| 2543 | Ga0307411_10144215 | |||
| 2544 | Ga0307411_10227554 | |||
| 2545 | Ga0316580_10029814 | |||
| 2546 | Ga0307510_10000091 | |||
| 2547 | Ga0307510_10008820 | |||
| 2548 | Ga0307510_10091404 | |||
| 2549 | Ga0307510_10135566 | |||
| 2550 | Ga0373944_0030594 | |||
| 2551 | Ga0373941_0001716 | |||
| 2552 | Ga0373957_0106428 | |||
| 2553 | Ga0373955_0042786 | |||
| 2554 | Ga0316574_0070151 | |||
| 2555 | Ga0316574_0075563 | |||
| 2556 | Ga0373937_0055659 | |||
| 2557 | Ga0316582_0004909 | |||
| 2558 | Ga0316584_0031063 | |||
| 2559 | Ga0316584_0245998 | |||
| 2560 | Ga0395899_0000033 | |||
| 2561 | Ga0395899_0000037 | |||
| 2562 | Ga0395899_0000796 | |||
| 2563 | Ga0395899_0011488 | |||
| 2564 | Ga0395899_0040931 | |||
| 2565 | Ga0395899_0076882 | |||
| 2566 | Ga0395899_0176577 | |||
| 2567 | Ga0395899_0205736 | |||
| 2568 | Ga0395900_0000014 | |||
| 2569 | Ga0395900_0020025 | |||
| 2570 | Ga0395900_0025707 | |||
| 2571 | Ga0395900_0034282 | |||
| 2572 | Ga0395900_0053699 | |||
| 2573 | Ga0395900_0058215 | |||
| 2574 | Ga0395898_0063471 | |||
| 2575 | Ga0395898_0344382 | |||
| 2576 | Ga0395905_0000241 | |||
| 2577 | Ga0395905_0000254 | |||
| 2578 | Ga0395905_0000278 | |||
| 2579 | Ga0395905_0001456 | |||
| 2580 | Ga0395905_0102782 | |||
| 2581 | Ga0395905_0180636 | |||
| 2582 | Ga0395901_0000582 | |||
| 2583 | Ga0395901_0001349 | |||
| 2584 | Ga0395901_0001630 | |||
| 2585 | Ga0395901_0165590 | |||
| 2586 | Ga0400489_60749 | |||
| 2587 | Ga0436365_0881017 | |||
| 2588 | Ga0436365_1079918 | |||
| 2589 | Ga0436365_1575134 | |||
| 2590 | Ga0436361_0671868 | |||
| 2591 | Ga0439436_0033623 | |||
| 2592 | Ga0439447_000599 | |||
| 2593 | Ga0439466_0000733 | |||
| 2594 | Ga0439466_0029101 | |||
| 2595 | Ga0439465_0004154 | |||
| 2596 | Ga0451807_1223207 | |||
| 2597 | Ga0451837_0930931 | |||
| 2598 | Ga0451853_1077363 | |||
| 2599 | Ga0451853_1344014 | |||
| 2600 | Ga0439431_0001706 | |||
| 2601 | Ga0439431_0008024 | |||
| 2602 | Ga0439445_0002350 | |||
| 2603 | Ga0439448_0000765 | |||
| 2604 | Ga0439434_0003786 | |||
| 2605 | Ga0451577_0000732 | |||
| 2606 | Ga0451577_0002136 | |||
| 2607 | Ga0451577_0003767 | |||
| 2608 | Ga0451577_0005099 | |||
| 2609 | Ga0451577_0014810 | |||
| 2610 | Ga0451577_0033905 | |||
| 2611 | Ga0451577_0036864 | |||
| 2612 | Ga0451577_0054343 | |||
| 2613 | Ga0451577_0107530 | |||
| 2614 | Ga0451577_0135050 | |||
| 2615 | Ga0466969_0000584 | |||
| 2616 | Ga0466972_0000207 | |||
| 2617 | Ga0466972_0003815 | |||
| 2618 | Ga0466972_0007800 | |||
| 2619 | Ga0466982_0129100 | |||
| 2620 | Ga0453683_0000174 | |||
| 2621 | Ga0453683_0004567 | |||
| 2622 | Ga0453683_0011474 | |||
| 2623 | Ga0453683_0020068 | |||
| 2624 | Ga0453683_0069892 | |||
| 2625 | Ga0453683_0210473 | |||
| 2626 | Ga0466965_0023948 | |||
| 2627 | Ga0466966_0000136 | |||
| 2628 | Ga0466961_0042386 | |||
| 2629 | Ga0466961_0225162 | |||
| 2630 | Ga0466961_0303882 | |||
| 2631 | Ga0466964_0033441 | |||
| 2632 | Ga0453684_0000167 | |||
| 2633 | Ga0453684_0000191 | |||
| 2634 | Ga0453684_0000202 | |||
| 2635 | Ga0453684_0000206 | |||
| 2636 | Ga0453684_0001141 | |||
| 2637 | Ga0453684_0001264 | |||
| 2638 | Ga0453684_0003500 | |||
| 2639 | Ga0453684_0003863 | |||
| 2640 | Ga0453684_0011041 | |||
| 2641 | Ga0453684_0012400 | |||
| 2642 | Ga0453684_0015367 | |||
| 2643 | Ga0453684_0026765 | |||
| 2644 | Ga0453684_0044759 | |||
| 2645 | Ga0453684_0051863 | |||
| 2646 | Ga0453684_0065811 | |||
| 2647 | Ga0453684_0066880 | |||
| 2648 | Ga0453684_0067315 | |||
| 2649 | Ga0453684_0076863 | |||
| 2650 | Ga0453684_0079972 | |||
| 2651 | Ga0453684_0086354 | |||
| 2652 | Ga0453684_0108767 | |||
| 2653 | Ga0453684_0116758 | |||
| 2654 | Ga0453684_0127953 | |||
| 2655 | Ga0453684_0132582 | |||
| 2656 | Ga0453684_0149655 | |||
| 2657 | Ga0453684_0151567 | |||
| 2658 | Ga0453684_0200916 | |||
| 2659 | Ga0453684_0248168 | |||
| 2660 | Ga0453684_0546075 | |||
| 2661 | Ga0466971_0032077 | |||
| 2662 | Ga0466970_0032860 | |||
| 2663 | Ga0466957_0007040 | |||
| 2664 | Ga0466957_0014895 | |||
| 2665 | Ga0466957_0051905 | |||
| 2666 | Ga0466957_0170116 | |||
| 2667 | Ga0466959_0000002 | |||
| 2668 | Ga0466959_0004264 | |||
| 2669 | Ga0466959_0063184 | |||
| 2670 | Ga0451576_0000003 | |||
| 2671 | Ga0451576_0000072 | |||
| 2672 | Ga0451576_0000088 | |||
| 2673 | Ga0451576_0000232 | |||
| 2674 | Ga0451576_0001854 | |||
| 2675 | Ga0451576_0006334 | |||
| 2676 | Ga0451576_0009893 | |||
| 2677 | Ga0451576_0010551 | |||
| 2678 | Ga0451576_0022082 | |||
| 2679 | Ga0451576_0112991 | |||
| 2680 | Ga0451576_0342262 | |||
| 2681 | Ga0451576_0405345 | |||
| 2682 | Ga0495627_000097 | |||
| 2683 | Ga0495627_005749 | |||
| 2684 | Ga0495627_012982 | |||
| 2685 | Ga0495627_021042 | |||
| 2686 | Ga0495629_0096536 | |||
| 2687 | Ga0495638_0000003 | |||
| 2688 | Ga0495638_0029092 | |||
| 2689 | Ga0495651_0038960 | |||
| 2690 | Ga0495653_0053573 | |||
| 2691 | Ga0495650_0000036 | |||
| 2692 | Ga0495580_0014773 | |||
| 2693 | Ga0495580_0039305 | |||
| 2694 | Ga0495585_0000831 | |||
| 2695 | Ga0495607_0032969 | |||
| 2696 | Ga0495606_0000008 | |||
| 2697 | Ga0495606_0003964 | |||
| 2698 | Ga0495606_0019321 | |||
| 2699 | Ga0495606_0025036 | |||
| 2700 | Ga0495606_0039090 | |||
| 2701 | Ga0495610_0000001 | |||
| 2702 | Ga0495610_0000233 | |||
| 2703 | Ga0495610_0023416 | |||
| 2704 | Ga0495610_0112392 | |||
| 2705 | Ga0495616_0004581 | |||
| 2706 | Ga0495616_0007672 | |||
| 2707 | Ga0495630_0012164 | |||
| 2708 | Ga0495630_0038354 | |||
| 2709 | Ga0495632_0068748 | |||
| 2710 | Ga0495632_0128572 | |||
| 2711 | Ga0495644_0030099 | |||
| 2712 | Ga0495648_0003229 | |||
| 2713 | Ga0495648_0003874 | |||
| 2714 | Ga0495663_0000165 | |||
| 2715 | Ga0495654_0000001 | |||
| 2716 | Ga0495609_0001065 | |||
| 2717 | Ga0495609_0012891 | |||
| 2718 | Ga0495645_0080467 | |||
| 2719 | Ga0495633_0000018 | |||
| 2720 | Ga0495633_0000080 | |||
| 2721 | Ga0495633_0000233 | |||
| 2722 | Ga0495633_0008035 | |||
| 2723 | Ga0495633_0008511 | |||
| 2724 | Ga0495668_0000044 | |||
| 2725 | Ga0495668_0000751 | |||
| 2726 | Ga0495634_0045371 | |||
| 2727 | Ga0495611_0001116 | |||
| 2728 | Ga0495625_0000379 | |||
| 2729 | Ga0495625_0000934 | |||
| 2730 | Ga0495625_0001653 | |||
| 2731 | Ga0495625_0034454 | |||
| 2732 | Ga0495661_0001087 | |||
| 2733 | Ga0495661_0001778 | |||
| 2734 | Ga0495661_0088121 | |||
| 2735 | Ga0495661_0092509 | |||
| 2736 | Ga0495657_0216696 | |||
| 2737 | Ga0495658_0087681 | |||
| 2738 | Ga0495671_0029844 | |||
| 2739 | Ga0495649_0000010 | |||
| 2740 | Ga0495649_0037561 | |||
| 2741 | Ga0495600_0071204 | |||
| 2742 | Ga0495674_0112806 | |||
| 2743 | Ga0495672_0018888 | |||
| 2744 | Ga0495672_0025973 | |||
| 2745 | Ga0495676_0070348 | |||
| 2746 | Ga0495680_0077801 | |||
| 2747 | Ga0495687_000001 | |||
| 2748 | Ga0495687_000736 | |||
| 2749 | Ga0495687_002474 | |||
| 2750 | Ga0495685_018838 | |||
| 2751 | Ga0495684_0167137 | |||
| 2752 | Ga0495686_0000004 | |||
| 2753 | Ga0495686_0000022 | |||
| 2754 | Ga0495686_0000196 | |||
| 2755 | Ga0495686_0003522 | |||
| 2756 | Ga0495686_0011430 | |||
| 2757 | Ga0495686_0069737 | |||
| 2758 | Ga0496100_0085300 | |||
| 2759 | Ga0496101_0301226 | |||
| 2760 | Ga0496102_0046542 | |||
| 2761 | Ga0496110_0105873 | |||
| 2762 | Ga0496114_0024981 | |||
| 2763 | Ga0496114_0055009 | |||
| 2764 | Ga0496115_0040646 | |||
| 2765 | Ga0496115_0102109 | |||
| 2766 | Ga0496116_0000004 | |||
| 2767 | Ga0496116_0000027 | |||
| 2768 | Ga0496116_0002379 | |||
| 2769 | Ga0496117_0000021 | |||
| 2770 | Ga0496117_0002276 | |||
| 2771 | Ga0496117_0085221 | |||
| 2772 | Ga0496118_0001245 | |||
| 2773 | Ga0496118_0026652 | |||
| 2774 | Ga0496118_0104190 | |||
| 2775 | Ga0496119_0000004 | |||
| 2776 | Ga0496121_0000020 | |||
| 2777 | Ga0496121_0044433 | |||
| 2778 | Ga0496122_0000154 | |||
| 2779 | Ga0496122_0000352 | |||
| 2780 | Ga0496122_0000591 | |||
| 2781 | Ga0496122_0000613 | |||
| 2782 | Ga0496122_0001522 | |||
| 2783 | Ga0496122_0003469 | |||
| 2784 | Ga0496122_0015395 | |||
| 2785 | Ga0496123_0000580 | |||
| 2786 | Ga0496123_0018244 | |||
| 2787 | Ga0496123_0023338 | |||
| 2788 | Ga0496124_0006587 | |||
| 2789 | Ga0496124_0016074 | |||
| 2790 | Ga0496124_0048297 | |||
| 2791 | Ga0496124_0088833 | |||
| 2792 | Ga0496125_0000012 | |||
| 2793 | Ga0496125_0001291 | |||
| 2794 | Ga0496125_0001400 | |||
| 2795 | Ga0496125_0011050 | |||
| 2796 | Ga0496125_0013680 | |||
| 2797 | Ga0496126_0001970 | |||
| 2798 | Ga0496126_0025237 | |||
| 2799 | Ga0496126_0028741 | |||
| 2800 | Ga0496126_0196632 | |||
| 2801 | Ga0495678_010906 | |||
| 2802 | Ga0501292_009646 | |||
| 2803 | Ga0501300_003399 | |||
| 2804 | Ga0501031_0066891 | |||
| 2805 | Ga0501032_0016207 | |||
| 2806 | Ga0501032_0017496 | |||
| 2807 | Ga0501033_0029523 | |||
| 2808 | Ga0501034_0004012 | |||
| 2809 | Ga0501034_0053271 | |||
| 2810 | Ga0501034_0066614 | |||
| 2811 | Ga0501034_0077642 | |||
| 2812 | Ga0501034_0122716 | |||
| 2813 | Ga0501034_0346038 | |||
| 2814 | Ga0501036_0019980 | |||
| 2815 | Ga0501036_0121343 | |||
| 2816 | Ga0501036_0159885 | |||
| 2817 | Ga0501037_0007826 | |||
| 2818 | Ga0501038_0007220 | |||
| 2819 | Ga0501038_0033809 | |||
| 2820 | Ga0501038_0122962 | |||
| 2821 | Ga0501039_0019205 | |||
| 2822 | Ga0501039_0262508 | |||
| 2823 | Ga0501043_0008215 | |||
| 2824 | Ga0501043_0015257 | |||
| 2825 | Ga0501043_0417047 | |||
| 2826 | Ga0501047_0009183 | |||
| 2827 | Ga0501047_0084328 | |||
| 2828 | Ga0501047_0147600 | |||
| 2829 | Ga0501047_0161519 | |||
| 2830 | Ga0501067_0050839 | |||
| 2831 | Ga0501068_0026838 | |||
| 2832 | Ga0501069_0007664 | |||
| 2833 | Ga0501073_0006174 | |||
| 2834 | Ga0501074_0034616 | |||
| 2835 | Ga0501198_002350 | |||
| 2836 | Ga0501202_009071 | |||
| 2837 | Ga0501202_030457 | |||
| 2838 | Ga0501207_011064 | |||
| 2839 | Ga0501207_018468 | |||
| 2840 | Ga0501217_000618 | |||
| 2841 | Ga0501217_004619 | |||
| 2842 | Ga0501222_004886 | |||
| 2843 | Ga0501223_006285 | |||
| 2844 | Ga0501223_007672 | |||
| 2845 | Ga0501235_005341 | |||
| 2846 | Ga0501240_004330 | |||
| 2847 | Ga0501240_013486 | |||
| 2848 | Ga0501242_006477 | |||
| 2849 | Ga0501243_000451 | |||
| 2850 | Ga0501247_006417 | |||
| 2851 | Ga0501249_000027 | |||
| 2852 | Ga0501252_004165 | |||
| 2853 | Ga0501257_001311 | |||
| 2854 | Ga0501257_018063 | |||
| 2855 | Ga0501259_000660 | |||
| 2856 | Ga0501219_000230 | |||
| 2857 | Ga0501225_0004035 | |||
| 2858 | Ga0501225_0004470 | |||
| 2859 | Ga0501225_0006622 | |||
| 2860 | Ga0501245_005844 | |||
| 2861 | Ga0501079_0075469 | |||
| 2862 | Ga0501080_0194961 | |||
| 2863 | Ga0501083_0055458 | |||
| 2864 | Ga0501241_000012 | |||
| 2865 | Ga0501241_005162 | |||
| 2866 | Ga0501264_000335 | |||
| 2867 | Ga0501266_000004 | |||
| 2868 | Ga0501266_005253 | |||
| 2869 | Ga0501267_009653 | |||
| 2870 | Ga0501269_000451 | |||
| 2871 | Ga0501280_000502 | |||
| 2872 | Ga0501035_0042854 | |||
| 2873 | Ga0501035_0043415 | |||
| 2874 | Ga0501035_0162925 | |||
| 2875 | Ga0501044_0016307 | |||
| 2876 | Ga0501044_0020946 | |||
| 2877 | Ga0501044_0021863 | |||
| 2878 | Ga0501044_0044831 | |||
| 2879 | Ga0501044_0161620 | |||
| 2880 | Ga0501044_0216066 | |||
| 2881 | Ga0501284_00029 | |||
| 2882 | nmdc:mga0k408_102151_c1 | |||
| 2883 | nmdc:mga0k408_105_c1 | |||
| 2884 | nmdc:mga0k408_13283_c1 | |||
| 2885 | nmdc:mga0k408_48_c1 | |||
| 2886 | nmdc:mga0k408_64279_c1 | |||
| 2887 | nmdc:mga05p37_285602_c1 | |||
| 2888 | nmdc:mga05p37_428740_c1 | |||
| 2889 | nmdc:mga0qj67_108041_c1 | |||
| 2890 | nmdc:mga08y16_142160_c1 | |||
| 2891 | nmdc:mga08y16_191002_c1 | |||
| 2892 | Ga0500635_0000796 | |||
| 2893 | Ga0500578_0000694 | |||
| 2894 | Ga0500578_0045759 | |||
| 2895 | Ga0500644_0000283 | |||
| 2896 | Ga0500646_0005658 | |||
| 2897 | Ga0500646_0027325 | |||
| 2898 | Ga0500647_0050815 | |||
| 2899 | Ga0500583_0000059 | |||
| 2900 | Ga0500651_0000253 | |||
| 2901 | Ga0500641_0000242 | |||
| 2902 | Ga0500557_033835 | |||
| 2903 | Ga0500562_014775 | |||
| 2904 | Ga0500607_018370 | |||
| 2905 | Ga0500608_027602 | |||
| 2906 | Ga0500608_073120 | |||
| 2907 | Ga0500618_000013 | |||
| 2908 | Ga0500618_011591 | |||
| 2909 | Ga0500658_0000010 | |||
| 2910 | Ga0500559_0006224 | |||
| 2911 | Ga0500568_0001626 | |||
| 2912 | Ga0500573_0117160 | |||
| 2913 | Ga0500577_0020859 | |||
| 2914 | Ga0500604_0006396 | |||
| 2915 | Ga0500604_0022589 | |||
| 2916 | Ga0500616_0000007 | |||
| 2917 | Ga0500616_0005429 | |||
| 2918 | Ga0500616_0009033 | |||
| 2919 | Ga0500616_0016083 | |||
| 2920 | Ga0500622_0000247 | |||
| 2921 | Ga0500622_0000515 | |||
| 2922 | Ga0500622_0000540 | |||
| 2923 | Ga0500622_0000777 | |||
| 2924 | Ga0500622_0001463 | |||
| 2925 | Ga0500624_000379 | |||
| 2926 | Ga0500633_0048877 | |||
| 2927 | Ga0500611_000034 | |||
| 2928 | Ga0501082_0112289 | |||
| 2929 | Ga0501082_0414103 | |||
| 2930 | Ga0466962_0005611 | |||
| 2931 | 2511234099 | |||
| 2932 | 2513232253 | |||
| 2933 | 2522547642 | |||
| 2934 | 2524005564 | |||
| 2935 | 2585144370 | |||
| 2936 | 2585158996 | |||
| 2937 | 2585163284 | |||
| 2938 | 2585425382 | |||
| 2939 | 2587677376 | |||
| 2940 | 2587745500 | |||
| 2941 | 2587750693 | |||
| 2942 | 2587943784 | |||
| 2943 | 2588208895 | |||
| 2944 | 2588212397 | |||
| 2945 | 2588225066 | |||
| 2946 | 2588231606 | |||
| 2947 | 2588445713 | |||
| 2948 | 2590602332 | |||
| 2949 | 2590611316 | |||
| 2950 | 2599480990 | |||
| 2951 | 2644009823 | |||
| 2952 | 2644374219 | |||
| 2953 | 2644683695 | |||
| 2954 | 2722726497 | |||
| 2955 | 2729202037 | |||
| 2956 | 2738727059 | |||
| 2957 | 2738760566 | |||
| 2958 | 2739254997 | |||
| 2959 | 2739300621 | |||
| 2960 | 2739590407 | |||
| 2961 | 2739617379 | |||
| 2962 | 2739647571 | |||
| 2963 | 2740002460 | |||
| 2964 | 2740007276 | |||
| 2965 | 2740033304 | |||
| 2966 | 2740061480 | |||
| 2967 | 2753671961 | |||
| 2968 | 2765576891 | |||
| 2969 | 2775673393 | |||
| 2970 | 2776612699 | |||
| 2971 | 2802652418 | |||
| 2972 | 2816872184 | |||
| 2973 | 2819548307 | |||
| 2974 | 2819573629 | |||
| 2975 | 2819680871 | |||
| 2976 | 2821136963 | |||
| 2977 | 2839991354 | |||
| 2978 | 2842086659 | |||
| 2979 | 2842906815 | |||
| 2980 | 2849286733 | |||
| 2981 | 2852623493 | |||
| 2982 | 2852630140 | |||
| 2983 | 2857615894 | |||
| 2984 | 2857620360 | |||
| 2985 | 2857632142 | |||
| 2986 | 2871724350 | |||
| 2987 | 2881362663 | |||
| 2988 | 2883072585 | |||
| 2989 | 2884637258 | |||
| 2990 | 2884795628 | |||
| 2991 | 2884937607 | |||
| 2992 | 2889292556 | |||
| 2993 | 2890737617 | |||
| 2994 | 2895501638 | |||
| 2995 | 2896087752 | |||
| 2996 | 2896112542 | |||
| 2997 | 2896319411 | |||
| 2998 | 2896347003 | |||
| 2999 | 2898713405 | |||
| 3000 | 2903897866 | |||
| 3001 | 2904422088 | |||
| 3002 | 2904446100 | |||
| 3003 | 2904468295 | |||
| 3004 | 2904559074 | |||
| 3005 | 2904783639 | |||
| 3006 | 2906000464 | |||
| 3007 | 2910248588 | |||
| 3008 | 2914760597 | |||
| 3009 | 2919097502 | |||
| 3010 | 2919182190 | |||
| 3011 | 2919189878 | |||
| 3012 | 2919192101 | |||
| 3013 | 2919400780 | |||
| 3014 | 2919442597 | |||
| 3015 | 2919686044 | |||
| 3016 | 2919695416 | |||
| 3017 | 2928080902 | |||
| 3018 | 2928150191 | |||
| 3019 | 2929154664 | |||
| 3020 | 2929178801 | |||
| 3021 | 2929241244 | |||
| 3022 | 2929923240 | |||
| 3023 | 2932088242 | |||
| 3024 | 2939668158 | |||
| 3025 | 2945927788 | |||
| 3026 | 2945981205 | |||
| 3027 | 2946019394 | |||
| 3028 | 2946020604 | |||
| 3029 | 2958459095 | |||
| 3030 | 2958512513 | |||
| 3031 | 2965323326 | |||
| 3032 | 2977236774 | |||
| 3033 | 2977246770 | |||
| 3034 | 2977271498 | |||
| 3035 | 2984575386 | |||
| 3036 | 2984608840 | |||
| 3037 | 2993374090 | |||
| 3038 | 2993480992 | |||
| 3039 | 3003233518 | |||
| 3040 | 8003153683 | |||
| 3041 | 8054310548 | |||
| 3042 | 8055423024 | |||
| 3043 | 8055590799 | |||
| 3044 | 8055596625 | |||
| 3045 | 8056442050 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1khd-assembly1.cif.gz_D | crystal structure analysis of the anthranilate phosphoribosyltransferase from erwinia carotovora at 1.9 resolution (current name, pectobacterium carotovorum) | 0.9453 | 2 | 327 |
| 5c1r-assembly1.cif.gz_A | stereoisomer of prpp bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyl (anprt; trpd) | 0.9384 | 4 | 328 |
| 4zof-assembly1.cif.gz_B | lobenzarit-like inhibitor bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd) | 0.9371 | 4 | 330 |
| 4x5b-assembly1.cif.gz_B | anthranilate phosphoribosyltransferase variant r193l from mycobacterium tuberculosis in complex with prpp and mg | 0.935 | 4 | 327 |
| 1kgz-assembly1.cif.gz_B | crystal structure analysis of the anthranilate phosphoribosyltransferase from erwinia carotovora (current name, pectobacterium carotovorum) | 0.9348 | 2 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1gxbA01 | Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C | 0.9732 | 2 | 182 | 1.20.970.10 |
| 1kgzA01 | Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C | 0.9575 | 4 | 183 | 1.20.970.10 |
| 5noeC01 | Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C | 0.9574 | 4 | 182 | 1.20.970.10 |
| 4gtnA01 | Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C | 0.9555 | 2 | 68 | 1.20.970.10 |
| 4yi7A01 | Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C | 0.9437 | 2 | 68 | 1.20.970.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A090VQB4-F1-model_v4 | Anthranilate phosphoribosyltransferase (EC 2.4.2.18) | 0.9957 | 1 | 268 |
GO:0000162
GO:0004048 GO:0005829 |
| AF-A0A2D5JLZ6-F1-model_v4 | Anthranilate phosphoribosyltransferase | 0.9922 | 1 | 200 |
GO:0000162
GO:0004048 GO:0005829 |
| AF-A0A6H9NY20-F1-model_v4 | deleted | 0.9911 | 1 | 174 |
|
| AF-A0A381PU49-F1-model_v4 | Glycosyl transferase family 3 domain-containing protein | 0.9901 | 45 | 330 |
GO:0000162
GO:0004048 GO:0005829 |
| AF-A0A3M1X9Y4-F1-model_v4 | Anthranilate phosphoribosyltransferase (EC 2.4.2.18) | 0.989 | 2 | 327 |
GO:0000162
GO:0000287 GO:0004048 GO:0005829 GO:0006541 |