F494544

General Info

Members Datasets Scaffolds Average Seq Length
1522 537 3045 330

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0000757|Ga0495610_0000757_7734_8876
Length 380
Sequence LFKKYIQKGLPYGNPFFMPPASANWRRSDKQGGMGKLYLCILIPPLGGWGQMKQILNHLFEHKTFSREQSKGILMNIAQGKYNNAQMAAFMTAYCMRSITVEELEGFRDAMLELCLPVNLETEGLIDLCGTGGDGKDTFNISTLASFVVAGAGYKVAKHGNYGVSSGCGSSNVMEYLGYQFTNNIDELKRSADEANICFLHAPLFHPAMKTVAPIRKELGVKTFFNMLGPMVNPAKPDNQLVGVFNLELARVYAYLYQKSTTKYTIINALEGYDEISLTCDFKTFSADGEKINSVEDLGFELLDPKEIIGGDTVEASAAIFSNVLKGDGTPAQNNVVLANAALAIKTIGPEKTFGDCFYEAEEALFSKKALKSFNTLLQN

Samples

Sample ID Description Type Environment
1 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
97 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
130 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
135 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
137 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
139 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
140 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
141 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
143 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
144 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
213 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
219 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
220 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
223 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
224 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
225 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
226 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
227 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
228 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
229 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
230 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
231 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
232 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
233 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
234 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
235 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
236 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
237 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
238 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
239 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
240 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
245 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
248 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
249 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
250 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
251 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
256 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
257 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
260 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
263 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
266 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
267 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
268 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
269 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
270 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
271 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
272 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
273 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
274 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
275 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
276 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
277 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
278 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
279 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
280 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
281 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
282 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
283 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
284 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
285 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
286 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
287 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
288 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
289 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
290 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
291 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
295 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
296 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
297 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
298 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
299 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
300 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
301 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
302 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
303 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
304 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
305 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
306 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
307 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
308 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
309 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
310 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
311 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
314 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
315 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
316 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
317 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
318 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
319 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
322 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
323 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
324 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
325 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
326 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
327 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
328 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
329 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
330 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
331 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
336 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
337 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
338 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
339 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
340 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
341 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
342 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
343 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
344 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
345 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
346 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
347 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
348 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
359 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
360 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
361 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
362 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
363 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
364 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
365 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
366 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
367 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
368 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
369 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
370 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
371 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
372 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
373 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
374 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
375 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
376 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
377 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
378 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
379 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
380 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
381 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
382 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
383 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
384 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
385 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
386 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
387 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
388 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
389 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
390 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
392 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
393 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
394 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
395 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
396 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
397 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
398 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
399 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
400 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
401 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
402 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
403 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
404 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
405 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
406 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
407 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
408 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
409 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
410 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
411 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
412 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
413 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
414 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
415 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
416 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
417 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
418 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
419 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
420 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
421 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
422 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
423 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
424 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
425 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
426 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
427 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
428 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
429 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
430 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
431 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
432 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
433 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
434 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
435 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
436 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
437 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
438 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
439 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
440 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
441 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
442 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
443 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
444 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
445 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
446 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
447 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
448 2738541278 Niastella sp. CF465 Isolate Unclassified
449 2738541284 Pedobacter sp. YR016 Isolate Unclassified
450 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
451 2738543023 Pedobacter sp. OK628 Isolate Unclassified
452 2739367651 Pedobacter sp. OK291 Isolate Unclassified
453 2739367656 Pedobacter sp. CF523 Isolate Unclassified
454 2739367663 Pedobacter sp. YR510 Isolate Unclassified
455 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
456 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
457 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
458 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
459 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
460 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
461 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
462 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
463 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
464 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
465 2818991437 Pedobacter terrae 518 Isolate Unclassified
466 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
467 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
468 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
469 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
470 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
471 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
472 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
473 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
474 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
475 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
476 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
477 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
478 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
479 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
480 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
481 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
482 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
483 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
484 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
485 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
486 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
487 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
488 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
489 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
490 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
491 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
492 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
493 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
494 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
495 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
496 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
497 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
498 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
499 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
500 2914759650 Rhizosphaericola mali Isolate Rhizosphere
501 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
502 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
503 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
504 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
505 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
506 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
507 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
508 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
509 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
510 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
511 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
512 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
513 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
514 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
515 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
516 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
517 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
518 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
519 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
520 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
521 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
522 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
523 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
524 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
525 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
526 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
527 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
528 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
529 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
530 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
531 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
532 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
533 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
534 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
535 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
536 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
537 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.38
Metatranscriptomes 0.07
Isolates 7.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 6.83
Nodule 0.2
Rhizoplane 0.66
Rhizosphere 82.65
Stem 0
Stem Tuber 0
Unclassified 3.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495610_0000757 3300046512 Bacteria 30503
2 SwRhRL2b_contig_1994362 2162886007 Bacteria 2992
3 SwRhRL2b_contig_2088904 2162886007 Bacteria 1972
4 SwRhRL2b_contig_3399644 2162886007 Bacteria 1678
5 JGI24741J21665_1002082 3300001915 Bacteria 5348
6 JGI24741J21665_1006025 3300001915 Bacteria 2472
7 JGI24740J21852_10005751 3300001979 Bacteria 5210
8 JGI24740J21852_10036460 3300001979 Bacteria 1527
9 JGI24739J22299_10038781 3300001989 Bacteria 1600
10 JGI24737J22298_10014703 3300001990 Bacteria 2539
11 JGI24744J21845_10002612 3300002077 Bacteria 3681
12 JGI25162J39368_1000017 3300002737 Bacteria 281385
13 JGI25162J39368_1000614 3300002737 Bacteria 25616
14 JGI25154J39366_1000040 3300002738 Bacteria 147410
15 JGI25164J39214_1001787 3300002772 Bacteria 4180
16 JGI25150J39212_1000001 3300002774 Bacteria 1318726
17 JGI25151J46595_10000005 3300003187 Bacteria 431598
18 JGI25165J46597_1000634 3300003214 Bacteria 29066
19 JGI25153J46596_10000040 3300003215 Bacteria 165523
20 JGI25153J46596_10003346 3300003215 Bacteria 9003
21 JGI25153J46596_10041566 3300003215 Bacteria 1412
22 rootH1_10003601 3300003316 Bacteria 8624
23 rootH1_10003601 3300003323 Bacteria 8581
24 rootH1_10007102 3300003316 Bacteria 23916
25 rootH1_10082958 3300003316 Bacteria 1273
26 rootH1_10151462 3300003316 Bacteria 2036
27 rootH2_10013635 3300003320 Bacteria 31266
28 rootH2_10016199 3300003320 Bacteria 99895
29 rootH2_10019144 3300003320 Bacteria 8706
30 rootH2_10030072 3300003320 Bacteria 4856
31 rootH2_10077704 3300003320 Bacteria 8498
32 rootH2_10190169 3300003320 Bacteria 2218
33 rootH2_10308990 3300003320 Bacteria 1586
34 rootL2_10002914 3300003322 Bacteria 16634
35 rootL2_10025842 3300003322 Bacteria 2271
36 rootL2_10032238 3300003322 Bacteria 2626
37 rootL2_10032239 3300003322 Bacteria 2459
38 rootL2_10079467 3300003322 Bacteria 6903
39 rootL2_10083418 3300003322 Bacteria 1603
40 rootL2_10122039 3300003322 Bacteria 2235
41 rootL2_10122858 3300003322 Bacteria 2150
42 rootL2_10134929 3300003322 Bacteria 4501
43 rootL2_10305032 3300003322 Bacteria 2251
44 rootL2_10327582 3300003322 Bacteria 1538
45 rootH1_10005821 3300003323 Bacteria 129122
46 rootH1_10020847 3300003323 Bacteria 7444
47 rootH1_10023753 3300003323 Bacteria 1453
48 rootH1_10031683 3300003323 Bacteria 5917
49 rootH1_10050118 3300003323 Bacteria 18955
50 rootH1_10052662 3300003323 Bacteria 12054
51 rootH1_10101577 3300003323 Bacteria 4765
52 rootH1_10182853 3300003323 Bacteria 2552
53 rootH1_10230655 3300003323 Bacteria 1855
54 JGI25160J50197_1005075 3300003354 Bacteria 5557
55 JGI25160J50197_1005718 3300003354 Bacteria 5138
56 JGI25160J50197_1013229 3300003354 Bacteria 2823
57 Ga0055535_1003449 3300003761 Bacteria 4482
58 Ga0055536_1000564 3300003781 Bacteria 25322
59 Ga0055528_1001650 3300003790 Bacteria 13115
60 Ga0055530_10000387 3300003791 Bacteria 39558
61 Ga0055530_10007698 3300003791 Bacteria 4481
62 Ga0055531_10000131 3300003794 Bacteria 85257
63 Ga0055531_10000156 3300003794 Bacteria 78858
64 Ga0055543_1021355 3300004625 Bacteria 1181
65 Ga0065165_1000102 3300005262 Bacteria 140917
66 Ga0065165_1001626 3300005262 Bacteria 22857
67 Ga0065714_10002826 3300005288 Bacteria 18386
68 Ga0065714_10011701 3300005288 Bacteria 2858
69 Ga0065714_10064551 3300005288 Bacteria 37166
70 Ga0065714_10065701 3300005288 Bacteria 8816
71 Ga0065714_10066278 3300005288 Bacteria 7219
72 Ga0065714_10070733 3300005288 Bacteria 3779
73 Ga0065714_10071292 3300005288 Bacteria 3606
74 Ga0065714_10085181 3300005288 Bacteria 2127
75 Ga0065714_10136175 3300005288 Bacteria 1207
76 Ga0065704_10070466 3300005289 Bacteria 23732
77 Ga0065704_10070721 3300005289 Bacteria 17058
78 Ga0065704_10072255 3300005289 Bacteria 8855
79 Ga0065704_10073358 3300005289 Bacteria 7256
80 Ga0065704_10093766 3300005289 Bacteria 2579
81 Ga0065704_10125453 3300005289 Bacteria 1702
82 Ga0065712_10076829 3300005290 Bacteria 3583
83 Ga0065712_10106080 3300005290 Bacteria 1896
84 Ga0070658_10000091 3300005327 Bacteria 81263
85 Ga0070658_10057776 3300005327 Bacteria 3156
86 Ga0070676_10000336 3300005328 Bacteria 21357
87 Ga0070676_10002755 3300005328 Bacteria 9076
88 Ga0070676_10003243 3300005328 Bacteria 8443
89 Ga0070676_10060138 3300005328 Bacteria 2255
90 Ga0070683_100000725 3300005329 Bacteria 24107
91 Ga0070683_100010872 3300005329 Bacteria 7837
92 Ga0070683_100032588 3300005329 Bacteria 4746
93 Ga0070683_100042317 3300005329 Bacteria 4194
94 Ga0070690_100005983 3300005330 Bacteria 6872
95 Ga0070690_100275978 3300005330 Bacteria 1197
96 Ga0070670_100039428 3300005331 Bacteria 4062
97 Ga0070670_100054985 3300005331 Bacteria 3417
98 Ga0070670_100060696 3300005331 Bacteria 3246
99 Ga0070670_100066481 3300005331 Bacteria 3094
100 Ga0070670_100082144 3300005331 Bacteria 2769
101 Ga0070670_100384887 3300005331 Bacteria 1236
102 Ga0068869_100039941 3300005334 Bacteria 3352
103 Ga0068869_100069980 3300005334 Bacteria 2595
104 Ga0068869_100127915 3300005334 Bacteria 1950
105 Ga0068869_100284187 3300005334 Bacteria 1331
106 Ga0070666_10000051 3300005335 Bacteria 99740
107 Ga0070666_10010156 3300005335 Bacteria 5881
108 Ga0070666_10010207 3300005335 Bacteria 5868
109 Ga0070666_10013609 3300005335 Bacteria 5165
110 Ga0070666_10143122 3300005335 Bacteria 1666
111 Ga0070680_100002139 3300005336 Bacteria 14605
112 Ga0070680_100050858 3300005336 Bacteria 3380
113 Ga0070680_100061374 3300005336 Bacteria 3077
114 Ga0070680_100065624 3300005336 Bacteria 2975
115 Ga0070680_100331896 3300005336 Bacteria 1292
116 Ga0070682_100000060 3300005337 Bacteria 105136
117 Ga0070682_100000596 3300005337 Bacteria 22012
118 Ga0070682_100001275 3300005337 Bacteria 14290
119 Ga0070682_100025241 3300005337 Bacteria 3545
120 Ga0070682_100026905 3300005337 Bacteria 3446
121 Ga0068868_100010338 3300005338 Bacteria 6749
122 Ga0068868_100015086 3300005338 Bacteria 5708
123 Ga0068868_100016530 3300005338 Bacteria 5482
124 Ga0068868_100076548 3300005338 Bacteria 2675
125 Ga0068868_100080003 3300005338 Bacteria 2618
126 Ga0068868_100080631 3300005338 Bacteria 2608
127 Ga0068868_100085678 3300005338 Bacteria 2532
128 Ga0068868_100162816 3300005338 Bacteria 1843
129 Ga0068868_100198670 3300005338 Bacteria 1671
130 Ga0070660_100000800 3300005339 Bacteria 20862
131 Ga0070660_100009297 3300005339 Bacteria 6907
132 Ga0070660_100071902 3300005339 Bacteria 2702
133 Ga0070660_100103890 3300005339 Bacteria 2253
134 Ga0070660_100106276 3300005339 Bacteria 2229
135 Ga0070660_100133278 3300005339 Bacteria 1989
136 Ga0070689_100001732 3300005340 Bacteria 13951
137 Ga0070689_100013351 3300005340 Bacteria 5941
138 Ga0070689_100014808 3300005340 Bacteria 5674
139 Ga0070689_100137929 3300005340 Bacteria 1959
140 Ga0070691_10033514 3300005341 Bacteria 2417
141 Ga0070687_100125604 3300005343 Bacteria 1474
142 Ga0070661_100003143 3300005344 Bacteria 11357
143 Ga0070661_100022549 3300005344 Bacteria 4508
144 Ga0070661_100118026 3300005344 Bacteria 1985
145 Ga0070668_100002494 3300005347 Bacteria 13548
146 Ga0070668_100100239 3300005347 Bacteria 2294
147 Ga0070668_100110332 3300005347 Bacteria 2189
148 Ga0070668_100132503 3300005347 Bacteria 2001
149 Ga0070669_100036574 3300005353 Bacteria 3558
150 Ga0070669_100048455 3300005353 Bacteria 3101
151 Ga0070669_100135719 3300005353 Bacteria 1892
152 Ga0070669_100141137 3300005353 Bacteria 1857
153 Ga0070669_100237791 3300005353 Bacteria 1446
154 Ga0070675_100013600 3300005354 Bacteria 6399
155 Ga0070675_100025711 3300005354 Bacteria 4720
156 Ga0070675_100055173 3300005354 Bacteria 3270
157 Ga0070675_100055271 3300005354 Unclassified 3268
158 Ga0070675_100080740 3300005354 Bacteria 2711
159 Ga0070675_100322491 3300005354 Bacteria 1365
160 Ga0070671_100004357 3300005355 Bacteria 11192
161 Ga0070671_100049587 3300005355 Bacteria 3493
162 Ga0070671_100074043 3300005355 Bacteria 2845
163 Ga0070671_100182326 3300005355 Bacteria 1778
164 Ga0070671_100198762 3300005355 Bacteria 1700
165 Ga0070671_100208844 3300005355 Bacteria 1656
166 Ga0070674_100084152 3300005356 Bacteria 2280
167 Ga0070673_100001990 3300005364 Bacteria 12324
168 Ga0070673_100017265 3300005364 Bacteria 5126
169 Ga0070673_100121048 3300005364 Bacteria 2183
170 Ga0070688_100008021 3300005365 Bacteria 5714
171 Ga0070688_100177611 3300005365 Unclassified 1474
172 Ga0070659_100000854 3300005366 Bacteria 22245
173 Ga0070659_100007938 3300005366 Bacteria 7732
174 Ga0070659_100011576 3300005366 Bacteria 6529
175 Ga0070659_100024762 3300005366 Bacteria 4603
176 Ga0070659_100035580 3300005366 Bacteria 3878
177 Ga0070659_100244042 3300005366 Bacteria 1487
178 Ga0070667_100000492 3300005367 Bacteria 40164
179 Ga0070667_100047694 3300005367 Bacteria 3604
180 Ga0070667_100054456 3300005367 Bacteria 3378
181 Ga0070667_100103565 3300005367 Bacteria 2460
182 Ga0070667_100294027 3300005367 Bacteria 1461
183 Ga0070701_10025529 3300005438 Bacteria 2870
184 Ga0070701_10045950 3300005438 Bacteria 2242
185 Ga0070700_100077166 3300005441 Bacteria 2141
186 Ga0070663_100068570 3300005455 Bacteria 2575
187 Ga0070678_100010791 3300005456 Bacteria 5599
188 Ga0070678_100013945 3300005456 Bacteria 5054
189 Ga0070678_100072331 3300005456 Bacteria 2584
190 Ga0070678_100241240 3300005456 Bacteria 1511
191 Ga0070662_100000011 3300005457 Bacteria 133652
192 Ga0070662_100004086 3300005457 Bacteria 9167
193 Ga0070662_100036135 3300005457 Bacteria 3493
194 Ga0070662_100056097 3300005457 Bacteria 2860
195 Ga0070662_100131800 3300005457 Bacteria 1928
196 Ga0070662_100243812 3300005457 Bacteria 1442
197 Ga0070662_100309850 3300005457 Bacteria 1285
198 Ga0070681_10021777 3300005458 Bacteria 6428
199 Ga0070681_10040812 3300005458 Bacteria 4649
200 Ga0070681_10141139 3300005458 Unclassified 2339
201 Ga0070681_10242445 3300005458 Unclassified 1716
202 Ga0070681_10293673 3300005458 Unclassified 1535
203 Ga0068867_100000841 3300005459 Bacteria 20653
204 Ga0068867_100132144 3300005459 Bacteria 1941
205 Ga0070685_10016536 3300005466 Bacteria 3932
206 Ga0070698_100074506 3300005471 Bacteria 3400
207 Ga0070679_100000575 3300005530 Bacteria 31162
208 Ga0070679_100004536 3300005530 Bacteria 12825
209 Ga0070679_100029492 3300005530 Bacteria 5413
210 Ga0070679_100042885 3300005530 Bacteria 4506
211 Ga0070679_100043938 3300005530 Bacteria 4450
212 Ga0070679_100045741 3300005530 Bacteria 4361
213 Ga0070679_100062675 3300005530 Bacteria 3707
214 Ga0070679_100170887 3300005530 Bacteria 2147
215 Ga0070684_100000228 3300005535 Bacteria 38984
216 Ga0070684_100021275 3300005535 Bacteria 5394
217 Ga0070684_100056123 3300005535 Bacteria 3436
218 Ga0070684_100117942 3300005535 Bacteria 2385
219 Ga0068853_100000221 3300005539 Bacteria 40294
220 Ga0068853_100020583 3300005539 Bacteria 5487
221 Ga0068853_100052784 3300005539 Bacteria 3501
222 Ga0068853_100055688 3300005539 Bacteria 3409
223 Ga0068853_100057721 3300005539 Bacteria 3350
224 Ga0068853_100091008 3300005539 Bacteria 2682
225 Ga0068853_100107829 3300005539 Bacteria 2470
226 Ga0068853_100159796 3300005539 Bacteria 2033
227 Ga0068853_100310572 3300005539 Bacteria 1459
228 Ga0070672_100039481 3300005543 Bacteria 3616
229 Ga0070672_100193930 3300005543 Bacteria 1697
230 Ga0070672_100213679 3300005543 Bacteria 1616
231 Ga0070686_100054827 3300005544 Bacteria 2551
232 Ga0070686_100126038 3300005544 Unclassified 1764
233 Ga0070686_100257432 3300005544 Bacteria 1278
234 Ga0070693_100045539 3300005547 Bacteria 2487
235 Ga0070693_100232174 3300005547 Bacteria 1214
236 Ga0070665_100000001 3300005548 Bacteria 1083363
237 Ga0070665_100000003 3300005548 Bacteria 811857
238 Ga0070665_100005742 3300005548 Bacteria 12739
239 Ga0070665_100060884 3300005548 Bacteria 3784
240 Ga0068855_100007886 3300005563 Bacteria 12858
241 Ga0068855_100019632 3300005563 Bacteria 8119
242 Ga0068855_100022883 3300005563 Bacteria 7490
243 Ga0068855_100029930 3300005563 Bacteria 6511
244 Ga0068855_100030208 3300005563 Bacteria 6482
245 Ga0068855_100042513 3300005563 Bacteria 5384
246 Ga0068855_100064567 3300005563 Bacteria 4270
247 Ga0068855_100075213 3300005563 Bacteria 3922
248 Ga0068855_100089498 3300005563 Bacteria 3554
249 Ga0068855_100139292 3300005563 Bacteria 2767
250 Ga0068855_100204082 3300005563 Bacteria 2224
251 Ga0070664_100003241 3300005564 Bacteria 13152
252 Ga0070664_100070355 3300005564 Bacteria 2996
253 Ga0070664_100072381 3300005564 Bacteria 2956
254 Ga0070664_100297839 3300005564 Bacteria 1457
255 Ga0068857_100001119 3300005577 Bacteria 20854
256 Ga0068857_100007157 3300005577 Bacteria 9611
257 Ga0068857_100018337 3300005577 Bacteria 6141
258 Ga0068857_100021607 3300005577 Bacteria 5663
259 Ga0068857_100024160 3300005577 Bacteria 5350
260 Ga0068857_100033737 3300005577 Bacteria 4527
261 Ga0068857_100272891 3300005577 Bacteria 1554
262 Ga0068854_100074699 3300005578 Bacteria 2487
263 Ga0068854_100163987 3300005578 Bacteria 1724
264 Ga0068854_100176276 3300005578 Unclassified 1667
265 Ga0068854_100232744 3300005578 Bacteria 1463
266 Ga0068856_100001307 3300005614 Bacteria 26219
267 Ga0068856_100002043 3300005614 Bacteria 20938
268 Ga0068856_100007064 3300005614 Bacteria 10963
269 Ga0068856_100095550 3300005614 Bacteria 2960
270 Ga0068856_100203889 3300005614 Bacteria 1992
271 Ga0068856_100235515 3300005614 Bacteria 1846
272 Ga0068856_100402951 3300005614 Unclassified 1388
273 Ga0068852_100002006 3300005616 Bacteria 13883
274 Ga0068852_100002446 3300005616 Bacteria 12784
275 Ga0068852_100018674 3300005616 Bacteria 5466
276 Ga0068852_100023547 3300005616 Bacteria 4958
277 Ga0068852_100033393 3300005616 Bacteria 4271
278 Ga0068852_100041003 3300005616 Bacteria 3910
279 Ga0068852_100061600 3300005616 Bacteria 3261
280 Ga0068852_100069230 3300005616 Bacteria 3092
281 Ga0068852_100123507 3300005616 Bacteria 2374
282 Ga0068852_100149038 3300005616 Bacteria 2174
283 Ga0068852_100175121 3300005616 Bacteria 2014
284 Ga0068852_100250677 3300005616 Unclassified 1696
285 Ga0068852_100327119 3300005616 Bacteria 1490
286 Ga0068852_100559387 3300005616 Bacteria 1145
287 Ga0068859_100000023 3300005617 Bacteria 221914
288 Ga0068859_100008109 3300005617 Bacteria 10653
289 Ga0068859_100009853 3300005617 Bacteria 9646
290 Ga0068859_100033356 3300005617 Bacteria 5169
291 Ga0068859_100067422 3300005617 Bacteria 3613
292 Ga0068859_100085184 3300005617 Bacteria 3206
293 Ga0068859_100171254 3300005617 Bacteria 2252
294 Ga0068859_100243384 3300005617 Bacteria 1888
295 Ga0068859_100324535 3300005617 Bacteria 1633
296 Ga0068859_100605749 3300005617 Bacteria 1188
297 Ga0068864_100005800 3300005618 Bacteria 10131
298 Ga0068864_100007839 3300005618 Bacteria 8801
299 Ga0068864_100026175 3300005618 Bacteria 4918
300 Ga0068864_100081365 3300005618 Bacteria 2839
301 Ga0068864_100273851 3300005618 Bacteria 1574
302 Ga0068864_100381557 3300005618 Bacteria 1336
303 Ga0068861_100009306 3300005719 Bacteria 6779
304 Ga0068861_100017858 3300005719 Bacteria 5041
305 Ga0068861_100202055 3300005719 Bacteria 1669
306 Ga0068861_100361265 3300005719 Bacteria 1277
307 Ga0068861_100364196 3300005719 Bacteria 1272
308 Ga0068870_10194693 3300005840 Bacteria 1225
309 Ga0068863_100001812 3300005841 Bacteria 21216
310 Ga0068863_100038562 3300005841 Bacteria 4545
311 Ga0068863_100093702 3300005841 Bacteria 2850
312 Ga0068863_100129455 3300005841 Bacteria 2409
313 Ga0068863_100194530 3300005841 Bacteria 1949
314 Ga0068858_100008485 3300005842 Bacteria 9874
315 Ga0068858_100048079 3300005842 Bacteria 3954
316 Ga0068858_100252575 3300005842 Bacteria 1675
317 Ga0068858_100310467 3300005842 Bacteria 1506
318 Ga0068860_100000046 3300005843 Bacteria 214800
319 Ga0068860_100000916 3300005843 Bacteria 32698
320 Ga0068860_100005408 3300005843 Bacteria 12959
321 Ga0068860_100007358 3300005843 Bacteria 11008
322 Ga0068860_100024991 3300005843 Bacteria 5767
323 Ga0068860_100034035 3300005843 Bacteria 4887
324 Ga0068862_100003779 3300005844 Bacteria 12914
325 Ga0068862_100022881 3300005844 Bacteria 5231
326 Ga0068862_100085090 3300005844 Bacteria 2748
327 Ga0068862_100188580 3300005844 Bacteria 1854
328 Ga0068862_100265707 3300005844 Bacteria 1567
329 Ga0081540_1029157 3300005983 Bacteria 3081
330 Ga0070716_100051038 3300006173 Unclassified 2350
331 Ga0075366_10000333 3300006195 Bacteria 21671
332 Ga0075366_10040925 3300006195 Bacteria 2742
333 Ga0075366_10085039 3300006195 Bacteria 1892
334 Ga0075366_10095111 3300006195 Bacteria 1786
335 Ga0097621_100000150 3300006237 Bacteria 42846
336 Ga0097621_100000847 3300006237 Bacteria 21541
337 Ga0097621_100001572 3300006237 Bacteria 15606
338 Ga0097621_100028478 3300006237 Bacteria 4402
339 Ga0097621_100062269 3300006237 Bacteria 3063
340 Ga0097621_100120542 3300006237 Bacteria 2224
341 Ga0097621_100123615 3300006237 Bacteria 2197
342 Ga0075370_10091284 3300006353 Bacteria 1757
343 Ga0068871_100000027 3300006358 Bacteria 78588
344 Ga0068871_100000354 3300006358 Bacteria 31915
345 Ga0068871_100001006 3300006358 Bacteria 18890
346 Ga0068871_100001864 3300006358 Bacteria 14258
347 Ga0068871_100040970 3300006358 Unclassified 3712
348 Ga0068871_100120184 3300006358 Bacteria 2218
349 Ga0068871_100125590 3300006358 Bacteria 2171
350 Ga0068871_100223279 3300006358 Unclassified 1633
351 Ga0068871_100287080 3300006358 Bacteria 1441
352 Ga0068871_100316893 3300006358 Bacteria 1372
353 Ga0075428_100024587 3300006844 Bacteria 6666
354 Ga0075428_100074722 3300006844 Bacteria 3702
355 Ga0075430_100010054 3300006846 Bacteria 8005
356 Ga0075431_100004434 3300006847 Bacteria 13760
357 Ga0075429_100005840 3300006880 Bacteria 10619
358 Ga0075429_100022996 3300006880 Bacteria 5403
359 Ga0068865_100000547 3300006881 Bacteria 20866
360 Ga0068865_100020901 3300006881 Bacteria 4251
361 Ga0068865_100225179 3300006881 Bacteria 1468
362 Ga0097620_100000023 3300006931 Bacteria 221914
363 Ga0097620_100008109 3300006931 Bacteria 10653
364 Ga0097620_100009853 3300006931 Bacteria 9646
365 Ga0097620_100033356 3300006931 Bacteria 5169
366 Ga0097620_100067425 3300006931 Bacteria 3613
367 Ga0097620_100085179 3300006931 Bacteria 3206
368 Ga0097620_100171243 3300006931 Bacteria 2252
369 Ga0097620_100243357 3300006931 Bacteria 1888
370 Ga0097620_100324543 3300006931 Bacteria 1633
371 Ga0097620_100605775 3300006931 Bacteria 1188
372 Ga0079104_1000178 3300006946 Bacteria 90393
373 Ga0105244_10000002 3300009036 Bacteria 495554
374 Ga0105240_10000074 3300009093 Bacteria 199611
375 Ga0105240_10000598 3300009093 Bacteria 67006
376 Ga0105240_10000626 3300009093 Bacteria 65179
377 Ga0105240_10001595 3300009093 Bacteria 38516
378 Ga0105240_10007062 3300009093 Bacteria 16373
379 Ga0105240_10015708 3300009093 Bacteria 10273
380 Ga0105240_10033651 3300009093 Bacteria 6617
381 Ga0105240_10046672 3300009093 Bacteria 5488
382 Ga0105240_10078410 3300009093 Bacteria 4068
383 Ga0105240_10266249 3300009093 Bacteria 1975
384 Ga0105240_10450625 3300009093 Bacteria 1440
385 Ga0105240_10552688 3300009093 Bacteria 1274
386 Ga0111539_10001328 3300009094 Bacteria 32966
387 Ga0111539_10015483 3300009094 Bacteria 9481
388 Ga0111539_10024925 3300009094 Bacteria 7332
389 Ga0105245_10092150 3300009098 Bacteria 2790
390 Ga0105247_10003751 3300009101 Bacteria 9849
391 Ga0105247_10005412 3300009101 Bacteria 8044
392 Ga0105247_10037118 3300009101 Bacteria 2972
393 Ga0114129_10020916 3300009147 Bacteria 9296
394 Ga0114129_10187025 3300009147 Bacteria 2814
395 Ga0114129_10195324 3300009147 Bacteria 2744
396 Ga0105243_10000018 3300009148 Bacteria 227618
397 Ga0105243_10001177 3300009148 Bacteria 23661
398 Ga0105241_10000659 3300009174 Bacteria 25872
399 Ga0105241_10000881 3300009174 Bacteria 22671
400 Ga0105241_10006159 3300009174 Bacteria 8846
401 Ga0105241_10014580 3300009174 Bacteria 5756
402 Ga0105241_10031709 3300009174 Bacteria 3958
403 Ga0105241_10034893 3300009174 Bacteria 3782
404 Ga0105241_10041058 3300009174 Bacteria 3494
405 Ga0105241_10160453 3300009174 Bacteria 1848
406 Ga0105241_10303576 3300009174 Bacteria 1371
407 Ga0105242_10006091 3300009176 Bacteria 9297
408 Ga0105242_10012454 3300009176 Bacteria 6549
409 Ga0105242_10040286 3300009176 Bacteria 3764
410 Ga0105242_10312645 3300009176 Bacteria 1438
411 Ga0105242_10468062 3300009176 Bacteria 1192
412 Ga0105248_10059502 3300009177 Bacteria 4291
413 Ga0105237_10000755 3300009545 Bacteria 44312
414 Ga0105237_10001361 3300009545 Bacteria 32387
415 Ga0105237_10002829 3300009545 Bacteria 21108
416 Ga0105237_10004143 3300009545 Bacteria 16893
417 Ga0105237_10007407 3300009545 Bacteria 12017
418 Ga0105237_10009395 3300009545 Bacteria 10472
419 Ga0105237_10020135 3300009545 Bacteria 6886
420 Ga0105237_10021690 3300009545 Bacteria 6601
421 Ga0105237_10025001 3300009545 Bacteria 6110
422 Ga0105237_10093900 3300009545 Bacteria 2989
423 Ga0105237_10094887 3300009545 Unclassified 2972
424 Ga0105237_10105937 3300009545 Bacteria 2803
425 Ga0105237_10113562 3300009545 Bacteria 2701
426 Ga0105237_10145894 3300009545 Bacteria 2361
427 Ga0105237_10204008 3300009545 Bacteria 1977
428 Ga0105238_10001132 3300009551 Bacteria 26885
429 Ga0105238_10011571 3300009551 Bacteria 8890
430 Ga0105238_10035958 3300009551 Bacteria 5035
431 Ga0105238_10165317 3300009551 Bacteria 2188
432 Ga0105249_10008464 3300009553 Bacteria 8963
433 Ga0105249_10012834 3300009553 Bacteria 7392
434 Ga0105249_10057441 3300009553 Bacteria 3565
435 Ga0105249_10059671 3300009553 Bacteria 3499
436 Ga0105249_10266201 3300009553 Bacteria 1705
437 Ga0105239_10000002 3300010375 Bacteria 610298
438 Ga0105239_10000012 3300010375 Bacteria 332279
439 Ga0105239_10000048 3300010375 Bacteria 177855
440 Ga0105239_10000055 3300010375 Bacteria 158211
441 Ga0105239_10000204 3300010375 Bacteria 87242
442 Ga0105239_10000785 3300010375 Bacteria 45044
443 Ga0105239_10002090 3300010375 Bacteria 25893
444 Ga0105239_10019429 3300010375 Bacteria 7501
445 Ga0105239_10048437 3300010375 Bacteria 4660
446 Ga0105239_10069310 3300010375 Bacteria 3875
447 Ga0105239_10075461 3300010375 Bacteria 3707
448 Ga0105239_10104224 3300010375 Bacteria 3141
449 Ga0105239_10155609 3300010375 Bacteria 2552
450 Ga0105239_10181833 3300010375 Bacteria 2352
451 Ga0105239_10300916 3300010375 Bacteria 1806
452 Ga0105246_10023007 3300011119 Bacteria 4028
453 Ga0105246_10066024 3300011119 Bacteria 2532
454 Ga0105246_10076160 3300011119 Bacteria 2377
455 Ga0105246_10208673 3300011119 Bacteria 1523
456 Ga0157373_10000001 3300013100 Bacteria 864756
457 Ga0157373_10000029 3300013100 Bacteria 131988
458 Ga0157373_10000094 3300013100 Bacteria 73332
459 Ga0157373_10007113 3300013100 Bacteria 8342
460 Ga0157373_10016080 3300013100 Bacteria 5462
461 Ga0157373_10016186 3300013100 Bacteria 5442
462 Ga0157373_10028385 3300013100 Bacteria 4036
463 Ga0157373_10028554 3300013100 Bacteria 4024
464 Ga0157373_10030973 3300013100 Bacteria 3849
465 Ga0157373_10039128 3300013100 Bacteria 3396
466 Ga0157373_10291476 3300013100 Bacteria 1157
467 Ga0157371_10000119 3300013102 Bacteria 120350
468 Ga0157371_10000216 3300013102 Bacteria 83975
469 Ga0157371_10000523 3300013102 Bacteria 45888
470 Ga0157371_10001598 3300013102 Bacteria 23238
471 Ga0157371_10001727 3300013102 Bacteria 22180
472 Ga0157371_10003284 3300013102 Bacteria 14807
473 Ga0157371_10003654 3300013102 Bacteria 13849
474 Ga0157371_10003809 3300013102 Bacteria 13493
475 Ga0157371_10008389 3300013102 Bacteria 8237
476 Ga0157371_10021342 3300013102 Bacteria 4755
477 Ga0157371_10032895 3300013102 Bacteria 3729
478 Ga0157371_10034773 3300013102 Bacteria 3613
479 Ga0157371_10050101 3300013102 Bacteria 2967
480 Ga0157371_10053609 3300013102 Bacteria 2864
481 Ga0157371_10061232 3300013102 Bacteria 2669
482 Ga0157371_10064775 3300013102 Unclassified 2589
483 Ga0157371_10101283 3300013102 Bacteria 2043
484 Ga0157371_10116938 3300013102 Bacteria 1895
485 Ga0157371_10220581 3300013102 Bacteria 1362
486 Ga0157370_10000261 3300013104 Bacteria 66927
487 Ga0157370_10000436 3300013104 Bacteria 52041
488 Ga0157370_10000839 3300013104 Bacteria 39014
489 Ga0157370_10002210 3300013104 Bacteria 23756
490 Ga0157370_10002385 3300013104 Bacteria 22662
491 Ga0157370_10002663 3300013104 Bacteria 21427
492 Ga0157370_10002692 3300013104 Bacteria 21301
493 Ga0157370_10003916 3300013104 Bacteria 17340
494 Ga0157370_10006823 3300013104 Bacteria 12514
495 Ga0157370_10024136 3300013104 Bacteria 6027
496 Ga0157370_10044524 3300013104 Bacteria 4264
497 Ga0157370_10044573 3300013104 Bacteria 4261
498 Ga0157370_10044996 3300013104 Bacteria 4238
499 Ga0157370_10066079 3300013104 Bacteria 3421
500 Ga0157370_10083264 3300013104 Bacteria 3008
501 Ga0157370_10168122 3300013104 Bacteria 2039
502 Ga0157370_10196428 3300013104 Bacteria 1872
503 Ga0157370_10275610 3300013104 Bacteria 1554
504 Ga0157370_10292841 3300013104 Bacteria 1503
505 Ga0157370_10306932 3300013104 Bacteria 1464
506 Ga0157370_10318568 3300013104 Bacteria 1435
507 Ga0157370_10337807 3300013104 Bacteria 1388
508 Ga0157369_10000004 3300013105 Bacteria 479764
509 Ga0157369_10002019 3300013105 Bacteria 24475
510 Ga0157369_10002652 3300013105 Bacteria 21364
511 Ga0157369_10004820 3300013105 Bacteria 15839
512 Ga0157369_10026016 3300013105 Bacteria 6493
513 Ga0157369_10047784 3300013105 Bacteria 4645
514 Ga0157369_10063536 3300013105 Bacteria 3977
515 Ga0157369_10100053 3300013105 Bacteria 3090
516 Ga0157369_10104624 3300013105 Bacteria 3014
517 Ga0157369_10220360 3300013105 Bacteria 1986
518 Ga0157369_10314250 3300013105 Bacteria 1629
519 Ga0157374_10000001 3300013296 Bacteria 1077351
520 Ga0157374_10000647 3300013296 Bacteria 30685
521 Ga0157374_10002171 3300013296 Bacteria 16542
522 Ga0157374_10003665 3300013296 Bacteria 12913
523 Ga0157374_10008464 3300013296 Bacteria 8797
524 Ga0157374_10025420 3300013296 Bacteria 5318
525 Ga0157374_10031171 3300013296 Bacteria 4844
526 Ga0157374_10050525 3300013296 Bacteria 3865
527 Ga0157374_10056944 3300013296 Bacteria 3650
528 Ga0157374_10101752 3300013296 Bacteria 2755
529 Ga0157374_10189714 3300013296 Bacteria 2010
530 Ga0157374_10217994 3300013296 Unclassified 1872
531 Ga0157374_10289281 3300013296 Bacteria 1619
532 Ga0157374_10471222 3300013296 Unclassified 1258
533 Ga0157378_10011078 3300013297 Bacteria 7892
534 Ga0157378_10011450 3300013297 Bacteria 7762
535 Ga0157378_10016222 3300013297 Bacteria 6524
536 Ga0157378_10021827 3300013297 Bacteria 5630
537 Ga0157378_10023453 3300013297 Bacteria 5431
538 Ga0157378_10024439 3300013297 Bacteria 5317
539 Ga0157378_10026056 3300013297 Bacteria 5154
540 Ga0157378_10034378 3300013297 Bacteria 4483
541 Ga0157378_10106642 3300013297 Bacteria 2563
542 Ga0157378_10191429 3300013297 Bacteria 1929
543 Ga0157378_10205182 3300013297 Bacteria 1866
544 Ga0157378_10249257 3300013297 Bacteria 1699
545 Ga0157378_10349223 3300013297 Bacteria 1444
546 Ga0163162_10000024 3300013306 Bacteria 188515
547 Ga0163162_10000205 3300013306 Bacteria 54827
548 Ga0163162_10000331 3300013306 Bacteria 43319
549 Ga0163162_10000967 3300013306 Bacteria 26666
550 Ga0163162_10001657 3300013306 Bacteria 20874
551 Ga0163162_10002520 3300013306 Bacteria 17318
552 Ga0163162_10005326 3300013306 Bacteria 12412
553 Ga0163162_10005839 3300013306 Bacteria 11903
554 Ga0163162_10011763 3300013306 Bacteria 8536
555 Ga0163162_10023196 3300013306 Bacteria 6122
556 Ga0163162_10025607 3300013306 Bacteria 5831
557 Ga0163162_10027741 3300013306 Bacteria 5600
558 Ga0163162_10037946 3300013306 Bacteria 4809
559 Ga0163162_10044468 3300013306 Bacteria 4448
560 Ga0163162_10082702 3300013306 Bacteria 3283
561 Ga0163162_10104877 3300013306 Bacteria 2921
562 Ga0163162_10220637 3300013306 Bacteria 2026
563 Ga0163162_10386237 3300013306 Bacteria 1533
564 Ga0163162_10628741 3300013306 Bacteria 1198
565 Ga0157372_10000011 3300013307 Bacteria 277202
566 Ga0157372_10000196 3300013307 Bacteria 66430
567 Ga0157372_10000921 3300013307 Bacteria 32008
568 Ga0157372_10001904 3300013307 Bacteria 22644
569 Ga0157372_10005934 3300013307 Bacteria 12984
570 Ga0157372_10007158 3300013307 Bacteria 11876
571 Ga0157372_10015967 3300013307 Bacteria 8054
572 Ga0157372_10050754 3300013307 Bacteria 4614
573 Ga0157372_10061677 3300013307 Bacteria 4199
574 Ga0157372_10063919 3300013307 Bacteria 4129
575 Ga0157372_10069226 3300013307 Bacteria 3969
576 Ga0157372_10072860 3300013307 Bacteria 3871
577 Ga0157372_10085260 3300013307 Bacteria 3582
578 Ga0157372_10085973 3300013307 Bacteria 3568
579 Ga0157372_10108951 3300013307 Bacteria 3171
580 Ga0157372_10113649 3300013307 Bacteria 3103
581 Ga0157372_10113694 3300013307 Bacteria 3103
582 Ga0157372_10176871 3300013307 Bacteria 2470
583 Ga0157372_10214259 3300013307 Bacteria 2232
584 Ga0157372_10337954 3300013307 Bacteria 1754
585 Ga0157372_10549923 3300013307 Bacteria 1346
586 Ga0157372_10617486 3300013307 Bacteria 1263
587 Ga0157372_10635185 3300013307 Bacteria 1244
588 Ga0157375_10000229 3300013308 Bacteria 52257
589 Ga0157375_10000257 3300013308 Bacteria 48156
590 Ga0157375_10003117 3300013308 Bacteria 14392
591 Ga0157375_10026758 3300013308 Bacteria 5382
592 Ga0157375_10043753 3300013308 Bacteria 4345
593 Ga0157375_10049275 3300013308 Bacteria 4126
594 Ga0157375_10108563 3300013308 Bacteria 2870
595 Ga0157375_10195972 3300013308 Bacteria 2175
596 Ga0157375_10206911 3300013308 Bacteria 2119
597 Ga0157375_10217627 3300013308 Bacteria 2068
598 Ga0163163_10000653 3300014325 Bacteria 29691
599 Ga0163163_10005525 3300014325 Bacteria 10945
600 Ga0163163_10102281 3300014325 Bacteria 2889
601 Ga0163163_10197303 3300014325 Bacteria 2061
602 Ga0163163_10240688 3300014325 Bacteria 1859
603 Ga0163163_10260289 3300014325 Bacteria 1786
604 Ga0157380_10004261 3300014326 Bacteria 9900
605 Ga0157380_10033396 3300014326 Bacteria 3961
606 Ga0157380_10151009 3300014326 Bacteria 2008
607 Ga0157380_10249108 3300014326 Bacteria 1607
608 Ga0157380_10396639 3300014326 Bacteria 1308
609 Ga0182008_10000008 3300014497 Bacteria 371823
610 Ga0182008_10000026 3300014497 Bacteria 182845
611 Ga0182008_10000080 3300014497 Bacteria 76626
612 Ga0182008_10000687 3300014497 Bacteria 24388
613 Ga0182008_10011464 3300014497 Bacteria 4714
614 Ga0182008_10030579 3300014497 Bacteria 2714
615 Ga0182008_10091087 3300014497 Bacteria 1503
616 Ga0157377_10000932 3300014745 Bacteria 12243
617 Ga0157377_10018348 3300014745 Bacteria 3635
618 Ga0157377_10031423 3300014745 Unclassified 2885
619 Ga0157377_10129759 3300014745 Bacteria 1538
620 Ga0157377_10150301 3300014745 Bacteria 1439
621 Ga0157379_10001640 3300014968 Bacteria 18479
622 Ga0157379_10002723 3300014968 Bacteria 14918
623 Ga0157379_10025305 3300014968 Bacteria 5273
624 Ga0157379_10175810 3300014968 Bacteria 1933
625 Ga0157379_10236611 3300014968 Bacteria 1656
626 Ga0157379_10246240 3300014968 Bacteria 1622
627 Ga0157376_10000721 3300014969 Bacteria 21396
628 Ga0157376_10002682 3300014969 Bacteria 12095
629 Ga0157376_10004414 3300014969 Bacteria 9794
630 Ga0157376_10005888 3300014969 Bacteria 8604
631 Ga0157376_10011043 3300014969 Bacteria 6640
632 Ga0157376_10017174 3300014969 Bacteria 5512
633 Ga0157376_10037066 3300014969 Bacteria 3954
634 Ga0157376_10074336 3300014969 Bacteria 2897
635 Ga0182006_1000039 3300015261 Bacteria 211568
636 Ga0182006_1001557 3300015261 Bacteria 13693
637 Ga0182006_1003104 3300015261 Bacteria 8708
638 Ga0182006_1003392 3300015261 Bacteria 8160
639 Ga0182006_1010187 3300015261 Bacteria 4189
640 Ga0182007_10000027 3300015262 Bacteria 167235
641 Ga0182007_10004301 3300015262 Bacteria 6483
642 Ga0182005_1000263 3300015265 Bacteria 33328
643 Ga0183373_1003 3300015682 Bacteria 558813
644 Ga0163161_10006392 3300017792 Bacteria 8158
645 Ga0163161_10007503 3300017792 Bacteria 7537
646 Ga0163161_10011036 3300017792 Bacteria 6259
647 Ga0163161_10067433 3300017792 Bacteria 2613
648 Ga0163161_10187089 3300017792 Bacteria 1590
649 Ga0163161_10397008 3300017792 Bacteria 1105
650 Ga0206351_10902020 3300020077 Bacteria 1239
651 Ga0213876_10001528 3300021384 Bacteria 14327
652 Ga0213876_10022962 3300021384 Bacteria 3295
653 Ga0209436_100493 3300025208 Bacteria 17414
654 Ga0207427_100103 3300025231 Bacteria 119618
655 Ga0209437_100024 3300025233 Bacteria 592878
656 Ga0209437_100101 3300025233 Bacteria 226668
657 Ga0209258_100151 3300025242 Bacteria 160444
658 Ga0207425_1000002 3300025245 Bacteria 1362590
659 Ga0209646_1000002 3300025246 Bacteria 1425781
660 Ga0209646_1000823 3300025246 Bacteria 10466
661 Ga0209026_1000434 3300025250 Bacteria 34861
662 Ga0209148_1000154 3300025254 Bacteria 145214
663 Ga0209148_1012278 3300025254 Bacteria 1570
664 Ga0209129_1000002 3300025258 Bacteria 1359086
665 Ga0209233_1000124 3300025261 Bacteria 226743
666 Ga0209233_1000396 3300025261 Bacteria 36455
667 Ga0209233_1011704 3300025261 Bacteria 2577
668 Ga0209455_1006267 3300025272 Bacteria 3539
669 Ga0209673_1000208 3300025273 Bacteria 117755
670 Ga0209130_1003361 3300025284 Bacteria 6880
671 Ga0209675_1000042 3300025291 Bacteria 235989
672 Ga0209676_1000008 3300025292 Bacteria 991778
673 Ga0209676_1001383 3300025292 Bacteria 23647
674 Ga0209025_1000004 3300025294 Bacteria 1361782
675 Ga0209564_1013616 3300025295 Bacteria 3435
676 Ga0209758_1000006 3300025297 Bacteria 1359562
677 Ga0209758_1003065 3300025297 Bacteria 15894
678 Ga0209758_1006777 3300025297 Bacteria 8046
679 Ga0209050_1000134 3300025298 Bacteria 184417
680 Ga0209050_1001255 3300025298 Bacteria 29270
681 Ga0209050_1003936 3300025298 Bacteria 10504
682 Ga0209050_1010474 3300025298 Bacteria 4563
683 Ga0207426_1000030 3300025302 Bacteria 461478
684 Ga0207426_1000051 3300025302 Bacteria 391700
685 Ga0207426_1000497 3300025302 Bacteria 58506
686 Ga0207426_1001981 3300025302 Bacteria 14539
687 Ga0207426_1006084 3300025302 Bacteria 5323
688 Ga0207426_1044109 3300025302 Bacteria 1365
689 Ga0209257_1000001 3300025304 Bacteria 2274655
690 Ga0209257_1000005 3300025304 Bacteria 1592528
691 Ga0209257_1001605 3300025304 Bacteria 25882
692 Ga0207656_10041673 3300025321 Bacteria 1952
693 Ga0207655_1000012 3300025728 Bacteria 640488
694 Ga0207655_1000228 3300025728 Bacteria 93810
695 Ga0207713_1079261 3300025735 Bacteria 1186
696 Ga0207682_10009425 3300025893 Bacteria 3852
697 Ga0207642_10117946 3300025899 Bacteria 1364
698 Ga0207710_10002748 3300025900 Bacteria 8047
699 Ga0207710_10043035 3300025900 Bacteria 2007
700 Ga0207688_10043481 3300025901 Bacteria 2502
701 Ga0207680_10000162 3300025903 Bacteria 32782
702 Ga0207680_10011575 3300025903 Bacteria 4461
703 Ga0207647_10000051 3300025904 Bacteria 87826
704 Ga0207647_10000149 3300025904 Bacteria 55611
705 Ga0207647_10000288 3300025904 Bacteria 41316
706 Ga0207647_10018104 3300025904 Bacteria 4774
707 Ga0207685_10055929 3300025905 Bacteria 1542
708 Ga0207645_10000156 3300025907 Bacteria 53492
709 Ga0207645_10000782 3300025907 Bacteria 26555
710 Ga0207645_10009564 3300025907 Bacteria 6697
711 Ga0207645_10032778 3300025907 Bacteria 3340
712 Ga0207645_10109477 3300025907 Bacteria 1787
713 Ga0207643_10003598 3300025908 Bacteria 8348
714 Ga0207643_10084438 3300025908 Bacteria 1843
715 Ga0207643_10188488 3300025908 Bacteria 1251
716 Ga0207705_10000132 3300025909 Bacteria 81270
717 Ga0207705_10017561 3300025909 Bacteria 5122
718 Ga0207705_10050880 3300025909 Bacteria 2983
719 Ga0207705_10073058 3300025909 Bacteria 2488
720 Ga0207705_10116961 3300025909 Bacteria 1974
721 Ga0207705_10177553 3300025909 Bacteria 1606
722 Ga0207705_10198785 3300025909 Bacteria 1519
723 Ga0207705_10257460 3300025909 Bacteria 1332
724 Ga0207654_10106324 3300025911 Bacteria 1738
725 Ga0207654_10144631 3300025911 Unclassified 1520
726 Ga0207707_10000051 3300025912 Bacteria 117204
727 Ga0207707_10028865 3300025912 Bacteria 4848
728 Ga0207707_10096572 3300025912 Bacteria 2582
729 Ga0207695_10000013 3300025913 Bacteria 821265
730 Ga0207695_10000071 3300025913 Bacteria 315568
731 Ga0207695_10000084 3300025913 Bacteria 282392
732 Ga0207695_10000323 3300025913 Bacteria 114265
733 Ga0207695_10004602 3300025913 Bacteria 18731
734 Ga0207695_10007525 3300025913 Bacteria 13810
735 Ga0207695_10012845 3300025913 Bacteria 10025
736 Ga0207695_10020015 3300025913 Bacteria 7681
737 Ga0207695_10030834 3300025913 Bacteria 5899
738 Ga0207695_10261931 3300025913 Bacteria 1626
739 Ga0207695_10340708 3300025913 Bacteria 1387
740 Ga0207695_10473374 3300025913 Bacteria 1135
741 Ga0207671_10001044 3300025914 Bacteria 33679
742 Ga0207671_10002500 3300025914 Bacteria 19619
743 Ga0207671_10002907 3300025914 Bacteria 17690
744 Ga0207671_10003166 3300025914 Bacteria 16626
745 Ga0207671_10003799 3300025914 Bacteria 14813
746 Ga0207671_10003904 3300025914 Bacteria 14529
747 Ga0207671_10003924 3300025914 Bacteria 14496
748 Ga0207671_10008063 3300025914 Bacteria 8998
749 Ga0207671_10018671 3300025914 Bacteria 5314
750 Ga0207671_10023419 3300025914 Bacteria 4657
751 Ga0207671_10047813 3300025914 Bacteria 3166
752 Ga0207671_10053071 3300025914 Bacteria 3004
753 Ga0207671_10054603 3300025914 Bacteria 2959
754 Ga0207660_10005186 3300025917 Bacteria 8471
755 Ga0207660_10013171 3300025917 Bacteria 5416
756 Ga0207660_10013385 3300025917 Bacteria 5377
757 Ga0207660_10276780 3300025917 Bacteria 1331
758 Ga0207660_10306548 3300025917 Bacteria 1265
759 Ga0207662_10012024 3300025918 Bacteria 4813
760 Ga0207662_10072777 3300025918 Bacteria 2084
761 Ga0207657_10010433 3300025919 Bacteria 9272
762 Ga0207657_10024041 3300025919 Bacteria 5657
763 Ga0207657_10027751 3300025919 Bacteria 5179
764 Ga0207657_10037574 3300025919 Bacteria 4321
765 Ga0207657_10042823 3300025919 Bacteria 3991
766 Ga0207657_10088481 3300025919 Bacteria 2588
767 Ga0207657_10088944 3300025919 Bacteria 2580
768 Ga0207657_10213406 3300025919 Unclassified 1548
769 Ga0207649_10009815 3300025920 Bacteria 5245
770 Ga0207649_10224063 3300025920 Bacteria 1341
771 Ga0207652_10000051 3300025921 Bacteria 120327
772 Ga0207652_10000384 3300025921 Bacteria 46082
773 Ga0207652_10020709 3300025921 Bacteria 5421
774 Ga0207652_10039453 3300025921 Bacteria 4007
775 Ga0207652_10045752 3300025921 Bacteria 3731
776 Ga0207652_10148855 3300025921 Bacteria 2096
777 Ga0207652_10446374 3300025921 Bacteria 1166
778 Ga0207681_10109432 3300025923 Bacteria 2007
779 Ga0207681_10136537 3300025923 Bacteria 1821
780 Ga0207694_10007231 3300025924 Bacteria 8426
781 Ga0207694_10216919 3300025924 Bacteria 1560
782 Ga0207650_10004151 3300025925 Bacteria 9903
783 Ga0207650_10029550 3300025925 Bacteria 3941
784 Ga0207650_10044181 3300025925 Bacteria 3273
785 Ga0207650_10084418 3300025925 Bacteria 2414
786 Ga0207650_10161026 3300025925 Bacteria 1778
787 Ga0207659_10148334 3300025926 Bacteria 1829
788 Ga0207659_10346473 3300025926 Unclassified 1232
789 Ga0207644_10002938 3300025931 Bacteria 10975
790 Ga0207644_10184510 3300025931 Bacteria 1637
791 Ga0207690_10004421 3300025932 Bacteria 8296
792 Ga0207690_10004758 3300025932 Bacteria 8008
793 Ga0207690_10007381 3300025932 Bacteria 6526
794 Ga0207690_10103237 3300025932 Bacteria 2040
795 Ga0207706_10000122 3300025933 Bacteria 83838
796 Ga0207706_10006768 3300025933 Bacteria 10596
797 Ga0207706_10009505 3300025933 Bacteria 8928
798 Ga0207706_10060615 3300025933 Bacteria 3332
799 Ga0207706_10095175 3300025933 Bacteria 2620
800 Ga0207706_10409233 3300025933 Unclassified 1176
801 Ga0207686_10003538 3300025934 Bacteria 8377
802 Ga0207686_10013442 3300025934 Bacteria 4531
803 Ga0207686_10031401 3300025934 Bacteria 3153
804 Ga0207709_10000021 3300025935 Bacteria 386722
805 Ga0207709_10000381 3300025935 Bacteria 44071
806 Ga0207709_10106339 3300025935 Bacteria 1866
807 Ga0207670_10251816 3300025936 Unclassified 1365
808 Ga0207669_10173204 3300025937 Bacteria 1538
809 Ga0207704_10000041 3300025938 Bacteria 89976
810 Ga0207704_10186500 3300025938 Bacteria 1504
811 Ga0207665_10123389 3300025939 Bacteria 1832
812 Ga0207691_10002527 3300025940 Bacteria 17886
813 Ga0207691_10004310 3300025940 Bacteria 13818
814 Ga0207691_10082409 3300025940 Bacteria 2889
815 Ga0207691_10107984 3300025940 Bacteria 2477
816 Ga0207691_10349044 3300025940 Bacteria 1266
817 Ga0207689_10001006 3300025942 Bacteria 27060
818 Ga0207689_10011687 3300025942 Bacteria 7524
819 Ga0207689_10051842 3300025942 Bacteria 3382
820 Ga0207689_10069790 3300025942 Bacteria 2887
821 Ga0207689_10209759 3300025942 Bacteria 1609
822 Ga0207661_10006472 3300025944 Bacteria 8280
823 Ga0207661_10042612 3300025944 Bacteria 3579
824 Ga0207661_10127723 3300025944 Bacteria 2173
825 Ga0207661_10491550 3300025944 Bacteria 1121
826 Ga0207679_10003010 3300025945 Bacteria 10450
827 Ga0207679_10067172 3300025945 Bacteria 2689
828 Ga0207679_10104790 3300025945 Bacteria 2220
829 Ga0207679_10201502 3300025945 Bacteria 1663
830 Ga0207679_10272053 3300025945 Bacteria 1449
831 Ga0207667_10000009 3300025949 Bacteria 603135
832 Ga0207667_10000177 3300025949 Bacteria 92852
833 Ga0207667_10000222 3300025949 Bacteria 79873
834 Ga0207667_10014871 3300025949 Bacteria 8851
835 Ga0207667_10015290 3300025949 Bacteria 8725
836 Ga0207667_10015451 3300025949 Bacteria 8671
837 Ga0207667_10021496 3300025949 Bacteria 7148
838 Ga0207667_10044124 3300025949 Bacteria 4727
839 Ga0207667_10086364 3300025949 Bacteria 3246
840 Ga0207667_10294914 3300025949 Unclassified 1657
841 Ga0207667_10596213 3300025949 Unclassified 1114
842 Ga0207651_10001099 3300025960 Bacteria 12009
843 Ga0207651_10010433 3300025960 Bacteria 5151
844 Ga0207651_10075842 3300025960 Bacteria 2401
845 Ga0207651_10087618 3300025960 Bacteria 2267
846 Ga0207651_10346452 3300025960 Bacteria 1250
847 Ga0207712_10011985 3300025961 Bacteria 5532
848 Ga0207712_10033754 3300025961 Bacteria 3461
849 Ga0207712_10072556 3300025961 Bacteria 2479
850 Ga0207712_10230009 3300025961 Bacteria 1488
851 Ga0207712_10332680 3300025961 Bacteria 1257
852 Ga0207668_10000843 3300025972 Bacteria 18537
853 Ga0207668_10045941 3300025972 Bacteria 2981
854 Ga0207668_10081892 3300025972 Bacteria 2343
855 Ga0207668_10095076 3300025972 Bacteria 2199
856 Ga0207668_10301111 3300025972 Bacteria 1323
857 Ga0207640_10011602 3300025981 Bacteria 4993
858 Ga0207640_10012737 3300025981 Bacteria 4799
859 Ga0207640_10049386 3300025981 Bacteria 2724
860 Ga0207640_10234487 3300025981 Bacteria 1414
861 Ga0207658_10015834 3300025986 Bacteria 5177
862 Ga0207658_10262591 3300025986 Unclassified 1472
863 Ga0207658_10301181 3300025986 Bacteria 1381
864 Ga0207658_10532665 3300025986 Unclassified 1049
865 Ga0207677_10008700 3300026023 Bacteria 5684
866 Ga0207677_10034996 3300026023 Bacteria 3257
867 Ga0207677_10061486 3300026023 Unclassified 2601
868 Ga0207677_10083187 3300026023 Bacteria 2303
869 Ga0207677_10180206 3300026023 Bacteria 1661
870 Ga0207703_10005016 3300026035 Bacteria 10732
871 Ga0207703_10252271 3300026035 Bacteria 1591
872 Ga0207703_10293914 3300026035 Unclassified 1479
873 Ga0207703_10444962 3300026035 Bacteria 1209
874 Ga0207703_10486797 3300026035 Bacteria 1156
875 Ga0207639_10003645 3300026041 Bacteria 10352
876 Ga0207639_10031777 3300026041 Bacteria 3882
877 Ga0207639_10048724 3300026041 Bacteria 3208
878 Ga0207639_10061775 3300026041 Bacteria 2895
879 Ga0207639_10081130 3300026041 Bacteria 2568
880 Ga0207639_10095928 3300026041 Bacteria 2385
881 Ga0207639_10269099 3300026041 Bacteria 1494
882 Ga0207639_10395493 3300026041 Unclassified 1244
883 Ga0207708_10127869 3300026075 Bacteria 1984
884 Ga0207702_10000463 3300026078 Bacteria 45983
885 Ga0207702_10016308 3300026078 Bacteria 6149
886 Ga0207702_10021967 3300026078 Bacteria 5286
887 Ga0207702_10182382 3300026078 Bacteria 1934
888 Ga0207702_10220130 3300026078 Bacteria 1769
889 Ga0207641_10000226 3300026088 Bacteria 72539
890 Ga0207641_10001217 3300026088 Bacteria 25759
891 Ga0207641_10004894 3300026088 Bacteria 11515
892 Ga0207641_10039269 3300026088 Bacteria 3958
893 Ga0207641_10064994 3300026088 Bacteria 3120
894 Ga0207648_10003412 3300026089 Bacteria 16676
895 Ga0207648_10003442 3300026089 Bacteria 16603
896 Ga0207648_10010003 3300026089 Bacteria 9023
897 Ga0207648_10064003 3300026089 Bacteria 3205
898 Ga0207648_10075871 3300026089 Bacteria 2930
899 Ga0207648_10119721 3300026089 Unclassified 2314
900 Ga0207676_10009837 3300026095 Bacteria 6802
901 Ga0207676_10022211 3300026095 Bacteria 4665
902 Ga0207676_10034551 3300026095 Bacteria 3829
903 Ga0207676_10082197 3300026095 Bacteria 2619
904 Ga0207676_10218506 3300026095 Bacteria 1696
905 Ga0207674_10000672 3300026116 Bacteria 44419
906 Ga0207674_10009363 3300026116 Bacteria 11203
907 Ga0207674_10035446 3300026116 Bacteria 5206
908 Ga0207674_10047123 3300026116 Bacteria 4421
909 Ga0207674_10053435 3300026116 Bacteria 4118
910 Ga0207674_10167317 3300026116 Bacteria 2152
911 Ga0207674_10180315 3300026116 Bacteria 2063
912 Ga0207674_10218190 3300026116 Bacteria 1855
913 Ga0207675_100000124 3300026118 Bacteria 63805
914 Ga0207675_100066501 3300026118 Bacteria 3369
915 Ga0207675_100295016 3300026118 Bacteria 1578
916 Ga0207683_10010911 3300026121 Bacteria 7748
917 Ga0207683_10015180 3300026121 Bacteria 6554
918 Ga0207683_10205270 3300026121 Unclassified 1792
919 Ga0207683_10503084 3300026121 Bacteria 1119
920 Ga0207698_10001082 3300026142 Bacteria 15843
921 Ga0207698_10004520 3300026142 Bacteria 8484
922 Ga0207698_10008356 3300026142 Bacteria 6541
923 Ga0207698_10018942 3300026142 Bacteria 4701
924 Ga0207698_10022184 3300026142 Bacteria 4406
925 Ga0207698_10201752 3300026142 Bacteria 1781
926 Ga0207698_10398949 3300026142 Bacteria 1314
927 Ga0209281_1000299 3300027111 Bacteria 90106
928 Ga0209995_1006596 3300027471 Bacteria 1865
929 Ga0207428_10121308 3300027907 Bacteria 2004
930 Ga0268266_10000049 3300028379 Bacteria 307763
931 Ga0268266_10000137 3300028379 Bacteria 140685
932 Ga0268266_10052240 3300028379 Bacteria 3509
933 Ga0268266_10373309 3300028379 Unclassified 1344
934 Ga0268265_10060000 3300028380 Bacteria 2913
935 Ga0268265_10130426 3300028380 Bacteria 2088
936 Ga0268265_10189233 3300028380 Bacteria 1776
937 Ga0268264_10000041 3300028381 Bacteria 372501
938 Ga0268264_10001720 3300028381 Bacteria 20153
939 Ga0268264_10003860 3300028381 Bacteria 12861
940 Ga0268264_10015087 3300028381 Bacteria 6337
941 Ga0268264_10018061 3300028381 Bacteria 5768
942 Ga0268264_10076166 3300028381 Bacteria 2854
943 Ga0268264_10233443 3300028381 Bacteria 1700
944 Ga0265334_10065194 3300028573 Bacteria 1366
945 Ga0265323_10000082 3300028653 Bacteria 54153
946 Ga0307517_10002048 3300028786 Bacteria 32795
947 Ga0307517_10009539 3300028786 Bacteria 13744
948 Ga0307517_10132404 3300028786 Bacteria 1789
949 Ga0307515_10000001 3300028794 Bacteria 4259510
950 Ga0307515_10000061 3300028794 Bacteria 251841
951 Ga0307515_10009265 3300028794 Bacteria 19056
952 Ga0307515_10022836 3300028794 Bacteria 11007
953 Ga0265338_10036318 3300028800 Unclassified 4718
954 Ga0265338_10094888 3300028800 Bacteria 2453
955 Ga0265338_10130605 3300028800 Bacteria 1984
956 Ga0307511_10000042 3300030521 Bacteria 102114
957 Ga0316177_1032754 3300030731 Bacteria 20502
958 Ga0316176_1030119 3300030732 Bacteria 23258
959 Ga0316183_1088093 3300030742 Bacteria 36462
960 Ga0316181_1244277 3300030744 Bacteria 1335
961 Ga0265327_10000370 3300031251 Bacteria 84921
962 Ga0265327_10000395 3300031251 Bacteria 81944
963 Ga0265327_10000614 3300031251 Bacteria 58841
964 Ga0265327_10009563 3300031251 Bacteria 6974
965 Ga0265327_10011198 3300031251 Bacteria 6212
966 Ga0265316_10000982 3300031344 Bacteria 30963
967 Ga0265316_10005052 3300031344 Bacteria 12946
968 Ga0265316_10007084 3300031344 Bacteria 10612
969 Ga0307513_10247949 3300031456 Bacteria 1580
970 Ga0307513_10368175 3300031456 Bacteria 1180
971 Ga0307509_10077458 3300031507 Bacteria 3448
972 Ga0307509_10109209 3300031507 Bacteria 2777
973 Ga0307509_10175070 3300031507 Bacteria 2019
974 Ga0307408_100001828 3300031548 Bacteria 15502
975 Ga0307408_100002354 3300031548 Bacteria 13345
976 Ga0307408_100003065 3300031548 Bacteria 11533
977 Ga0307408_100008089 3300031548 Bacteria 6953
978 Ga0307408_100009674 3300031548 Bacteria 6357
979 Ga0307408_100042599 3300031548 Bacteria 3226
980 Ga0265313_10025091 3300031595 Bacteria 3169
981 Ga0307508_10002100 3300031616 Bacteria 21430
982 Ga0265342_10077052 3300031712 Bacteria 1932
983 Ga0316576_10019459 3300031727 Bacteria 4654
984 Ga0316576_10136585 3300031727 Bacteria 1845
985 Ga0307516_10001558 3300031730 Bacteria 31533
986 Ga0307405_10000001 3300031731 Bacteria 1731270
987 Ga0307405_10002108 3300031731 Bacteria 8664
988 Ga0307405_10396170 3300031731 Bacteria 1079
989 Ga0316577_10025236 3300031733 Bacteria 3306
990 Ga0307413_10000106 3300031824 Bacteria 21433
991 Ga0307413_10025336 3300031824 Bacteria 3251
992 Ga0307406_10000055 3300031901 Bacteria 62544
993 Ga0307406_10151508 3300031901 Bacteria 1655
994 Ga0307407_10000130 3300031903 Bacteria 23045
995 Ga0307412_10000023 3300031911 Bacteria 237005
996 Ga0307412_10000034 3300031911 Bacteria 206033
997 Ga0307412_10000431 3300031911 Bacteria 25291
998 Ga0307412_10001853 3300031911 Bacteria 11714
999 Ga0307412_10004743 3300031911 Bacteria 7590
1000 Ga0307412_10011797 3300031911 Bacteria 5072
1001 Ga0307412_10119710 3300031911 Bacteria 1894
1002 Ga0307412_10236457 3300031911 Unclassified 1410
1003 Ga0307416_100000004 3300032002 Bacteria 505535
1004 Ga0307416_100000994 3300032002 Bacteria 14992
1005 Ga0307416_100417085 3300032002 Bacteria 1385
1006 Ga0307414_10000012 3300032004 Bacteria 322675
1007 Ga0307414_10000067 3300032004 Bacteria 103245
1008 Ga0307414_10000205 3300032004 Bacteria 39667
1009 Ga0307414_10000368 3300032004 Bacteria 24667
1010 Ga0307414_10018419 3300032004 Bacteria 4299
1011 Ga0307414_10019912 3300032004 Bacteria 4169
1012 Ga0307414_10034191 3300032004 Bacteria 3367
1013 Ga0307414_10043161 3300032004 Bacteria 3069
1014 Ga0307414_10065989 3300032004 Bacteria 2585
1015 Ga0307414_10070691 3300032004 Bacteria 2514
1016 Ga0307414_10073136 3300032004 Bacteria 2478
1017 Ga0307414_10103927 3300032004 Bacteria 2145
1018 Ga0307414_10303636 3300032004 Bacteria 1351
1019 Ga0307414_10342649 3300032004 Bacteria 1280
1020 Ga0307411_10000008 3300032005 Bacteria 321575
1021 Ga0307411_10144215 3300032005 Bacteria 1760
1022 Ga0307411_10227554 3300032005 Bacteria 1451
1023 Ga0316580_10029814 3300032139 Bacteria 1689
1024 Ga0307510_10000091 3300033180 Bacteria 68694
1025 Ga0307510_10008820 3300033180 Bacteria 12018
1026 Ga0307510_10091404 3300033180 Bacteria 2886
1027 Ga0307510_10135566 3300033180 Bacteria 2120
1028 Ga0373944_0030594 3300035089 Bacteria 1615
1029 Ga0373941_0001716 3300035115 Bacteria 4704
1030 Ga0373957_0106428 3300035120 Bacteria 1127
1031 Ga0373955_0042786 3300035172 Bacteria 2434
1032 Ga0316574_0070151 3300035398 Bacteria 2213
1033 Ga0316574_0075563 3300035398 Unclassified 2134
1034 Ga0373937_0055659 3300036401 Bacteria 3632
1035 Ga0316582_0004909 3300036647 Bacteria 6832
1036 Ga0316584_0031063 3300036712 Bacteria 3949
1037 Ga0316584_0245998 3300036712 Bacteria 1307
1038 Ga0395899_0000033 3300037312 Bacteria 306589
1039 Ga0395899_0000037 3300037312 Bacteria 280224
1040 Ga0395899_0000796 3300037312 Bacteria 30874
1041 Ga0395899_0011488 3300037312 Bacteria 6779
1042 Ga0395899_0040931 3300037312 Unclassified 3464
1043 Ga0395899_0076882 3300037312 Bacteria 2436
1044 Ga0395899_0176577 3300037312 Bacteria 1501
1045 Ga0395899_0205736 3300037312 Bacteria 1370
1046 Ga0395900_0000014 3300037418 Bacteria 386513
1047 Ga0395900_0020025 3300037418 Bacteria 6822
1048 Ga0395900_0025707 3300037418 Bacteria 6027
1049 Ga0395900_0034282 3300037418 Bacteria 5226
1050 Ga0395900_0053699 3300037418 Bacteria 4147
1051 Ga0395900_0058215 3300037418 Bacteria 3978
1052 Ga0395898_0063471 3300037466 Unclassified 3584
1053 Ga0395898_0344382 3300037466 Unclassified 1421
1054 Ga0395905_0000241 3300037471 Bacteria 82847
1055 Ga0395905_0000254 3300037471 Bacteria 79953
1056 Ga0395905_0000278 3300037471 Bacteria 75859
1057 Ga0395905_0001456 3300037471 Bacteria 28398
1058 Ga0395905_0102782 3300037471 Bacteria 2683
1059 Ga0395905_0180636 3300037471 Bacteria 1981
1060 Ga0395901_0000582 3300038443 Bacteria 42425
1061 Ga0395901_0001349 3300038443 Bacteria 25743
1062 Ga0395901_0001630 3300038443 Bacteria 23212
1063 Ga0395901_0165590 3300038443 Bacteria 2321
1064 Ga0400489_60749 3300039093 Bacteria 3591
1065 Ga0436365_0881017 3300039437 Bacteria 14010
1066 Ga0436365_1079918 3300039437 Bacteria 37760
1067 Ga0436365_1575134 3300039437 Unclassified 1274
1068 Ga0436361_0671868 3300039447 Bacteria 7057
1069 Ga0439436_0033623 3300041404 Bacteria 1484
1070 Ga0439447_000599 3300041407 Bacteria 13468
1071 Ga0439466_0000733 3300041411 Bacteria 12417
1072 Ga0439466_0029101 3300041411 Bacteria 1903
1073 Ga0439465_0004154 3300041413 Bacteria 4710
1074 Ga0451807_1223207 3300041486 Bacteria 1082
1075 Ga0451837_0930931 3300041494 Bacteria 2172
1076 Ga0451853_1077363 3300041512 Bacteria 1368
1077 Ga0451853_1344014 3300041512 Bacteria 1337
1078 Ga0439431_0001706 3300041997 Bacteria 4842
1079 Ga0439431_0008024 3300041997 Bacteria 2366
1080 Ga0439445_0002350 3300042004 Bacteria 4203
1081 Ga0439448_0000765 3300042005 Bacteria 7805
1082 Ga0439434_0003786 3300042435 Bacteria 4422
1083 Ga0451577_0000732 3300042876 Bacteria 50760
1084 Ga0451577_0002136 3300042876 Bacteria 24236
1085 Ga0451577_0003767 3300042876 Bacteria 16532
1086 Ga0451577_0005099 3300042876 Bacteria 13538
1087 Ga0451577_0014810 3300042876 Bacteria 7266
1088 Ga0451577_0033905 3300042876 Bacteria 4604
1089 Ga0451577_0036864 3300042876 Bacteria 4403
1090 Ga0451577_0054343 3300042876 Bacteria 3575
1091 Ga0451577_0107530 3300042876 Bacteria 2493
1092 Ga0451577_0135050 3300042876 Bacteria 2215
1093 Ga0466969_0000584 3300044656 Bacteria 19813
1094 Ga0466972_0000207 3300044658 Bacteria 42277
1095 Ga0466972_0003815 3300044658 Bacteria 7496
1096 Ga0466972_0007800 3300044658 Bacteria 5371
1097 Ga0466982_0129100 3300044672 Bacteria 1556
1098 Ga0453683_0000174 3300044673 Bacteria 89378
1099 Ga0453683_0004567 3300044673 Bacteria 9791
1100 Ga0453683_0011474 3300044673 Bacteria 5837
1101 Ga0453683_0020068 3300044673 Bacteria 4273
1102 Ga0453683_0069892 3300044673 Bacteria 2196
1103 Ga0453683_0210473 3300044673 Unclassified 1235
1104 Ga0466965_0023948 3300044683 Bacteria 2951
1105 Ga0466966_0000136 3300044684 Bacteria 47038
1106 Ga0466961_0042386 3300044693 Bacteria 2917
1107 Ga0466961_0225162 3300044693 Bacteria 1155
1108 Ga0466961_0303882 3300044693 Bacteria 974
1109 Ga0466964_0033441 3300044706 Bacteria 2049
1110 Ga0453684_0000167 3300044712 Bacteria 290200
1111 Ga0453684_0000191 3300044712 Bacteria 267816
1112 Ga0453684_0000202 3300044712 Bacteria 261894
1113 Ga0453684_0000206 3300044712 Bacteria 257650
1114 Ga0453684_0001141 3300044712 Bacteria 82874
1115 Ga0453684_0001264 3300044712 Bacteria 76025
1116 Ga0453684_0003500 3300044712 Bacteria 35253
1117 Ga0453684_0003863 3300044712 Bacteria 32992
1118 Ga0453684_0011041 3300044712 Bacteria 15260
1119 Ga0453684_0012400 3300044712 Bacteria 14064
1120 Ga0453684_0015367 3300044712 Bacteria 12121
1121 Ga0453684_0026765 3300044712 Bacteria 8310
1122 Ga0453684_0044759 3300044712 Bacteria 5915
1123 Ga0453684_0051863 3300044712 Bacteria 5371
1124 Ga0453684_0065811 3300044712 Bacteria 4620
1125 Ga0453684_0066880 3300044712 Bacteria 4574
1126 Ga0453684_0067315 3300044712 Bacteria 4555
1127 Ga0453684_0076863 3300044712 Bacteria 4189
1128 Ga0453684_0079972 3300044712 Bacteria 4084
1129 Ga0453684_0086354 3300044712 Bacteria 3894
1130 Ga0453684_0108767 3300044712 Bacteria 3373
1131 Ga0453684_0116758 3300044712 Bacteria 3231
1132 Ga0453684_0127953 3300044712 Bacteria 3053
1133 Ga0453684_0132582 3300044712 Bacteria 2988
1134 Ga0453684_0149655 3300044712 Bacteria 2776
1135 Ga0453684_0151567 3300044712 Bacteria 2754
1136 Ga0453684_0200916 3300044712 Bacteria 2324
1137 Ga0453684_0248168 3300044712 Bacteria 2045
1138 Ga0453684_0546075 3300044712 Bacteria 1277
1139 Ga0466971_0032077 3300044719 Bacteria 2354
1140 Ga0466970_0032860 3300044765 Bacteria 2742
1141 Ga0466957_0007040 3300044842 Bacteria 6358
1142 Ga0466957_0014895 3300044842 Bacteria 4535
1143 Ga0466957_0051905 3300044842 Bacteria 2496
1144 Ga0466957_0170116 3300044842 Bacteria 1419
1145 Ga0466959_0000002 3300045049 Bacteria 362671
1146 Ga0466959_0004264 3300045049 Bacteria 9538
1147 Ga0466959_0063184 3300045049 Bacteria 2689
1148 Ga0451576_0000003 3300045051 Bacteria 1550573
1149 Ga0451576_0000072 3300045051 Bacteria 257650
1150 Ga0451576_0000088 3300045051 Bacteria 234139
1151 Ga0451576_0000232 3300045051 Bacteria 135846
1152 Ga0451576_0001854 3300045051 Bacteria 34226
1153 Ga0451576_0006334 3300045051 Bacteria 14542
1154 Ga0451576_0009893 3300045051 Bacteria 11012
1155 Ga0451576_0010551 3300045051 Bacteria 10581
1156 Ga0451576_0022082 3300045051 Bacteria 6905
1157 Ga0451576_0112991 3300045051 Bacteria 2827
1158 Ga0451576_0342262 3300045051 Bacteria 1566
1159 Ga0451576_0405345 3300045051 Unclassified 1430
1160 Ga0495627_000097 3300046453 Bacteria 107790
1161 Ga0495627_005749 3300046453 Bacteria 4949
1162 Ga0495627_012982 3300046453 Bacteria 2940
1163 Ga0495627_021042 3300046453 Bacteria 2166
1164 Ga0495629_0096536 3300046459 Bacteria 2062
1165 Ga0495638_0000003 3300046460 Bacteria 888792
1166 Ga0495638_0029092 3300046460 Bacteria 3564
1167 Ga0495651_0038960 3300046462 Bacteria 3700
1168 Ga0495653_0053573 3300046463 Bacteria 3086
1169 Ga0495650_0000036 3300046471 Bacteria 400633
1170 Ga0495580_0014773 3300046472 Bacteria 5916
1171 Ga0495580_0039305 3300046472 Bacteria 3385
1172 Ga0495585_0000831 3300046492 Bacteria 26632
1173 Ga0495607_0032969 3300046501 Bacteria 3155
1174 Ga0495606_0000008 3300046507 Bacteria 321373
1175 Ga0495606_0003964 3300046507 Bacteria 15184
1176 Ga0495606_0019321 3300046507 Bacteria 5075
1177 Ga0495606_0025036 3300046507 Bacteria 4284
1178 Ga0495606_0039090 3300046507 Bacteria 3203
1179 Ga0495610_0000001 3300046512 Bacteria 1620061
1180 Ga0495610_0000233 3300046512 Bacteria 59298
1181 Ga0495610_0023416 3300046512 Bacteria 3359
1182 Ga0495610_0112392 3300046512 Bacteria 1205
1183 Ga0495616_0004581 3300046513 Bacteria 8701
1184 Ga0495616_0007672 3300046513 Bacteria 6451
1185 Ga0495630_0012164 3300046517 Bacteria 6242
1186 Ga0495630_0038354 3300046517 Bacteria 3584
1187 Ga0495632_0068748 3300046519 Bacteria 1706
1188 Ga0495632_0128572 3300046519 Bacteria 1180
1189 Ga0495644_0030099 3300046523 Bacteria 2050
1190 Ga0495648_0003229 3300046524 Bacteria 14455
1191 Ga0495648_0003874 3300046524 Bacteria 12979
1192 Ga0495663_0000165 3300046525 Bacteria 26227
1193 Ga0495654_0000001 3300046530 Bacteria 1513197
1194 Ga0495609_0001065 3300046538 Bacteria 19213
1195 Ga0495609_0012891 3300046538 Bacteria 3957
1196 Ga0495645_0080467 3300046543 Bacteria 2339
1197 Ga0495633_0000018 3300046558 Bacteria 243398
1198 Ga0495633_0000080 3300046558 Bacteria 127703
1199 Ga0495633_0000233 3300046558 Bacteria 67958
1200 Ga0495633_0008035 3300046558 Bacteria 6001
1201 Ga0495633_0008511 3300046558 Bacteria 5769
1202 Ga0495668_0000044 3300046616 Bacteria 227585
1203 Ga0495668_0000751 3300046616 Bacteria 38311
1204 Ga0495634_0045371 3300046642 Bacteria 2972
1205 Ga0495611_0001116 3300046648 Bacteria 14130
1206 Ga0495625_0000379 3300046660 Bacteria 67828
1207 Ga0495625_0000934 3300046660 Bacteria 39261
1208 Ga0495625_0001653 3300046660 Bacteria 26125
1209 Ga0495625_0034454 3300046660 Bacteria 3737
1210 Ga0495661_0001087 3300046665 Bacteria 23875
1211 Ga0495661_0001778 3300046665 Bacteria 17318
1212 Ga0495661_0088121 3300046665 Bacteria 1772
1213 Ga0495661_0092509 3300046665 Bacteria 1718
1214 Ga0495657_0216696 3300046675 Unclassified 1162
1215 Ga0495658_0087681 3300046683 Bacteria 1838
1216 Ga0495671_0029844 3300046692 Bacteria 2797
1217 Ga0495649_0000010 3300046694 Bacteria 430552
1218 Ga0495649_0037561 3300046694 Bacteria 2658
1219 Ga0495600_0071204 3300046809 Bacteria 2272
1220 Ga0495674_0112806 3300047319 Bacteria 2303
1221 Ga0495672_0018888 3300047320 Bacteria 4564
1222 Ga0495672_0025973 3300047320 Bacteria 3743
1223 Ga0495676_0070348 3300047321 Bacteria 2696
1224 Ga0495680_0077801 3300047322 Bacteria 2512
1225 Ga0495687_000001 3300047443 Bacteria 1215582
1226 Ga0495687_000736 3300047443 Bacteria 35743
1227 Ga0495687_002474 3300047443 Bacteria 14740
1228 Ga0495685_018838 3300047447 Bacteria 2370
1229 Ga0495684_0167137 3300047471 Bacteria 1638
1230 Ga0495686_0000004 3300047472 Bacteria 869019
1231 Ga0495686_0000022 3300047472 Bacteria 403456
1232 Ga0495686_0000196 3300047472 Bacteria 112875
1233 Ga0495686_0003522 3300047472 Bacteria 13510
1234 Ga0495686_0011430 3300047472 Bacteria 6255
1235 Ga0495686_0069737 3300047472 Bacteria 2167
1236 Ga0496100_0085300 3300048903 Bacteria 2143
1237 Ga0496101_0301226 3300048904 Bacteria 1256
1238 Ga0496102_0046542 3300048905 Bacteria 3940
1239 Ga0496110_0105873 3300048913 Bacteria 2524
1240 Ga0496114_0024981 3300048917 Bacteria 4879
1241 Ga0496114_0055009 3300048917 Bacteria 3318
1242 Ga0496115_0040646 3300048918 Bacteria 3698
1243 Ga0496115_0102109 3300048918 Bacteria 2352
1244 Ga0496116_0000004 3300048919 Bacteria 839841
1245 Ga0496116_0000027 3300048919 Bacteria 448077
1246 Ga0496116_0002379 3300048919 Bacteria 19844
1247 Ga0496117_0000021 3300048920 Bacteria 444168
1248 Ga0496117_0002276 3300048920 Bacteria 24806
1249 Ga0496117_0085221 3300048920 Bacteria 2058
1250 Ga0496118_0001245 3300048921 Bacteria 39130
1251 Ga0496118_0026652 3300048921 Bacteria 4916
1252 Ga0496118_0104190 3300048921 Bacteria 1905
1253 Ga0496119_0000004 3300048922 Bacteria 536344
1254 Ga0496121_0000020 3300048924 Bacteria 498732
1255 Ga0496121_0044433 3300048924 Bacteria 3832
1256 Ga0496122_0000154 3300048925 Bacteria 160610
1257 Ga0496122_0000352 3300048925 Bacteria 99090
1258 Ga0496122_0000591 3300048925 Bacteria 74549
1259 Ga0496122_0000613 3300048925 Bacteria 73259
1260 Ga0496122_0001522 3300048925 Bacteria 36911
1261 Ga0496122_0003469 3300048925 Bacteria 20744
1262 Ga0496122_0015395 3300048925 Bacteria 7314
1263 Ga0496123_0000580 3300048926 Bacteria 62313
1264 Ga0496123_0018244 3300048926 Bacteria 5590
1265 Ga0496123_0023338 3300048926 Bacteria 4736
1266 Ga0496124_0006587 3300048927 Bacteria 12611
1267 Ga0496124_0016074 3300048927 Bacteria 7138
1268 Ga0496124_0048297 3300048927 Bacteria 3638
1269 Ga0496124_0088833 3300048927 Bacteria 2525
1270 Ga0496125_0000012 3300048928 Bacteria 651142
1271 Ga0496125_0001291 3300048928 Bacteria 37141
1272 Ga0496125_0001400 3300048928 Bacteria 35266
1273 Ga0496125_0011050 3300048928 Bacteria 9061
1274 Ga0496125_0013680 3300048928 Bacteria 7960
1275 Ga0496126_0001970 3300048929 Bacteria 29097
1276 Ga0496126_0025237 3300048929 Bacteria 5722
1277 Ga0496126_0028741 3300048929 Bacteria 5293
1278 Ga0496126_0196632 3300048929 Bacteria 1705
1279 Ga0495678_010906 3300049459 Bacteria 4379
1280 Ga0501292_009646 3300049515 Bacteria 1436
1281 Ga0501300_003399 3300049523 Bacteria 2378
1282 Ga0501031_0066891 3300049568 Bacteria 2341
1283 Ga0501032_0016207 3300049569 Bacteria 5243
1284 Ga0501032_0017496 3300049569 Bacteria 5034
1285 Ga0501033_0029523 3300049570 Bacteria 4121
1286 Ga0501034_0004012 3300049571 Bacteria 16517
1287 Ga0501034_0053271 3300049571 Bacteria 4075
1288 Ga0501034_0066614 3300049571 Bacteria 3614
1289 Ga0501034_0077642 3300049571 Bacteria 3326
1290 Ga0501034_0122716 3300049571 Bacteria 2584
1291 Ga0501034_0346038 3300049571 Bacteria 1416
1292 Ga0501036_0019980 3300049572 Bacteria 5623
1293 Ga0501036_0121343 3300049572 Bacteria 2207
1294 Ga0501036_0159885 3300049572 Unclassified 1899
1295 Ga0501037_0007826 3300049573 Bacteria 7827
1296 Ga0501038_0007220 3300049574 Bacteria 10263
1297 Ga0501038_0033809 3300049574 Bacteria 4500
1298 Ga0501038_0122962 3300049574 Bacteria 2138
1299 Ga0501039_0019205 3300049575 Bacteria 5243
1300 Ga0501039_0262508 3300049575 Bacteria 1357
1301 Ga0501043_0008215 3300049579 Bacteria 8223
1302 Ga0501043_0015257 3300049579 Bacteria 6018
1303 Ga0501043_0417047 3300049579 Bacteria 1012
1304 Ga0501047_0009183 3300049581 Bacteria 9336
1305 Ga0501047_0084328 3300049581 Bacteria 3054
1306 Ga0501047_0147600 3300049581 Bacteria 2228
1307 Ga0501047_0161519 3300049581 Bacteria 2112
1308 Ga0501067_0050839 3300049583 Bacteria 2297
1309 Ga0501068_0026838 3300049584 Bacteria 3397
1310 Ga0501069_0007664 3300049585 Bacteria 5663
1311 Ga0501073_0006174 3300049589 Bacteria 8944
1312 Ga0501074_0034616 3300049590 Bacteria 3661
1313 Ga0501198_002350 3300049649 Bacteria 2543
1314 Ga0501202_009071 3300049652 Unclassified 1821
1315 Ga0501202_030457 3300049652 Bacteria 1123
1316 Ga0501207_011064 3300049654 Unclassified 1338
1317 Ga0501207_018468 3300049654 Bacteria 1097
1318 Ga0501217_000618 3300049661 Bacteria 5991
1319 Ga0501217_004619 3300049661 Bacteria 2838
1320 Ga0501222_004886 3300049662 Bacteria 1820
1321 Ga0501223_006285 3300049663 Bacteria 2463
1322 Ga0501223_007672 3300049663 Bacteria 2204
1323 Ga0501235_005341 3300049669 Bacteria 2794
1324 Ga0501240_004330 3300049673 Bacteria 1641
1325 Ga0501240_013486 3300049673 Bacteria 1134
1326 Ga0501242_006477 3300049674 Unclassified 1335
1327 Ga0501243_000451 3300049675 Bacteria 5469
1328 Ga0501247_006417 3300049677 Bacteria 1331
1329 Ga0501249_000027 3300049679 Bacteria 87387
1330 Ga0501252_004165 3300049682 Bacteria 1531
1331 Ga0501257_001311 3300049686 Bacteria 5126
1332 Ga0501257_018063 3300049686 Bacteria 1643
1333 Ga0501259_000660 3300049688 Bacteria 5531
1334 Ga0501219_000230 3300049703 Bacteria 10699
1335 Ga0501225_0004035 3300049705 Bacteria 4392
1336 Ga0501225_0004470 3300049705 Bacteria 4163
1337 Ga0501225_0006622 3300049705 Bacteria 3380
1338 Ga0501245_005844 3300049708 Bacteria 1710
1339 Ga0501079_0075469 3300049741 Bacteria 2607
1340 Ga0501080_0194961 3300049742 Bacteria 1861
1341 Ga0501083_0055458 3300049744 Bacteria 2657
1342 Ga0501241_000012 3300049758 Bacteria 104953
1343 Ga0501241_005162 3300049758 Bacteria 2438
1344 Ga0501264_000335 3300049761 Bacteria 7341
1345 Ga0501266_000004 3300049763 Bacteria 356286
1346 Ga0501266_005253 3300049763 Bacteria 1614
1347 Ga0501267_009653 3300049764 Bacteria 966
1348 Ga0501269_000451 3300049766 Bacteria 8982
1349 Ga0501280_000502 3300049776 Bacteria 9210
1350 Ga0501035_0042854 3300049822 Bacteria 4080
1351 Ga0501035_0043415 3300049822 Bacteria 4052
1352 Ga0501035_0162925 3300049822 Bacteria 1930
1353 Ga0501044_0016307 3300049823 Bacteria 7981
1354 Ga0501044_0020946 3300049823 Bacteria 6981
1355 Ga0501044_0021863 3300049823 Bacteria 6820
1356 Ga0501044_0044831 3300049823 Bacteria 4586
1357 Ga0501044_0161620 3300049823 Unclassified 2216
1358 Ga0501044_0216066 3300049823 Bacteria 1870
1359 Ga0501284_00029 3300050005 Bacteria 74818
1360 nmdc:mga0k408_102151_c1 3300050493 Bacteria 1691
1361 nmdc:mga0k408_105_c1 3300050493 Bacteria 39936
1362 nmdc:mga0k408_13283_c1 3300050493 Bacteria 4195
1363 nmdc:mga0k408_48_c1 3300050493 Bacteria 60474
1364 nmdc:mga0k408_64279_c1 3300050493 Bacteria 2135
1365 nmdc:mga05p37_285602_c1 3300050507 Bacteria 1966
1366 nmdc:mga05p37_428740_c1 3300050507 Bacteria 1537
1367 nmdc:mga0qj67_108041_c1 3300050509 Bacteria 2244
1368 nmdc:mga08y16_142160_c1 3300050511 Bacteria 2495
1369 nmdc:mga08y16_191002_c1 3300050511 Bacteria 2124
1370 Ga0500635_0000796 3300053080 Bacteria 7818
1371 Ga0500578_0000694 3300053086 Bacteria 40191
1372 Ga0500578_0045759 3300053086 Bacteria 2808
1373 Ga0500644_0000283 3300053088 Bacteria 28078
1374 Ga0500646_0005658 3300053090 Bacteria 3165
1375 Ga0500646_0027325 3300053090 Bacteria 1552
1376 Ga0500647_0050815 3300053091 Bacteria 1994
1377 Ga0500583_0000059 3300053092 Bacteria 68222
1378 Ga0500651_0000253 3300053093 Bacteria 32192
1379 Ga0500641_0000242 3300053096 Bacteria 20695
1380 Ga0500557_033835 3300053105 Bacteria 1566
1381 Ga0500562_014775 3300053108 Bacteria 2001
1382 Ga0500607_018370 3300053121 Bacteria 3972
1383 Ga0500608_027602 3300053122 Bacteria 2676
1384 Ga0500608_073120 3300053122 Bacteria 1628
1385 Ga0500618_000013 3300053125 Bacteria 183026
1386 Ga0500618_011591 3300053125 Bacteria 2333
1387 Ga0500658_0000010 3300053134 Bacteria 248149
1388 Ga0500559_0006224 3300053136 Bacteria 5402
1389 Ga0500568_0001626 3300053139 Bacteria 14158
1390 Ga0500573_0117160 3300053140 Bacteria 1486
1391 Ga0500577_0020859 3300053142 Bacteria 2150
1392 Ga0500604_0006396 3300053151 Bacteria 3115
1393 Ga0500604_0022589 3300053151 Bacteria 1787
1394 Ga0500616_0000007 3300053153 Bacteria 836875
1395 Ga0500616_0005429 3300053153 Bacteria 8651
1396 Ga0500616_0009033 3300053153 Bacteria 6104
1397 Ga0500616_0016083 3300053153 Bacteria 4268
1398 Ga0500622_0000247 3300053156 Bacteria 55130
1399 Ga0500622_0000515 3300053156 Bacteria 35966
1400 Ga0500622_0000540 3300053156 Bacteria 34894
1401 Ga0500622_0000777 3300053156 Bacteria 27709
1402 Ga0500622_0001463 3300053156 Bacteria 18819
1403 Ga0500624_000379 3300053157 Bacteria 14179
1404 Ga0500633_0048877 3300053160 Bacteria 1452
1405 Ga0500611_000034 3300053727 Bacteria 78957
1406 Ga0501082_0112289 3300060353 Bacteria 2359
1407 Ga0501082_0414103 3300060353 Bacteria 1177
1408 Ga0466962_0005611 3300061719 Bacteria 6028
1409 2511234099 2511231000 Bacteria 4488346
1410 2513232253 2513020052 Bacteria 5120511
1411 2522547642 2522125168 Bacteria 7376607
1412 2524005564 2523533629 Bacteria 2982326
1413 2585144370 2582581278 Bacteria 5296881
1414 2585158996 2582581281 Bacteria 4487904
1415 2585163284 2582581282 Bacteria 4495830
1416 2585425382 2582581873 Bacteria 3032664
1417 2587677376 2585428045 Bacteria 5203023
1418 2587745500 2585428060 Bacteria 5304711
1419 2587750693 2585428061 Bacteria 3939663
1420 2587943784 2585428115 Bacteria 4420269
1421 2588208895 2585428182 Bacteria 5007281
1422 2588212397 2585428183 Bacteria 5166119
1423 2588225066 2585428185 Bacteria 4969476
1424 2588231606 2585428187 Bacteria 4629388
1425 2588445713 2588253712 Bacteria 5403181
1426 2590602332 2588254255 Bacteria 5014294
1427 2590611316 2588254257 Bacteria 5436094
1428 2599480990 2599185184 Bacteria 6430550
1429 2644009823 2643221600 Bacteria 5530138
1430 2644374219 2643221667 Bacteria 5627472
1431 2644683695 2643221725 Bacteria 5087956
1432 2722726497 2721755487 Bacteria 6357185
1433 2729202037 2728369107 Bacteria 5082720
1434 2738727059 2738541278 Bacteria 9755573
1435 2738760566 2738541284 Bacteria 5199923
1436 2739254997 2738543014 Bacteria 4048139
1437 2739300621 2738543023 Bacteria 6767879
1438 2739590407 2739367651 Bacteria 6359826
1439 2739617379 2739367656 Bacteria 5152243
1440 2739647571 2739367663 Bacteria 5040914
1441 2740002460 2739367857 Bacteria 5433684
1442 2740007276 2739367858 Bacteria 5432813
1443 2740033304 2739367866 Bacteria 4215900
1444 2740061480 2739367874 Bacteria 4872888
1445 2753671961 2751185877 Bacteria 4921427
1446 2765576891 2765235839 Bacteria 5314748
1447 2775673393 2775506739 Bacteria 3855222
1448 2776612699 2775506987 Bacteria 5373360
1449 2802652418 2802428842 Bacteria 4926114
1450 2816872184 2816332188 Bacteria 5133218
1451 2819548307 2818991437 Bacteria 5805520
1452 2819573629 2818991442 Bacteria 8318214
1453 2819680871 2818991460 Bacteria 7595395
1454 2821136963 2821136567 Bacteria 8080116
1455 2839991354 2839989709 Bacteria 3773432
1456 2842086659 2842083920 Bacteria 4857652
1457 2842906815 2842903701 Bacteria 6986368
1458 2849286733 2849281842 Bacteria 6065644
1459 2852623493 2852623160 Bacteria 4376875
1460 2852630140 2852627209 Bacteria 5896285
1461 2857615894 2857613821 Bacteria 4917088
1462 2857620360 2857618242 Bacteria 5635925
1463 2857632142 2857627736 Bacteria 5625397
1464 2871724350 2871720351 Bacteria 4862476
1465 2881362663 2881359912 Bacteria 4935907
1466 2883072585 2883068021 Bacteria 6192739
1467 2884637258 2884634485 Bacteria 3928637
1468 2884795628 2884791551 Bacteria 8511252
1469 2884937607 2884933994 Bacteria 4535041
1470 2889292556 2889290771 Bacteria 5530962
1471 2890737617 2890737413 Bacteria 4269751
1472 2895501638 2895498888 Bacteria 5283788
1473 2896087752 2896085136 Bacteria 6129793
1474 2896112542 2896109856 Bacteria 7140722
1475 2896319411 2896317667 Bacteria 4606601
1476 2896347003 2896344016 Bacteria 3811746
1477 2898713405 2898713307 Bacteria 4110805
1478 2903897866 2903895155 Bacteria 5258610
1479 2904422088 2904419702 Bacteria 5166287
1480 2904446100 2904445276 Bacteria 5310396
1481 2904468295 2904467357 Bacteria 8057758
1482 2904559074 2904555929 Bacteria 5218588
1483 2904783639 2904780799 Bacteria 5840761
1484 2906000464 2905999023 Bacteria 4591259
1485 2910248588 2910245624 Bacteria 6935613
1486 2914760597 2914759650 Bacteria 4701441
1487 2919097502 2919097161 Bacteria 3860339
1488 2919182190 2919177583 Bacteria 5641607
1489 2919189878 2919186247 Bacteria 6244071
1490 2919192101 2919191525 Bacteria 5765973
1491 2919400780 2919399522 Bacteria 5164947
1492 2919442597 2919437846 Bacteria 6199444
1493 2919686044 2919683626 Bacteria 5534354
1494 2919695416 2919692658 Bacteria 5943958
1495 2928080902 2928078545 Bacteria 6534839
1496 2928150191 2928147474 Bacteria 6512076
1497 2929154664 2929150217 Bacteria 5462483
1498 2929178801 2929177148 Bacteria 7883697
1499 2929241244 2929239360 Bacteria 7745570
1500 2929923240 2929921140 Bacteria 8649150
1501 2932088242 2932082852 Bacteria 6563563
1502 2939668158 2939664404 Bacteria 6364494
1503 2945927788 2945924605 Bacteria 4296724
1504 2945981205 2945977869 Bacteria 7777518
1505 2946019394 2946013367 Bacteria 7766675
1506 2946020604 2946019816 Bacteria 4621265
1507 2958459095 2958458903 Bacteria 5301041
1508 2958512513 2958512119 Bacteria 4528530
1509 2965323326 2965320100 Bacteria 3975600
1510 2977236774 2977232053 Bacteria 5485925
1511 2977246770 2977243572 Bacteria 4374394
1512 2977271498 2977268062 Bacteria 5243061
1513 2984575386 2984572630 Bacteria 4186940
1514 2984608840 2984606641 Bacteria 4186971
1515 2993374090 2993372514 Bacteria 4214139
1516 2993480992 2993480792 Bacteria 4022225
1517 3003233518 3003233435 Bacteria 4458031
1518 8003153683 8003151029 Bacteria 8187759
1519 8054310548 8054307821 Bacteria 5212224
1520 8055423024 8055419101 Bacteria 5289643
1521 8055590799 8055588893 Bacteria 3619545
1522 8055596625 8055592153 Bacteria 5961247
1523 8056442050 8056440228 Bacteria 4946504
1524 Ga0495610_0000757
1525 SwRhRL2b_contig_1994362
1526 SwRhRL2b_contig_2088904
1527 SwRhRL2b_contig_3399644
1528 JGI24741J21665_1002082
1529 JGI24741J21665_1006025
1530 JGI24740J21852_10005751
1531 JGI24740J21852_10036460
1532 JGI24739J22299_10038781
1533 JGI24737J22298_10014703
1534 JGI24744J21845_10002612
1535 JGI25162J39368_1000017
1536 JGI25162J39368_1000614
1537 JGI25154J39366_1000040
1538 JGI25164J39214_1001787
1539 JGI25150J39212_1000001
1540 JGI25151J46595_10000005
1541 JGI25165J46597_1000634
1542 JGI25153J46596_10000040
1543 JGI25153J46596_10003346
1544 JGI25153J46596_10041566
1545 rootH1_10003601
1546 rootH1_10007102
1547 rootH1_10082958
1548 rootH1_10151462
1549 rootH2_10013635
1550 rootH2_10016199
1551 rootH2_10019144
1552 rootH2_10030072
1553 rootH2_10077704
1554 rootH2_10190169
1555 rootH2_10308990
1556 rootL2_10002914
1557 rootL2_10025842
1558 rootL2_10032238
1559 rootL2_10032239
1560 rootL2_10079467
1561 rootL2_10083418
1562 rootL2_10122039
1563 rootL2_10122858
1564 rootL2_10134929
1565 rootL2_10305032
1566 rootL2_10327582
1567 rootH1_10005821
1568 rootH1_10020847
1569 rootH1_10023753
1570 rootH1_10031683
1571 rootH1_10050118
1572 rootH1_10052662
1573 rootH1_10101577
1574 rootH1_10182853
1575 rootH1_10230655
1576 JGI25160J50197_1005075
1577 JGI25160J50197_1005718
1578 JGI25160J50197_1013229
1579 Ga0055535_1003449
1580 Ga0055536_1000564
1581 Ga0055528_1001650
1582 Ga0055530_10000387
1583 Ga0055530_10007698
1584 Ga0055531_10000131
1585 Ga0055531_10000156
1586 Ga0055543_1021355
1587 Ga0065165_1000102
1588 Ga0065165_1001626
1589 Ga0065714_10002826
1590 Ga0065714_10011701
1591 Ga0065714_10064551
1592 Ga0065714_10065701
1593 Ga0065714_10066278
1594 Ga0065714_10070733
1595 Ga0065714_10071292
1596 Ga0065714_10085181
1597 Ga0065714_10136175
1598 Ga0065704_10070466
1599 Ga0065704_10070721
1600 Ga0065704_10072255
1601 Ga0065704_10073358
1602 Ga0065704_10093766
1603 Ga0065704_10125453
1604 Ga0065712_10076829
1605 Ga0065712_10106080
1606 Ga0070658_10000091
1607 Ga0070658_10057776
1608 Ga0070676_10000336
1609 Ga0070676_10002755
1610 Ga0070676_10003243
1611 Ga0070676_10060138
1612 Ga0070683_100000725
1613 Ga0070683_100010872
1614 Ga0070683_100032588
1615 Ga0070683_100042317
1616 Ga0070690_100005983
1617 Ga0070690_100275978
1618 Ga0070670_100039428
1619 Ga0070670_100054985
1620 Ga0070670_100060696
1621 Ga0070670_100066481
1622 Ga0070670_100082144
1623 Ga0070670_100384887
1624 Ga0068869_100039941
1625 Ga0068869_100069980
1626 Ga0068869_100127915
1627 Ga0068869_100284187
1628 Ga0070666_10000051
1629 Ga0070666_10010156
1630 Ga0070666_10010207
1631 Ga0070666_10013609
1632 Ga0070666_10143122
1633 Ga0070680_100002139
1634 Ga0070680_100050858
1635 Ga0070680_100061374
1636 Ga0070680_100065624
1637 Ga0070680_100331896
1638 Ga0070682_100000060
1639 Ga0070682_100000596
1640 Ga0070682_100001275
1641 Ga0070682_100025241
1642 Ga0070682_100026905
1643 Ga0068868_100010338
1644 Ga0068868_100015086
1645 Ga0068868_100016530
1646 Ga0068868_100076548
1647 Ga0068868_100080003
1648 Ga0068868_100080631
1649 Ga0068868_100085678
1650 Ga0068868_100162816
1651 Ga0068868_100198670
1652 Ga0070660_100000800
1653 Ga0070660_100009297
1654 Ga0070660_100071902
1655 Ga0070660_100103890
1656 Ga0070660_100106276
1657 Ga0070660_100133278
1658 Ga0070689_100001732
1659 Ga0070689_100013351
1660 Ga0070689_100014808
1661 Ga0070689_100137929
1662 Ga0070691_10033514
1663 Ga0070687_100125604
1664 Ga0070661_100003143
1665 Ga0070661_100022549
1666 Ga0070661_100118026
1667 Ga0070668_100002494
1668 Ga0070668_100100239
1669 Ga0070668_100110332
1670 Ga0070668_100132503
1671 Ga0070669_100036574
1672 Ga0070669_100048455
1673 Ga0070669_100135719
1674 Ga0070669_100141137
1675 Ga0070669_100237791
1676 Ga0070675_100013600
1677 Ga0070675_100025711
1678 Ga0070675_100055173
1679 Ga0070675_100055271
1680 Ga0070675_100080740
1681 Ga0070675_100322491
1682 Ga0070671_100004357
1683 Ga0070671_100049587
1684 Ga0070671_100074043
1685 Ga0070671_100182326
1686 Ga0070671_100198762
1687 Ga0070671_100208844
1688 Ga0070674_100084152
1689 Ga0070673_100001990
1690 Ga0070673_100017265
1691 Ga0070673_100121048
1692 Ga0070688_100008021
1693 Ga0070688_100177611
1694 Ga0070659_100000854
1695 Ga0070659_100007938
1696 Ga0070659_100011576
1697 Ga0070659_100024762
1698 Ga0070659_100035580
1699 Ga0070659_100244042
1700 Ga0070667_100000492
1701 Ga0070667_100047694
1702 Ga0070667_100054456
1703 Ga0070667_100103565
1704 Ga0070667_100294027
1705 Ga0070701_10025529
1706 Ga0070701_10045950
1707 Ga0070700_100077166
1708 Ga0070663_100068570
1709 Ga0070678_100010791
1710 Ga0070678_100013945
1711 Ga0070678_100072331
1712 Ga0070678_100241240
1713 Ga0070662_100000011
1714 Ga0070662_100004086
1715 Ga0070662_100036135
1716 Ga0070662_100056097
1717 Ga0070662_100131800
1718 Ga0070662_100243812
1719 Ga0070662_100309850
1720 Ga0070681_10021777
1721 Ga0070681_10040812
1722 Ga0070681_10141139
1723 Ga0070681_10242445
1724 Ga0070681_10293673
1725 Ga0068867_100000841
1726 Ga0068867_100132144
1727 Ga0070685_10016536
1728 Ga0070698_100074506
1729 Ga0070679_100000575
1730 Ga0070679_100004536
1731 Ga0070679_100029492
1732 Ga0070679_100042885
1733 Ga0070679_100043938
1734 Ga0070679_100045741
1735 Ga0070679_100062675
1736 Ga0070679_100170887
1737 Ga0070684_100000228
1738 Ga0070684_100021275
1739 Ga0070684_100056123
1740 Ga0070684_100117942
1741 Ga0068853_100000221
1742 Ga0068853_100020583
1743 Ga0068853_100052784
1744 Ga0068853_100055688
1745 Ga0068853_100057721
1746 Ga0068853_100091008
1747 Ga0068853_100107829
1748 Ga0068853_100159796
1749 Ga0068853_100310572
1750 Ga0070672_100039481
1751 Ga0070672_100193930
1752 Ga0070672_100213679
1753 Ga0070686_100054827
1754 Ga0070686_100126038
1755 Ga0070686_100257432
1756 Ga0070693_100045539
1757 Ga0070693_100232174
1758 Ga0070665_100000001
1759 Ga0070665_100000003
1760 Ga0070665_100005742
1761 Ga0070665_100060884
1762 Ga0068855_100007886
1763 Ga0068855_100019632
1764 Ga0068855_100022883
1765 Ga0068855_100029930
1766 Ga0068855_100030208
1767 Ga0068855_100042513
1768 Ga0068855_100064567
1769 Ga0068855_100075213
1770 Ga0068855_100089498
1771 Ga0068855_100139292
1772 Ga0068855_100204082
1773 Ga0070664_100003241
1774 Ga0070664_100070355
1775 Ga0070664_100072381
1776 Ga0070664_100297839
1777 Ga0068857_100001119
1778 Ga0068857_100007157
1779 Ga0068857_100018337
1780 Ga0068857_100021607
1781 Ga0068857_100024160
1782 Ga0068857_100033737
1783 Ga0068857_100272891
1784 Ga0068854_100074699
1785 Ga0068854_100163987
1786 Ga0068854_100176276
1787 Ga0068854_100232744
1788 Ga0068856_100001307
1789 Ga0068856_100002043
1790 Ga0068856_100007064
1791 Ga0068856_100095550
1792 Ga0068856_100203889
1793 Ga0068856_100235515
1794 Ga0068856_100402951
1795 Ga0068852_100002006
1796 Ga0068852_100002446
1797 Ga0068852_100018674
1798 Ga0068852_100023547
1799 Ga0068852_100033393
1800 Ga0068852_100041003
1801 Ga0068852_100061600
1802 Ga0068852_100069230
1803 Ga0068852_100123507
1804 Ga0068852_100149038
1805 Ga0068852_100175121
1806 Ga0068852_100250677
1807 Ga0068852_100327119
1808 Ga0068852_100559387
1809 Ga0068859_100000023
1810 Ga0068859_100008109
1811 Ga0068859_100009853
1812 Ga0068859_100033356
1813 Ga0068859_100067422
1814 Ga0068859_100085184
1815 Ga0068859_100171254
1816 Ga0068859_100243384
1817 Ga0068859_100324535
1818 Ga0068859_100605749
1819 Ga0068864_100005800
1820 Ga0068864_100007839
1821 Ga0068864_100026175
1822 Ga0068864_100081365
1823 Ga0068864_100273851
1824 Ga0068864_100381557
1825 Ga0068861_100009306
1826 Ga0068861_100017858
1827 Ga0068861_100202055
1828 Ga0068861_100361265
1829 Ga0068861_100364196
1830 Ga0068870_10194693
1831 Ga0068863_100001812
1832 Ga0068863_100038562
1833 Ga0068863_100093702
1834 Ga0068863_100129455
1835 Ga0068863_100194530
1836 Ga0068858_100008485
1837 Ga0068858_100048079
1838 Ga0068858_100252575
1839 Ga0068858_100310467
1840 Ga0068860_100000046
1841 Ga0068860_100000916
1842 Ga0068860_100005408
1843 Ga0068860_100007358
1844 Ga0068860_100024991
1845 Ga0068860_100034035
1846 Ga0068862_100003779
1847 Ga0068862_100022881
1848 Ga0068862_100085090
1849 Ga0068862_100188580
1850 Ga0068862_100265707
1851 Ga0081540_1029157
1852 Ga0070716_100051038
1853 Ga0075366_10000333
1854 Ga0075366_10040925
1855 Ga0075366_10085039
1856 Ga0075366_10095111
1857 Ga0097621_100000150
1858 Ga0097621_100000847
1859 Ga0097621_100001572
1860 Ga0097621_100028478
1861 Ga0097621_100062269
1862 Ga0097621_100120542
1863 Ga0097621_100123615
1864 Ga0075370_10091284
1865 Ga0068871_100000027
1866 Ga0068871_100000354
1867 Ga0068871_100001006
1868 Ga0068871_100001864
1869 Ga0068871_100040970
1870 Ga0068871_100120184
1871 Ga0068871_100125590
1872 Ga0068871_100223279
1873 Ga0068871_100287080
1874 Ga0068871_100316893
1875 Ga0075428_100024587
1876 Ga0075428_100074722
1877 Ga0075430_100010054
1878 Ga0075431_100004434
1879 Ga0075429_100005840
1880 Ga0075429_100022996
1881 Ga0068865_100000547
1882 Ga0068865_100020901
1883 Ga0068865_100225179
1884 Ga0097620_100000023
1885 Ga0097620_100008109
1886 Ga0097620_100009853
1887 Ga0097620_100033356
1888 Ga0097620_100067425
1889 Ga0097620_100085179
1890 Ga0097620_100171243
1891 Ga0097620_100243357
1892 Ga0097620_100324543
1893 Ga0097620_100605775
1894 Ga0079104_1000178
1895 Ga0105244_10000002
1896 Ga0105240_10000074
1897 Ga0105240_10000598
1898 Ga0105240_10000626
1899 Ga0105240_10001595
1900 Ga0105240_10007062
1901 Ga0105240_10015708
1902 Ga0105240_10033651
1903 Ga0105240_10046672
1904 Ga0105240_10078410
1905 Ga0105240_10266249
1906 Ga0105240_10450625
1907 Ga0105240_10552688
1908 Ga0111539_10001328
1909 Ga0111539_10015483
1910 Ga0111539_10024925
1911 Ga0105245_10092150
1912 Ga0105247_10003751
1913 Ga0105247_10005412
1914 Ga0105247_10037118
1915 Ga0114129_10020916
1916 Ga0114129_10187025
1917 Ga0114129_10195324
1918 Ga0105243_10000018
1919 Ga0105243_10001177
1920 Ga0105241_10000659
1921 Ga0105241_10000881
1922 Ga0105241_10006159
1923 Ga0105241_10014580
1924 Ga0105241_10031709
1925 Ga0105241_10034893
1926 Ga0105241_10041058
1927 Ga0105241_10160453
1928 Ga0105241_10303576
1929 Ga0105242_10006091
1930 Ga0105242_10012454
1931 Ga0105242_10040286
1932 Ga0105242_10312645
1933 Ga0105242_10468062
1934 Ga0105248_10059502
1935 Ga0105237_10000755
1936 Ga0105237_10001361
1937 Ga0105237_10002829
1938 Ga0105237_10004143
1939 Ga0105237_10007407
1940 Ga0105237_10009395
1941 Ga0105237_10020135
1942 Ga0105237_10021690
1943 Ga0105237_10025001
1944 Ga0105237_10093900
1945 Ga0105237_10094887
1946 Ga0105237_10105937
1947 Ga0105237_10113562
1948 Ga0105237_10145894
1949 Ga0105237_10204008
1950 Ga0105238_10001132
1951 Ga0105238_10011571
1952 Ga0105238_10035958
1953 Ga0105238_10165317
1954 Ga0105249_10008464
1955 Ga0105249_10012834
1956 Ga0105249_10057441
1957 Ga0105249_10059671
1958 Ga0105249_10266201
1959 Ga0105239_10000002
1960 Ga0105239_10000012
1961 Ga0105239_10000048
1962 Ga0105239_10000055
1963 Ga0105239_10000204
1964 Ga0105239_10000785
1965 Ga0105239_10002090
1966 Ga0105239_10019429
1967 Ga0105239_10048437
1968 Ga0105239_10069310
1969 Ga0105239_10075461
1970 Ga0105239_10104224
1971 Ga0105239_10155609
1972 Ga0105239_10181833
1973 Ga0105239_10300916
1974 Ga0105246_10023007
1975 Ga0105246_10066024
1976 Ga0105246_10076160
1977 Ga0105246_10208673
1978 Ga0157373_10000001
1979 Ga0157373_10000029
1980 Ga0157373_10000094
1981 Ga0157373_10007113
1982 Ga0157373_10016080
1983 Ga0157373_10016186
1984 Ga0157373_10028385
1985 Ga0157373_10028554
1986 Ga0157373_10030973
1987 Ga0157373_10039128
1988 Ga0157373_10291476
1989 Ga0157371_10000119
1990 Ga0157371_10000216
1991 Ga0157371_10000523
1992 Ga0157371_10001598
1993 Ga0157371_10001727
1994 Ga0157371_10003284
1995 Ga0157371_10003654
1996 Ga0157371_10003809
1997 Ga0157371_10008389
1998 Ga0157371_10021342
1999 Ga0157371_10032895
2000 Ga0157371_10034773
2001 Ga0157371_10050101
2002 Ga0157371_10053609
2003 Ga0157371_10061232
2004 Ga0157371_10064775
2005 Ga0157371_10101283
2006 Ga0157371_10116938
2007 Ga0157371_10220581
2008 Ga0157370_10000261
2009 Ga0157370_10000436
2010 Ga0157370_10000839
2011 Ga0157370_10002210
2012 Ga0157370_10002385
2013 Ga0157370_10002663
2014 Ga0157370_10002692
2015 Ga0157370_10003916
2016 Ga0157370_10006823
2017 Ga0157370_10024136
2018 Ga0157370_10044524
2019 Ga0157370_10044573
2020 Ga0157370_10044996
2021 Ga0157370_10066079
2022 Ga0157370_10083264
2023 Ga0157370_10168122
2024 Ga0157370_10196428
2025 Ga0157370_10275610
2026 Ga0157370_10292841
2027 Ga0157370_10306932
2028 Ga0157370_10318568
2029 Ga0157370_10337807
2030 Ga0157369_10000004
2031 Ga0157369_10002019
2032 Ga0157369_10002652
2033 Ga0157369_10004820
2034 Ga0157369_10026016
2035 Ga0157369_10047784
2036 Ga0157369_10063536
2037 Ga0157369_10100053
2038 Ga0157369_10104624
2039 Ga0157369_10220360
2040 Ga0157369_10314250
2041 Ga0157374_10000001
2042 Ga0157374_10000647
2043 Ga0157374_10002171
2044 Ga0157374_10003665
2045 Ga0157374_10008464
2046 Ga0157374_10025420
2047 Ga0157374_10031171
2048 Ga0157374_10050525
2049 Ga0157374_10056944
2050 Ga0157374_10101752
2051 Ga0157374_10189714
2052 Ga0157374_10217994
2053 Ga0157374_10289281
2054 Ga0157374_10471222
2055 Ga0157378_10011078
2056 Ga0157378_10011450
2057 Ga0157378_10016222
2058 Ga0157378_10021827
2059 Ga0157378_10023453
2060 Ga0157378_10024439
2061 Ga0157378_10026056
2062 Ga0157378_10034378
2063 Ga0157378_10106642
2064 Ga0157378_10191429
2065 Ga0157378_10205182
2066 Ga0157378_10249257
2067 Ga0157378_10349223
2068 Ga0163162_10000024
2069 Ga0163162_10000205
2070 Ga0163162_10000331
2071 Ga0163162_10000967
2072 Ga0163162_10001657
2073 Ga0163162_10002520
2074 Ga0163162_10005326
2075 Ga0163162_10005839
2076 Ga0163162_10011763
2077 Ga0163162_10023196
2078 Ga0163162_10025607
2079 Ga0163162_10027741
2080 Ga0163162_10037946
2081 Ga0163162_10044468
2082 Ga0163162_10082702
2083 Ga0163162_10104877
2084 Ga0163162_10220637
2085 Ga0163162_10386237
2086 Ga0163162_10628741
2087 Ga0157372_10000011
2088 Ga0157372_10000196
2089 Ga0157372_10000921
2090 Ga0157372_10001904
2091 Ga0157372_10005934
2092 Ga0157372_10007158
2093 Ga0157372_10015967
2094 Ga0157372_10050754
2095 Ga0157372_10061677
2096 Ga0157372_10063919
2097 Ga0157372_10069226
2098 Ga0157372_10072860
2099 Ga0157372_10085260
2100 Ga0157372_10085973
2101 Ga0157372_10108951
2102 Ga0157372_10113649
2103 Ga0157372_10113694
2104 Ga0157372_10176871
2105 Ga0157372_10214259
2106 Ga0157372_10337954
2107 Ga0157372_10549923
2108 Ga0157372_10617486
2109 Ga0157372_10635185
2110 Ga0157375_10000229
2111 Ga0157375_10000257
2112 Ga0157375_10003117
2113 Ga0157375_10026758
2114 Ga0157375_10043753
2115 Ga0157375_10049275
2116 Ga0157375_10108563
2117 Ga0157375_10195972
2118 Ga0157375_10206911
2119 Ga0157375_10217627
2120 Ga0163163_10000653
2121 Ga0163163_10005525
2122 Ga0163163_10102281
2123 Ga0163163_10197303
2124 Ga0163163_10240688
2125 Ga0163163_10260289
2126 Ga0157380_10004261
2127 Ga0157380_10033396
2128 Ga0157380_10151009
2129 Ga0157380_10249108
2130 Ga0157380_10396639
2131 Ga0182008_10000008
2132 Ga0182008_10000026
2133 Ga0182008_10000080
2134 Ga0182008_10000687
2135 Ga0182008_10011464
2136 Ga0182008_10030579
2137 Ga0182008_10091087
2138 Ga0157377_10000932
2139 Ga0157377_10018348
2140 Ga0157377_10031423
2141 Ga0157377_10129759
2142 Ga0157377_10150301
2143 Ga0157379_10001640
2144 Ga0157379_10002723
2145 Ga0157379_10025305
2146 Ga0157379_10175810
2147 Ga0157379_10236611
2148 Ga0157379_10246240
2149 Ga0157376_10000721
2150 Ga0157376_10002682
2151 Ga0157376_10004414
2152 Ga0157376_10005888
2153 Ga0157376_10011043
2154 Ga0157376_10017174
2155 Ga0157376_10037066
2156 Ga0157376_10074336
2157 Ga0182006_1000039
2158 Ga0182006_1001557
2159 Ga0182006_1003104
2160 Ga0182006_1003392
2161 Ga0182006_1010187
2162 Ga0182007_10000027
2163 Ga0182007_10004301
2164 Ga0182005_1000263
2165 Ga0183373_1003
2166 Ga0163161_10006392
2167 Ga0163161_10007503
2168 Ga0163161_10011036
2169 Ga0163161_10067433
2170 Ga0163161_10187089
2171 Ga0163161_10397008
2172 Ga0206351_10902020
2173 Ga0213876_10001528
2174 Ga0213876_10022962
2175 Ga0209436_100493
2176 Ga0207427_100103
2177 Ga0209437_100024
2178 Ga0209437_100101
2179 Ga0209258_100151
2180 Ga0207425_1000002
2181 Ga0209646_1000002
2182 Ga0209646_1000823
2183 Ga0209026_1000434
2184 Ga0209148_1000154
2185 Ga0209148_1012278
2186 Ga0209129_1000002
2187 Ga0209233_1000124
2188 Ga0209233_1000396
2189 Ga0209233_1011704
2190 Ga0209455_1006267
2191 Ga0209673_1000208
2192 Ga0209130_1003361
2193 Ga0209675_1000042
2194 Ga0209676_1000008
2195 Ga0209676_1001383
2196 Ga0209025_1000004
2197 Ga0209564_1013616
2198 Ga0209758_1000006
2199 Ga0209758_1003065
2200 Ga0209758_1006777
2201 Ga0209050_1000134
2202 Ga0209050_1001255
2203 Ga0209050_1003936
2204 Ga0209050_1010474
2205 Ga0207426_1000030
2206 Ga0207426_1000051
2207 Ga0207426_1000497
2208 Ga0207426_1001981
2209 Ga0207426_1006084
2210 Ga0207426_1044109
2211 Ga0209257_1000001
2212 Ga0209257_1000005
2213 Ga0209257_1001605
2214 Ga0207656_10041673
2215 Ga0207655_1000012
2216 Ga0207655_1000228
2217 Ga0207713_1079261
2218 Ga0207682_10009425
2219 Ga0207642_10117946
2220 Ga0207710_10002748
2221 Ga0207710_10043035
2222 Ga0207688_10043481
2223 Ga0207680_10000162
2224 Ga0207680_10011575
2225 Ga0207647_10000051
2226 Ga0207647_10000149
2227 Ga0207647_10000288
2228 Ga0207647_10018104
2229 Ga0207685_10055929
2230 Ga0207645_10000156
2231 Ga0207645_10000782
2232 Ga0207645_10009564
2233 Ga0207645_10032778
2234 Ga0207645_10109477
2235 Ga0207643_10003598
2236 Ga0207643_10084438
2237 Ga0207643_10188488
2238 Ga0207705_10000132
2239 Ga0207705_10017561
2240 Ga0207705_10050880
2241 Ga0207705_10073058
2242 Ga0207705_10116961
2243 Ga0207705_10177553
2244 Ga0207705_10198785
2245 Ga0207705_10257460
2246 Ga0207654_10106324
2247 Ga0207654_10144631
2248 Ga0207707_10000051
2249 Ga0207707_10028865
2250 Ga0207707_10096572
2251 Ga0207695_10000013
2252 Ga0207695_10000071
2253 Ga0207695_10000084
2254 Ga0207695_10000323
2255 Ga0207695_10004602
2256 Ga0207695_10007525
2257 Ga0207695_10012845
2258 Ga0207695_10020015
2259 Ga0207695_10030834
2260 Ga0207695_10261931
2261 Ga0207695_10340708
2262 Ga0207695_10473374
2263 Ga0207671_10001044
2264 Ga0207671_10002500
2265 Ga0207671_10002907
2266 Ga0207671_10003166
2267 Ga0207671_10003799
2268 Ga0207671_10003904
2269 Ga0207671_10003924
2270 Ga0207671_10008063
2271 Ga0207671_10018671
2272 Ga0207671_10023419
2273 Ga0207671_10047813
2274 Ga0207671_10053071
2275 Ga0207671_10054603
2276 Ga0207660_10005186
2277 Ga0207660_10013171
2278 Ga0207660_10013385
2279 Ga0207660_10276780
2280 Ga0207660_10306548
2281 Ga0207662_10012024
2282 Ga0207662_10072777
2283 Ga0207657_10010433
2284 Ga0207657_10024041
2285 Ga0207657_10027751
2286 Ga0207657_10037574
2287 Ga0207657_10042823
2288 Ga0207657_10088481
2289 Ga0207657_10088944
2290 Ga0207657_10213406
2291 Ga0207649_10009815
2292 Ga0207649_10224063
2293 Ga0207652_10000051
2294 Ga0207652_10000384
2295 Ga0207652_10020709
2296 Ga0207652_10039453
2297 Ga0207652_10045752
2298 Ga0207652_10148855
2299 Ga0207652_10446374
2300 Ga0207681_10109432
2301 Ga0207681_10136537
2302 Ga0207694_10007231
2303 Ga0207694_10216919
2304 Ga0207650_10004151
2305 Ga0207650_10029550
2306 Ga0207650_10044181
2307 Ga0207650_10084418
2308 Ga0207650_10161026
2309 Ga0207659_10148334
2310 Ga0207659_10346473
2311 Ga0207644_10002938
2312 Ga0207644_10184510
2313 Ga0207690_10004421
2314 Ga0207690_10004758
2315 Ga0207690_10007381
2316 Ga0207690_10103237
2317 Ga0207706_10000122
2318 Ga0207706_10006768
2319 Ga0207706_10009505
2320 Ga0207706_10060615
2321 Ga0207706_10095175
2322 Ga0207706_10409233
2323 Ga0207686_10003538
2324 Ga0207686_10013442
2325 Ga0207686_10031401
2326 Ga0207709_10000021
2327 Ga0207709_10000381
2328 Ga0207709_10106339
2329 Ga0207670_10251816
2330 Ga0207669_10173204
2331 Ga0207704_10000041
2332 Ga0207704_10186500
2333 Ga0207665_10123389
2334 Ga0207691_10002527
2335 Ga0207691_10004310
2336 Ga0207691_10082409
2337 Ga0207691_10107984
2338 Ga0207691_10349044
2339 Ga0207689_10001006
2340 Ga0207689_10011687
2341 Ga0207689_10051842
2342 Ga0207689_10069790
2343 Ga0207689_10209759
2344 Ga0207661_10006472
2345 Ga0207661_10042612
2346 Ga0207661_10127723
2347 Ga0207661_10491550
2348 Ga0207679_10003010
2349 Ga0207679_10067172
2350 Ga0207679_10104790
2351 Ga0207679_10201502
2352 Ga0207679_10272053
2353 Ga0207667_10000009
2354 Ga0207667_10000177
2355 Ga0207667_10000222
2356 Ga0207667_10014871
2357 Ga0207667_10015290
2358 Ga0207667_10015451
2359 Ga0207667_10021496
2360 Ga0207667_10044124
2361 Ga0207667_10086364
2362 Ga0207667_10294914
2363 Ga0207667_10596213
2364 Ga0207651_10001099
2365 Ga0207651_10010433
2366 Ga0207651_10075842
2367 Ga0207651_10087618
2368 Ga0207651_10346452
2369 Ga0207712_10011985
2370 Ga0207712_10033754
2371 Ga0207712_10072556
2372 Ga0207712_10230009
2373 Ga0207712_10332680
2374 Ga0207668_10000843
2375 Ga0207668_10045941
2376 Ga0207668_10081892
2377 Ga0207668_10095076
2378 Ga0207668_10301111
2379 Ga0207640_10011602
2380 Ga0207640_10012737
2381 Ga0207640_10049386
2382 Ga0207640_10234487
2383 Ga0207658_10015834
2384 Ga0207658_10262591
2385 Ga0207658_10301181
2386 Ga0207658_10532665
2387 Ga0207677_10008700
2388 Ga0207677_10034996
2389 Ga0207677_10061486
2390 Ga0207677_10083187
2391 Ga0207677_10180206
2392 Ga0207703_10005016
2393 Ga0207703_10252271
2394 Ga0207703_10293914
2395 Ga0207703_10444962
2396 Ga0207703_10486797
2397 Ga0207639_10003645
2398 Ga0207639_10031777
2399 Ga0207639_10048724
2400 Ga0207639_10061775
2401 Ga0207639_10081130
2402 Ga0207639_10095928
2403 Ga0207639_10269099
2404 Ga0207639_10395493
2405 Ga0207708_10127869
2406 Ga0207702_10000463
2407 Ga0207702_10016308
2408 Ga0207702_10021967
2409 Ga0207702_10182382
2410 Ga0207702_10220130
2411 Ga0207641_10000226
2412 Ga0207641_10001217
2413 Ga0207641_10004894
2414 Ga0207641_10039269
2415 Ga0207641_10064994
2416 Ga0207648_10003412
2417 Ga0207648_10003442
2418 Ga0207648_10010003
2419 Ga0207648_10064003
2420 Ga0207648_10075871
2421 Ga0207648_10119721
2422 Ga0207676_10009837
2423 Ga0207676_10022211
2424 Ga0207676_10034551
2425 Ga0207676_10082197
2426 Ga0207676_10218506
2427 Ga0207674_10000672
2428 Ga0207674_10009363
2429 Ga0207674_10035446
2430 Ga0207674_10047123
2431 Ga0207674_10053435
2432 Ga0207674_10167317
2433 Ga0207674_10180315
2434 Ga0207674_10218190
2435 Ga0207675_100000124
2436 Ga0207675_100066501
2437 Ga0207675_100295016
2438 Ga0207683_10010911
2439 Ga0207683_10015180
2440 Ga0207683_10205270
2441 Ga0207683_10503084
2442 Ga0207698_10001082
2443 Ga0207698_10004520
2444 Ga0207698_10008356
2445 Ga0207698_10018942
2446 Ga0207698_10022184
2447 Ga0207698_10201752
2448 Ga0207698_10398949
2449 Ga0209281_1000299
2450 Ga0209995_1006596
2451 Ga0207428_10121308
2452 Ga0268266_10000049
2453 Ga0268266_10000137
2454 Ga0268266_10052240
2455 Ga0268266_10373309
2456 Ga0268265_10060000
2457 Ga0268265_10130426
2458 Ga0268265_10189233
2459 Ga0268264_10000041
2460 Ga0268264_10001720
2461 Ga0268264_10003860
2462 Ga0268264_10015087
2463 Ga0268264_10018061
2464 Ga0268264_10076166
2465 Ga0268264_10233443
2466 Ga0265334_10065194
2467 Ga0265323_10000082
2468 Ga0307517_10002048
2469 Ga0307517_10009539
2470 Ga0307517_10132404
2471 Ga0307515_10000001
2472 Ga0307515_10000061
2473 Ga0307515_10009265
2474 Ga0307515_10022836
2475 Ga0265338_10036318
2476 Ga0265338_10094888
2477 Ga0265338_10130605
2478 Ga0307511_10000042
2479 Ga0316177_1032754
2480 Ga0316176_1030119
2481 Ga0316183_1088093
2482 Ga0316181_1244277
2483 Ga0265327_10000370
2484 Ga0265327_10000395
2485 Ga0265327_10000614
2486 Ga0265327_10009563
2487 Ga0265327_10011198
2488 Ga0265316_10000982
2489 Ga0265316_10005052
2490 Ga0265316_10007084
2491 Ga0307513_10247949
2492 Ga0307513_10368175
2493 Ga0307509_10077458
2494 Ga0307509_10109209
2495 Ga0307509_10175070
2496 Ga0307408_100001828
2497 Ga0307408_100002354
2498 Ga0307408_100003065
2499 Ga0307408_100008089
2500 Ga0307408_100009674
2501 Ga0307408_100042599
2502 Ga0265313_10025091
2503 Ga0307508_10002100
2504 Ga0265342_10077052
2505 Ga0316576_10019459
2506 Ga0316576_10136585
2507 Ga0307516_10001558
2508 Ga0307405_10000001
2509 Ga0307405_10002108
2510 Ga0307405_10396170
2511 Ga0316577_10025236
2512 Ga0307413_10000106
2513 Ga0307413_10025336
2514 Ga0307406_10000055
2515 Ga0307406_10151508
2516 Ga0307407_10000130
2517 Ga0307412_10000023
2518 Ga0307412_10000034
2519 Ga0307412_10000431
2520 Ga0307412_10001853
2521 Ga0307412_10004743
2522 Ga0307412_10011797
2523 Ga0307412_10119710
2524 Ga0307412_10236457
2525 Ga0307416_100000004
2526 Ga0307416_100000994
2527 Ga0307416_100417085
2528 Ga0307414_10000012
2529 Ga0307414_10000067
2530 Ga0307414_10000205
2531 Ga0307414_10000368
2532 Ga0307414_10018419
2533 Ga0307414_10019912
2534 Ga0307414_10034191
2535 Ga0307414_10043161
2536 Ga0307414_10065989
2537 Ga0307414_10070691
2538 Ga0307414_10073136
2539 Ga0307414_10103927
2540 Ga0307414_10303636
2541 Ga0307414_10342649
2542 Ga0307411_10000008
2543 Ga0307411_10144215
2544 Ga0307411_10227554
2545 Ga0316580_10029814
2546 Ga0307510_10000091
2547 Ga0307510_10008820
2548 Ga0307510_10091404
2549 Ga0307510_10135566
2550 Ga0373944_0030594
2551 Ga0373941_0001716
2552 Ga0373957_0106428
2553 Ga0373955_0042786
2554 Ga0316574_0070151
2555 Ga0316574_0075563
2556 Ga0373937_0055659
2557 Ga0316582_0004909
2558 Ga0316584_0031063
2559 Ga0316584_0245998
2560 Ga0395899_0000033
2561 Ga0395899_0000037
2562 Ga0395899_0000796
2563 Ga0395899_0011488
2564 Ga0395899_0040931
2565 Ga0395899_0076882
2566 Ga0395899_0176577
2567 Ga0395899_0205736
2568 Ga0395900_0000014
2569 Ga0395900_0020025
2570 Ga0395900_0025707
2571 Ga0395900_0034282
2572 Ga0395900_0053699
2573 Ga0395900_0058215
2574 Ga0395898_0063471
2575 Ga0395898_0344382
2576 Ga0395905_0000241
2577 Ga0395905_0000254
2578 Ga0395905_0000278
2579 Ga0395905_0001456
2580 Ga0395905_0102782
2581 Ga0395905_0180636
2582 Ga0395901_0000582
2583 Ga0395901_0001349
2584 Ga0395901_0001630
2585 Ga0395901_0165590
2586 Ga0400489_60749
2587 Ga0436365_0881017
2588 Ga0436365_1079918
2589 Ga0436365_1575134
2590 Ga0436361_0671868
2591 Ga0439436_0033623
2592 Ga0439447_000599
2593 Ga0439466_0000733
2594 Ga0439466_0029101
2595 Ga0439465_0004154
2596 Ga0451807_1223207
2597 Ga0451837_0930931
2598 Ga0451853_1077363
2599 Ga0451853_1344014
2600 Ga0439431_0001706
2601 Ga0439431_0008024
2602 Ga0439445_0002350
2603 Ga0439448_0000765
2604 Ga0439434_0003786
2605 Ga0451577_0000732
2606 Ga0451577_0002136
2607 Ga0451577_0003767
2608 Ga0451577_0005099
2609 Ga0451577_0014810
2610 Ga0451577_0033905
2611 Ga0451577_0036864
2612 Ga0451577_0054343
2613 Ga0451577_0107530
2614 Ga0451577_0135050
2615 Ga0466969_0000584
2616 Ga0466972_0000207
2617 Ga0466972_0003815
2618 Ga0466972_0007800
2619 Ga0466982_0129100
2620 Ga0453683_0000174
2621 Ga0453683_0004567
2622 Ga0453683_0011474
2623 Ga0453683_0020068
2624 Ga0453683_0069892
2625 Ga0453683_0210473
2626 Ga0466965_0023948
2627 Ga0466966_0000136
2628 Ga0466961_0042386
2629 Ga0466961_0225162
2630 Ga0466961_0303882
2631 Ga0466964_0033441
2632 Ga0453684_0000167
2633 Ga0453684_0000191
2634 Ga0453684_0000202
2635 Ga0453684_0000206
2636 Ga0453684_0001141
2637 Ga0453684_0001264
2638 Ga0453684_0003500
2639 Ga0453684_0003863
2640 Ga0453684_0011041
2641 Ga0453684_0012400
2642 Ga0453684_0015367
2643 Ga0453684_0026765
2644 Ga0453684_0044759
2645 Ga0453684_0051863
2646 Ga0453684_0065811
2647 Ga0453684_0066880
2648 Ga0453684_0067315
2649 Ga0453684_0076863
2650 Ga0453684_0079972
2651 Ga0453684_0086354
2652 Ga0453684_0108767
2653 Ga0453684_0116758
2654 Ga0453684_0127953
2655 Ga0453684_0132582
2656 Ga0453684_0149655
2657 Ga0453684_0151567
2658 Ga0453684_0200916
2659 Ga0453684_0248168
2660 Ga0453684_0546075
2661 Ga0466971_0032077
2662 Ga0466970_0032860
2663 Ga0466957_0007040
2664 Ga0466957_0014895
2665 Ga0466957_0051905
2666 Ga0466957_0170116
2667 Ga0466959_0000002
2668 Ga0466959_0004264
2669 Ga0466959_0063184
2670 Ga0451576_0000003
2671 Ga0451576_0000072
2672 Ga0451576_0000088
2673 Ga0451576_0000232
2674 Ga0451576_0001854
2675 Ga0451576_0006334
2676 Ga0451576_0009893
2677 Ga0451576_0010551
2678 Ga0451576_0022082
2679 Ga0451576_0112991
2680 Ga0451576_0342262
2681 Ga0451576_0405345
2682 Ga0495627_000097
2683 Ga0495627_005749
2684 Ga0495627_012982
2685 Ga0495627_021042
2686 Ga0495629_0096536
2687 Ga0495638_0000003
2688 Ga0495638_0029092
2689 Ga0495651_0038960
2690 Ga0495653_0053573
2691 Ga0495650_0000036
2692 Ga0495580_0014773
2693 Ga0495580_0039305
2694 Ga0495585_0000831
2695 Ga0495607_0032969
2696 Ga0495606_0000008
2697 Ga0495606_0003964
2698 Ga0495606_0019321
2699 Ga0495606_0025036
2700 Ga0495606_0039090
2701 Ga0495610_0000001
2702 Ga0495610_0000233
2703 Ga0495610_0023416
2704 Ga0495610_0112392
2705 Ga0495616_0004581
2706 Ga0495616_0007672
2707 Ga0495630_0012164
2708 Ga0495630_0038354
2709 Ga0495632_0068748
2710 Ga0495632_0128572
2711 Ga0495644_0030099
2712 Ga0495648_0003229
2713 Ga0495648_0003874
2714 Ga0495663_0000165
2715 Ga0495654_0000001
2716 Ga0495609_0001065
2717 Ga0495609_0012891
2718 Ga0495645_0080467
2719 Ga0495633_0000018
2720 Ga0495633_0000080
2721 Ga0495633_0000233
2722 Ga0495633_0008035
2723 Ga0495633_0008511
2724 Ga0495668_0000044
2725 Ga0495668_0000751
2726 Ga0495634_0045371
2727 Ga0495611_0001116
2728 Ga0495625_0000379
2729 Ga0495625_0000934
2730 Ga0495625_0001653
2731 Ga0495625_0034454
2732 Ga0495661_0001087
2733 Ga0495661_0001778
2734 Ga0495661_0088121
2735 Ga0495661_0092509
2736 Ga0495657_0216696
2737 Ga0495658_0087681
2738 Ga0495671_0029844
2739 Ga0495649_0000010
2740 Ga0495649_0037561
2741 Ga0495600_0071204
2742 Ga0495674_0112806
2743 Ga0495672_0018888
2744 Ga0495672_0025973
2745 Ga0495676_0070348
2746 Ga0495680_0077801
2747 Ga0495687_000001
2748 Ga0495687_000736
2749 Ga0495687_002474
2750 Ga0495685_018838
2751 Ga0495684_0167137
2752 Ga0495686_0000004
2753 Ga0495686_0000022
2754 Ga0495686_0000196
2755 Ga0495686_0003522
2756 Ga0495686_0011430
2757 Ga0495686_0069737
2758 Ga0496100_0085300
2759 Ga0496101_0301226
2760 Ga0496102_0046542
2761 Ga0496110_0105873
2762 Ga0496114_0024981
2763 Ga0496114_0055009
2764 Ga0496115_0040646
2765 Ga0496115_0102109
2766 Ga0496116_0000004
2767 Ga0496116_0000027
2768 Ga0496116_0002379
2769 Ga0496117_0000021
2770 Ga0496117_0002276
2771 Ga0496117_0085221
2772 Ga0496118_0001245
2773 Ga0496118_0026652
2774 Ga0496118_0104190
2775 Ga0496119_0000004
2776 Ga0496121_0000020
2777 Ga0496121_0044433
2778 Ga0496122_0000154
2779 Ga0496122_0000352
2780 Ga0496122_0000591
2781 Ga0496122_0000613
2782 Ga0496122_0001522
2783 Ga0496122_0003469
2784 Ga0496122_0015395
2785 Ga0496123_0000580
2786 Ga0496123_0018244
2787 Ga0496123_0023338
2788 Ga0496124_0006587
2789 Ga0496124_0016074
2790 Ga0496124_0048297
2791 Ga0496124_0088833
2792 Ga0496125_0000012
2793 Ga0496125_0001291
2794 Ga0496125_0001400
2795 Ga0496125_0011050
2796 Ga0496125_0013680
2797 Ga0496126_0001970
2798 Ga0496126_0025237
2799 Ga0496126_0028741
2800 Ga0496126_0196632
2801 Ga0495678_010906
2802 Ga0501292_009646
2803 Ga0501300_003399
2804 Ga0501031_0066891
2805 Ga0501032_0016207
2806 Ga0501032_0017496
2807 Ga0501033_0029523
2808 Ga0501034_0004012
2809 Ga0501034_0053271
2810 Ga0501034_0066614
2811 Ga0501034_0077642
2812 Ga0501034_0122716
2813 Ga0501034_0346038
2814 Ga0501036_0019980
2815 Ga0501036_0121343
2816 Ga0501036_0159885
2817 Ga0501037_0007826
2818 Ga0501038_0007220
2819 Ga0501038_0033809
2820 Ga0501038_0122962
2821 Ga0501039_0019205
2822 Ga0501039_0262508
2823 Ga0501043_0008215
2824 Ga0501043_0015257
2825 Ga0501043_0417047
2826 Ga0501047_0009183
2827 Ga0501047_0084328
2828 Ga0501047_0147600
2829 Ga0501047_0161519
2830 Ga0501067_0050839
2831 Ga0501068_0026838
2832 Ga0501069_0007664
2833 Ga0501073_0006174
2834 Ga0501074_0034616
2835 Ga0501198_002350
2836 Ga0501202_009071
2837 Ga0501202_030457
2838 Ga0501207_011064
2839 Ga0501207_018468
2840 Ga0501217_000618
2841 Ga0501217_004619
2842 Ga0501222_004886
2843 Ga0501223_006285
2844 Ga0501223_007672
2845 Ga0501235_005341
2846 Ga0501240_004330
2847 Ga0501240_013486
2848 Ga0501242_006477
2849 Ga0501243_000451
2850 Ga0501247_006417
2851 Ga0501249_000027
2852 Ga0501252_004165
2853 Ga0501257_001311
2854 Ga0501257_018063
2855 Ga0501259_000660
2856 Ga0501219_000230
2857 Ga0501225_0004035
2858 Ga0501225_0004470
2859 Ga0501225_0006622
2860 Ga0501245_005844
2861 Ga0501079_0075469
2862 Ga0501080_0194961
2863 Ga0501083_0055458
2864 Ga0501241_000012
2865 Ga0501241_005162
2866 Ga0501264_000335
2867 Ga0501266_000004
2868 Ga0501266_005253
2869 Ga0501267_009653
2870 Ga0501269_000451
2871 Ga0501280_000502
2872 Ga0501035_0042854
2873 Ga0501035_0043415
2874 Ga0501035_0162925
2875 Ga0501044_0016307
2876 Ga0501044_0020946
2877 Ga0501044_0021863
2878 Ga0501044_0044831
2879 Ga0501044_0161620
2880 Ga0501044_0216066
2881 Ga0501284_00029
2882 nmdc:mga0k408_102151_c1
2883 nmdc:mga0k408_105_c1
2884 nmdc:mga0k408_13283_c1
2885 nmdc:mga0k408_48_c1
2886 nmdc:mga0k408_64279_c1
2887 nmdc:mga05p37_285602_c1
2888 nmdc:mga05p37_428740_c1
2889 nmdc:mga0qj67_108041_c1
2890 nmdc:mga08y16_142160_c1
2891 nmdc:mga08y16_191002_c1
2892 Ga0500635_0000796
2893 Ga0500578_0000694
2894 Ga0500578_0045759
2895 Ga0500644_0000283
2896 Ga0500646_0005658
2897 Ga0500646_0027325
2898 Ga0500647_0050815
2899 Ga0500583_0000059
2900 Ga0500651_0000253
2901 Ga0500641_0000242
2902 Ga0500557_033835
2903 Ga0500562_014775
2904 Ga0500607_018370
2905 Ga0500608_027602
2906 Ga0500608_073120
2907 Ga0500618_000013
2908 Ga0500618_011591
2909 Ga0500658_0000010
2910 Ga0500559_0006224
2911 Ga0500568_0001626
2912 Ga0500573_0117160
2913 Ga0500577_0020859
2914 Ga0500604_0006396
2915 Ga0500604_0022589
2916 Ga0500616_0000007
2917 Ga0500616_0005429
2918 Ga0500616_0009033
2919 Ga0500616_0016083
2920 Ga0500622_0000247
2921 Ga0500622_0000515
2922 Ga0500622_0000540
2923 Ga0500622_0000777
2924 Ga0500622_0001463
2925 Ga0500624_000379
2926 Ga0500633_0048877
2927 Ga0500611_000034
2928 Ga0501082_0112289
2929 Ga0501082_0414103
2930 Ga0466962_0005611
2931 2511234099
2932 2513232253
2933 2522547642
2934 2524005564
2935 2585144370
2936 2585158996
2937 2585163284
2938 2585425382
2939 2587677376
2940 2587745500
2941 2587750693
2942 2587943784
2943 2588208895
2944 2588212397
2945 2588225066
2946 2588231606
2947 2588445713
2948 2590602332
2949 2590611316
2950 2599480990
2951 2644009823
2952 2644374219
2953 2644683695
2954 2722726497
2955 2729202037
2956 2738727059
2957 2738760566
2958 2739254997
2959 2739300621
2960 2739590407
2961 2739617379
2962 2739647571
2963 2740002460
2964 2740007276
2965 2740033304
2966 2740061480
2967 2753671961
2968 2765576891
2969 2775673393
2970 2776612699
2971 2802652418
2972 2816872184
2973 2819548307
2974 2819573629
2975 2819680871
2976 2821136963
2977 2839991354
2978 2842086659
2979 2842906815
2980 2849286733
2981 2852623493
2982 2852630140
2983 2857615894
2984 2857620360
2985 2857632142
2986 2871724350
2987 2881362663
2988 2883072585
2989 2884637258
2990 2884795628
2991 2884937607
2992 2889292556
2993 2890737617
2994 2895501638
2995 2896087752
2996 2896112542
2997 2896319411
2998 2896347003
2999 2898713405
3000 2903897866
3001 2904422088
3002 2904446100
3003 2904468295
3004 2904559074
3005 2904783639
3006 2906000464
3007 2910248588
3008 2914760597
3009 2919097502
3010 2919182190
3011 2919189878
3012 2919192101
3013 2919400780
3014 2919442597
3015 2919686044
3016 2919695416
3017 2928080902
3018 2928150191
3019 2929154664
3020 2929178801
3021 2929241244
3022 2929923240
3023 2932088242
3024 2939668158
3025 2945927788
3026 2945981205
3027 2946019394
3028 2946020604
3029 2958459095
3030 2958512513
3031 2965323326
3032 2977236774
3033 2977246770
3034 2977271498
3035 2984575386
3036 2984608840
3037 2993374090
3038 2993480992
3039 3003233518
3040 8003153683
3041 8054310548
3042 8055423024
3043 8055590799
3044 8055596625
3045 8056442050

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02885

Glycos_trans_3N

Glycosyl transferase family, helical bundle domain

53

115

0.97

PF00591

Glycos_transf_3

Glycosyl transferase family, a/b domain

122

371

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1khd-assembly1.cif.gz_D crystal structure analysis of the anthranilate phosphoribosyltransferase from erwinia carotovora at 1.9 resolution (current name, pectobacterium carotovorum) 0.9453 2 327
5c1r-assembly1.cif.gz_A stereoisomer of prpp bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyl (anprt; trpd) 0.9384 4 328
4zof-assembly1.cif.gz_B lobenzarit-like inhibitor bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd) 0.9371 4 330
4x5b-assembly1.cif.gz_B anthranilate phosphoribosyltransferase variant r193l from mycobacterium tuberculosis in complex with prpp and mg 0.935 4 327
1kgz-assembly1.cif.gz_B crystal structure analysis of the anthranilate phosphoribosyltransferase from erwinia carotovora (current name, pectobacterium carotovorum) 0.9348 2 327
ID Description Score Start End Superfamily
1gxbA01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9732 2 182 1.20.970.10
1kgzA01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9575 4 183 1.20.970.10
5noeC01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9574 4 182 1.20.970.10
4gtnA01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9555 2 68 1.20.970.10
4yi7A01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9437 2 68 1.20.970.10
ID Description Score Start End GO Terms
AF-A0A090VQB4-F1-model_v4 Anthranilate phosphoribosyltransferase (EC 2.4.2.18) 0.9957 1 268 GO:0000162
GO:0004048
GO:0005829
AF-A0A2D5JLZ6-F1-model_v4 Anthranilate phosphoribosyltransferase 0.9922 1 200 GO:0000162
GO:0004048
GO:0005829
AF-A0A6H9NY20-F1-model_v4 deleted 0.9911 1 174
AF-A0A381PU49-F1-model_v4 Glycosyl transferase family 3 domain-containing protein 0.9901 45 330 GO:0000162
GO:0004048
GO:0005829
AF-A0A3M1X9Y4-F1-model_v4 Anthranilate phosphoribosyltransferase (EC 2.4.2.18) 0.989 2 327 GO:0000162
GO:0000287
GO:0004048
GO:0005829
GO:0006541

Map